08PuRj'&<  'uRjKG&P''`'#. #.uRj'&P@@<@T 08PuRj'&<  'uRjKG&P''`'#. #.uRj'&P@@<@TU uRj`'#.yAuRjuRjuRjQ$f uRjuRjuRjRAuRjuRjuRjnAuRjuRjuRjoAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjmKc%uRjuRjuRjX`hpx$uRjuRjuRj (08@HPX`hU$uRjuRjuRjpxmQ$uRjuRjuRjS$nuRjuRjuRj (08@HPXKAuRjuRjuRjCuRjuRjuRjAuRjuRjuRjAuRjuRjuRjmAuRjuRjuRj`hpx\$ uRjuRjuRj$uRjuRjuRj$>uRjuRjuRj$uRjuRjuRj$suRjuRjuRj$uRjuRjuRjAuRjuRjuRjm uRjuRjuRj$uRjuRjuRj $uRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRj$cuRjuRjuRj (08@HPX`$uRjuRjuRj$uRjuRjuRj$uRjuRjuRj$uRjuRjuRj$uRjuRjuRj$uRjuRjuRj$uRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRjAuRjuRjuRj~-ˈ FWw/#+΅tgvdF%>Wŀ7ZY*W;E%)r[; .=oDY& %ٙ}^(@lIlClA(z&g[@#. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4`%4 (""$22#TTT,,$22Ptd)QtdNetBSDLwGPaXU,SR ffffUSWVP[o.t$DujPjjj\jB#0Fɉ$uȮ& Q/tu|$Tu?;(s(U9r!\|$u  t W8P8;sU9rHPJ8$06v? Pj3USWV [hn.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]7USWV[Ûl.; s' ~*u.UE9r^_[]SWV[Ll.;s9r^_[f$SWl.5u1ƃ5$tЃ t$k_[SWök.4uYƃ4$t|$<$kt(?t<$nktЃ_[WVD$0tP>tKj/V{t@Ƹ!"p&PVt&uVh"hȀ"hԦ3K;^_`SWVh"h"hԦ3%; 1۸!"p&PCPrFhԦ3j Gwhɇ%hԦ3: uhԦ3j GjM/D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5Į3  u$1^_[Vh"Vh"VD 53h܃"j̸wVh"j茸USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&tutD$D$$D$% D$t$@N D$l$hȮ3h׼$/D$ @l$0tD$Ph$/j .D$  |$\$4t$,s$L$)L >QPh"/ D$  L$s()@L$L bQPhۅ"U/L$ D$  s D t 4&h")/L$ D dtPh "/D$(@9XUf\$D$T$T$9tt$N9BD$4&53h*". 1h^_[]t$|h";%WS$h>"h["jկU53hy"jt$|h"53hn"3$h"jhc 5Į3 u153h-"j蔯SWVPD$Hw#t$>Ƞ&Wt ub̠&$h""Wt N1AQhc5Į3! u 1^_[53hB"jUSWVP|$t$7KLh>"WV蜶 fu 7U3u $3)u 3uhA"I"t 3hjQ| Į3u 53hR"Ih(u3$(|&SUt uUh{"jh["j$NPVS& P#V6Ԧ3PhV"V. Vjjh"&|&h"hԦ3. ujA#5Į3|WVοV& tuVh"j4 &^_VPΉj PQܫ x $9u^Vh"jWVοV&tuVh"jͬt&^_USWV\$$13 |33 3sV"j=Px<$h٣jjhР&U# 3H F H 3VP3u3t;#=t%{ 3##=uthR"l73tttut!tcu3h ,3^_[] 3VhȆ"W Wh"4$h"4$h""jEhl"h"D$L$011PjPjt$h$ 3|33 31PjPjt$h"ܕ<383h"j1hjPPt$h"訕43031PjPPt$h"脕,3tVj; 3u$1PjPjt$h)"L3 3ËD$3h:"j'1hjPPt$hP"$3 3h\"j3u$1PjPjt$hs"Ԕ3|3ËD$3h"j诩1hjPPt$h"薔331hjPPt$h"nL3H3fSWV@3t/ 33 t53)փ>8F u3h33 3 p3l3;|3 3r*jUh33l3 p3 33^_[á3 3 t l3p3h&h׼$j藨h&h׼$j膨h&h׼$juh&h׼$jdUSWVt$|$6Ed#Sj SVW& u=$3P]3u,3^$3(3&Ah"j(3&1QQP!v 3y 533 3 =,3r3uhN"롡3u#33"3&13H3& hQPu 3yJ13H 3 hP53Q 3 3y 53d3d33utS1V 3<38393rZ 3t= 83 |3@ d3t# 3) 3I |3 3ujgd3 3h3 3 $3t 3 3t 3h`u;53 |3=3 353VP53W 31Vh3Vhjhj5T35X35\3P3h-,3`3t%33 3 3;03 43ss$3 3tQj QjP (35 35353P$ xd53- 31‰1 3 3=3 333=3 33 3xPh׼$0,3u6(3j535 353P  t53h׼$3 3 3 33=3 33=3 33C3s 33=3 33=3 33u@s)tЯ3ԯ3H 3PQQJ 33,3=l3 p3j133133hz"jPh׼$jWV,3=t=h=u <3p3 l3t;|39щ53s))Rj5h3 3 |3p3 l3 u\53=3 tJ5|3j5d3R 3 |3p3 l3d3ʉh3)Ɖ=353 t jY=3u3jPu 8u*353Pt^_h~#jӡh"USWV|3|$,tl3d3(p‰D$l$|$,u 3 xT$ 33 t!3jQP53R !ƒ~t$VShd3 $~ D$ `18D$ Z 33 ʋ-33t>535|3QP襢د3ܯ333133T$<$t$ 3-3l$13L$ 3į3D$11 3t,`3u#`353h "+T$3L$ AD$)ʋ$tЃ|1@|p9@|533*|31 3T$1 uK33I$T$ p3l3)ѣl3 p353-|393į3$ t h3)PQ5d3 l31d3h3 L3H3 t(335į353QPVR  tjh%jk$^_[]53h/"53hՈ"53h"j53h׼$j蝞USWVt$(|$,\$$UhP3j{k C4WVs(P( 8jUjWk 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h"jV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu@8u F ́Ĵ^v$h׼$jgVP螞9v V讠VPQХ t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVH3 L3t/jh=d3u =M=p3ui $SWVPΉjP~qt4ÿ<$VWt Ku1^_[hċ"jGWV=3t+t΃j PV tu砈3 34^_USWVtՉ΀=|3u)t L$jPh "h Q L$jh PQ趝 =X3L$jvvQPh" v$v vvvvhA" vxv=T3u=`3vX0ƱPh$hԦ3 h"'0蝱Ph$hԦ3 hގ"N^_[[0hPh$hԦ3 hBX&hN 43uáH3u tjwGjFUSWVj譆Ƌ|$11K< @u=3t?jj5Ȱ3 5Ȱ33İ335Ȱ3UjWݴ A)߉n3 İ3N F53q033-3F İ3 0Ph$hԦ3P hBX&Mrh "]1Hİ330կPh$hԦ3 h"'0謯Ph$hԦ3 hގ"LV蜕1^_[]Vt$53q0F33^WVL$ 435̰39})=379}>3839~vRO9G9~-833~Z3΋Nu#83)Ou9~83RN983 ̰3u H3uu83^_É1jDjDVT$3t=31363t@9uхt3uh'%hK1^SWV13ij3j?蠒h #Q/"tW t|8/uWh5"WhA"hа3'0 а3tLPt$hh"PȰ31ۅu@WN5а3h׼$y}k"jh}N"PJVܑ^_[VȰ3tAPxGȰ3а3t!P35а32а313İ33;5а30PVh+&hԦ3h"I^Vt$Ȱ3t3Pdа3t!P5а3衒а3VQjh\3h$3 "x 3331԰3@=ujuSVL$D$ T$t$Ա3԰35Ա3԰3~A2԰3BI^[fV1ر3ܱ333P{Pml3Fu^SWV5ܱ395ر3t$ر3Vjjh3ut=333jjPPVth܏"h׼$[H303@u3=3VtVP_G~*h "53r0h"h׼$G1N1Nyh0"h׼$G5ܱ3~ر3H ر331H^_[Ë ر3u!T$7ܱ3ر31ܱ3xD$Qر331HSVփuU303@u3jjPPUth܏"h׼$G3 3 33aˍ3)Qh3P  3303@u3jjPP@Uth܏"h׼$FVjjh3踭^[Vt$ ر3uܱ3ر31ܱ3x 1H^USWVh"]Ɗtx<0uFD uh"h׼$$EGuȿ|w WjP  1T L ш @u3hjV PA1Fthя"h׼$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhA"XC^_[]eC$t硨38u@353Nj-31;-3M1WtÃ=ij3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-3|1MV431535353535 3j5 3 43u H3uu ^j:jq;V53953} 3I43P5 3vtC53 3 43u H3urufL$3r53 1^0螤Ph$hԦ3 hBX&A 43u‹ H3u tj:j9USWV l$ D$fD$p 1P 3319 3@u 9u3Sk3 t$$PPh,  $ 3| t %03ڃuh 43uH3utj8u"j&7WV 35319}' 3FىDuw9@u1=3^_USWVD$L$9tV3r= 3~=39 t9|1C3Mu9|1C3= 3 9u^_[]fUSWVl$}!uEhx@#P<UT1hx@#PÅt*t$Sǀ}!u?S%#=~0苠PUh+&hԦ3h"=eSx(=@3uWh("hԦ3 53+t$00PUh+&hԦ3Wh"=^_[]USWV |$$Wơ3$ij3D$31-3-ij39-,3t\$=3t$ gDž~w114353Y6ts3PPjJ Å 43uH3t$ Dž|$$\$9t$utt "<$u=3t!ʐ"9u ij3 uhԦ3PCc9¡ij3Ƌ 3Ӏu1A9|$t $ 3 ij3,3t )) 43u H3ut j4 ^_[]j3USWV1|$=,3t WrGHOHt uG `- 39}3V439rFU53/~- 33 43u H30u ij3F8Wf<1ۍF- 39~N43 39wUQ}t7- 33 43uH3uhtk30 F0՜Ph$hԦ3 hBX&9 43H3j2G @utL30 F38L0YPh$hԦ3 hܐ"Y9-130=ij3=3  )Ɖ^_[]js1USWV|$?!uGhP$P5t$WI,VPÅt2l$t$ US NjD$8!u?S=o0|PWh+&hԦ3h"{8mSx-=@3uWh("hԦ3w t D$ )@ʼn30 Pt$h+&hԦ3@h "8^_[]USWVPl$Uƃ=,3t1ۅtf;l$ `1V$th~;-3u=ij3t =3u8 GWPt$ F x4EEs @6;l$ |=,3tt$$$^_[]USWV|$\$l$19t[=,33t UPrUP/Fy0ߙPh$hԦ3 h$"61^_[]USWVP\$53FEx @u}|~PVq6tj(39~l43$39SPygƉ(3$3 43u.H3_tO53;^_[]Ë5$3W53V4 . ,1xщǃ|$uE3| /5(39$~Z439V5$3ycÉ5(3$3 43uH3t $3W53U聣 ,$+HPS5$3D( |$tM1BDžh["40ŗPh$hԦ3 hBX&41 43H35(39} $3|$N43$39͋|$|MVPwt05(3$3 43u H3umua(/ 0Ph$hԦ3? hBX&4 43t1H3uj-j/,SWV11(3H (37h$3虿u803@%f039u$3H $3ÍF=`39~Y439wW53v=`33 43u H3t 30u ij3F 3C0豕Ph6"hԦ3 hA"2%031t 3033^_[H0UPh$hԦ3 hBX&U2 43uH3u tj_+j*USWV\$ D$1tt$hS"D$ l$1uHD53J 3;3у  |3Q|3;=D3|h|3hX%X1GD5 | <\t<3H 3;3h|3j\|3H |3\\5tjj ShX"艟 tVGX")Ȋa"3J 3;3Vу J |3Q|3\$ !03H 3;3h|3P|3H |3D50 3Q3ɋ\$ ; 3h|3P |3Q|3D50 3Q3; 3h|3P: |3Q|3Dh|3Q4 3Q3; 3~;ȃ t3 |3Q|3D$F9h|3Qh|3P똡3H 3~|3H |3 h|3j 1^_[]fWVD$L$L$$$0| $ |r183hj"t$t$ k ot9EtzSD3ǃxtostypf7UP3먡$3  $)D$|$ta$8-uW@3D$|<$3b<3S ,3D@35$L$jjthj1FhVVjhjhT3vƅux'L3|$t$8t$0|$t[hԦ3hr"T$8u h"_-j1u$hԦ3hq"Thu"--y =03thd3h$hԦ35 P3tPh׼$~h|3q xt` 3| 3x51g3QPP M=3=@3hԦ3hr"Sh":,j %033h[",%03΃t0hԦ3hr"#Sj虢5153hԦ3hr"Rh"+VgQ=03thd353h"hԦ3jrjkPh&hԦ3^ j=03junhd353h"hԦ3f$j0yj谡t$8!$h0hP3o uhd3h$hԦ3 jL$ ɸ!H3Phht@jx x#$r@3D$ rD3ËL$=43t1@ H3Ql"L$=43t1@ H3Q#WV1F=83t9|$ ?!t!hQ#Wvtj/Wth")1^_3333x>3 3 33 3;t,uQ39;u3빋 3| 33t9t31Ƀ USWVP33DJ@t t@3@DJ@t uHH 3~Ã=w$&=3!h<"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=3t=@3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h("=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH-33=3=3 9=3 -339 9w hm" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sOFj h353U 3w8"%3 3:o t!gc ptrP  A 3< b=3Ho13PP9 3-3 =3=3 9=33-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@3 3AQP2 3<`j h353(S @3-8"h"N@3 3x w =33t30hC& 3x A =3u;.53O1@3 3AQP@ 3jPP>3x  1q1ۃ=@3Ƀ=3 ˃h'% 3x  =3u-5353 53g 3x ? =3uL-5353: 3@;3?73-3x =3u , 3IQ T3x =3u,3 39QPn3x QVP 3y F( 3y 1 3y P5353g 3A1Qptnt lu  Љ 3Aω 3y  33=@39|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+0303uF%3x 7Uu<3=P3t1P33x =d3hd3h$hԦ3v 3x }*x1Hptntlu  ˣ3@У3x ',3G1333@Hptnt lu  ˣ3У3x =P3P3u%|$WtP$5353QP';333x ==3uJ)=P3P3u53Q5;3)3hX"h"h"3h'%31< *5 3y qt3@P3@Pw.=@3h4 &+3x )53j 6'(Y$i*tEEp $A8GMi 3913)@أ3=3t W6U31 43u H3u u^_[]jjSWV=L3uj貽L$ɸ!H33PjhP$h"Hy|hY#gVtkP(=Yà P?tGWP|3/tf/Ved.hDhup53jhP$Vj=L3ujL$ɸ!H3jhT3USWVPl$53'Ƌ=33-39ʼn) u)E1u1$43E@43V}tzP蘹t_3PPj DžtO343H43u H3u[uE6M3@Pi1,$l& 43u H3ut j1^_[]jUSWV$83 D3th"ckjP~3L$F$ Գ39} г3V43г39|BVP]H5Գ3г3 43u H3! 3 u1C1E҃!%=P3hP3P]Ɖ$ Գ39V439V5г3G5Գ3г3 43" H37 09L$]9439|WP+G=Գ3г3 43]9~[439V5г3F/5Գ3г3 43u H3yt vг3 3 (E 3Q39\u=Q3I ( г3G (E,$s 3L$A 3 3y س3)9~_439VPEI5Գ3г3 43u H3 س3г3| 3A(EA3س39r 3L$A 37 H33/ 3Q3 ( 3݀ (5ܳ39}3R4339|KVPEt]5ܳ33 43u H3S5г3Po 3س3D$1!P0dPh$hԦ3H hBX& 43 H3u!u#^_[]h"qhu"gj'jVj/9tL$Qq p PIH1a0ncPh$hԦ3觶 hBX&n1^VP3t.L$19 3u3HP3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hd3߱XWV 3 td< uhA"1 Q3I t;8t7P1ǡ3t?=3u6Px3953h"R53j73tV35<3WPd 3t.h'hd3QPK53G33/袙0aPh$hԦ3 hBX&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M4339|KUP{AtYlj-33 43uH3uyS53W l 53=ij3tsj jSWme耘0`Ph$hԦ3Ƴ hBX&1 43u*H3u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwR#j h353/ 1w8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[439V53>#533 43u H3\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t %03ى384339|NWP=t8=33 43u H3uuuw5303M1I0\Ph$hԦ37 hBX&1 43u H3uu^_[]H3,j'jUSWVPL$33193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP3431S̪á3tP芬EPPjM Ņtl9u 43l$ uH3ue$33+39}yF3@3P%Ut$ Pt$$hDž+9 43u1H3uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=ij3tj jvS肮vލD$jPjSut1t$ED$$D$1E $A9T$ 439Ɖ $T$~c43t$ 9V53:\533 43t$ T$uH3=ij3tjj RS藭T$=3RSWd 4$D$D$ 3 $9~bt$ 43$9V539533 43t$ uH3=ij3tjj t$(S=3t$SWNd Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu&D$)D$39~V43 39SQ833 43uH3|$~#D$$ D$ ud$th/"$=ij3\$tjj SV賫3SVPc 3f |$%C<藏0WPh$hԦ3ݪ hBX& 43t e^_[]Ë H3u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y439W53[7=33 43T$uH3%$9C 31F9uEEπ;D$$,$L$l)39~Y439W536>=33 43T$uH3ml9}C 31F9u,$y^=39}3_439|W536=33 43tT$ H3T$M 0E+3;3539}3J4339|KVP5t)533 43u H3u^u`I迌0TPh$hԦ3 hBX& 43u H3uu؃^_[]jjfWV3 39|ld 3j Qh3 tJP@TPh$hԦ3y hBX&@53&:133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWWg99u33H33L3^_[USWV=H3=L3=3t 33$3D$j荣433 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H33$H3L33D$L31 43u) H3u&tj\hJ"$^_[]jlUSWVL\$d3vhZ" =_"tNjt$`hj"SV* fttu=7U߃u $3r|$L$ D$1Х&"D$PfxƋO9rPSt$ Ky tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ ho"j!L$j QP  $;Fl$|1ƋD$8u&1zPUy!Uh׼$j!D$ th"j!NjC=m@!sHQPW xs{QPW x4$Uh"͟ =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@Wh y?60PhГ"ӍL$fqQhmW: 3UhE#D$ukD$Pho"h" T$"h"T$"h/"3H 3~|3H |3 Phj"kh|3j 9t$8t$8t$8t$8t$4h"ht$Ht$Ht$Ht$Ht$8hǔ"Gt$h"6t$ h"%jKPhD"hԦ3覠 j,SWV֋|$t 8"?t>"VQP؝ JB83H 3;3h|3jI|3H |3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hk"7th}"P0uu3h"7th}"Puu h"ըjh}"h"qW /PMu h"j0&D$ u h"jt$,)݉\$D$$D$11D$$h"SU$ c7~+Hr߃8tlH w&$X&7U$뼃4t6맃dtket/1@D$#.=7UumWt$sXhΕ"57UKD$71@D$$+L$ $3 $3T$uA$3$T$uȋ$D$,jj@RLl$L$ $tL$ $L$,1ۋD$P>qCEu S)St$PʼnD$$A+ Upl$$T$DtIL$ىL$$U$E L$)QPR* 4$pEuED$ushΕ"h+/%nu]h"bhҕ"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh3t$ t$,QPR=Vt$ -yj衏=3y h"|$$tQt$(jVjhS`y h*"rjVjh53j`y h<"IhΕ"mǽt$(1CUVSwD$P)`UVSw53`t$,+1L$XAAA @D$HPQS% =3u'l$hD$h8jU&} ul$ueDžy h@#1O~fVS53` VSt$V` |$h53l$0fE<u1,~u@hWjE u~8}18tƉjjU( tD$68Zt}8tEVSt$ x )b}8#Th%|$l$8fE=3ul$0fE9EjD$LPj |$@f9fGfG3G$jVU\ tQf|$<tٺtf|$4t?3L$0u+fD$<=3ufD$4 |8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hN"jt$j:h$yzh"PhS"hԦ3膗j PD$L$jQ53 XUSWVA1K8uSt<։{hU7 ~WUV ~)u1{1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSiƅu]jj"tqƉx jPS* ǀ;t$8u<3{8"u(G=w(rfljF^_[ÍG=rhh"j h"j/fD$0聲yj貊fP=3tD$L$ $QPjC XWVt$|$ t8Ph"jB 4( ĵ3A9tL ĵ3^_SWV\t$lt8|$jYPWuM GY&Ӄ(Ӄ0(4(8'WVd^_[USWV $8 $4 5ȵ3ViPV0W5&1WWPփ (JWWSփ _ƍ Wh P& WjjW& TV&h <Ƹ jPPV(& hVUL V&E=a==hD$\jPS& 1Nxr$ SuhǃW0t^SWP$ tg0$8 hԖ"ja@0h!"jJ@ 1N ^_[]þhԖ"j$@۾Sh"j @ ¾hI"V%=bt =buk $}u+Zt$WSVL$ 1C FYD$t8Shw"#Shk"WVPB tt|@PƉ4Pq8tg04@tt| r>1A8Љ4DAtt;L5rSh"j> 1<0h"USWV u|$W31+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h˗"j=NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxjQWPcl1eUSWVl$(D$,8tщ$PQh" D$|$,x &Phу xBWh& 1yJt$t$,WSh'"j<#t$t$,VSh"jb<^_[]USWVu ]̵3е3,ܵ3?ص31=33=3=ȵ3hM"VS I~Hw0$&3уCt DG7U3봃J7Uȵ3333x57Uе3`3UG3I57U_3157Uص357U.̵357U3 $3) =3x =3tD$)T)&1PPU0D$qU Qh"j08 $N tut ttL$8L$t Ht D$\$$|$1¿ u׉|$L$pL$ |$x\$|څy11Pt$RQ8 L$D$T$$D$4t$$$SWt$h" D$pźHt;T$v$uuD$,D$xT$|$$)ډ<$9|$\$߉ËD$lD$ @"9ؿUD$uD$Pt$L$(tT$Rh1"`83L$(D$TD$X<3tt<$11D$|$PD$PPh  T$ t$$t$t; D$XL8T$4 2L8L2 8L$L8L2L$L2 L2 L8L22Pt$S 4L01 L0T$T$B`$|$ tt$t;< zD$p$tF8DQhܛ"j4 &kjPh"j4t$(V583bl0Vh" $4dK4ҍ4v֋T0|0T0|0u׋$8tthxUj4 PT$8H Ht1<D$@$L$D93tx8D$,D$ tD$tD$,4 L$p̵3ލQ։9w9681 ̵3D$pNt$u1G|$D$ 9ξ|L$T$ $8T$$T$tL$$t$Pt$ Qh"$¾tt $<1|$t$  $8:O_ d$1F$+4im۶D$D$uD$$SQWPhΝ"~ dK<t@1ɍA;r^_[USWVhKtWjjP̤ hK9u hK4t0jQ7x!=3h#"j#t$&hKxi8tYPWh\"Qf#VtPSh"WB#jjt8VhB"j# 1^_[]fWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 3I 31KIu顀3PK 3~ t1@K@9uUSWVD$931A9|G3SƉ<$~ SjVU 3D$~Q1ɡKt<3*tBEB(B$B4!؉B8<:tWBuA;L$u5K;5K$3^_[]V$tK xKD$D$ &T$ t$ 35|Kt$T$L$D$\$ $Ǡ"aq$^Vt$FtN H N tNHNfr v V pK^VD$`sH) KK KHtP4BPQ@@1ҋKv9tKKrh "jtp4F@K^USWVD$T$#35KtC=pK11-|K9| n-|K9t%9P4uH$3L$X(3\$ t Fu1^_[]h]"hV"hh"PUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv {F V>pK K 39|[5KtFNu K5Kt5FNHNFy F4VPVpK@pK1@j@PU1@PF ~4D$F(^$F0^,n#3^8K Kt q4K^G FtH 7~ F^_[]É K=hs"hl"hh"hl"hh"OVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP KHKN^,H KKKH@KP K KHKH4IKH89t;tprpK40Kt4F KH^h"h"h4h"MUSWV}]uuu W@t tK1@xK1HCSuu WW KN0F,xNF4VPe^_[]vjv O fUSWVP|$g&s&G4$O,53w0VPww D$0^_[]USWVPt$ff&s&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p KHtƒQ K@ K^_WVt$ KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvM v^_USWVPT$|$:%4K\$ K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4K1ہ=K| t PtKK1t 98t@^_[]Ã^_[]`V15K5KhVhKL 5K^ft$ t$ je`SWVt$frLN4F,=3~0WPvv 1&t\fv4V1AN4F,=3~0WPvv 1&1;NuN^_[h"p1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS/$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"EUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP)3T$3D$M u1^_[]USWV(t$FpaFaF 1bF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"袏$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthuW1$3L$1 QWPUSVh4j5ÍD$(Pu S; \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4jIËl$hu PR $\ E1PU\$tE|$8t ho"R,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"،t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"xZB$  $ V)19tQRhڥ"4Z 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȢ"UN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth٢"Yh|3 D$(u KHKpStURQPt$DljT$t hڦ"襊u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" KVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhˣ"D$L$9tQP$$h"Vt$Ht$wL$tI9ȋt$ tPQ$$h"1t$\^_[]h"hv"h)h"&'h"hv"h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt~|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ + ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW蓹ƋD$0T$UWwƋD$0 u$$$UW<ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPϸERP迸$GW #RP誸ERP蚸$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP膳t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPH|$FV D$t RP+|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP賱 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP药$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP舮ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVpD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hդ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"gUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 躱A L$H SjQP ^_[]fUSWVL$T$ BKulF1G&Uh#y/,$3H 3~|3H |3 h|3j 4u q1^_[]VԦ3PPhd"V1Vjjh""@t&PhP#hԦ3h1&uj%USWV׉΋*h"U&tCt[PUjhhKs 5K袿Kt2KKWVS5K~^_[]Uh{"j胯5Kh׼$j衯USWV$:$D$VuP 9$j uPb 1ɉ\$QSu6 Ƌ88"u11F9Ή$<$1ɉQSu z ËD$8Չ_8"u !t$$Vhyd5Km tbVhg",^_[]jh"7jh".uh"$h"h"$p h5"hM"jӭ$05KhE#jUSWV}E phZ%VNFhȨ"V8h %V"SD$(P5KZ#D$0= M$L$A1yyy D$Phwd5K# D$tG\$ D$ L$|$j PljL$ NjL$IuɉNjD$ D$|$uhjȹD$v1111O w+Ow?u$L$A1AAA D$Phwd5K9  \$tmt$ NL$,D$(KD$FD$FD$ FD$$~D$(PPWt$,t$t$t$h"7* KuD$1D$|$Ynhxd 5KR5K1111VQRP5Kh")hxd 5KJ KLQh8")ww ww5KhQ"t)w_G|$9w  jPQ5K!¡KtNSVPh"!)Wt$ 5Kyx 5$9t#"QZh|3SVPhk"كT$;r ZƉ[|$?e^_[]jj#5Kh"lh"h"hΨ"hԦ3+ jQh"WV$u>$jvWι s'Wh{dЀ5K t^_jh"jQ65KhE#jmVPPhtd@5KX $t%t5Kh"'$"uʩ"5KQ'K$$>">"sd#QPh"U' K$$ >"sd#QPhC"0' K$$>"sd#QPhk" ' K$$>"sd#QPh"& K$$sd#VPh"&^5Kh"j?WV$u^Vhzd@5K tH$D$PWVh"j&$PwwwwVh "H&^_%5Kh"j踧USWV}D$Phd@5K tzD$Phd@5Kj u5Kh?"K$|$\$ t$jVSWVRPSWt$hQ"%e^_[]f5Kh."jSWVP|$uX|$_h#SlƅthH"SXu+1Qhwd5K t ^_[75KhE#j}USWV|$0t$,1@7U$3$1ۉ؉D$h|"WV qt\$te+$95$31|$7wWh|d5K D$ ;D$t-i9l$sUt$ƉD$l$묅hhPVgKL$ d#ti#RQPhݫ"#|$ t\ư1P`VvvvvQPh"# G;|$ ru5Khë"#$t1^_[]W5Kh"j5Kh"j訤jqP|$u1Phd@5K KtQh" #XD$ 0QhE#j耤SWVP|$t$^h&#StDhx@#St@hP$SttT$da3 D$dD$ tTj/S7tF1;tٍT$d#3D$dD$,t>\$:t$1\$(X԰&а&h"' u1\^_[]hG"h "z$3=Kuj=KKKKK KYh"57UhӬ"Phd"jK=Ku th|"0"K Kt uh"t=3uh˭"0()ǃ|u D3j=K|$\G1PPL$lQPjWt2t$d赟t"1PPD$lPVjW`t53=Ku4$P53|u#$=uKK K K K=K ɡ3=Kt&jQPi 3u[53hO#jhh$KQP53y"$8h$Kh"&3$K=Ku'L$dQPI53h "h KhrdAP  53hI"衘h KhedA53 53h["h$Kh"^$$t(hQP53h"%$$ƒ \K>s1@![Vs ) ȣTKPKHKLK? \K xK|KTKKPKK5HK53=LK= K?wKK=KL[VK?K) K>r$r$K KKKu 33]u1hQPUUUU)ʹ3333!!сis K1Kt!ttKKcԋK KK1K‰ KKK1 K1AhQhK3 i-K=K / KًKP+==w !r%1H$D$ ʀŸw1D$ $}ȹKytKt  uK1I $L$9 K11O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj \K1҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$K-K=KKD$Kt T$$T$K=Kuu 3; K7=KlK_h""EK81uhU"@KL8L$(L8L$$L8L$ L8L$48\$81=3Ɖڋ\$4PVQRPSt$@t$,t$4t$K1K1Kޅ`1PPPPPP =38h"1K8LFu=KuRhx"%tajh"2 1"WjWWWP+h"t҉Ku K=KuKu K1g=KKD$tD$|D$h_"\<K1N=t 蹵@ 1<"WhVVWP+9tigfff։f5KKL$ȃjP衘D$ u hp"jsh}";1HL$ Ajhk" 1۾KD$KtB?t=kWUh"  "KL$ DD 3$ D$tD$D$ uK K1K|(.tq<(tk{PWh"  KKKt (BD$,T(2D$ TL 3$3L$ щtT$ KT$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$RzK=ueK$@D$ $#D$u D$ а&1$L$19;ta $ȢK=KuKuKu K=Kt8K~ h"NK~lh"3]h"9=Ku1I(K Kt h"8hZ"tKoKe$jt1 KKt Kt3$ D$ K u=K5KKK1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ K|$E9u KD KDKDKDL /K KWQD$lPJ D- K1ۉl$(-D$D$DK$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$K K5K KD$t$5K5K5K5K5Kh>"5Khe"Phs"h+" K K535|K5xKRQP5Kh}" hK" K K5K5KRQP5Kh"m5 K5Kh@"T USWVPˁˀ K K K1KK~t=uKt 9r u֋ K~:K”>u~t:t  IuK щ $ Kt&=uKօ4$u KGKtiKȨuh "hب%;KtjK=uKЅ$tN K=Ku"PhB"0h "Phw"t K =KuQH$$t%t%1KtiKх $t4$P5 Kh"m=Ku5 Kh"1t"1K=u KK^_[]VPD$ L$ $QP|{h"(3H (3~$3H $30h$3-Ɖ t9tD(3H (3~$3H $3h$3ƒ1Y^h"jlUSWV1=K˃y CS t |K5xK11 uY1ɉNVt11@5C Cg"t"Ph"j hT"1He^_[]SWVP$3;3u+Ku"QhmdP  y h#i11hK<=Ku;5K|- K1Puhe"V=K~e1K111 KKPt,K8C;K|hC"hShz"h$3;3u+Ku"QhmdP y h#h^_[USWVP։1ɉQPUWi 1O}t#Ë$8u\8"u r1^_[]USWVP։ϋl$=KT+K Ktúd#td$76PSRh"T$7St$h"D$7UPS\$ Sh"_7PUSh"G77PUSh"!7PUSh" 7?PUSh"77PUSh"7PUSh"7?PUSh""'1PPPUt$(SRht"l^_[]USWVˉ1u=Kh"T$$8$43|$͉)uhd#Wh"e |$Z)uhd#Wh"K D$|$K:KK Kl$M?>KKKL$ u}tGE)9H9^_[]USWV,։L$D$DD$+"tD$F"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h" KKD$HL$LVSQP蹴D$T$D$PVSUP蝴D$|$ D$@VSPW聴ljӸ1=3ƉT$ L$@PVt$QREPSW|$LWVUl$lt$,t$,t$(t$@h",h$3jdhKn |h0#hK K\$ $t < uC{ - 3DAu<-j D$$PhK D$$\$ hĕ&SmK|$(@D$Ph"SGq $ϋT$ t։t=t$hQ&Sq t't$h "Sq ct$ |$@D$1=3ы5KjVWRŲD$ՋD$D$D$D$D$$t$t$D$$  T$ Ku1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th0#S < u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh3"KVƀKt$Vh "} 5KD$,$t$P։ω,^_[]h"j\USWV΃ twttu"^T$(|$$+ KуD$ ;K"L$ K|.|$,T$0 K|$9=K|=Ku|$4u 1^_[]Ë-K~} ʉ$9twK|(tk Kt( T( (t1+ K9\$ \$$}2;T$}#=Ku6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉKtt  $tt ^K K11 Kt$ -Kt$|$$|$}K] ʀ|(tP Kt( ;L$T$|L( (9Ή} =K{|$(t ;KKC KK"1$t=t K KS_"=K|$(5K5Kym1KKKKKKKƆKt$ |$(PK9Ku85Km1KKKKKKKK1Ƀ|$(T$3\$1 5Kn K|+D$Nu K[\$j5 KK)؋ KP|$(t$ hhjseKVfǀUKL$ KD$KƋD$$ȉ5KKK11KuK=Kh""u"D"=K1|$(9 Ku85KYk1KKKKKKKKJu UPQ_ K1|$(tD$KD$K5K=K^_[]hp"jVWVKt^ tڋt֋|҉tΡK4 K QPV<_ Kƀ^_USWV T$L$K@hPhKB  KK~CKK$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR^ K;UjP買 fDŽ;UtZF , M ;M;MU;; K KT$)ʉUL$  K1 EE=K KϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MK ^_[]h"jpTWV1=KAut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 3D$Ӌ53݉t$މ$!!jVWt$x!1Kl$ 33uhUPzQ5KP  ;3u[jVW53!1Kt?D$H5K#$SUP܋ 53V53W ;3tÉ؃ ^_[]h"jdRUSWV$0$,1@D$l$D$D$ $1h"WV Z suMj U57U[ á7U8=L$90趷8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-$3)1<$L$jhQP4!ah,KhedAPT =K]g9l$| Pg@fKUjDž\$ t|3H 3~|3H |3 h|3j jh,Kh|3 3H 3~|3H |3 h|3j <$ D$ttd#t$"Ph"D$fK,KWafKgdWPV% xnu)D$PhwdV  h"h"DV 1^_[]Ph"257Uh"jO4 hW"hz"yj<׳Ph1"hԦ3 jUSWV\T$TK< $SRD$9d$ՉjRPt$ VP11 Sl$UV 9 1U\$tL$j@PQ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4ذ&h"T$l$ K1ɺK1MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$Kt)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf KŅtMaQ4ذ&h"T$ t tuf f111K|$ KKT$KKfKl$E<$g\$ttXaQ4ذ&h"; ;B Q4ذ&h," <$\$t4ذ&h]"<$l$!F1D4 vjL$”19v f39rËL$D$”19v f39rfUSWV|$t$t$h"V Gw4&h "Ph"V_ GPSh"VGGPSh"V4VjjhEa&"}GXtVjj h" }GXtVjjh"|GXtVjjh"|Vj w(h"V w,h"V w0h*"V w8h?"V w4hU"Vw w1u8CHKt;C~&H **;C~H Sj+Sj*Sj FM8H1HPh"S F;Eh"h9&j?WVPhx@#Qat1ƉPjPW Wt jPV,P^_fWVt$|$ VWt$?/tWh*"VhC"^_Wh"jW?fWVt$ |$7WVUSWV $$l$WVSU$ $ hU3WhX"SuWVh"jG>D$@tF$j$h&hV1NV$$$h"j$USWV$$$$D$1 h"SUE $D$D$1G$D$ȃ 1$̵&N|w57UFt|$`N|Z57UFx|$Cj$h&57U4PK457UUFp<$h"SU&E V$3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h5"j<Wh$jG<Ph("hԦ3袽 j@(WVPt$jWV; 9u9t x^_Vt$he"j<Vt$VW8t@^h##V^Vt$VS=t@^h7%V|^WVPt$jWV}: 9t9u x^_Vhw"j;WVt$|$ VW7t$?/tWh*"VhC"^_Wh"j;fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$ Q<D$ T$M⿪t׋E4D$P9$E0D$@s h",1VWt$ t$b<P:1@PPVVu4u0ufNË\h4h &P`s }D@u hhT& hhT&S;s }D@\E,CEho%V臑$tho%Vh"+ E]u"Mr u%1ɺu; L$M υu"Mr $9\$~\$~tSh"0+\$9|1} t h"+hW5Kh "lt$ }4xME0;E4ru0h^"*u8E,u.D$@ E4t h"D$P 1u D$@E|@L$tɉ$~ș|$u D$x9~BQh"P*D$x,D$xt9th"+*D$x$5 t$ D$$$$ $$$E@$D$,D$(AD$|AD$tAD$0A $CD$ D$TFD$D$HD$DAhD$LL$$AlD$dD$XA D$8X$$AP$$p$$$$tD$hD$\$$A`$AtD$pD$lH$$x$$DŽ$\$|$$S (L$ L$,tL$(|$1F9tSh"'D$ D$L$ 1۾Ë$||$|tL3L$ 3tD D$ Wp'\$t4$1F9tWh%"P'D$ 1t4$ tЉ<$TB7D7R&tt htD$pt\$1t$$2:|$$xtIt$%Whd"Ԧ3P~ |$)Wh"Ԧ3P_ D$ $L$t$}D@tBW&1@9tWhD"% $G$D$D$||$tD$tD$L$\$dT$,T$T$8tD$T$\$XT$(T$T$0\$`T$<ÉȺ$L$`D$L$<wD$ $L$t$L$}D@$t1ɉD$d|$$tD$X$D$8tD$08$t$1ۋd|$tTt˹)$E3|$x|$trE P|$t$ \$t$ lt $U<$uTL$$|$t$$t$ \$1ҋ} P#$t$D$1P#L$hT$tL$\},D$dD$tD$X0#1T$(L$t$D$htD$\0Mt$  $t1D$uAAQ 1D$1L$HD$tL$D $L$h|$tL$\$tT$HD$< u M։ ut$< uƋ$ș)Љ$T$ uD$D$u$p $pL$WFD$(+D$L$,L$ ʃ{1QPWVth"j1F\$D1VPSh"'D$XWVPSHX%|$$u1Ʌ|$t1ɉAw1@|$Ph5"сD$tt$5K5K5Kt$\t$dt$<5K5KQ5K5K53PWt$L@ƃ|$4tVxUSWVӉ $h|$j W\$ S] Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ g8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"jFUSWVԦ31F/WVUh4"h3WVjhd"W3WVj!hz"F3WVjh"53 WVSh" 3WVj+h"3WVj;h"2WVj$h,"2WVUhQ"2WVjh"2WVjh"2h"W譁WVj h"2WVSh"2VvfD$t1B9| 3I 31 K 8K 39|[5LKtFNu PK5DKt5FNHNFy F4VPV K@ K1@j@PnU1@P_F ~4D$F(^$F0^,n#3^8TK TKt q4TK^G FtH 7~ F^_[]É HK=hs"hl"hh"hl"hh"ZVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP HKHHKN^,H 0K4K8KH@@KP @K PKHPKH4ITKH89t;tprpTK40TKt4F TKH^h"h"h4h"nYUSWV}]uuu W@t $K1@(K1HCSuu WW KN0F,xNF4VPe^_[]vjv [ fUSWVP|$gP&sL&G4$O,53w0VPww D$0^_[]USWVPt$ffP&sL&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jr8p XKHtƒQ XK@ XK^_WVt$ \KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd F hjvY v ^_ USWVPT$|$:%4`K\$ `K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4` L1ہ=\K| t Ptd LXK1t 98t@^_[]Ã^_[]`V15\K5h LhVh`KX 5XK^ft$ t$ j=lSWVt$frLN4F,=3~0WPvv 1P&t\fv4V1AN4F,=3~0WPvv 1L&1;NuN^_[h"H 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"QUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FUFUF YVF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"z$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthiW1$3L$1 QWPUSVh4j ÍD$(Pu S# \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4j!Ël$hu P*" $\ E1PU\$tE|$8t ho"*,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"谘t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"PfB$  $ V19tQRhڥ" f 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȢ"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth٢"dh|3D$(u KHKpStURQPt$DljT$t hڦ"}u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" l LVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$d$D$puD$ 11L$ I,$t$UQPhˣ"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$h"`1t$\^_[]h"hv"h)h"2h"hv"h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttV|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$Dl LuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWkƋD$0T$UWOƋD$0 u$$$UWljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPERP$GW #RPERPr$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW޿Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP^t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPӾT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP |$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP苽 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPe$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP`ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVHD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv # t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hդ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"?USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 蒽A L$H SjQ( ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP?1 ^Vt$ V(1y?1I+F$ыT$ptj42QP?1 ^Vt$ V(1y?1I+F$ыT$ptj42QPV?1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jL׺Ɖ t,U譺Ftf^81FF"P迺USWV=h Ltp\$1 ^uXGourEr?E!u$t.E( E,tWt$t$' Ut$t$ F(u1^_[]USWV(l$Dt$@|$<]N(;LrN,t 9ы|$H1|$<΋t$  LuN  LNVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVhA"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"j@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ L LuPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp  ^ hjS V^_[]h"h"hh"USWV l$4E}0I\$8u tȉFSt T$$8F V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt腋/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$"袵\$8u;l$L$4A(I,WhT$L$$D$ + l$u L$4A(I,T$L$$D$  \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$}F(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$d}F0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tW=ƅuWh]"j藆$$<$4D$Phd@U, tj1OLVhedAU} F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;L%t$=1 Sh"U葥 CPh "U/ C Ph"U CPh"U  CPh"U CK,C,Qh"U C0Ph,"UϦ $@D$t PW<1-Uhzd@$<WW t1 VhedAW< hjU D$ P$4eD$, 9L$L$9u0$S11:j8tx$0ht"Tb$11҉ $ƅ*ŰPj PUP ^_[]$0h"jUSWV81ۍD$4ShPSu訓1NtAljSPSWuWRuMU D$t$$$Q1e^_[]fUSWV $( $$ hojSk hx@#Ut.P|$:"V(t!UhU"JUh;"1OUh"l$D$QUPh%WItPUh%W2iD$$Ca2=ouV!\$&V{V$( ]hh"W| ƃaT$q"V1u\$ىjW$( h"  VT$X"V$$ h"Y V` ^_[]1ىj=ߊ< t< uGjhQ#W\ k2$( aj2WPw EKu$( 8~y$( 1\$ىj(Sh$Py u$PUhl"g  "j2PW E2$( ;(|V>\$}"V$( @V T$d"Vg$$ hK"h" uD$ $PUh_"S蓾uU<Shhg"  $( aPWh"Uh&"$( x?$( Z1ىjPySh$PXx uSUh"  j2PW藏 E2$( ;h||$jt\h"@PUWV $( ƁaD$ a9QPUh" $( ƀa$( ]UD$PD$ PD$Ph"W%L$\\L$\\ $\]u^E (&Yt8u1҄tʋ$( t?r QVR Vq8uUh"Ih"Ph"4USWVՉt$hR  1I t uFjhQ#V u<^Ft t u^F t tW~PWVs tt$hU  u1I1ɉ^_[]WV׉RhQt  t6< ~< t<#t< t >t< u6AWhV@  űD$ 1GtPh׼$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh"+C< t< t< uhx@#SƍD$$VhPc L$T$\$PQRSD$0PD$Ph"D$@Pm t$$$ىh"rC< t< t< uS=$<rLjSh,"ShH"JySh|"h"t$<L$D$D$L$ oP~tXljo 1tX L@uH~vCtTjhhV"o Vv$^_[]V] )UjS D$ D$ CD$CD$C D$C$Cl$Uhf#V1 u D$CV)1$<;obD$D$PSh" =USWV$0xjW+ƅ~F$0h$1jU~4$hP C9uЋ$4hx@#S+Ǎ$ىh:"$0SAt| uƄ$ $0phi"QUID$$0qhs"QP'ىD$PUPUS u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph%S׶D$L$ T$ ыD$E L$ T$ D $A9L$D$uPh"h"u}Sh"h" Sh"h"u $02t$t$h"$@t$Ph"E |$WH}~14蒋G;}|V胋1^_[]USWVD$(}~;$ ~VE pSn $PjVWjSD$11D$D$D$D$$D$ D$h$"u Vu~ H5$&D$>j 57UP׆ Cr L밋7U$P+Crj h#V̂ ىVSA1P;uE$ ~S4V莂 $Ph`jSPt$VuVh\" kWh"j?rÍD$LPSBu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV 8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQ迡 $PhV"Phr<rr h"jhr +rryt$$$PVW>ލ$P|$xh"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP謠 $Phq"Phr}"t5"PSh" .1$P;$hn"Shrt$V"9;$PVh"|$$Vh"h{"jhr t$Cj.= L:$h"Whrt$"?c.\$j.h"WhrS$d|1$XAA$Pj2PQ  $Ph>"Phr9rh"$`>ߋN8un&w&PVh@"~ `Ouet$$P\$ ZSh"Oh"$P\$;$PPh=" V0h-"Sh*rt$  09rh4"h@"$\>$Thj{% VhR"z$X~:$\1j hT$V "tQCC`;$X|j l~-hw"$`>V `Ouj ;$X1~$1:t @`9u9u$\Ph["1@\D$,\$H|$PS1$hjV L$,9F Vh"VhrWN h^"MF0Ph"[F0Pv,v(v$h">j Thk"$Th"Ph"h"Fh5%VQD$0L$4$PND$8Fh9"Vh(r W  FtsShX"$PtPh%hu"$Tt*Mbi)QRh"J j `$XqPSh"  ]h"$X~n$1Wȃw,#"$&L$S7"!""un& }""PRhJ" F`;$X|ۋt$~G$`>G8tu #Pun&w &QWhJ"M `Kut$hn"VhrP >"t"Pt$1 E$`$d $jj ho$QPjVyjhvp$V]v V$`t$Vh"$XMbi)QR$\Vh,"j$|$|$|$|$|$|Vhi"2 $\uMi#1wh"L$!r"$PPVt$h"!11҉4hӀB9ud#ti#QPt$h"= L~S$h1hR'#u1PQh"X C uߍ_ j e rt$h"Vh&r@t$L#;$Pt."}"t5"RPt$h"t$ USWVdp׉L$$xph"S׻tÃr t1C$|L$ PVQ Ou wu pu o$1hoVW owt1$4 j2tWs F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0Ghh"Wr Ƈ$L$h"Qh+r|$W9uh{"jhr Wdp^_[]ø"1@$" "$Pt$h"hԦ3PWV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhΊ%Sft tVjh"SRt tBjh`#S>t t.jh"S*t jh#St u$D$D$h"PhrWh"PhrW= Lt?|$"t"PVh" |$u$4x&Vh,"g ^_[$oWVƿԦ3Ph!"W Vhd"W Vh"W Vh"W Vh"W Vh"W Vh"W} Vh;"Wn Vh\"W_ Vhs"WP Vh"WA Vh"W2 Vh"W# Vh"W Vh"W Vh-"W VhD"W Vhe"W Vh"W Vh"W Vh"W Vh"W Vh"W jVRhQX t^Vh׼$j_WVPΉ1WPhPPj PQG u^_Vh"Qj^USWV։ωl$PU\$hjS E9C Sh"ShrW Vh0"'ssss hI"ss3h"{""t"t$(Ph" t$4t$4t$4h"$t$Ht$Ht$Hh"D$8Ph6"$t"VhI"i$4x&h\"K$hs"7Ę^_[]t$ t$ t$ 諥 tt$h"j]USWVӉύD$(jPn1t$`FFF FFD$hd#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP^D$HD$PD$P &5&|$D$ fD$ l$ \$Tl$+D$Ty1 &Ph׼$j($PT$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$`&ݜ$ܼ$D$pt$t$$߬$`&ݜ$݄$T$xL$|l$x`&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<s5= L ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%Sۗt jh#S t ;/u f. Gf./WSՕ9SW1t͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 53 DLH $s-t$$tHfHxt P2)1^USWV= Lth|3jjh#ljj9#tvƃ= Lth|3jjh #xlHL1GNIIˋ^s DL tVfV(HLޅuTL=PL1WS"ơHLKrk= LtV$Ph#h|3貺 ~uV7dV'%V`v v"LF$5Lvu;PLTLK^_[]USWVPl$DLM1t$"Džt.w w!ƅu h+#d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+= LtW"PhC#h|3o W_1l$$ttF9u t G9t$&Qt$hLh(#hԦ3 <$WbWE&F~X|$<th#V_VCbV&vfFt$ t$ t$ h#hԦ3xEuFufFFV!|$WP`WV&N= L1ۈLL|NILLhL蹌LǀL|NAMǀLEFNDt$hLh#h|3ķ1N1@= L1ۈLL|NILLLWAǀLFNDǀL|INOW$LǀL|NAMǀLEFNDVdPt$hLhg#h|3%C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@= L#~VPt$ht#hԦ3蒶1t$hLhE#]a >W\Ut$$t$$|$$WX ƃ*Vh#V%]1@KGufGfG1@= L$ WbPt$hLhg#h|3εUt$$t$$|$$WƀH1@= LىV_bPWhLh# |$u V[v vYLF$5LUt$$t$$WDUt$$t$$W.PZN1@= Lt-ى,VaPWhLhg#h|3ݴ؃^_[]S1LL|NILLt!hLhǀLAPEǀL|ONTt!hLBǀLFNDǀL|INOt(hLǀL|NAMǀLEFNDƀLt(hLǀL|MODǀLECHGƀL[SWV= Lth|3jjh`#dTL=PL1VWftmxtg DLW sJX tCf{u7= LtSPhz#h|3p S\S [빃;=PLTLk5Ltc~ tWuLfth#W Z= LtWRPhz#h|3 Wy\W9 륋v$^_[SWV= Lth|3jj h#cLtSL1{ t$C$Su[SFuՅu5Lth#VKYv$^_[USWV= LR LutDh|3jj"h#c,th|3jjh #c5 Lt$G!jj#^ơ L;PL LTL,׋- LWV]Ɖ׋ L L9sAWV2ÅuWVh"#p\ SPh2#hԦ3e c렉1‰1 u`WVÅu hj#%\Cuh#SXCt SZcSSPCcQPWVhI#hԦ3ݰ:K L9tPt$ ZU- L L;PL LTL^_[]USWV= Lth|3jjh#paf LjY9T jj\ʼnT$TL PLPQ\D$5 L5 LJ\Ɖt$U9\ʼn$St$p\Él$9$\$ L L9ˉs6f Lj8DTk D$; L LrM\$ - L9sI L95 Ls9- LtS  LE9u L L9\$  L L9ΉsZWVÅu h+#YSCPh2#hԦ3߮ cWV[Ɖס L L911 uU9t$D$ rIWV<Åu h+#|YSPKAc9- Lu*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5 L5 LfZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ= Lth|3jjh#^FtVPXfvu݃= Lth|3jj h#^TL=PL1ҹ$RL$QtMƋhtDEt9VP|$ W躷1ۀ~UiCSPW+W em븋L$$; PLTLr^_[]SWV= Lth|3jjh#]TL=PLrc11CWS5t:FfN~u %fFfth#VYSvuȃ;PLTLr^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh#V ~u,|$ t%h)#VRWh#hԦ3 1^_[]fUSWV`= Lth|3jjhT#\5\L5XL5 Lhs#hh3\ L t=dt9߁^_[]áLtPjt$t$hVuù3WVIAfF=L|CL)fL5LjQhLVu5LF1LPVQ|, =LFL^_ù3Qht #P!H8u"h #h #5 Lh #hԦ3脤j WVjh3|1t)h &t 8@ WL^_V L  Lt7# L=@u%o> L  Lt L!=@t^USWV$$$ $jhWVh,LtE1M1 tmjWVS$8jWVS$8t$Shk%hV\Vx$ LU Rh5LDžtGh%PytShF#hԦ3 5LDžtGhQ#P[ytShn#hԦ3Ģ 5L[Nj5L1jPP6i+^^$DOGrhPD$Ph#hԦ3V:hPt$V2 $(j7V@ Lu D5LNj5Lj1PP6i+^^X^_[]SWV׉1jPP1h+FF9tX\$)yWh1 #hԦ3蝡 %؉jQP6h~tF hP63 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFhb%Pmw;-PLTLrv= LtUh#hԦ3負 \GP1= Lt:Ph#hԦ3胠 %1= LthԦ3jjh#`Q1^_[]USWVD$$PǪD$x/@thb%Q蘣1ƀ81Mbi)LH1ًP1 t LP RVjt5LAt\G9uGSVP>u t5LDžu*hb%D$PТtƀ8MbE^_[]USWVt$!M1 tFjhRWc,Lt(E1M1 tm`ƋU R^_[]ËD$0}1USWVX= Lth|3jj&h #O L ߉^_[]USWV|$u h; #>Wh-Lu`Ɖˋ- LUDžuhE #z>- L)ً-L9w؉9vlj<-L|$-LWSΝ^_[]USWV։ϋ\$ t;=PLTLrVWh #= -)L)LQPVWW{s LK$\= Lt%[$tC1K 1 uh:#S9^_[]SWVt$f~th #V9~u(~th #Vg9~ th #VS9FN tkQPDžuh #V)99tt79uNH4~^ SW FtPh #V8.>Wf-L-L-LF$5-L^_[ËAP 9ttЋR9uIHËIH hI#Qt8Vt$V.f-L-L^SWV|$t$Åuh* #V,8;^ty^C Fs j/WWGSe-L -LW WeFV86PHg1ɅF fN^_[USWVd= Lth|3jjh` #A= Ltd|$xhP$WԐƅu0t0=Phz #hԦ3< Wh{ #;t$ f TLPL1؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6@vuݡTL$PL؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W?[uTL$5PLL$T$9΋$D 1$T$|)L~L1\$)L tAD$t$ jjSy?G)L9|͋ TL $5PLT$|L$<q$Q Ai L LQA XL\LQA LA$t$ Vjj(Q ?F @t3r0:Ph #hԦ3 t$xh #8V9bh^_[]USWV$= Lth|3jjh #>e1PPU Džy0r0:Ph{ #hԦ3W Uh#88D$,PW;Ny0q09Ph9#hԦ3 UhC#7$jSƅu he#7SVW xD$j(PW y0Tq0a9Ph #hԦ3蚌 Uh#{7W LRrD$l$ L= L,$1Չ1 9$hԦ3jjh#jj5TL5PL )LjP)Lu h #6PjPh%HĨ^_[]f LD$L$ L LD$L$ \LXL= Lu t$(6t$pPh#S6D$ L$$ TLPLL$T$ )L<))L؅~ڋt= LtPWh#h|3m =tK0KPSh#&K03PSh#hԦ3kff LsPPP[ 1ۉ؍e^_[]4$5#hԦ38` jTUSWV$$= Lt$h#h|3_ Z$ $(މ4$9{CKQPh"hl$U[= Lt CU343h #h|3|_tUCKQB+{))σ5#WRL$ QP$(CKQB3{))σ4$U#WRL$ QP$,BCKQB;k))΃D#Vt$RL$ QP$,Kt%= L$(tqUhf#h|3s^ \{$(u0jhv#D$ Pо tFjh#D$ P踾 tk= Lth|3jjh#9(jtzwC@#P$56C@#P$m5C@#Pj$$D4!C@#Pj$$4 u_{C@#Pj$$3!C@#Pj$$F4 = LJ= Lt&d#;$ t#Ph#h|3\ = Lth|3j ti^_[]=SWV|$t$= Lt?SDžu#Sjj0SDPO/F^_[WV|$ th#WWNƃ= LuhVԹx= Lt0cPVh#hԦ3Y^_WV$ F th#VjF fFVPWc6Veh.u Ft#h#WYt9h7%WGt'\$j SW3 $ 9uy6hD #U$~h#Wt@h7%Wt.\$j SW D$ 9uyvhW #jD$PhU5HL u ^_[2hg #jSWV |$t$ >h#Wat9h7%WOt'\$j SW; $ 9uy6hD #U$~h#W t@h7%Wt.\$j SW D$ 9uyvhW #jD$PhU5HL  u ^_[:hs #jUSWVhA$(1hWD$ P& |$ |$ D$~P1ۈD$$,,jUhg"` tjUh|!#L tG99ufD$u\$ tR$,4jVh'% EjVh!# 4jVh!# 5\$ D$7f@jh0uht$Vj P5HLD$^ރ9tD$j@h!#P ߉tD$PQDaryDpriml$t?tD$P&D andfD D$P DgrowfDnt$VD defDectsDuVjh!#P V5HL5HL5HL5DLh!#.AEt2tR}jh"#V H}j1hx"#Vo #}jIh/"#VJ t6Wh"@Sh׼$@UփOut$ h&#>r^_[]1h]!#jUSWV}\$j S5HLO D$t"NuD$Hj@PjSPh"#j-$j$Vjj5HLrF=tPh"#?D$D$ D$$fD$t$j VE 0F 9 1L$81qAQQ a A j QV5HL-D$t$ *jh##E pR  D$ @L$jhtjPjQ5HLh##>h|3D$t$H1D$`D$L'Ƅ$0VhQ`5HL $j D$tPS |$'y9D$(ȋL$;&|"@D$Ph## >h|3j uD$$<JD$ D$ L$jhtjPjQ5HL~e^_[]ÄtH<t<u'5DLh3## 5DLhN##hԦ3!@ P5DLha##hԦ3@h##Y=h&##jӾE 0h"#`USWV $ ~($ 1j4h##g ?C9u1CCJt$LUPV[  CJjh'UVjS5HL~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5HL5HL5HL5DLh##I< vL$D$$jh'hVjS5HLFfȁw$VhU VhU ƅtL$D$jh'h$PjS5HL]$f1Ɂw$PUhWh'#7mWh$I;vL$D$jh'h$PjS5HL$f1Ɂwh'#lt$ t$ 1؃;D$ D$4ƜF>|$Ń <&hl&ho%: ~y)L$"d#t>"RPh$#p6 DLD$td#VPh$#P6 DL|$ >"yd#QPh %#+6,^USWV t$4}ty|$8h&#St:hx@#S t,hP$Sth/"St '1̓uhq$wtR1ۉjVjj5HL7 f ?F$ȈFfFF PVQ5HLY 0^_[]Ã|$ u(1AA5Ph'PPjQ5HL$V(|$0D$40iб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P5HLD^SV|$$jVjj5HL^DLtB>">"@td#QPhY%#3 DLyd#VPh%#3 Ph2%#3DL|$ >"yd#QPh%#3$^[`USWVt$,}ty|$0h&#S t:hx@#S t,hP$St th/"Sb t '1@̓uhq$w9 t1ۉjVjj5HLf ?F$?ȈFF PVQ5HL(^_[]USWVh蘷ƋD$(1|$|$ |$ D$D$~{ŋD$,Sh%# tMSh&#{ t?Sh7%i t1jD$PS8 L$9=r1D$G9uD$@@ jh0uhVj P5HLȉ$=r%ht$5DLh'&#1$<$r],$1D L Tl| D  PW5DLhE&#L1C9$uV^_[]ËD$,4h &#j育h%#D$Ph"#1VD$P H PpRQh"#0 tVh"#0^h'#b^VD$P H PpRQh"#0 tVh"#l0^h'#=b^USWV$Gh4&V Vh5'#0 r[hG'# 0O yj hW'#/O,@tPhl'#/O, tPh|'#/GȅtPh'#/GȅtPPh'#/ O W hVbVh'#`/GtPh'#J/$hVjWƅtVh'#/j 4.t)$1@9}$݀KAL$Ap hLLA jPV"p jhH%Vp HLW4PWVo Vpr^_SWV׉ΡMLH MLuhhML輭NLh@#h@#hS hP$S NtZÉ >A#td#hML5MLPhA#S#Y|@hLLS PhEA#S# zh@#Ph@#jy<|/iĹd#hIQ#Ph@Q#Ph6Q#Ph,Q#Ph Q#PhP#PhP#hԦ38jaUSWVpT$ L$$$NLnƍNLD$\D$`$RLRRLL$XL$H)L$L)L$dtMuI|$ tB1\$L|$Hd#t%L$$ L$D$ \$<$D$O%D!F9t$ uȋu] }trOl 3|$ wd#L$L$dL$L$` $D$ D$o%%wd# GD$t$ D$LD$D$H$D$O% ދ] =NL  3=NLtD$RL$#! 3nD$RLD$NL$BD#KwD%$&D$#$$LD#uGG0O4D$L$$bD#vp$D#E# E# E#D$$LD# D$,G@D$$sD#%RLd#D$0pu?t$RL<$D$d#'t$<$D$E#%ىШpu:|$t$RL4$|$4$D$E#Ψكှ%] yBD$t$RL4$表D$4$D$%E#舨%sBD$t$RL4$YD$4$D$.E#@% sBD$t$RL4$D$4$D$6E#% sBD$t$RL4$ɧD$4$D$@E#谧% sBD$t$RL4$聧D$4$D$HE#h% sBD$t$RL4$9D$4$D$RE# % sBD$t$RL4$D$4$D$6 #ئ%sBD$t$RL4$試D$4$D$VE#萦%fyBD$t$RL4$bD$4$D$`E#I%sBD$t$RL4$D$4$D$%%}tQL$ D$h$D$q#D$ |$t$RL4$賥|$D$hD$}4$蜥D$0D$D$RL$~D# GHtD$$D# G(D$$D#$ |$,u=NL 3t|NLuteXu<$L$$T$ NLu t GX@r9=NLuD$NL$#pGXHw $]Q#$4D.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$RL$NLƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$HD$(u;NL NLY=NLLD$NL$D#U3D$(M I"$&|$D$ D$D$$$_8NLZG4D$hL$$T$ JL$0$ʕLưD$81D$D$D$hD$ t$D$0D$D$$$V"4$D$88 D$h$Z1uG0D$$WD#PD$,-1D$D$D$(D$ t$ht$D$ D$D$$$Ǽ14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$rD$(D$4$D$NLD$(1ɉL$L$D$ t$ht$D$ D$D$$${4$D$D$$"`1D$D$D$(D$ t$D$ D$D$$$贻D$($D$NLS1D$D$D$(D$ t$ht$D$ D$D$$$]4$D$D$NLc[iF D$|$D$ D$D$$D$ D$D$D$RL$NLVi8 D$($t31D$D$\$ t$D$ D$D$$$蘺&A1Ah 3$D$NLD$D#SD$ @D$0t$h1AtD$h9k4$^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$ˑT$<1Ht |$t$ $_T$a΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PS  D$ D$ 938*8\$ L$ D$D$W|$hE#SnDh&SX;hBu&SB7h|#S,3hiM#S'hnM#SD$t$ |$@1ɉQD$PSd  D$D$ 9؋t$88|$1ɉQD$PSq  L$ 99։D$nL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShNL4t 3hlP#v 1<==NL ڍt$81 D$ \$phjShNLPVT$R#$1BD$L4JD4`L$p$QRSRPV耯NL NLu1$Pvp$w (&QhNLhO# NL1<=4 j=V9=NL j=VT$81 D$ t$ hjVhNLPRW\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPT$hNLhSP#D$49t 8VhP#S1JD$ $$Qh@O#,=NLD$t$=NL$D$D$,D$\$(VTGC@D$p9VhP#0Pt$hO#|$oQh\O#=NLD$WSt$hHM#VD$ 81ҸD$ |$\$ Cj"$PÍD$pWVPSt$ $P觬\$ E $NLjt$tS7 $NLjWV# -0PhNLh6P# BNL NL$PhNLh+&kD$ $u1@t$2|$ QhN#(11G|$1\$ tpupth#Q]D$ t$D$t1@L$ ɉ%t.M#PQ^Q|$t 8t1j t$ 4$`St$hM#FQt$hM#7.l 3m 3L$ L$ ف$K{8P|$WD$ t@j QS衏 D$ ;$|$8tQtUL$4 T$hjRhNLQWt$辊 l 3T$ gL$4D$ NL1ɍAD$4tT8`T$ Q$QRQPW cNL NLT$Jvp$w(&Pt$hO#t$L$ $d$ r $3 $tu¸|#tnM#PQhO#|$D$u |$u |$TF1@]%t.M#Pt$h M#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0QhuO#(05Pt$hO#|$L$lj% L$St$hM#{D$$&1ɉQD$PS L$ 9t 9St$h=N#,D$ D$ D$D$0L$0RPQt$,t$$PçtBD$tUtsD$ |$NLjVPM D$h|$t811FD$&|$NLVVP  D$'$D$8|$NLjVP D$pNLjVP UD$1=NLD$44$Vt$hM# Ph5M#=NLhe^_[]4$hN#ًt$D$t$$t$S@9s Vt$h|N# S@D$t$|1ɉQD$PS] T$tD$pD$ 9t8u8 St$hN#QhN#c1ɉQD$PS3 ƋD$ 9t8t}St$h^N#St$huM#D$t$։D$L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hL# jj-զPhNLhL# hL#hO#hP#hNLhD#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSP1Ht$L$ltT$d;WuT$h;W(u Q\{ ŃtD$ppPU D$DGXHr P見oXd^_[]USWV$l 3xPL8NLt xPL/yPLShNL蓨tWNLމ)ˉESQ|$ Wr DWxPLVSVfǀxPL/SU@uNLUhxPLUS,^_[]USWVhT$D$E#l&1ChxPLD$ CL$;rjt$VD ufD$jD$PjhxPLVt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPWt$hgE#|$$j@WVPˍWt$hwE#juWVPt$=h 3EPh#W  NLt5NLPhK#5h 3D$$PV5h 3 NL^_V΅tOTHw;s1NL NLte.0;PhNLhL#M AtʡNL NLt"0PhNLh+& u =NLt^jUSWV=NLˋ}NL NL t u tth|3jVuѦ}ti=NL|}t j -MO؃thD$VuPo t$UtuRh#{5p 3Rho% bD$VuP tMD$PVh&L#\ D$VuP t+t$ t$ Vh-L#*]D$ s*P? D$L$ r!QPhQ$ rD$rIPhf#QPhx$xt$h3\$}u h6L#j e^_[]PhZ&USWVP=NLu(ˋl$ D$$|$5NL NL t u^_[]Åtth|3jt$W܅NL| t j A$^_[]uCuWt$h" K4$~DN1ۅtPh(#t#=NLuPhML#9tNLC뿃u,h6L#'t+ORh#{K#e^_]QhMI#jcUSWV@$ @=NLt Z$ VEmƍ$ h jU h%V@ t}1ۍ|$1E:SWV L$99=z  h%j(@ƅu$ 11L$RUPQ$8@$8@ tIt =NL$,@$@NL NLt.1T$Ph X1Ʌ1ۅÍL$MPR$@SPUB U$@7vtWNL NLt$ jh V0$ PjPS Su@^_[]8"tD$9t 8uVhlK#Vh[K#jahNK#h׼$jaUSWV \$0|$,1PPUPSW趌)4$d1PPUVSW舌=NLut$ h#>rt51t ttt ttthK#w 9uЋkT ;$tl  1L$D$Sjh"- {t+1:LtPhK# G,;{r܃TD$@TL$9uj VCt1A ^_[]hNLhK#+USWV }=NLt D$ tohK#W蒷tc1ɉt$QVWB T$$9t8u|8,WuhK# =NLj>11CL$ t$PSQVuu荊tWt =NL1=NLu?=NLu6L$1J1ыT$1 u#MUPj hK#1ɅRaMUPjV tK=NLu-=NLu$1H3$3|$ uMUjj hK#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVhK#S Uh$S t9Vq4$Euuhd#DgƉ$t^_[]hK#hK#j]hK#hK#USWV\։ύD$ jPj Px 1u0D$F|fD$Y|Uh;L#j D$ Pf$L$D$ L$/Ph(#j D$ P>[ $fL 3/LA .sD$ L<u\$ S? jPj SҾ E9[|$ t D$ P Vh@L#'d^_[]WVth΋u\~8tU~4~`N4F8 I9rPGp1F0F4F8FXHr P(pFX^_fUSWV\$SLSLhnQ#sP\su SL:h"Pu SLj藝SLJmx &蹶'?c.5SL芓h"Pu L=LyQ#t$l#l$PKrt Pu|Qߋ<-t<+u{uNh&S蜲tGSM16kh~Q#qSLt8u)hQ#qSLPqt SL$hQ#}qSLPqt SLQ#1=SLtjhQ#~FP7֛j觛N=SLu0j_`ujjB=SLt!= Lu=SLujhQ# C1FVV7=LuhE#5003&u\~jhQ#B jM5Lf:0BuK@SLSL!Ѓt4\LSLBzu=(Lt0譚|(LjS=hLu TSL=\L~jh R#u j j 6GWVt$ y5SL5SLSLut[<|=ԎLt=SLt|3'V1Wu=WSBVWV|$ W@jP'etWP^_t$t$dtjh#R#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9SL<SLU5؛L5=TLu SLTLU2=v====,=XAf2 SLiTL TL$TLF=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fTD$TLD$L$d$ TL $TLD$D$fD$ D$5؛L#Pj5؛L SL,^_[]VPhht@jΜ t1h?R#ktP$t$uչ%~(TLh:R#rkt(P# (TL (TL 3 (TL (TLu.hJR#!kt PO#Tƅ~5,TLhER#jtP# ,TL ,TL ,TL ,TLP^V[tP=X`Lt1H Vr^PL$$0TL1Qw$D&RR#M(uMf0TL xUR#4XR#+[R#"^R#aR#dR#gR#=YÉjR#/uf0TLmR#uf0TL0TLWV׉vu1=X`Lu WV跴^_SWVPhpR#iPi1Ʌ 3h%uid]&tX`LQhXTLptX`LR#tX`LVy n9#\`LR#``LR#d`L#M&h`LK##l`LR#|p`LɁ"yt`Lx`L|`L`L`L`L`L`L~ LX\L%`LtT#d#d#t `Lr#gtlj=`LR#OSLR#>R#t `LR#!R#t `L=$Lt8=SLu/R#`L\b&`L=`Lu `L1`Ld#u `Ld#[$`Lt8uSL`Ld#ia&q`L=h`Ltt8uSL`Ld###:`Lt8uSL`LH%R# `Lt 8t1@ `Ld#1`Ld#R# %VWWh`Lh`Lq) #m&V5`L5`Lh`Lh`LH`#^%V5`L5`Lh`Lh`LQ&^%V5`L5`Lh`Lh`L#;tlj=`L #m`L@&}#d#d#tơ`L8t,<$1QQPH PWN<$Wr@$hR#`L⹪%= 3d#ud#ud#`L8t2<$ (TLIQjP̱ PW<$W@$C#S>`L # tÉ`L#d#tƹ"=d`Lud#t‰hd#Ɖ5`L>u kL^_[É$`Lz8{lV t<0 1=X`Lu V^USWV׋t$$\$l$;Et*+u(^%d#t D$ L$M^_[]USWVր9tMτtC1aL U5(TLW4 aL1aLU5(TLV ;aL|ut$SL^_[]Ë `L(TLUSWVL $։ύl$ D$?hR#Wh)?SWU D hVUt $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$|xt$4hVW L^_[]Ë `L(TLV=(Lt =SL=hLuF `L(TL`L8t!`L8t=p`Lu `L1BSL=lLu `L(TLb=Lt `L(TLH`L=Lt!=(TL|1Fj 2F;5(TL|^Ë `L1B^ `L1B `L1B=`Lug=(Lt =SLuN=Lt `L(TL=lLu `L(TL=hLu `L(TL`LÃ=SL"`LË `L1BY `L(TLHt$j5`L 1B)= LtË `L9t(TL =LjË `L(TL `L1BV=L`Lt`L1B5aLt-F=h`L`Lt`L1BV^Ã=h`L`Lt`L1B^_-%aLt `L1B>aLt `L1B'aLt `L1BaLt `L1BaLWVD$ #=$ 3 lj Ƌ `Lj" `Lj `Lj=LttV$ `Lj5aL^_WV|$ 1Ʌ<+u OL$ GW:-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$ 3 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th-%VtrL$PQV t4uRL$xR# $x2P R#T$x R#$x S#w^1JR#^aD$# $ 3  aL9uVD$ T$5$ 3! щ щ! ‰ 19^Ã= 3thR#Ë `L1BSWV@΃= 3ttaLtVsÛtx1Cj S*VGV֙SP_GVhy%P aL=aL!VhR#j@WWZ@^_[ËD$aLWV9 3t#֍|$RQjW1B$5 3^_Ãw&ÉfUSWVPt$ P!уtRPtt jhS#jh#S#l$$\$|$Q t^tY9uE}㽙 u yՃt(ˉ $19u tC ;$u~2KՃujhkS#t jh:S#jhQS#D ^_[]1ۅs IQRP踒fVt$t= 3tjhS#5 3^á 3xy= aLuE aL0@#4@u. aLjhS#?t țLt 3P 35SLUSLV1N=aLt9t/ aL,@wB$@(@1҉,@Ɖ^USWV= 3aL@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhS#1@$qQ5 3Y  9D$}aL럃^_[]USWV-aL1|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5țL(aL@9@S aL1JЅt8=aLu/@u1u0@4@ X'[WVaL1t[@t @4v aL4@0@{!уt RPF1G)t țLt^_USWVaLt>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHaL9t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë aLt$@(@ ,@1HUSWV5aL1H(@$@9t#H1ًP1 u,@;Hs DLL%D$z9tG1؋O1 D$ ~9 $tG#G=HLt @t 3x9 @}lh jJtH @1HGG7FGF8~FNOG Fx ~,@;GsN+HL~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@!ƒ5aL@@ 3tOD 3Q@u;G  )RQ@w u&aL0@4@&OD1@l$1tʼn$yjhS#1=SLu 3x~OUQP 5aL@@o<$t0@D$4@=aLtU=LLu#L$ Qh׼$ LLj2=aLt=Lu q=țL5aL9>tOOHOaL5aLwx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhS# kL1H^_[]USWVaLti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H 3áaL@u1I4@0@Ë9t1JQQ 9u@o aL4@0@1@@(@$@,@PPP@觀!ƒtjhS#81PPjt$}!1WVaL0@4@!΃t@@9} 0@4@^_SV\$t$ 5SL({aLh8@jaL@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV!ƒtaL aL@P5SLvzaL@u@^[SV5aL@  ˀuH9tPQP PJdž @vv Hu5aL@uE u@5aLdž@tVcJ1aLP5SLy^[áaLt@1fWV|$t$ t=aLttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVgtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hd#j `hX#lLhbLhbLhbLhbL\$ -uF :tjhY#]jNbt'.t5bLbt0:wtptcu+bLF&jShbL bLjSQ ,uFbL|bLbLbLbLtbLbLxbLbLlbLbLpbLbLdbLbLhbLhX#J1tPhX#J1F$ 3VhX#WhaLP(hX#dJVhX#Wh aLP ^_[hX#>JPJj3]1B thX#Jƅu&hX#IƅuhX#Iƅt]hP$V#u6hS#Vu$hW#Vuh W#Vt1BS#w1 3TA ruƀ$aLƀ$aLƀ$aL@=u=aLD$$aLSVt$ dbLM1ۅuDtbL;1Cu13(u!=Lu3 1ۅÉ^[D$$aLËL$=r!=aLtP5aLj h$bL荮'$aLu $bL%bLu$bLESC$bLÃw@$aLuQhX#VPt$ u DbLESCuw $aLu;Vt V5 aLB$DbLxPV@,@$aLuPhX#V5aLj hDbL跭DbL^WVD$L$ =aL=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$(&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=aLt'~3P19wKS>~-19s2C,9r9v)CK$SUd}uF8AU9V9o ɋl$u9tSv &}t1|$jjSOF ~.EFE0uE^_[]VjLt";T3t1FVhbLP/ jLp^USWV\$,=aLtVjLtgفuHjLJ jLjL19*QhjL~-jL5jL1E4jLJjLjL1EjL=jLu jL jL1҅; <3t҉օt1PS;H*$<&=jL+"jLШu*%=tS jL1jL]^_[]Ét$jL5jL 3yjLbL)É 3n1|$ l9} SWhbLz uԉnd#tjLbLVW賮=jL=bL5* jL8u!e0jLjLtP6jL%MD$Pyx-jLE˨ -jLEjL jL? ǃjL^_[]jL] vjLejLjL=bLv!x ux ;|jL=bLw%jLjL< t jL8 tjLjL jLjLB5jLajLjL8r jLjL=bLwx u jL=bL\x tQ jL=bL.uD$ L$PjQ课 $T$e^_]Ë jL1; jL|bLájLt @@@ 1141PPUSWV=SL׉΋$$L$ D$1AyōD$PU#D$=xhx@#UyU/W$ShU 0jhY#UH ShU豧 D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(3D$ $X3D$D$ $Uj $Pt$Wփ ShU谦 Sp1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=SLo=83u=h3u =|LP1TAPo@PjVP若Wo|8QZtQL8hP$WEÉ4$pu1ND$PV[x#D$ =uhVyhtY#a0tPƅdո(3Ex uָX3Fx uhY#h$S/ T$Z6VUhY#S:Sln4$VW_W,V,Ā^_[]SWVhY#/P/tt;^_[&hE#Vp1ۅt+h%v%VptV<1AÅt^_[SWV|$\$t$t.9tFtVaF(3tX3u%Y#+Y#Qh$P tWhY#v Y=83t"hY#h$vʘ V(3=h3t%hY#h$v蟘 VX3^_[^_[USWVPӋl$D$ $uSP mSS1tD$ t}t8^_[]StV믉hbLjPN SPuSqWVjL8L$ ƋjL ,TL9}I9ujLxtWD$jL$jLVjL8t,t$<$PD$jL8uڃ^_SWV bLjL$ ,TL+ jL|51ۉ|$8tZO\$,TL+jL$9|Ӏ8t-t$|$D$|$D$$8u$bL)ȣjL5jL^V^_[V5jLbLtRjL)Ɗ 0@u 35jLA=jLbL"jL=bL 1@^À=bLt8jLjL 35jLjL1@ájL8t AUSWVPQj$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhY#O+hY#@+VhY#P@ Åt^_[]jhY#Wz@ t VhY#Pe@ U'uhY#*VhY#P:@ ÅuVhY#W%@ WV9G t'փtPhY#V趔 G?G uG^_ÐkLi ËD$u5Ã<03PhY#USWVD-SLÅE\$9uz$1ۀ|tisljDDs9u>rjjx kLkL$t,tV#hj:} =țLTeuYÃ=țLe4΃ekL~o6/=kLu #=@kL t t =^=kL;@kLCt}.CЃ jS&ed~h(kL kLkL=kLt kL5=kLu!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=kLikLih\%jjS\Fc`$&=SL 4 &t#-l35kL=ES[jUY  xSkLH݃t =L-kL>!(Ƌ 3ķ>tjVUP t j= 3u J[\ 3jry C$& 5kL h[#9TL9SL9 TL=kLSkLC1Ƀ HkLt5,kL,oL0kLL4kLLj)eD$t Pj{@eJr蘬 L$Qh׼$1;kLkL|kLkL)O=tLkLu' kL|5$kL5 kLzMkLjjP1;kLkL|kLkL跷ݫjj蟷ūD$<03D$PhY#=SLjhZ#VR kLkLXL kLkLXLkL1ɉ kL|kLkL1@Pe(ejhZ#e1;kLkL|YkLkL 諶Ѫ=tLu5$kL5 kLLjj- kLkLʃEݣxLc kLkLxL8kL  8kL1; kLkL kL|kLkLq j5<3?kL158kL"58kL1;kL kLkL|kLkL j5<3RCikL1D58kL=tLt5$kL5 kLJ1=W kLikLme5SLV?P/V$kL1ɉ kL|kLkL1@PuGjhZ#kL1ɉ kL|kLkL1@Pk 2V_e!ֹe5\LRPyJ1A诳է kLkL1҉AQPcM,oLNn,oLkL>X`hZ#r1PP?ùe9TLe9SLe9 TLe e S賁+̲1PP5Ln豲צ1PP5LjP#'kLkLؽy蟦=tLt5$kL5 kLGjj5kLd:0ؔkLkL艽*Pjj5kL9; eS贔D$D$PhI[#{豱ӡkL1ɉ kL|kLkL1@P"etbt3tFu j11A; kLkLxZ#|d#L$QhZ#11%kL1ɉ kL|kLkL1@P'"e11A; kLkLxZ#|d#L$QhZ#je5SL<hE#PbQ5SL1=tjh@Z#o5l3kLnvh4 &1SVUh蠻Ag5SLrSPx]xL ,TL݉kL kL,oL9‰}kL5kL)‰,oLkLexL ,TLkL kL,oLkLi1kLkL15\LQPHFjhZ#H3D$Ph1[#d ։u=(kLtkL kL(kLe,5(kL5kLtI~V8Jjh%Z#bUSWVP趮ܢGVD$1Ƀɉlj щ 4oL0oLaL=țLuH9ljD$u21xUUjn6 9-țLu;=0oL4oLD$taL țL2t8teue^_[]USWVPӉơkLukL1 r4$0utV4$#kLkL1ESWPO ákL kL 8kLtu1Fx` sKu j]j%u0SW5kL ákL kL 8kLujh[#t 4$4$^_[]WV= 3u=(Lt =SLu袬׮t SLSL!ʃt]5SLQYkLu = 3uP5L=aLLaLu _BLE5L=aL1jPPB ^_SWV!t LkLt PV!LkL=SLMLkL.hs[#qF<+t< t SLt QV菛SL/7E=SLV蜭hy[#Pt% =SLV^XkL^(N5kLjF5kLjQP軯^5P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=LÃB1ۃ=LÃCɍH9 (TL~Pj#|kkLSWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=LÃB61ۃ=LÃC%|$mu9(TL~HPj#jkL؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P:V0ʼnP:D$X9vpG$11Ʌu2~>9sWt$V~; t't1:%31F9r':$3u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW:V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQt1=LƃtEuG%t|Qh^#hhy>&AVh׼$6 Eu ?=u Qhb^#$ u 覣!ƒtVHQh@^#^Ã=Lt$SLtPP&t5SLËD$t5SLPF$1PUSWVu195SLOSLt_jP%=SLtJtWg%W"=SLu"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =TLuID$xAPZ#t4D$8\$Ph4]#FًT$WVt$j 1@t=SLjWd$5SLt$V$t$5SLg$5SL$hSL5SL#SLt$ t$ ۨL=L111țLD$4PD$,$jUuWP4YWh UR#ڃ,$C^_[]SVt$ hE#V$1Ct'hQ#V$th\#V$1ۅÉ^[WV$ VtVWVs(tWt^_USWV 1=L]=SLPj\hbZ#1Ƌ|$ 11@L|uM@-u)FhE#W#)1%tuQ%t s@AAۃ\$WV!W!؃D$jPtWVt$PHW "S 1tXt^~u1O\$$D$jPW{ uQD$P4D$(0E#^jh^#4|1 ^_[]ÉOV{;t;V{1|$rɅuŋD$(\#1O;PrS USWV=SLt^_[]j荈h*_#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh4_#U{PljD$UV8 W- S\$ ,8jUHrS\$SVUP8G4$ S \W VAz V|V$薪#N@ |^WV|$=TLtaPWU1=TL#D$=W1*jP`qWPThP3LPWx#D$=@{WjPqWPTh@3V+ WoƉ|^_V|$PV x D$XT$\1jPPV|^UWV蒊lj5SL# QP,t1GL$ T$3kL3 kL1@ u,L$3 kL$3kL u!tL$\9|$X}e^_]øg_#Vt$V9vHx/uAΉ^fVn kL1ы5kL1 u^ãkLkL=Lt^6~^P~SWV1ۃ=aLt^_[!ƒtj}!Ѓt111 1Ctj}1Ã=kLtkLUSWV-ĎL~ON}=ĎL~Q111SWuljӉ:}qF;5ĎL|؃=ȎL' =ȎL1=ȎL|=(TL111;5ĎL| V|ljՉ!<$=ȎLFD$1;ĎLá,TLD$ \`LD$,oLD$$,TL1\`L,oLPPSUt$ ljՋD$ ,TLD$\`LD$,oL9pt$j pF1M(TLH91Z{1@^_[]Vh 2F;5ĎLuj{ t j2^USWV\$,=kLtkL&|$$t$ l$(TLt  $9~ t'sujjh(4$jw!уtjt$WRPS#^_[]Åt(TLHPjytm=aLtPay1u11FUvUVRPVjv!уu țLtw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V (TL~&111RP!уtF (TL9| 1 (TL19^fVt$tsVGF95SLu#1=3tu1Ɂ3tщ SLAF=3tH kLv v ^ ^ËD$3tQ13tЅtË 13tËD$3t 13tËD$3tI13tákLUSWV\$S@Nj533tv W6W |$j4j'fSeFSF 1HF$F F1FFF0F,3tFq0@@F=3t@kLVEESkËnU]9Ë\$sUY SKeFWD 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t Po w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=,oLjjPWV^_USWV,T$Dl$@ظBӃ=Lt  |Lt0kL @1)ʉ|ЉjSUQP虊كQP4v=0LtK uu|| t u+| t uțLttțL}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tțLǃ݃ tkwRPW v=dLt( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N ,oL CfN =,oL=dLti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1(Ll$t$1E1!1M,^_[]Ã=|Lt׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy5 3= 3H~y@wr 1N5 3= 3^_[ÐSWVstjh_#c^_[uƉס(TLHPLi11 u^_[8iWV!Ӌ (TLIt*QRP4 (TLHPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhQ`#bKy1V[hVjRPUo=tLjusj'hD$ jhD$T$l$ !Ѓtd9}\(TLH94$SW!уRPvlj9Љ $A(TLH $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$(TL1VVjt$t$PY95tL^_[]1K16-kL-kL(TLH $)QUjSWP(1K[6=Ltf"g15kLSW=g(TLHVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9kLc#>$4,$tt=t|<9kL|wC^w \$D$Shc#jWB($4,$jc#f9kLu+9kL}9kLt9kLhu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEud#d#6$4t$ t t_Gc#d#$40tUP'tu!d#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVFkL^_[]SWV׉Ή5kL5kLhc#hS$=w )WVRQ{$kLS^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl"3 t^kLkLkLJtGtO GO kLkLl"3 tkLukL^_[]ÍZ w6$\'tEGЃTZ$'btPeu>fkL랄tGOm>C#w>l&h>@&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]kLkLd   >kL kL kLkLkLRhc#jhkL4"c#kL_t>d#vVh6d#mLP+t mLŠ"hGd#蹻nLPt nLXd#jVLnLjVLnL5kLhnLhnL1nLPҎ $unL^1|$ánLnLS nL1nLnL nLnL nLnL@nL; nL|1ۉnLnLnLnLnLnLnLnLnLnLnLnLoL1HnLnLhnL#hnLnLP $unL[USWV\$0l$,1=DLuSUƉס|L LSU\*@u6 3 3!ʃt'9݋T$0| 3@9- 3T$0| oL=|LtU toLnLZnLnL,nLL nL9}QnLƁnL ,nLك=DLWV^! tt$j VRP)NV1 L)~$nLr5nLƂnL ,nLIu܅~+1ɊT 5nL~=nLnL,nLA9uסnLH nLƀnL ,nLnLnL^_[]Ë |Lt L=DLt1L@V5 nLnL9}9 nL<u"nL0PhnL nLnLF9|Ӌ5 nL5nLnLnL^SWVt$\$u$D$0j?oP/=aLt&v!Ss1҅ SVqt1҃Pn1҅t$StnL~- nLVt[unL nLLV3Zt nLt> nLVtV[t'i=aLtVs1҅ƒK1JFVY# `L#`L#5`L#t`L‰^_[QY# `L#|`Lʉ# `L#x`LánLoLnLoLáoLnLoLnLËL$1wQ5mL,1SVt$ 1ۃw)V5mLuV5nL1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJqd#9u!B1@uDA;1A+u%uVt1@^ÃwV5mLu߸ع#L$1uj jE1ɉHH韱 SWV=nL u|$t$\$t-1 |15oL5oLtm1@Z ugLt LuU=nL~+oL oL\@ oLnLnL5oL=oL1nL=aL nL%=ua oLP oL$oL19Rh$oLbmh$oLm$oL5oL5oLoL oLH oLnLu" oL$oLx,1WV=aLt oL1At^_[ÉШu-%=tS0lnL=oL5oL뢋oL oL oLnLUSWVӋl$,|$(nL=PL8oLuBu>%j jzC1҉PP8oLnLnLnLtwQPl'UWS 8oLxtnLPhnL蔅18oLnLu+LtLA\$l$͉=aL1؋5nLnLnLRk5nLUWS% 658oL 8oLnLPV軄nL@nLVP诅V荄 nLAVUUUЍ@@nLnL ,oL9}ohnL藅ơnL ,oLY$gQVlu&nLnLPjVPmnL$#5nLnL9|nLl$ EVjUek L$ )v %uhnL蚃58oL躬 8oL nL; nL 5nL|tq=nL0jf jnL9u"_l$\$u4Шx$_l$\$u$5nL _ ‰$ u*Lt =LuKuG ڃ^_[]aLm_uiud1UWjnL+nL t"3kL91J$;kL} qɉы4lL)t _nL\$ PjSi 1EL$nL) nLPjS`i ǡnL nLtW4V)nL~ZnLt\ [5x"3)Й)֋$F UWh\% N1nLE1-nL$_PdtUW ]aLt6=PLt-QdtQd UWl $UWS t1@1^_[]SWV= oL~4։1$oLPd VW u C; oL|1 oL)^_[Ã=nL~oL oLnL1WV=nL~oL oLmnL|$t$ =nLuu 15oL5oLitb=LtYnL,TL9nL|nLnLnLnLA,TL nLH9nL}L j LLjf=LnLtLoLtBx nL ,TL9}; j,nLP nL ,TL9}oLы nL ,TL9|L=\`LtC``L„u0=PLt't4|$t- 1j1j 1j5nL95kL unL0nL^_V=PLuajm5mLtMȺj9R#Fu=nLu"Ⱥj~d#Fu^SWV։ˋ=nLGnL9=kL unL8nL4D$ nL; nL~~ nLnLnL nL^_[SWV nL nL9}1T$5nLׁtu Ӊ nL@9|^_[ËD$L$ nL,nLVD$ L$=nLu=pLttNI1҉ tK1GnL9~,nLnL+5 nL)΋ nL nL0 ~^nLnLUSWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8țLu/kLH9| Qu@nL8GO1H^_[]cS nL9t nLMtۉ>?SUSWV-kL\-jS- jS DžtVtRU5nLV nLUPW U认 5nL蠤 5nL=nLkL1t W} 1Gt Vm ^_[]USWVL$D$ʃQPO1H…t$=kLnLD8OlV tnțLuc~nL>-kLu@nL (I=kL9rHŠIJnL9s=kL)\8OVà uQL$ t nLt=kL91H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15,oL1K,oL|EtESSP t,oL@ԋ=nL9=kL uS1Hte1ɺ|"3:tWAuN1|"31I:t?@u21|"31I:t%@u1|"31I:t @u^ËL$H1Ʌx "3USWV։Q`@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=PLu1@$5nL+5nL~1; ,TL^USWV։L$|$0\$,ЃtnL!t6tC؃T$RjQPWSQ=L=nL1ۀ=nLtw4$nL nLىȺVUUUЍ@)InL~4,IŠnL1E 8Vt$0j* G;}|Cu4$SG oLtf 4oL0oL!Ƴttt$,9} 50oL=4oLnL1ۃtQnL nLT$ 1ۅ~&L$ PjQ\ nL~nL\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1EnL;,oLuXnL#nLuD$,nL=nL=nL~01nL 8jG;=nL|hnLtnL;nL~<$~nL nL nL$nL~1 ;j_G9unL1;,oLuD$PhnLtnL nL9~~51ɋnL4*1 nL444A; nL|١nL) $ nLnL nL; ,oL~(L jnLHnL;,oL؉^_[]WV|$t$ =PLu1WVP PV WVt1@1^_ÐDoLH ȁLr1LDLDoLHL$LLL PL LLTLXL\L`LhLdLUSWVL$0D$,l$$LL$LLLLt-9Br }$r1z3|$( HLLu$$rDLt :=DLHLHL<$:rBJ jl$(jWLLtC:LLt9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?LLt_ )ϋ,$]}LLtLLtV+BJ NF=HLuW-LLMEu$9ˉ|-HL],$ϋ=LLt sKӋ$JHJ^_[]USWV1=DLtD|$(T$$!t3|0LLLL=LLt'9PH }=LLu11CŋE1ЋM 1 u ]u,tLpLxLEP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}țL!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[țLu`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStxL 11؉^_[]Ã=xLxÃ=DLu kL1DLPh~d#4VxLxNH xLd|@xL* tL5pL9|jhd#z5xL^USWV|$ l$1ɃLLLLtKC9LLdL1 hL1 5PLv vB1IʅI~nVv 4$9ʼn1I1PPt$R9țL ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RțLuF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=(TL~%GW8É!Ѓu O;=(TL|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh`#2@oL1111ۉu WVSU1PPWV+țLu Ɖ!Ѓu@oL^_[]WVT$D$ =̎Lt 5ĎL1)|щƉ^_fUSWV t$ >-uF(s7h4 &+V+htkV聪tmSʼnD$$U $ȃ$jP'袷t$PSh%t$Ut$q  Sa'Ņu>tVh"F'U_U7 jpNWQW^N1FVJ]V'D$$t*P*hd#y*/j ))3kLt$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhd#.1N\$hP$S)4h4 &Q)SH)hSL \L|L1LL LLt P LFu,~1S薺PW豺Fv ^F~ ^v;SLt PNu VSWh ^_[ËL$t@;SLtjhd#x)1HËA QUSWVD$T$1ɾL=SL9~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9Lu LLuUSWV\$SκƋLt@PPVuLL踋 DžLW襋 u^_[]USWV=L|$,t$0h$W l$LL!ʃtWj UQP"LuL hE#VtLVULPh e#W/u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=(TL9Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P  $FQF^_[]V=SLtjh=e#&dt$D$tt/uKVSL;m?u7= 3xCjhse#뵃= 3x%SLQhe#l&^jh_e#jhe#{VơSLt PJ VޣPSLV( 5SL蛙 ^3SLVD$$L$ t tC8.@L$$Vhu&Q #3>jhe##3xxPhe#j VVz||P|0tB D$0Phe#;D$$Vhu&P >t.jhe#1\LL$Qhe#$^ã\L#3V#3x$ (TL1Vh@BVPRQ_\L^VD$$L$ t tC8.@L$$Vh#Q #3>jh!f##3xxPhe#j VVA||P|0tB D$0Phkf#;D$$Vh#P >t.jh9f#1xLL$QhOf##^ãxL#3V#3x$ ,TL1Vh@BVPRQ&xL^V|$u%t$jVt0Phf#N#^V|$u%t$jV؇t0Phf##^SWVD$L$tPLp=SLtjhf#"VP>PR Zt V踘)X!ЃtV谕5\LSW? ^_[VD$L$tt\uoPe003_Pơ003t=(03t P? VӟP003V 003Qhf#!^V|$uJt$ =LtVSL-Lhb%_V_h@^^WVD$t t0t$hLl7=tDMtGhuXF 03PLhLQh׼$5!Emtwt su!FF03FpLFlLF$037 V^_D$u5LL6Ã|$"7VD$Hs^\jhf#7<03V)h$&Phg#hg#VM;03xu'hCg#h}g#hg#hg#hh#hGh#h|h#j^^WVD$t$ʃc"y$'m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=Lutjhh#$FVPMy0Phh#^_ÉPhh#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;kL~kLA9s } uE9u9t},u E&| t"3kL+kLx"3 ^_[]WVD$Pt t*$TVmPVLD$ps D$ stopD$Tab =t"3|i1Gt$rV%fD,V4kLhf#P G;=t"3|VD andD theDen t$V5x"3hi#P 0Ph׼$D^_à D$t t+uyL$tJQtQytWjh/i#Mà$3L$%3AAD$PhSi#!%1%3$3$3%3 $3%3 V D$t t]D$t$jho$QVP46hE#Vrt5>t L $L8LtP9LE#L$Qh]i#O ^ËD$Hsjhui#/Åu SLÃ|$u=LD$u =L~GTLÃD$ u)=L| Phi#LÃD$ u)=L| Phi#LD$u"=Lt=SLt*!ƒÃD$ t t%uCD$ #3^u2@t+$#3"#3P7Qhi#V D$,L$(t tC1ɉ ĎL ȎL8,uT@L$,t$Vh3$Ql >tejhj#Ot$5ȎL5ĎLh2$jV0Ph.j##t$D$,Vh3$P >tjhi#9 ^ãȎLĎLD$,8,cSVD$$tkD$(M@1ڃQ~#s wX$d'd~&s wR$'s wU$<'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G؎L1 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qhfj#1QZS؎L^[ÍD$PhKj#҃=`L=ȎL=ĎLË XL1 (TL+ĎLt$4Phk#hL$ LUSWVl$,H ԍLt&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Phk#hL LFVEŅ8D$EH$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=LnAL$,9 ItIT$uWoD$,7Lj+o2Phk#LV T$jV%D$,|$?+SLt Pw GP SLCE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WDw |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh؍LP ԍLIԍL^_[]É|$|$ u D$Phj# D$Phj#͉-ԍLōD$8Phyj#uA0hk#j*h؍LËI1Phk#j*h؍L~USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Phl#=j UQ xt-u)%tt0Phk#1H^_[]SWV9toӉQ臷@jP ljtG\$=Lt <\u ~t F <$t)\tPS{t GFFuD$Qhk#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$؍LPhk#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hR~#3rtPa$~031@USWV\$(|$$1E=LuhL;?L؛L9<$l$D$l$ =LLt=@oLt=Lu03=4LubPjD$P( D$tD #39PaHD$=aLt=܎Ltft$,SW( L=aLu"t1L@L| j=y!蒿8脿8#1Hpt9=؛Lt4L[1LD$ D$D$$PD$Pj& 9=؛Lt țLt, țLL^_[]øjhLUVV WVe^]USWV\$达0ˆ S̮V,jUVShE#UP^_[]Vt$V蘆 uVhb~#h5Lq 5L^USWV D$0щL$l$ |$$t$4PWU@ZƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVYՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SVY׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP YÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWXi)$l$D$ ׋ $D$ՋD$1PPU\$S-Xыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP$e^]fSWVPțLt kLZ1PLWP(t>1C4$$PLu V WSCu ^_[S=XLtXL \$03=SLr 03H 03TL[V503TLt(TL03VP503p! 9t kL^Vt$503^Ã=XLtXLr Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVيl~#O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRVtيl~#O u݃|$0xG-Wt$8; ^_[]SWV|$(L$$\$ 1Ѝt$Fl~#NuxF-VQ^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P葥 ƃ^_[]WV t$RVQ t|$P3GuV5^_9Hw @sÃtP=USWVPt$|$\LV<$=LuԇTh=t`L d#Vt$ P]Eu x`L48JMp;5,TL| kL^_[]VWj .^_[]ËL$T$d#PPh}~# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuXL^_[]WVt$|$ zt!#3Ph~#Ph~#d#PPh}~# ^_WV|$t$ t%WVra7ft=,TL kL j Qu jF^_fUSWV\$l$=@Lu<؉%t1U蔢1GWP?[PW1WPPUVd[1 jj1=SL1Ƀ=LHPVW| Åt!W*` |$t8jh~#'D$ tP蒏D$ 0_ D$ 89t V_ ^_[]Vt$tPR6_ ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ蕠 ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u 蝠D$E ʀ[} @L@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øn&fL$tt"u$ (TL(TLHI (TLI`LʋTUSWVD$T$ (TL5`L|1Gll\G9uTD^_[]SWVD$L$5(TL`L|F|\\|N B^_[á(TL~Ph5`L譪 USWV (TL; dL`Lth!t 1G31K;)1G1I4:tl!GtˉP+\  (TLjQJƣ`L(TLdL~PhV !t\l^_[]USWVPL$\$As (TL11H$(u(TL1@$1`L<#|tZ`L4ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$`L1H; t$z|#=(TL|O1;Ll |C9u^_[]USWV (TL~.`L11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5`LA1G1֋l9߻rB9u^_[]ËT$(TL!х1A9Hh '*hL=Lx't='P lLh'pLhT'03h' 03h'$03USWV \$4tLtL|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$'=DLEQ-s4C$ىË $Fw$'#Fw}$\'X!уj WRPBBtDt L=DL!15SLhE#P1sTu~-l$PuYQA tLу|=RP螽1 $1=tLtL7f1=,oLu ÊCCs|,v, l,uȡSL!ƒtظ:,u5SL资j W5,oLQTу (TL5ĎLn9|$ V5SL5SL蛅PtmƉVV +1+5Q ic+Ɖ!уRPUVtL=tLH8 tLH=tLwA5SLkP豄 !уRPaٹ ĎL (TLVQRPJg SL5SL,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15SLMj WP j W1P9<"@|tLd#9 tLt tLd# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5\LQ^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^503~V5L1=Ltȉt 03hL0ASL^5$03'SWVQȔNjtLعtL9r ЍtLWVSpp ;tL;^_[VQ!уu$x (TLH9}FV!уtt^^Ð1xL|LLLWV|$ =kLt5LtZ=`Lta=(TL|<1W!уtRP虆Ws@G(TLH9|vuL覍5L^_USWV 3 3D$L$!ȃ 3D$ 3D$ 1H 3 3 3 3=`L=kLt4$=(TL|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$(TLH9|u $u^_[]Ã^_[]鍌^_[]TxLK|$thLm=Lt1=LLj jh~#"V΋At P#P FVC^hLSWVt$>t_w O WO ߅u1F FF1HLLLL^_[hLSWVQ1u(\$|$LSt ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-LVt;xH|p$x Hȅu^_SWV|$t$u;LWt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=|LuH 35 3!ȃt3 39 3|$|$ !@tp\$9ϋ\$(|$}^LU1tHt$ !t Q9y}1I(t(t$=LtT$$1=Luȅt^_[]hLL=LtUWVjW7!t"j]jRPWV je^_]Ã=Lu @LLxLd LVj5<3t2xLjVx 1F=Lu=Lu@11N^USWV(U ]1Nt$ t$tr:tm1xLPSi( L1 |Lt)1V5LhL L|Lttxq @3L Lt =|Ltj)Lu=LtL9LJ\$tP1ػ&!Ѓ1ojh~#D$Pj@t$>SD$$PL$Qt$Tt$V>ěL$u:L L!ƒt&9L$L$|D$;LD$Lt$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dLT$X/ t$%C t$ C \$(T$_CtN4$jjD$xP$Pt$4t$5|L5xL2$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$jB VaB T$1H#E t0E t L$PL$THD$$e^_[]Ã=Lu?hLL$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ ,oLL$,oLL$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$,oL}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8,oLkLt$O@ t$ C@ }tEL$L$H1USWV8=LL5LLD$$8u=ěLu\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}L LȉT$!Ѓtsu!9t$ƄuYL5L;t$T$$|@Ut$ 9D$ЉʋD$4$kL@EhLhL}!kL @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># LL$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=LL!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$L L!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ LD$LD$$LD$ Le^_[]1JЋ4$|$9ωL$}@D$ kL I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=ěL USWVt$hLtH>tC\$1EjU1GGGUSxLěLG=ěL-5ěLt~'VT; uěLkL^_[]W,; USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5LjjSt$DPV5|L5xLs$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@tLPhDL貝USWV T$(\$$t$ 1`03PURSa])ˉ<à uVh׼$t$|$u u)u%u!1ɃtsQl03Phb#džt DhO#荸^_[]SWV \$ hSh## uPth#H ^_[fxEhSh.#o# 4$t t$j Vh<#뙿 hFF Wfj523t$S jWHj|$W諜[9uR1Vt$;4$PjSh#`V|WV|$ 533j/VMt@jWhg_#QV訄^_1@pLPjiÊD$3J 3;3~{у ts |3Q|3jPh|Lh#" th|Lhx@#P҇t:j523P? f=43u5LEh|3Q6h|Lh#rUSWVt$81GWh~"5L 1-pLhnH ShD$hTLSD$U< WhL5Lu tLtFPFuf=43LtjQP: Poj5t$4l$0jD$T$1D$EHM~EHMU[ڃÃ=pLuf=|43u0Iڃ% tM 1f=|43@ ЈD$P D$ƒ t|f=|43Qq f=|43uf=33tT$j \$Ct,j Cu\$T$f=|43x댉\$ 넻 $f=33tD$ @D$ Phe#Gڃf=43xL5l43jW5L| xL pL u61=ܣL#$ |339uj5$t h#薳jڀ tf=|43u j ttFPFujÉUlXt$jef=33t'+\$|$f=|43i#t#WSP jhL5L8 h(Ljjw9(^_[]USWVP\$D$jP5L f=431=xL5l43jD$P5L  Wp9=xLttػ1FU Ph#dKtMVhL5L- =xL5l43VD$P5L W9=xLu^_[]WVjPh̤Lh#% t ^_hLh̤LHrh$#蜱ы Lu LQ[hx@#P蝂tAf=43 LȀ#t#PQhW}Wh#V \Wh#:LhN jcxLUSWV$3J 3;3у  |3Q|3t$hVh# 1GWh~"5L WSbWjbhTLSj6 WhL5L \x>jƉ׉U ~*9u$h|3QƒEh<#11f=33tjX)RPh# jhL5L 1h(LVW*6 WVbWjb^_[]j5L W\ 1SjaSWaVVh#>}SetUSWV$3J 3;3у  |3Q|3t$hVh# 1GWh~"5L WSaWjahTLSj5 WhL5L |x>jƉ׉U*~*9u$h|3QEh<#11f=33tjx)RPh# jhL5L 1h(LVWJ4 WV0`Wj%`^_[]1W5L)j5LSk Wj_WS_VVh#O{WvrUSWVPhI#1GWj_Wj_9!tDƅtZWޑ9uhO#Ȭ1VjK_Vj@_ ^_[]hԦ3Wjh$V.h&#Z1Sj_SV_-33j/UCt@SQUy hԦ3WVh$-h#WWVPjh[$5Lg f=33t%533>t=LVsQPVW8 1FVht$=LV^PPVW# jij{VhVhk# V23t$23jho$5L 33u33$33%33t$33t$33f=33t543t$$543f=<43d#tێ"Pn43t$4343xL43t$43j43t$$43f=43d#tێ"P^WV,|$8V5LX;hێ"WPt! $#(L $ (L(L1GVW5L/ h(LWj/8^_WV,t$8W5L:hێ"V/P1Ʌ#G OWj5Lg/8^_V1Vh{t 5L]@ jCVhzt 5L?@ ^S\$1ujP|[ESWV|$\$1FtCWPt1^_[fUSWVl$$14L LL%PhP13h#t$4U1I~1L$$D$=xL8O>HЃ sX 4HЉ5LjhP13h#t$4UG߃ufH1K$'7U4L뷃EF7Ujh"SM jh"SM h&#SCND$QPuV7Uh%SNh#SMzh&#SM$_=|L7UL1@D$<$XD$xL= L7Uj/S& Lk<$$YxD$ P1PhPjPP57U8 LL$ !P57Uh1#Q~LPLL=7UWJ*Sh%h L 1@1H1HD$1@$D$~1HD$$$3)t5|$L$(4hi%V#Lt5LLPLLg Vj/5 LjV  L4L5HLLPL=Lu L%LLY1ɉ PL Lt=4Lu4Lt =Llj:hl$t$y 1Ʌ xL=Lu64Lt=PLtP5 LF1L5HLj:h]a&t$ t 33j:h&t$ t 43j:hL#t$ t 23j:h#t$ t 23j:h%t$ t 33j:hC#t$o t 33j:h#t$N t 33j:hXc#t$- t 33j:h%t$ t <43j:hv%t$ t <43j:h/"t$ t |43j:hl$t$ t 43j:h!#t$ tLj:hH#t$j t 43=dLu dL23=XLu XL23TLtPh",\LtPh"hLtPhƅ&`LtPh%hlLhn#t$c u lLhpLh##t$> u pLhtLh>#t$ u tL 5 L5ĠLȠLt%j,VtA1ɉ5 L ĠL^_Vh=# VhU#h#jttu$Vh؇#wh #h#wj'afSWV t$ |$6ψ7̠L#РLԠL bؠLOht#PBܠLVW8=L1hLS+- (LL%4L%(L%,LfHL TL(LfFL@Lh(LjS! hLhLhLhN ju+t$`Lt P+ Vƣ`L43h&#V>tsܣLh#V>tah#V>tShX%Vy>teh%Vg>t1Ԧ3Vh_#Wg W&ܣL$11ɺ230 ߈`LBu^_[ñ1WV,|$8V5L(WVWV\#NF=Lt L$f=43t D$#$d$d$ wfD$ f=<43t $Vj5L8^_h(Ljj SVPf=33tj蘧t$R 330utztD$=ܠL„u330u1f=3333몈D$< t< u>jV5Lz f=43t|$ C#td#PT`u 2 <33tu 33tt A8u1f=33t 3DAt 3DAD$jV5L f=43D$Pb/hLjjO USWVt$D$ $1=Lh l jGD$1CSjGhLSW Vh׼$tbhLxtWD$ h(Ljj t$jFUjF=LuD$ 1;$ȃ^_[]Ët$$4$(3H (3~$3H $3h$33:eȋL$ < U;t$ KD$ V1FVj F5LhC#fVhLwSWVP33\$ x03t%ԠL039u Gt+t' u9tpD$jP5L Yـƀ_rأL^?t@آ٣LڣL أL٣LhأLh׼$`PW1^_[P(3H (3~$3H $3$$38t1Ƀ=ܣL!YXD$_rأL^?<t@ ٣LڣL أL٣LأLSWVT$L$D$=ܣLut1<1L1F9uRQP yG8th% ^_[hQ#USL$ \$1B1t 9tA8u[VL$آLtSA .#8t6u(^@\VPtأL)ƃuf^?݈@آL^VD$Ph9#_=x03x03ԠLFt33_rأL^?<t@ ٣LڣL أL٣LhأLh>#^_rأL^?<t@ ٣LڣL أL٣LF t*vPhأLhB#L^ԠL~ v 7^ÐWV1FLVW5LM VW5L} ^_USWVt$jV5L[  uD$41؍oD<jV5L2 D$< t r֍,f=33tdLt P4 u33D$y1D$h%Ps`dLtD$y33D$nD$jP5L_^_[]1f=2323USWV1GWjlAWjaAr VWRAVjGALfCLCfC 1l$jjS7 ~}D$tvjhL5L ~]LBt8StGWuG1GWLU5L腪 WUl$5L豫 1f=2323D$hU5Lw j_Ɖ,<=ܣL  A9rWD$Pj f=33dLtyf=23~g|$_r5,33Pt. dLYSQ;Y~ڃ tZG9r QR`l$!y-^B8u!PWjl$UV^Eh@^jf=33tdLt P1jQfSWV23t323^tP'tF tFFu҉5 43hʼn#hWXhx@#Wa]tRVhWg t4=LtWhω#!Zj W"tWV 1%%33^_[USWV|$h7%W2j Wj=WT t@C@uSh X%W2u S6ÉXj?W t0tO@t8JS?!tOYt@t UtWh#X~5=23t,23Ft = @t t~vuك=|L~hC#~|L^_[]SWV΋|LC!w\C|L؋ 3Q3; 3h|3j ]|L |3Q|3 X|L#|>Wu/أ|LNI$'Who#W|L@|LN Q1f~ @|L3H 3t;3lh|3j!=]l|Lv Wh#rW `Who#bW|L@|LN tEPP.|LV|3H |3!6h׼$W|L#||LhC#ψ^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n؉#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh X%S/uW 1@W蘠ljR1^_[SWV231t8ϻ23WP.t!CtWP.t Cuމ^_[USWV׉A tS^؃H$'n tWU`.tjPu U W%F tQfB t \th#ކ*N 1?!9~ t~ N 9tF N^_[]h#fSWV,1f=33t h#T|$ufjOhL+tjKhLu@Uhxt 5L Uhyt 5L OEh#8R11@^_[]USWV D$h} jy6D$L|$hL hus523jW5L: jl$ÈD$V)t1:ul$B9u|$tjj5D$t$j51 ^_[]VP1Vhxt 5L j輔Vhyt 5L j5L(j联j5Ljh#5L  #<0t<3th#Ph#P1FV$Phf@5L jh#5L詞 Vj5Lpjhxt 5L 5L^jhC#5LV h-#PLjhL^ffUSWV $ unh\jhLO3 1HLtLhG#Et F# LO#he#$t L$ h}#US ƃw$' L׃B/7U8jL$QPU $9bLL L냀 Lw7U% L` LT LH-7Uh/#U||ſ#D'h3#UVWU蕱 u<7t;utC LKD5tX<=Eh%Uƃt=tUn%UD$0@<=uEjD$PUT L$9` t ,QIKLh/#V{,<0$ $ 7U#57UWh)#W+t%thz#W|$ DL$ $ 4hW uW$ 4hE#9ō$UhP tʼn-L=LLhPU Lu%t#P5Lh#hLP u5Lhэ#LuG=LtyL LAu$ th#=@u5tL觗tL$ thώ#hw#h2"h00USWVt[ׅtf΋D't#H'tVPt%]uWVh4#sS j=L^_[]h#h #hh##h #hh6#&+PPPhĒ#hԦ3HLt@t hLЃj=D$t@0h#R1hq#hf#hh6#t&D$t@0h#R1hq#h#hh6#>&D$t@0h#gR1hq#h#hh6#&USWVhޑ#:R1l&,4'Qho%hԦ3G<'t*tu6hԦ3jjh#hԦ3jjh#hԦ3jjh#T#t#FKrhԦ3j T^_[]USWV39u1Ht$Vhht@P  V$PPftхu! $hQ#-QD'tc D$l&H'0tBVcؽ ;$ݸ#D$VPho%hԦ3vFD$#uhԦ3h5sh#.5s hО#5s$h#5s(h#4sHh-#4s,hT#4s0hr#4s4h#4s8h#4sXf|$rL$I#fw 'L$T$ t$"VRQPh#2h#h#jD$f=73173hjD$$P fD$|$<73fD$ $T$73h׼$12H$'L$f|$#t#P1D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPh#s1~|$uj!(jPPc jt$t$ V VhiWF u h#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSW jl$UW6 wh#/h|3Wh:it$Vf uO j..h|3j+sWh:iV! u Cw8)|$â##P9a$rkLPD$$PQ $<1|$Vh#/t$kL4t4'h`#.hw#.48~1D=P-G9uh#`4 D$4!4"4#4$4%PSWRQt$h#i.4(h#U.444,40k<SWPRQPhϡ##.4`h2#.hW#.4\t hf#-t hk#-h#_4d6|$1A t$t&u/7t$t nu Qhp#z-FL9Mt$ $t$qV~P$t$RV}hL#Ph#hԦ3/ j5$USWV։1hUSg jWS  sUPPH t'Sh9iPB tVT}Ĕ^_[]h7&h؝#jUSWV׉1hVU jSU }VPPɷ tAUh:iP uGPh#\1FS|Đ^_[]h7&j脭VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph#+^WVh#|+f>r1D~Phk&a+GH9|j]n*^_WVh#:+f>r91D>Ph(#+ 9} j:(*G9|h#*^_WV$fGjRW WhiVH t Đ^_h#j+fUSWVu }6lIhd#j hӢ#VW謳 Hw$'dLhLԃBu|1PP57UH `L불lLpLtLxLdL|L너lLLsjh|3O_lLS3=$3=xLu.1L$A AAAQj jy =hLpLdL|LLlL231O=tL^$3tchE#Vt^=tLukjjVx ƅD$ PVbD$(!=<\$yB  23u1PPVx Ɖx\$L3=tL5`LPL$Qw ƅ~E1LVPS2v i)u5`L5Lt$Lw ƿy5Lh׼$L231O=\$t$9ȉQ4xL$5`Lu ύD$ PS5`Lr*V( LVh2#!4L`LLLLVw3h׼$L3Vhw3h#3ˋ$B65`L9J Phߢ#hԦ3 ) 1@L^$;$3t=hE#W_t1#=tLux@#PW.);? \$$3\$=L 1$ӋFHN~ HV&ƒ =|Lu u u1G1=dLup=hLu< u7 =pL>hd#h#h|3' 3@t>$@$Ph#h|3'ڃ 3@ t_  =pL3H 3;3h|3j$u*  =Lx3H 3;3h|3j^*:=lL,3H 3;3h|3jM)ڃ|3H |3$|3H |3^3H 3!;3h|3jIe) |3H |3I |3H |3M3H 3%;3h|3j-)ڃu!|3H |3-3DPuW3H 3;3~ƒ t|3H |3h|3R(ڃ3H 3";3h|3j^V(ڃuv|3H |3^?tЃ@Ӌ 3Q3; 3~ ȃ t |3Q|3Vh|3P'=F @t5Lh׼$NLf 3@ui$3\$t V($3%03Wh׼$L1;`h|3uLe^_[]h"jh^$fUSWV$$0I@hd#jv 11E1D$D$D$D$$׉jh 83hK#$V蜞Q~Hw@$P'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j7U$ىY1ɉPXuG $3$T:-u"j9uzuI $3 u $3)t u <$u|$uM1ۋD$Ã<$D$ !tD$ $4u9>W@uTWh#D$u5t뢍D$PWu!Wh#Mh\#j۠$1 |$ $jSVd u hR&Pm1uv8VW1CHHf wy$'|$uhUmÅu뼋ss @ PVhE#+ |$u.jSUy ss PVhE#+ 1F $tCPpQ;>|$t KP;AmPsT$Z|$Osh׼$芝1F7hR&jßPPh#hԦ3 jCfUSWV$$6<1hd#U -L-L-L-L1Ch*#VW e'H wu$'L-L-LŃo'filL뙃prvLoaLLL%L-L-L7L-L-LL LLLLLLLu $3)ǃ=LLu-tX1Ƀ=L=LtL$H=L=L=L=LtʉT$4Lj蓯īLP腯t$lVUhH839 9rUh#\hH83H83 @83QT$/u>t$|9A@83A @83I83vy/th7#hl#j臜t$ D83Dh jy=Lu$PhH83;}$PhH83}u@ 8uT\=Lu=Lt@L Lt3D$ P6|1#$=@txUhH83D$ P6.}u6h׼$j؛#D$=@uL L1ۉ  t1ۀ|$/uhH83h¤#.t9UVr|/u (IHr IH9/touɉt$PȫLUSWVT$juQ^ P%hD$1t$CHfw?$'ss PVt$ hE#&& Pshؤ#&>|$(5D83C,H83)=|5TShH83h#% t$V{g1Ga{DuO|$u C(D$?Cj/D$ P!t L$)@L$D$hQ#QT$CS(L$)ʀ</t ~/t/FD$щT$H83)rPhH83h#t$PV̗ L$@83@83=I83vx/u H@83=LtD$PhH83zD$PhH83zT$KP3Qt$31 u@T$(3Qt$$3q u.shH83h8#o$ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH83h^#$ 1Gt$#KPqt$1BD$ $('=LL$ QP T$ L LsHtbffM ̻LQ̻LT$ ̫Lt$/D$ !=@8fush##jSt$ V$q 1G)=LtRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=Lt$tjQ\̻LH ̻L<ȫLtICPphH83]i4sh#"D$ PhH83w1u=LthH83shZ" VzcÅc1G18uFVbe^_[]h#h#h6h*#h##h?hޥ#-7h׼$hR&jhH83fWVt$$D$(H0JH(x,z H4x8J z@/uD$PVh#X$hSW W;t?$ VPhԓ%hWD$PWh#t VQhD$PWhÅMWV/PVrt@\$L$/PWRt@L$ Q\$Su)D$ )=|\$=ػMu=ܻMh|3OWhԧ#hԦ3 (3H (3~$3H $3h$3jÉ؃t9 t4(3H (3~$3H $3h$3*ƒ߃Y=лMu#D$=@uW W%u8=Mu WV VԻM PWQVQVtW#1ۀ=M$MVPWh#*hԦ3jj h#请9D$t$QVP莾 Ƅ fDŽ$.$$PQf\$4$9|$ t#t$WP;$ D$Ƅ fDŽ$.$PQe$3$$3$ $3$$3$  WVh#  fD$L$TTPQ ËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP*^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPG^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87hd#j߫ jt7D$Phht@j! uD$tL<3MMM諒u Mt$41۽h#WV膈 HσG$t'M1M1M,M0MM1MM MM M낃w@MDM^LMOTM@$M1M"dMhM@1M,M0MMM4M$M(M M=Mt M M@MDM1V8MG 3J 3;3~у t |3Q|3Guh|3Q=dMtXD>3J 3;3~!у t |3Q|3Gu7h|3QLL$D$ ρÃxMT$9|M}`;L$}XD>3J 3;3~!у t |3Q|3Guh|3Q衄3H 3;3h|3j |3H |3 1D>3J 3;3~!у t |3Q|3Guh|3Q%衄3H 3;3h|3j |3H |3 e^_[]SWV΃=TMt vrhb%c1TVO^_[SWV΃=TMt vhb%1TV^_[Ã=TMtATPqhԓ% ÃTQh׼$|Í` f w5$'3H 3;3h|3j@I/3H 3;3h|3j*3H 3;3h|3j=k3H 3;3h|3j%D3H 3w;3oh|3j|!3H 3g;3_h|3j/1@á|3H |3@|3H |3=֡|3H |3%á|3H |3|밡|3H |3/1á|3H |3*USWVl$(}=8MtE G=`Mt=@Mt(DG M1 XMÍ4^69L<3} ^_[]{E ;\<3~*P5M+u tM \<3MM4FMt%$Q  Qt $ B$Iu$ L<3șƉșD$$t$D$ D$|$1ۋt$=@Mt( M U tt$ ;4$}Z;D$}El$)š3H 3;3h|3j |3H |3 MuC;\$r3H 3~|3H |3 h|3j D$@D$;D$ ^_[]jcLUSWVt$~=8MtF G=`Mt=@Mt(G M1 XMÍ,C L<3-9} ^_[][Gșljș|$$.1E  E;|$|63H 3~|3H |3 h|3j 1V =@Mt(41;$}D$)á3H 3;3h|3j ?|3H |3 KuGm=3H 3~|3H |3 h|3j ^_[]USWV|$=8Mt_ C1ۃ=`Mt=@Mt(C= M71F  F3H 3;3h|3j,P|3H |3, +N,3P3; L<3} 0;3(h|3j ;~&|3H |3 "|3H |3 h|3j 1W =@Mt(4_ŋv3H 3~|3H |3 h|3j _^_[]fSWV|$0MWt pSPZe t81PWV Vh׼$CVu ^_[h#Wh#j}aUSWV$Uf4(F$$1 |$1 9$)덄$PSUD$P蠇 tXǃt-tat$ ?tL$T$d$.?T$O$E1 $ ;3r9vL$?T$$$^_[]SWV ΉRQS7 1t4u t|uHth|3PjS}t V% lj ^_[fUSWV$$31hd#W轊 WXr%$ D$D$ hi%SVg mu057UMtChP$Ws 뼃pu D$ 뭃u $3,uk57Uh#j_#D$=@u.$VtPm 9r*th۩#j\|WPn ty/t AƄ/@L$M$D$Si|/uH9tx/@tj/Srޅt@V0L$rSh۩#1A $'@PVt$ d ٍ$Ct1@$Mg4$;PPh#hԦ3jMUSWV։π=MujVqt~VW',t9K8uR\$@SV<t{SW<9Wh׼$1ۀ=MVWhZ" VWh#X w=Mu=jW_quWh#H#D$H=@Vn=M/jVqD$@PV;jWpuD$1Pt$L7D$2x d#t\%D$1Pt$\1Pt$`oVPSt$D$BPh#hԦ3Q#D$H=u}1PPW?( t$HhV#( \$D$MMVCVh##lW1C؍e^_[]ÉVhB#hԦ3 (3H (3~$3H $3h$3-ÃtH tC (3I (3~$3P$3h$3 (3 tuÃ߉1ۃYM@Vh׼$V'$MS*\ Mt$|$SPt$ & Å11S5Mt$,% 9x߉=Mt{\$(t$,l$( &$$L$$D$ l$ |$T$ fT$l$\$l$T$MRQPVSt$(t$(hV#hԦ3 $5M5Mt$ % Å6|$W\$STt$uVhQ#TUS&D$hL$l$JD$pBD$tB D$xBD$|BRW)tVh>#Tt$\t$\W) ޼8tVhL#T#D$HD$Ht$\$ \$D$t$Ph׼$TVtVh3#{Tt$%S%1VVT5Mt$%t$ЋD$HPW(tVh`#T$W~(t8-t$Vhm#S WR%tV|$Wt Wh3#H1ۀ=MDVt$SWVP׉ljWP t$t-h#h# h#h#OS1@^_[%tPh#hƪ# ljWP- t$th#h#%tPh#1돸#=Mu##jWVh&Ph"SSh׼$RjC#jVh&h#h"WWUSWV8`<3t P#`<31MMMMMM@3it$L$'hjVn" `<3VhB#0jG`<3hhV%" `<3MhjV! `<3oVhw#0jͳMu<31`<3Md<31t~Mttja`<3Ml<31@5`<3Ml<31@DVh\#0jE`<3tMtj`<3 hNtQ`<3hļMPܔxC̼M%= ts=`=@5Mh#j許 -5Mh#0j膲5`<3{!`<3M1HPhm8@5`<3, 1ɅA M- M5MMˋ @3uhN hN<3v$'=hN= hN>1jSS5`<3軙!ƒu<8fM- M5M a1H @3@3=,MGt =}r t~= hN hNq˃u#=hNtPWUV ~jWUV tw߿(= hNu  hN~~=<3|<318^_[]111RSWV։ωSfP<3D$t,t\$W3f4$t$ ctjt$eg_#1@jt$e #1PWe4$t$jSVVMx^_[h# h#h$#jdOVP=`<3x=piN iNt}=Mut=iNtD@iNHQP~'Q &M1MM$Pj 5iNhګ#5@iN 5@iNB=MuKhļM5`<3Ɛu4#̼M=u" M Mu5MUM=@3w=diNt<3~ jP5`<3j<3~jQP piN iNt4=Mu+5@iNh##J@iN5@iNb`<3=Mu MtP1MM8iNt<3 piN iNt'=iNtG@iNHQP~Q MPj iN8iNtZ5iNh #֤uC5@iN #hV$VSh#hW}W謡PW}tf=`Mt]t$5M5Mh3#hV$Vh`Mh#hWWJPWj @3u_5M<$t$WjV$h$RPWh>#hS9$S]Vh#hP8iND$=<3OMD$ 3#D$5#hSl$S]$QL$Qt$Wt$$h #hP8$t$VPVj "$PW5iNhE#t$e^_[]V~=Mu(=|<3~h~V5`<3 |<3~^V@M1=MuE1jVV5`<3蕑xRP5`<3 yh#0jd 1N^Ã=Muh<#jI&1=Mu5iN5 hNhn#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSUK ~)t^_[]WV5|<3=Mt$t$5`<3H ƃu*~3M;5 hNtc5 hNtUML~ M?5|<3x5<3hͬ#j, 1语5<3h#0j^_USWVP5|<3|$l$1ۡ`<3$WUt$S ƅ~)tދD$9u@MM!|<3MHs- 8 uc1h#Vh5|<3:~\%tS1jPP5`<33x})RP5`<3Z yPb蜬8tD蒬8t:般8t0Ty:x8t n8u |<31X8Eu |<3xt @M1M=@Muh#j腥`tx>8iNHt)t h#5<3hͬ#jL 1%hp#jƫ5<3hM#0j^_[]USWV1N=DM=|<3 @3uhح#j٤M<uM-MsgM,M1jWW5`<3藍xXͽuWURPa)jWU5`<3WyQu t#M@M=|<3:h#Ff@Phm5`<3 x|<3h7#j1^_[]USWV \$$|$ l$(1uu5|<3M1jVV5`<3}x\D$ljT$Ӄ=MD$ MM9L$ujRP5`<31x+D$T$EU,=Mu#蜩hk#0j |<31N ^_[]USWV~=|<3$(~$$~Mt)h#j蔢I1u)1ɍ|$h~W5`<3+ 0|$fGWhm5`<3 fD$D$Whm5`<3 \$h~S5`<3 $h~S5`<3 GfD$D$Whm5`<3胊 |<3t1<$uzfD$D$Whm5`<3D f $ hN11F$$~jQURCы$ʉD$ ʋ$$~) h=#b1F|?1jPP5`<3މxg)y11=<3|!h#11Fs1o7hZ#RjRP5`<3葉1yKh#.h:#"hʮ#h# h#0jB 1N5|<3~^_[]fD$D$ D$Shm5`<3 y莦t$hm#~t$hճ#0j٠SWV VhiNj  yCh#0j袠 jVjs  yh#0jv 1N=DM@M=LM=jNu5iNhʯ#趟=Mhl<3W菗hd<3Wyo MaX#tE# <3 #tf#QWPA S8 @3#t 8iNSPh\MQ@ M$ ML$QPh\M\h\MCjuh\M[jh\M^uH=`M/u+-Bu"`MP1PhaM`MPB h|3WVh\MM<3@ubMM M MQP.t 8iNP(jhiNj xsZ1e^_[]vh#0jՙ USWV (=3x&,=3kL<39|׋yM1II1M1PQÅy19}WDu=@3h#j.hhMOÅy1ۉ9|(=3x(,=3kLShM<3y݅u=@3teh#j迗M1E$sVhMMPA )؍M1Eh"#ji1IkFL<38iNShM#1ɉ^_[]USWV D$8iNxGD$M$1F1MSQ291C8iNhMh\MP$ 8iNQu*D$PUhMQ8 Mtu=@3h϶#j耖t$hMhM? $W1CttUtB:x9u=@3tFh#j,WhMQ19uh:#j1H ^_[]h`#th\MQ<t M1h#USWV1C8iNPH8iNP yj,4Ɖ׃=hNt/5@3t՛h#0j4 e=XiNt Rrx7t$t48iNP(jhiNj lzbV1ۉ؍e^_[]Ít$\$D$ MHw5 8iNVPh\MQ@ MD$ ML$ h\MkWeh\Mduy=\iNtSh`Mht^liN xiNtSh`MIh\MUjh\MXt@h\MEmMM M MQP=`M/u+?<u"`MPCPhaM`MP= iN iNtSh`M piNtp@iN|NPWt$h\M)6Q=liNxiND$L;MD$PMPh`M8iNxMt@t=iNu Pl=@3t1 MHr@tZ tUh\Ml'9D$X;MD$\M?uD$Ph\M$Ã|$=iNut$h\MÅ8iNVSh\MP@ =iNuSh\M/!؃=piN\$C=iN6D$@iNHQPQ iN=iND$L;MD$PMMM M MQPDy h\Mj=piN\$^=iNQ@iNHQPQ D$L;MD$PMD$X;MD$\MOPj 蠵iND$uMD$ ML$ QPpxMx5@35@iNhMM M MQPh\Mji\$=D$L;MD$PMPj شiNUSWVj/h`Mw1Uh`Mt>5XMhXMU' /tOGhXMWUh`Mhյ#jjO1N,K|/t1Nuh`Mh#jj^_[]SWV=8iN01F 8iNt9t71h#jێmQHb8iNP R=liNt i<8iNx t `m#piN iNt#5iNhܴ#5@iNU iNujh\M^t(MM M MQPu1=liNth\Mhxuth\Mly8iNP(ljgSW, xapiN iNt&=iNt5@iNh##2iN1G*ƃuejhiNjO ^_[USWV $8iNxu d?*1F8iNP,8iN@0D$ j+D$T$=XiNjSh\M9]jh\MQ$=liNth\M~gh\M+th\M2d M w's1PP5lM* $jh\MPƀ=`M/u+4u"`MP薂PhaM`MPb5 =iNt4$h\MZ' piNt:@iN|Pt$t$h\Ms.Ph`M0iNMh\MT$t8=piN=iN@iNHQP~dQ c8iNL$Qt$\MSPD ƉPS?&=piNtc=iNtZ@iNHQP~3Q 2Pj 讯iNPh\M%dPj 臯iND$L$ʃ|QP  MMʃ|QPxnh\M*1C@TPh\MZ%芐5lMh#0jh\M8ch\M)t 8iNP4 jhiNj =hiNtn)11Fe^_[]þ\MPV$Vb뙉Ph\M$뇃=liNt cxIx8iNPHx11@USWV $$h 5iNS9 = u$ /,4ŏ4/t EƄ4/FED$P5iN< #D$=@`1Gxv%xmlxd=XiNt exRh\M!(ttjhiNj  Gm'15iNh #j 1GĐ ^_[]y5iNh(#0j҈5iNhO#뻸 )D$ )D$$h\M XliN xiNtV1=`M/`Mt$PUW8 ;D$vh`Mhq#jN _D$PS] E\MWT&W^jh\MKt'h\MK`h\M&'VSh\MNR xơiN iNtD$Ph`MI=piNt5@iNh`M+iNM=`iNtEh\MC=liNxiND$D;MD$HMh\M{ MHt 1PP5lM $jh\M#Pt$h\M Wh\MD$P;MD$TM7wD$ Ph\M;iNtk=iNtbD$D;MD$HMNh\Mh\M^^D$D;MD$HMD$P;MD$TM<5lMh#0j蕅P\MWWWh\M!Ph\M=piNe=iNX@iNHQP~ Q Pj iN D$D;MD$HMUfhNMhNu 8iN@hN=~| h~PhM#thPh~#j蜃1Hã hN<35My x1,hN(hN hNhNʉ0hN 4hNhNM=@3u=hNt4=~| h~Ph#thPhݷ#j1H5M y xhN hN0hN4hN1/u/1N=PhNMWh0#js PhN.|$tjh W V $=ThNThN_Sh#VPV$(ƅE<$8$S x<Sh#P$ $۳ywy0=iNt5@iN9K$h#Vjs15ThN$z' $=yQh#0js1N^_[ÉuUSWV|$?/tGj/PRDƳUWgu/Fj/V$DƅuhW=iNt$$W jW)y3UWu%D$ PW)jUPWV/Fj/VC1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P/yu~wWh#0j r$tDP誱y~w$hۺ#0jq$% 1$ThN^_USWVD$Et$$^߅tPywWh#0jpq=iNt<$8$W 1 iNtt)$($u7=`hNuj4#\hNP&#`hN\hN!UW@3 @3t%1PPL$H$X$T$W$tJSWy!+vSWh#0jpW2$1$ 1$ThN^_[]WV1uA|$ t$t$W@ t(5@iN~GuWh\#0jp1N^_Vt$#D$ PVt%5@iN5GmuVhz#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=@3t =@3D$PVttVh#0jKo_=@3u&D$DL$HL$$Mbl$L‰T$=@3u'D$PL$TL$D$ Mbl$X‰T$WV!#t6et8Nu} u&WV uFtVh1#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVXt%#D$=@uVh#jm 1HjW |^_[USWV׉L$]D$PSt6St$thBs0wwS tՃ} tL1@_1=\iNuTG3D$ 3L$ uKG3D$O 3L$ u9t$h4#jUl 1St$hc#Vj6m1He^_[]ø#D$=@u%h%SdtS 0S蠬} DfrShR#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=\iNt1A$$3L$ $3$ u*0$3L$,$3T$ uVh2#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $'5iNhW#cuu=iNtlD$PUuZD$ !=uHhWU ƄD$PWWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$ 4$U_=pL$ t uu$UFD$y)Q8=iNus<$8$U xZL$ A$ot$Uha#0j3j1H=iNt2<$8$U Uh#Wji1ɡiNtt1Ƀ$ !($t($t$$5iNh #ajUxN1=iN=@3=@3Uh#Uh#j7h 1OD$PU@x=1$ ?#D$ PU1@=iNu;L$ ($/gnt$h#0jh$ PU1@Pt$6UK@31 @3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWW1x1K=\iNt މ|^_[]ø#D$=@u5h%Wk_1EtXWyĉ#$t W{y5@iN ?ۺ#h#jJe*kt$8h#kt$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWSMxjhXhNS\ y%#ͼ#\$PkSV0je^_[Vt$ xFP=hiNt.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$(FxLX$3D$8T$3L$4 uF1VVV$(kLxE$($\h#ih#.h#j%c #i$(h#0jc1N|(^_[]V=iNtdhN=|iNtdhN=iNt@dhN=hhNuh  lhNt01x&=hiNtDyh}#jhb1N^WVhNtP 1hNhN1NhhNt xhNtqAxhNuj1(3H (3~$3H $3h$3YtN;4=3u1tB lhN9G= |+xhNxxlhN PW1t-lhN8j5dhNhlhN hN&1^_SWV|$tR?tMj | tSƋ\$WWH~ </u>ۉ^F=hhNt%thNp!h#j`1Hhǽ#5hhN5thN1^_[áxhNt@=diNt|hN=iNu0=TiNt'D$$uhNtjP5hN WV=hiNtB5hhNt;11G~u)uh#jA`6h$hԦ3 vu^_USWV =|hNu%|hN1NhNuhN}$ $ $L$PhNt#HHf w=$ 'phq##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p ye hNqh#0 ph9#p j_e=hiNt\@PL$QL$ Qpp p09Bx8hNjjt$t$t$t$phU#p j[_ hN1N1 $H'LJ$Ƅ  LJ$LJ$=hiNtwL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G hN VqPV  hNVqP5 5iNh #U1uxhN@e^_[]fUSWVT\$tl$h=piNP($T$L$X$1V8$9PV<$Qd#d#t4$tVjQjRD$Ph#Sb~ $u2@$%  RPh#Uh$^|$x$h#S~EPD$Ph%S}$Hs Uhþ#u# Uh\"S} S4X^_[]Sj 蒊USWV@L$E\$CD$PS6{3j/9#|#L$QPj@t$V%ue^_[]SWVT|$dT$t$X$hS($WVSh˾#t[d^_[SWVt$F=u1H|$Ph=t6t)G\$QjPSVVSGu܃^_[Ã^_[USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VtiN~1F1utiNhԾ#j9W^ÐSWVL$D$t$|$7UhNthNtt\^_[}\1KZhNteSP(ti:tdx:$39}j 7U@$3sPVW7 hVhN:-u/hNÈhNnhNhN`S6h%#$3=S6h<#hԦ3$x?^_[f1Ã=hNu1á8iN0h#jV hNt"H hNp0h#hԦ3w5iNhW#4Nu_sUSWVd|$|j/7=iNt@l$xiNhW#PmiNW#1Ctjh#S= tj1ujSðuhE#U`>t WC<=$iNUh#l$}$l$h#W>]tjWB\$rt D$W<3|$ td^_[]áMt8uhZ".Mt8uM_"Uhv#j E USWV|$b%UW胒UVNJ00ht$跩tAtZ/UVCUWe488ht$vuKt$h#0jxE1H1^_[]áhNt H hNhԦ3h#jjZWVԦ31FWVhh#WVhhc#WVhh:#WVhh4#V`ZUSWVPˉjPQ, փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q$1>tj,VÅtj=Vtmj tdAE0H@hN=hNt iNsiNuhT#j6B1O^_[]hh#h#hh#j B4$ ɋD$L$01Z:WV5iNh#hԦ3c t(ο#Php$hԦ3c !uءܦ3H ܦ3~Ԧ3H Ԧ3 hԦ3j mf^_SWVPωPQXt4Ƌ$| tC$Su t'ǍCPVW DG $iN $iN1^_[USWV$t%t_݊M\tS8uEEh#j@Ej UEƃjSV t3l$hUVPWUh#j\@S $EE<\t:uCCUf $AStRC1fGt,PtStgtstp1B ы$J@u $A=(iNtZ,iNHVV#4$5 Wh#ji? 1H^_[]V#V h# (iN ,iN1Vs#4$ Wh#USWV\$tK;tFj+ tLNjl$1pS5G woD$G950iNt%4iNx!h8#j>1NhM#=0iN=4iN^_[]WV50iNt;11GFu)uhz#j^>6h$hԦ39` vu^_USWV0iN1 l$$=diNKt(=TiNt!9t)@tB9uKKt8<0iNCSw Dž$h#j=z$uEPt?NjCt /C;W4C |/uHC C$#h#j2=Ct/C1N^_[]USWV|$LJ$0iNtOwCu kPUC |/uPV3t4 t2[u1=PiNO=diN=PiN 2$=PiNtW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=TiNtGtlD$@1G8D$@1D$\1GEt$ hI#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhc#j59tNjE|$tDD$@t:$t$PVh#hԦ3VVh#hԦ3V $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh/#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7q@iNԦ3WVVjruD$L$ L$$VjVjIuD$L$ L$$VjVj uD$L$ L$$VjVjuD$L$ L$$Vjh#iN1iNiNiNP iNt$,NFF FFi~ |$WVj8 y|$ujWj7 WVj7 y|$ujWj7 WVj7 y|$ujWj7 WVj7 y|$ujWjv7 TWVjb7 y|$ujWjJ7 (D$,WVj .7  WVj7 0=@3t3i=)‹1@?9 tR=iNt3<$/>3i=)‹1@9 tR iN1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=iNujh= iN#t\u#uGW tjxGj jWS ] />3i=)Ë iN,t 98t#@u $j t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=iNujh= iN#t\u#uGW tjxGj jWR />3i=)Ë iN,t 98t#@u $j t!8h $1(Wh*#j<, hR#h#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhv#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWh4#j*SL h#C=iNt$iNX Vh#jW* 4Vh#iNiN1Wh#j** S hW#}VQh#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$Åt>VV ,FN4A1R113W 1J 4$$P"'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSpV!1҃ډЃ^_[]fV1=iNu*jh ? iNuh#j1(1N^USWV iN1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3 S Sx h#j&1NwUSWViNt"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh#jY 1^_[]USWViNCD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u iN-iNiNiN-iNӉl$T$tQغ/>3i=)‹t01ڋh1 t@iN=iNl$T$s}ډD$0! umщjt[iN=iN tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=iNu*jh= iNuh #j1N^WViNt813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W5 h?#jj ^_[]USWV iN1Kt$/>3i=)‹/uPVDžj$詿 tWWtN$$QVQ4y8~V Q(y,~VIlNF iNF5iN3Wh#!Wh#j V Vhs#j ^_WV5iNt~1FiN=iNu~ t v6蚫@3 @3tWWvvvv 6踫=@3t v6ά6 V 5iNu^_jhÀ=jNu1WVL$T$t$ jN11H<>u5Guu%P=jNtjN11@^_V|$ |et$>t\jhU#PS t A3=A3t#h#j|j A31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#S+u3h&#Wu!@3u9jNDžu91FWSh#Voh&#h#hI#V WShw#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD ShjNh jN   PhjNhjN  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ 7 1D$ereRPQ ^_[USWV $ $Hw.$|"' e| Rh'#{=jNx1ۃd|RhE#Q1l$ hVU $ jdPU$, $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h #$F1 $F2 jdPVN fF0 $j j0P hN hNthNT$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U! $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ hc#$%$ $LJ$m9rD$ )yQj0Uc 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhU#W  t1H^_jh#W u(=jNujNujNh#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQ Ǎ A/G<rH )UhjNh jNo   PhjNhjNG  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$"'<2ǃ$)$Qgtxu>;&;&Qh#j 1^_[]USWV$ $Hr4t/uH1G=jNh#j  d|=jNtR ~djN_)݃ÜL/tMC Vh#_tZ1ɍD$hQP  $$1$$t$D$]hWP )D/,$7ti 1ۍD$hSP  $$$D$jdWP莻 $I H2375$"'1Wh#4$MS@$$1$SA19r.$ 0I9ݻÍ$Mr19rD$)Qj0R  $  $ % 1$U$[A9r'$ 0I9޻Ér119rD$)Qj0U5  $ h#L0$p x$|$ف$dž$$A19r.$ 0I9ݻÍ$r19rD$)Qj0R  I6$$f@ 0j j0PY  DK$A jdPQV  jN1$$A9r'$ 0I9޻Ér119rD$)Qj0U  $ h%#$B L jNفME1$A9r+$ 0IՉ9޻É׉r119rD$)Qj0R5  $ th.#jF UfDŽ$ rDŽ$usta=jNt fDŽ$  fDŽ$ 00($1l$hL$nA9r'$ 0I9޻Ér119rD$)Qj0U  $  th%$8$1l$pL$vA$9r'$ 0I9޻Ér119rD$)Qj0U  $  th%<$1l$xL$~A9r'$ 0I9޻Ér119rD$)Qj0U t$ hL#hN hN$ thNT$HIrm$1$A9r'$ 0I9޻Ér119rD$)yQj0U $ t*hP#h#j1G^_[]1GWt$KW<$ƍ$ d#d#tٻ SQP $-tSUP 1L@=uL@=u1퍔$$A9r.$ 0I9޻ÉՍ$r119rD$)mQj0R t&$ hV#h#jhD$Pf1O$ jj ?$jNtT5 jNP( jN1҉$jN jNj%)jPA$  %USWV$׉Ήh$jS $l$h h"'U E t u4 $jN F$jN@ jNSĸ$^_[]Wh#j/WVt$ V#=rVh]#j[ ^_USWV̀| uJt?5311\=.*t?u.L^u\L@\@G9u1D}/tP\$$Sh#h WW1NxtSh!#h WWxS|$$Wh/#h VoV~x$Wh7#h VNV]1N^_[]USWVPt$>-u~t6hx@#V|#Džu'0 PVhs#jH$31FUWDt5Ë$rt$Vh#j$_Ft1N1$3t W^_[]fVjhj#woxKhP$PS(jNt)hx@#V<,jN1u;5(jNV(p=XiNthj#hB#j 1H1^WVPD$$|$t DiNt$iN piNt"=iNthԦ3j .iNԦ35iNh#W! 4$VW~% Wj c. ^_P(jNt$L$T$ $RQPP% 5(jNXSWV|$1N|5,jNt,\$OPWS, t;j S1t^_[SWVPD$ $|$t DiN|$t$iN piNt"=iNth|3j -iNԦ35iNh#S  4$WS}$ ~V$ Ph$hԦ3]  hԦ3j >- ^_[fUSWV} u7x<hd#j \$1h̹$WV貦 LtPt߃95$3D$hm#軸ƀ8/h^#Vush#Vua$PV3tKD$Ph%t4$3D$ $3L$ u$3D$$3L$ t1PPWƅu j02VONh|3b3@ujh"jӝPhb#hԦ3 jTUSWV$$6:hd#j" 11Chs#VU0 e~%q~3كrtރvt_xDjNŃV.PtrكRtwftAi4jN8jN뒃Wt6duq0jNz@jNl4jN8jNWHjNItVG t|$u G?,kNw w W  ,kNu=0kNt^_WVt$ ,kN1G2'uGP;kNWVP kN8^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5kN^_ÊVF|uܹո ѹ Ǹ É)B$:@B2'uVPQh# fUSWV|$,t$(Sh=jNjLVt:xIuxNt@jLPj VϹ1tE@j P輹)=jN5jN5kN&1,=kNuƉS^_[]ù#V=kN)u ^5jNQh#*WVd#|$ |$wLA3 PA3 @sN>t'F @sNQ@sN6N@>vuڋ7 @sNQ@sNt  @뭅+LA3@P5wNVrƉRPhμ$& 1 ^_USWV8׉ˋ kN kND$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhΚ"jVjVt$ [( USWV Ջ\$$St$$tƉ׃=kN%up1҉  ډD$$=kN&uU1ۉ D$kN kNME \$$L$SPy t D$$ ^_[]ù.#SWV֍Qȋ\$L$|$$#'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹##w#wSWVP=wNkNwNQ+Ɖ=wN=A3ttxt>u&1ۉSPV Ɖ9u$8t*8u+$t@2' t$@u^_[ù# &USWVPՋ\$St$gƉ׃=kNuKl$kN kNMES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաkNHwSjP ljաkNuND$kN kNN1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THkN kNN&ىWP1Eكra$"ى=kN#ÉkN݅~hkN kN2É׃'1HkN kNNPىWP1 1kN kNNىWPÉkNLkN kNNىWPe$É׍EكwkN|$4t;~l-kNb1A1Ǎt$WShΚ"jVjV5kN0't1I1@1l$QPhΚ"jUjU6s" ؉^_[]ùJ#T<#Je#@USWV֋] $t$ơkN kNL$ D$T$uPV֋=kNWw,6'87'}uPW ֋=kNȃ}tً$VPt$ ֍Gw7';E Qȉe^_[]fUSWVbA3$D$ h#d=etuD$ jHsN0hkNGVS?SU@P蔩ákN)QPS kN)١HsNpQx VPS[$jhY#2&ƅ<.u 1~.D0tD$SR@PD$jVD$Pu1 Åt$ Pt$ h+#: Đ^_[]Ê<-~|5kNu5kN$cD$t$h#SVh#h#V=kNt^À= kNu3 kNhm#讖PtVkN^OSVD$ ,kNP蔒x\|$j ,kNu=0kNt4tI|$tO=A3u =A3t=5kNh$(1N ,kNu$=0kNth@#E  ^[SWV|$;kNtytuW@P>kNWPE5LA3PA3@sN?/=kN?GH @sNĨƊGF?@sNՋ kNtQ kN,kNkNkNjG ,kNu=0kNt=kN"V5kNhj# V5kNhm# /u@sNNkN{Ht/t@1@kNhQ#S tg;t^h%StL@sNH @sN袧/@;tS @sNQ@sN}O@?u+' LA39r9v@sNF~/uЋkNƅ/jhm#s(1;LA3u @sNQ@sN/@=@sNu @sN,kNkNt PH kNkN5LA3襣kNV5kNhj# V5kNhm# ,kNu=0kNt^_[ákNt HQt/tA1A kNUVutf>/ua$Ph%kYtGPVZYt6$3D$$3 $ u$$3L$3D$ 1e^]Sh̹$%t/h̹$uHsN8LtjHsN8j*5kNuj=kN5B3B3f`5kNB3HQPPB3Q 5B3{B3@u1[hq#[0 Ph#Ah#7SWVW賡WP]u2\$VQ8"u6W聡WP+tV0kNV^_[Åup0} Ph#jkNtjPhm#V h#ÐUSWVD$ B3fa1Ƀ|$‰tpыLh+$S$thE#Su 1t$.4NJ]taM\uNEU\rw$#'\0u!11ЃwxAunjt$>B3HQPPB3Q t$.PN    ȉšB3HQPP{B3Q<$t*B3HQPPGB3Q 5B3B3Hu 1^_[]ÁfHh#jf$kNuL$ (kNjP`V=,kNt 0kNK150kN0ppp VPj9A 95@qNt =A3ujVV^jpPT$=|kNu |kND$ $1APV0kN,kNt1It$a8VPL$T$ D$$PD$|kNjWVP|$t$D$$4$ WWV׉ΡXB3t LB39ty u hLB3/=@kNpkNuMPh#h`B3< =DkNt5DkNh#h`B3 t*t$ Wh`B3" x4h"%h`B3xVe Ph׼$h`B3 B3HQPP B3Q h`B3[ ^_SWV|$t$\$SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$gWY^_PT$D$ $1IP>XËT$1It$)Vf@$'T$ L$9upu'0fuQhV&j h4kN4kN@^1HkNPkNTkNXkNWV|$ |t|$wLA3 PA3 @sN>t'F @sNQ@sN*N@>vuڋ7 @sNQ@sNt  @`kN15ޝ+LA3@Pơ\kNPV `kN^_USWV\$0t$,|$W谛5wNjVj j=8B3thƉ؃$1t7=A3u.D$0t g $uQVi=HkNu"W裛j获=8B3u11EjWGu `kND$0u^_[]jUSWVL$,|$(A306̓V踚$(%'Uw1ۀ=A3_=HkNMjw1ۀ=A31=HkN$=`kNjwH1ۀ=A3=HkN=`kNuQ=tNt~jw1ۀ=A3=HkN=`kNt  u8V1tu `kN1l=tNtUW_j\$0SWh a=tNtWD$,E=tNtt$,WK_=tNtt$,WE\$,SW=tNtjUW=tNtSUWyPh_# hLB31k=tNtwww. `kN@jw1=`kN`kN jwa=`kNt `kN1V蔘VYL$,= vNt =rA3t `kNtu u^_[]PjUSWV@|$T5$kND$$wG=*B3tttnvN5wNP$P]ho#PGtj P5B3c Kȅuh# 5B3l$jUOth5$kN5(kNju<$t&4$h#5B3m|$`kN\$X,kN-$kNj wD$ ,kNu=0kNtSw,kN5$kNj ,kNu=0kNt]<$t&4$h#5B3@^_[]j5$kN|USWV\$;s=*B3{vN5wNPPho#stj V5B3 vh#`u h#NB3HQPPFB3Q 5B3l$,kNttu }tF1ۃjU ~Sl$SP tuQV}`kNJu ,kNu=0kNtjsUsV螂`kN ,kNu=0kNttJ=*B3tA{t;vN5wNPOPh#5B3^_[]SWV|$TkNjw1=A3t TkN5`kN^_[Ë\$1HkNu/? `kNut΅tSw5`kNHkNt"u8LkNH LkNKHkNjw=A3tru+LkNH LkNHkN1 1@65`kN+USWV1=A3t5`kN|$0D$Pm[thUS- =HkNtiD$TkN,$\$4>GwN=*B3 vNPQPShw #Fw ;B3HQPP3B3Q=uB3HQPPB3Q 5B3~juw 5 Sw5`kN=A3uZHkNt"u*LkNH LkN9HkNm"uLkNH LkN HkN TkN5`kND$P艑 ^_[]USWV|$0t$V6@O wNjPw, _1=HkN1{t'GwN$pWgXuuޡHkN[tZtT1=HkNuI=A3u@l$41; u{CwNUs t=HkNu =A3tʋ-`kN-`kNV葐 ^_[]USWV\$K1t@ ,kNPS>yƋk1Ou,D$}t]1{PuVz uR ,kNu=0kNt~ jW|$x4$M3jt$jux W%3<$t$3mE{t V x1 V^}`kN ,kNu=0kNtA^_[]Åx W2G0T Ph#USWV$$D$1t$ vND$$DvND$DHvND$Ht$05hkN$P袎5lkNEwNL$XIEtH1F\$XljtwuGwNhSWI) 1ɉȋOυuNjL$\u L$4IEt6t$4NjGwNw蚺tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P̌$D$XtH$r4$ ȅu$1ɉL$@=A3t=XkNu|$ ~ $@D$@D$ )$=*B3vN5wNPKPl$41dz=u)B3HQPPB3Q9}j=W|Ɖt>uB3HQPPB3QFP\U 1Ո`1t$XtOË$t)B3HQPP;B3Qv É΅u$u t(PV5B3 مt ȋN΅uءB3HQPPB3Q 5B3C|$ +t$4~jh%'W u|$$ƅuf|$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t D$$|$ u$|$<‹$t$t$$t$4V0fD$ fD$D$ f=tNt*fsD$= t=+ u ft$}u$D$@f%u D$,kNjU sD$,ED$D$tD$L$`2 =zA3u f|$t$Ut$4gt t@`kN|$D$D$`t$d-D$,F L$,kN=0kNtYD$t;=hkNu,kN=0kNt.t$`,jt$hL$D$Hs*|$ toD$ t$,v`kN.u D$@1@Ht$,Jq,kN=0kNH> $At:ʉ9-ЊQ-t u{yh8‰uD$_}t } ]1HL$|AAA wND$(wN\$l1GSQWd) =hkNrQNjhkN1-hkNUD$pPj() D$ $kN D$(wN_UUW  $1ɅȉD$PPVeTsN\$|fXsND$ HTsN$\sN1`sN,kN wNL$( DkNL$LwND$D$hP5 ,kNu=0kNt$jV7$kND$ 5$kN|$t&D$1f|$tH DvNHvN$DkNh t$8TXkNH XkN=t$L$QPD XkN,kNt$u D$(wND$DDvND$HHvND$LDkNhTsN轛TsNt$|D$ $kN|$Pt j ,kNu=0kNt=HkNu 1HkNLkND$G$jW$kND$ =$kNh!t$8.S5hkNt$ Ut$^_[]h#|5`kNt$1=hkNȍPu =hkNu"D$4thB pȅu]5hkNt$ t$,Pt$=(kNuSE'h#hTsN,TsNt$||$Pt jt$hD$(wND$DDvND$HHvND$LDkND$ $kNjP]01hkNPD$pPjR" ,kNu=0kNtV Ph#%(kNuhkNjj`kNt|kN1TWVt$tr|$w$%'j Wv 6 $@Fvu;Ftj WP $jpV ыF @v 빃^_V t$t8>u3Ft,p謩tF vNQjRp ^SWVQjt1OS jjP" t6 #>F1"jjP" tv"^^_[USWV|$41GGG =A3l$0\$S~,kNAjUgjUPi uA,kN=0kNt4$B"1CSt$SU\$t$"$w ,kNu=0kNtgS~~^_[]h#VPdkNu1PPVPjhA3} tF$P|dkNt.1QQVPjhA3} tdkN@=PATH5dkN!f dkN A3 A3^álkNSVhd#HsN8uj1^[1ۈA3A3蹏5tkNthB v65HsN vNSSQPVXkNáHkNËD$ HkNLkNPËD$@LkN HkN1HkNLkNVt$ |$|vPh#F1@ TkN9~1Ҁ8cBHkN LkN1^WV15`kNVHsN90t\Wh|HsN0PjPoI5pkN5PkNXkN@PkNj7y5PkNKWM|`kN^_USWV$vN$j/W~t@D$PW1D$ %=`t|=@t}Ā^_[]ÉjWS/ tFƍl$UV0uD$ %=`uV){jWS ƅuWh9%Wh)#Wh#L$PkNx PkNV|$|D$ p#`kNPkN5XkNuu~9} ~ HkNLkN^11@1USWV4hd#|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h?#5B3(14^_[]UWV׉΋ xkNuj'zDk< xkN11D$ T$l$ &D$ $,$<$\$ D$\#D$G?6u0uFjh$W+^ %W|80uHx.t x0@te^_]USWV|$7j/V~u#$jVP uaK$$WV47 Pu/. 1@Ɖ$m=kNud$$UVuG²8t8賲8t.該8 uPV-t 育Vxju$P OfSƒrtt~ |kN7PSPVhE#jSWVt$|$t$VW% t ^_[Ã|$u08 jWD6_vPsNpkNV=j]USWVPD$tnt$ t%1;t <:t9tGt$胡,89-PA3}w,; LA3t,WSQL$ 蒄L$ |9/u 1xAA/D$PL$QkNE9u,;E-kNL$Et <:tEL$<:t1ED$(Q٠ $+ LA3AQ~u^_[]USWV$1C1D$ 1D$D$D$\$ha#芎Hw5$%'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ HsN9AHsN93t$$1CjWtV@wM$&'|$t&|$ t4t=0A3x'@ |$uHsNH HsN8uvNPVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿkN/tPEȃw?$(&'|$u/|$ u&u |$tf<u t$Um묃lNr5B3B3$@thk#1@$$$$^_[]SWVt$,kNkNt5Hftfu950A3| P*\ 9p}Ëu̓lNr ,kNt^_[Ã=0kNt^_[USWV$G$$8&'ovNEjWS PsM䃼$$twh#5Vh#fGPh׼$,kNwPQh` ,kNu=0kNth#D$Ph#/th#h#GPh׼$q t*B3HQPPB3Q*B3HQPPB3Q ^_[]ÃPWh#_SWV|$tWȊ Bu%iC)ʾ!)!kN3tFWP苝tc6|$tT,kNW諛PoƉf@@ WPN ,kNu=0kNt %1lN^_[,kNlNQKY  ,kNu =0kNUSWV$$$j/$8vturfEE^vN9tth#V;t $j$q1Ʌt@@t`tm$umtisD$ P$Y%xfE$K-88$ u=0A3x $u  \u =0A3y& u $MƋ$1Mtfyu0A3YL$$j$P 1OD$VnGkNtAPh# }t$t-'5kNh#|t>/u19}-9j$$PM ƅvvD$ PV#x3D$(!D$ =u8=kN$Nu$葨8t臨8t }D$}o$E$\$|$$t$t'5B3jS P$h+&VfEo$T$pƋ$$,kN|$ÍD$ uj$HfxT$ ufBuω7 ,kNu=0kNt sׅt"G GfEG EG fEGE fEEĜ^_[],kNT$ Éuj$fxE$ufBj ,kNtbiVC+LA3PkVjj$t3fxu*SVn$=0kNV$h#SWVPl3'1t8|$t3'L$8u%tWP+L$ t us^_[SWVP|4'1t3|$4'L$8uWPL$ t us^_[V|4't%4'jPf@NHu^VkN 0A3trft fuxB =lNr^USWVP\$=vN1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#xt1<:CG럡0A3y x50A31Ʌx $y $Q50A3^_[]SWV,kNkN>t+fuwWR ߉?u׃lNr ,kNt^_[Ã=0kNt^_[2WV|$D$ ,kNjP+@ft*fu vDfFGF GF GF ,kNt^_Ã=0kNt^_WV t$D$L$ ,kNfO A3fOPGWVU ,kNt ^_Ã=0kNt ^_cjt$itfxup%1USWVt$4$1E11D$h#Xot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;HsN:6BHsN*1\$ D$}u<$uhr#߃<$u Ux*'t']|*'8uUP@ujUƃ<$tvh$ h#Tj vcmtih#6vh$HsN8tcB3HQPPtB3Q 7<$t"Uh$h#Rh#HsNH HsN(|$t PjD$PU1L$#jUHfL$@D$wS$H&'j/URljUoQ~<$0h PhL#@<$ulh #]<$uh#D<$u h#7<$t,Uh$T)vN\$|$tIGh#t$HsNH HsN(nv<$uh3$O뒡vND$ CjUD$PO PveK<$u h3$ Vh$t$vt$1^_[]h,#d#ctd#RPhO#Ph#f1PPt$  5LA3@PdUSWV |$$D$ \$(=A3tlNH lN LA3 lN PA3 @sN1ɉ lN lNH wN@\$$@sNtH @sN~ lN lNHfH lN lN+LA3$Vc(lN$lNu&4$$1cp (lN(lNq$lNl$4$(lN-(lN5$lNx=tA$lN0F$]5(lN΅ue lN@sN.4$(lN$lNt O(lNG ^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tPvNt D$B3 TvND$ lN+LA3D$?~uЃtRWOT$4$ D$1@D$ wy< @sNH @sN lN1=TsN lN; LA31y VT$0>u!y@u=D$D$lN$@sNH @sN lN=lNut lN+ LA3;L$~axu[@sNH lNk@sNH @sNA lN@@sNH @sN lN$ |$D$ЉD$$ @sNH @sN  lN LbT$,H lN$t)Ut$ et lN+LA3jPHP T$,>~y=u|$ D$ _RV/ uwN@sNH @sN~# lN%aT$,H lN aT$,H lN$Ut$ eT$4 lN+LA3jPHPT$8 %aT$,H lN>@sNH @sN~ lN `T$,H lN8 _wNT1>uO@t*u t  $! QVT$4`T$,H lNwNl`T$,H lN$J`T$,H lND$$ |$tu^_[]USWVt$0|$(= lNtPvNt$D$B3&j\xNFTvND$1@)D$ D$<$lN_w9gD$(Êxr>jWhĕ&^j 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tj[ $HT$0JB^_[]WVt$ NȊ@>*u [t?uߋ=(lN,kN,lNu(Q9PZ,lNNQPc5,lNC ,lN ,kNu=0kNtQ(lN9t31Ʌt AuQP"u=(lN7v (lN6^_Vt$t"(lN0vX5(lN΅u^V5lNt1,kN6PB 5lN ,kNuۃ=0kNt菺1 lNlN^USWVt$(PSZ lN+LA3PRYLA3Gtr}t  KvC#:t /tQ t7=A3tAL$,u8 @sNQ@sN[O@랃tPY^_[]Ã=@sNu [@sNLA38t!PS/ tx PYu$hY#2ljPYGËD$,tÊ0'$< t< s4< w*@sNH @sN~ lNZH lN@sNH @sN~ lNZH lNGw/u}/uE>P8/ USWV,D$DD$l$@}E$u D$E2'D$D$D%D$ j=U]D$pD$(|$$|$l$|$t;D$PU!tdá lN+LA3D$$1U$t>D$t;t0 lN+LA3D$1ue1C}@$ulN lN+LA3D$=A3t-E1<*t&<@t"1ۃ wйs\111O|$1CD$%t$RPUT$1 u= lNLA3D$)ǣ lN=@sND$%D$ u!L$ȃ@!"}@u =TsNt1E L$@11 $at$|$Wt$l$UV1 WgD$(D$8 u;1|;u|$ |$y|uCD$ 0'$< u*@sNH @sN~ lNWH lN@sNH @sN~ lNWH lNL$ CuqCD$ < w*@sNH @sN~ lNgWH lN@sNH @sN~ lN=WH lNL$ Cu1CK $Ix$&'t @sNH @sN~Y lN\$$W1C:څu0L$ QV1ۀ>t5 lNW' lN$ukV$\$H lN= lN+=LA3t$ t$(SRWVu lN=LA3 lN)=@sNSL1C lN+LA3t$ Pt$ D$ t[1GFtuրut܋ lN lǸtuŠQ1ljOu,^_[]ÉUVh:#=x+D$5wNhR#t$#u+HL$IQt$P5wNhm#D$ƃHT$QRP5wNh#ƳUSWV lN+LA3D$,kNlND$ lND$$lND$(lND$,5 lN=lNl$0UR\$+LA3PQ\$ S$URD$,lND$(lND$ L$$ lNlN5 lN=lNk$$ L$1ҍ|$DT$rD$HL$[|$  ,kNu=0kNt8hWt$y y=8t,kNHD$]Et uD$F끋D$H9 @sND$} QST$~ @sN @N1Ҁ|$t0' tـ s ـ w @sN@ @sN@D$,kND$ x PD$t P9 D$tP5?lkN$uD$+LA3jPt$$ D$ lN ,kNu=0kNt^_[]USWV D$4L$@- lN5LA3l$)hPD$@sNH @sN~ lNZRH lN=LA3UPW#D$ PDP lN+LA3PCO5wNW袛ljӍD$ PFPLA3 lN lN) @sN @sNjQ lNSWhΚ"jP  lNxt$GF9Iu|$"tjVU0 lNA lN@sN)@sND$ ^_[]SWVt$1ۃ|$|$á lNt#9xu 9X up2jM lNlN lN lNxpX ^_[WV= lNt$ 95lN~?=lN,kN?P77 =lN ,kNu׃=0kNtˮlN lNt?9p|,kN8P6  lN8 ,kNu=0kNt脮 lNu9q~)q$95lN~  lN lNlN5lN^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) &@sNH @sN~ lNDH lNTsNڃt$$@8)΋=\sN$E1 Øt4t/*@sNH @sN~ lNDH lN@sNH @sN~$H $ lNQ lN C lN $Q$ P lN$j@sNH @sN~$D$ lNM ȨtD$BD$)@sNH @sN~ lND$ D$H lN@sNH @sN~$H $ lNQ lN > lN $Q$ P lN$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G@sNP@sN>GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r,lN9tH9u b%8/t F%QMD$;5,lNtF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$ t8tG@u@/UPWV 5,lN=0kNtt$tWE/Q ,lN߀xruX@8tB@9tD$P5,lNAx5,lN,Ą^_[]ËD$1Ʌt AuQPFWV|$ Wc@P78WPAj!8p (lN(lN^_USWV\$D$|nOʼnmIWP)|$SUÉpsdx 7u߅u҉3D$^_[]SWVt$(\$$W^8C lNLA3 lNPA3@sN lNjs@sNH @sN~ lN9H lN lN+LA3P7jVP W 8^_[USWVt$FPhf#تB3HQPP艦B3|$Q1ۃ|11E4aE9uSh$~B3HQPP/B3Q|=1C4蚥B3HQPPB3QC9u1^_[]Ðh#bh#XllNH llN~plNH plN#=~ullNH llNUSWVP8A3H llNt+u yllNH llN~xhLB3该h`B3袥 tlN18A3~PXplNhSpK {ep8t_8A3xLo8#>WjW !Pjj  hj#J8A3ptlN8A3@1ҋplN  plN@@P t 1+plNllN8A3{tXAˋ-tlNM tlN~ @لtplNأllN=B3t$5plND$脣5B3&D$plNH plN0~^_[]øllNtlN1tlNllNh#ДUSWV=8A3w ,kN^t)kU}^~D(< t< u 8B3Hc FplNFllNF tlNG $9t V@  ,kNt^_[]Ã=0kNt^_[]ѓV llN1~^Ë8A3r t ~6u1@1zllN plNSWV\$t$|$,kN 8A3y tj1 8A3I  8A3A$A plNH llNH tlNH XtK =plN5llN ,kNt^_[Ã=0kNt^_[WV$,kNjWiƍD$PVAIuT#D$ =uD1PPPV/O u2jPV u <$ELF1PPPVN uZV轌9t:$Ph ,kNu=0kNt3Ā^_Wh#菒Vh;#|VWh!#hVWh#TVt$,kNhI V賌jjV |$ t8A3H~Q豌8A3pxuh 0 8A3A1llNtlN4A3 ,kNt^Ã=0kNt^J8A3tL$T$9PuHuállN 8A3A tlNAplNA4A3Aj8/ 8A3@1ɉH H$H8A3WVt$|$ ,kN|$t=plNWZllNtlN54A3 ,kNt^_Ã=0kNt^_鄐V58A3,kNFx P{FtP ~ u8A3V 8A3H llNH tlNH plN@4A3 ,kNt^Ã=0kNt^8A3Vt$ 8A39t0lNtPu^hS#2=8A30lNt-Ã|$t=8A30lNu8lN~P藊8A3@fWV|$ 9=|pN=@qN@A3t PNjhj#@A3MPt@A3hM P5@A3vpNB9t jj1Vj:Vj/Vj$  pN9tQjpNP5@A3?5@A3@A31VjfVj[VjP=|pN@1VCtVk@A3Fuh#^A3^_g0/ hPh#ލg0/ hsg0/ hPh#詍@A3;D$u D$@A3hd#fEHsNSWV=pNjQEƋPh׼$۟|-1GPh5[$负G;|ۡB3HQPPVB3Q c5@A3wtJ,kNV[V9 ,kNu=0kNt^_[h#h#u f0-. hPh#VVt$ hd##D^USWVhd# D=pNHsN1FjPlj+pNi5rO@QPh3#e |,Ph5[$?E;|ۡB3HQPPB3Q WHsN8tH HsN@(1^_[]h#+h#!USWV\$n;%u(sV8V8H4#KS84#dSb8 pNM5pNAt#~i9:0#I {pN4#4$D$D$=pNC1tQ~H$8?uEt$PTuuUt$f7t 4#tl4#K\$ueZ*t%tS-tU+ED#DA3x+;pN}#5pNit c#\$1|$ t5^_[]áDA3t pNiS#뚽S#SU"USWVpN)i5rO=DA39u=DA3)pN~9ut Ku ]t]tu`ǁTtCiu3itit0 5DA3^_[]SWVt$,kN~X1tttG9uމjQm ua19}q~5@tu ƆH ,kNt^_[Ã=0kNt^_[+5pNi5rO@Ph;#W+5pNi5rO@Ph{#kt!Zu忀ރlt puԉпɁuHsNtg8tbPh׼$7m=A3u =A3u@HsNtA5B3jPvW:HsNH HsN@ujٗW5B3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPhC&W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thP'#jD$Pԗ ] pN)i5rOC-DA3+9tti-;)t RPh#jl$ Uy\$D$PN$t+,D$0h'#jSDS\$NNŋCt:tBuM ,%Ph,#jQD,ingD,Runn}=tQ% l$ ,j SPF1 D$xxl$ ?SMl$ ō,@)QPh5# 1 h%jQf ݍ,PlMWD$P葑݃FD$ ݋\$GHO WH EuݍCWPF$u/1M|t؁Ph5[$WT N1MM|FGHO WVH GHOl$  W2H|1GHO WH ~T$KW}D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =A3$tCt>5@A39t%5@A3PV$=pN~y\$t$1=pNtEt*t t.<$u u/S0=pNu WE;-pN| $^_[]Z0# hkPh#*USWVD$4\$,tl$0|$WUS ƃuZ8= vNt,kNpNpND$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1opND$ pN$iD$ 9T$tcu tQ=@qNt 1=A3uL$,uP9tPtu B3P ,kNu=0kNtt~^_[]Vt$,kN9tP džƆ1z ,kNt^Ã=0kNt^~WV,kN5pN~%=pNFt WN ,kNt^_Ã=0kNt^_}WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#a5t$ntpupsND$D$D$t HsN8D$t(1PPS芒 EjS̟==pNu|$1pN-HsN~6@ pND$u}t!AH Et{1jP~ƅt9u ED$u :u G EuHsNt Dt111D$uD$pNL$L$t$D$\$l$|$ pN@1퀹ttt[uL$́Hͅ=u;1D$L$QPjX ul$t3u 'L$͊u/ <u UdD$pNC$jU9 L$tc|$tNuJD$1rȋi4hf#jD$(Pkl$D$D$L$D$u UD$\$l$t0~Ot)D$pNy\$l$D$tUD$tMjPS ?jVDžtjuS =A3u V. Ń퀉0^_[]h#ySh#ySh#yUSWVP1$1C11h#1it"gu$ڃjt puЉ̉( HsNt yjP6ƅt,1tpN)i5rO@Ph.#‹H$t#tH~1i0 tPhC&11G^_[]Ã~1i4hل#GB3HQP~G ;| Z %PG ;| B3Z;|lh#Cxh#9xV1=pNujt$ t1+^V1=pNt. pN~$ApN1F:uI}^V=A3tO=@qNtFD$t+ pNi5rOA1ɋB3u0VQhq#R載^USWVl$=pNu~ pNpN~"5pNHI},kNtfiP)Ƌ-pN=pNiPUV$ ~ ;uKuU l$hƋ=pN5pNi 1҉AJw)׉=pN ,kNu=0kNtu,kNfdž=A31Ɉ~1|pN1BtiP Ɔ ,kNu=0kNt]u^_[]USWV \$<|$41HL$AAA UQj蚶 ƅt#tFjUj} VSt$@Wl$\$<$D$ 5 ^_[]N0jUj0 V Ph{#uUSWV|$ @qNu@qN$kNqNt$$WW7~=pNu uHjVj u |pNl$t$t%t =A3ttttk0hWj\WjQt uurmul1VbVh%v%TtOh%v%h#tVj/uV5@A3tTWjzWjzt*=A3t!WjzWjzWjzupN^_[]KM0X hPh#sUSWVt$ l$|$1ۃ=@qNt/t*=A3t!ttSVZu5f@..@.^_WVt$ ,kNNJujVj 瀾tW5@A3<u%+pNi5rO9DA3t jVt=tu  ρπtt=ttu jIu V ,kNu=0kNtq^_K0% hPh#NqSVD$L$ =A3t1ۅ SPj ^[Ët$1҅tހu1=pNu2pNu) pN~pN:tzt Iuh#pN1@SWVt$$1@=pN|$(1@$#$&'Wh#bjvu htd#h\%tjjvjv t1~ h#21@^tjs%;th#h$jvh.%1Wvh#1Wvh#Wvh#jvu htd#xhi#kjvm~ t+u htd#Gh#:jv <u htd#h##Rjvu htd#h#7hw #v h{#jvh#jvu htd#h1x%;h#kFp]h{#P~tF1SwJh^#.Sw 1> #t#P uh#hvp$vh#v#'1R#1###1#N9tQhf#jWWSxuF x%Phf#jVVjv S hE#51^_[h#h#jvUSWVfD$ pN pNl$$1D$Uލ}<$1!# x$h'']1,$]&~'t!=\tD"t $6\$ \|$ 'UӃ#\$ t #T$Ӊ$Ӄ;$#|$ t #,$ߺ&!}D$ ##(} u,$#$.%)|"qT$t=Ӄu?<''t u9$;u<''_.ֳ",$,D$1 <'':''D$t#@ʼnʉ]|t GhJuJы,$ɉ/t t"@I pNpN^_[]WVt$ tG|$t jV~t'h\%h\%jVvu^_fUSWV$t pN =pND$P xvNt hvN|vN $=pN1jh('S eP >@Hx@u8/ZD$PVOx D$pL$t 1D$tD$p1ɋpN9pNkNtH1 8t:tGt89=PA3^ 9=PA3~kN5LA3WPV >DS#A=@sN jn V2: fiDle cDhangD ged߉V wB3HQPPwB3Q D$pL$t pNpNE;-pN1-pND$PĔ^_[]~>fUSWV<1Uj ?D$hhh UPj  R9u +9ÈpNj U蘪 pNjqNhd#UE ha#A3,$UhqN"ot$T|$P$kNqN@hY#('t1Ph~#QPP[V$=A3uA3 pNt N=pNuEt$(Vh#蒀t8t$P1TPV$wN=B3t =LsNtj''kuD$PLsNu/jM=A3tFhLA3)PA3 ,kNu=0kNt[`^_[h#`D$t LA3) PA3LA3j h#j1 6D$ HA3 LA3H PA3H @sNH DsNHDsNËD$,kNH DsNP ,kNu =0kN_Vt$,kNHA3;t HA3P FLA3FPA3F @sN ,kNt^Ã=0kNt^Y_USWVPA3<k,kN-LA35HA3DqNt|F9uuHA3PV  HA3HA3+ PA3 @sNLA3=PA3DsNtG90uC HA3 LA3H+HH x@WSUP  5LA3=PA3 ,kNt^_[]Ã=0kNt^_[]o^h#^D$,kNLA3)PA3 ,kNu =0kN4^V5PA3PA3@sN5LA3^WV|$ 5PA3+5@sNPA3)@sN9|5LA3^_ËD$ LA3) PA3 PA3LA3+D$ȣ@sNUSWV(L$@D$D$@t-΍i11P'wDGÉ,$Eu1ۋD$b B31AthF#sa1@e^_[]t$h#Sh"R,0 Ph #Rt$h#R|,0 Ph"#RfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV t9t9u1u^_Vh#RVh#RL$A1@҃Ѓ wAu1SWV\$1tZStMPh%SP 1Ft5Wh#S: t"uhێ"Sc t Ѓ s^_[S襎1ɅfVt$ |$FHsN(A3Ɓ2B3uA3jHsN LsNu B3 =B3=A3u't#jtjtA3A3<u=B3u A3=A3uA3PsN=A3ut 8-uA3(2B3u 3B32B33B3uހ=B3LsNu:u6pkNHsNH HsNPsNjPǼPsNpkNLsN HsNt/t_9tZAHsNLsNQt HsNPsNȣ\sNYsN8t TsNAx@uHsN TsN^{hq#OUSWVt$LsNH HsN-t+C11C<-t1Eu{-1E1 [A3t$YA3t(81B3uƆ2B3u ZA3@uă^_[V(D$ T$0B39tu#RPh#Jt#1B3t(81B3uƆ2B3u숁2B3^WVt$ ~t)~tPj uvV ^_USWV jA HsNt_y 8-uUD$$HsN1lsNP  HsNy8-@P1F PơTsN),kNTsN=\sN~-XsNFt7 XsN1N\sN1ɋu`sN ,kN=0kNH1F5TsNP)ƅTsN99S,kN TsN\sNlj4$މt$\$)1*C/5\sN9rL$ 9v!\$ۋ4$ P; \sNw4$ 9vQ9w`sN ,kNu=0kNtGW1 ^_[]h,#BHh#8Hh#.Hh#$HSWVT$ lsNtstm8u'1z:trrD8uAÀ~:u"9u HsNQHsN tf psN1ɉ lsND5HsN>1t6?-u1t+O^HsN-uta5HsN1^_[Ph#JGPh#?G|$u1PjPPf,kNjwHsN8t PI ,kNu=0kNtzF1ËD$Ѓ w#j jP^ u`sNYsNËL$~ND$tH  \sN=YsNu `sNdsNYsNhdsNh`sNQpphB#SFUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhd#he#iZ J|$:uUD$8@?jPhe#BZ ^jUhe#Z 1|$D$0)@<Phl#h`B32W jhe#g1?\$D$01@11T$4*l$Phf#j UiWhUh#Y D$EEjUt$0Y u0^_[]À|$:uD$8@:Ph#K1L$0L$4UjCfVD$ 8B31qqA1Ʌ xpN20PLR8B3p ]t u 1%8B38B3@j* 8B3 u^qqh#CPD$xpN/$QXUSWV'ơ8B3@tu'tƃ 8B3 x,$@D$t.$x"$18uWPtG|*'uD$tKjD$pH(t6NjpV WPVخ E$ht8B3@^_[]USWV8B3@|$u 8B3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8B3@@|$Fu6|$uD8B3@ 8B3Ap8 u\|$u8B3@^_[]jjX 8B3ASWVƻt u j pxʡ8B3@^_[USWV8B3kE1͋ 8B3x t*xpN,PN8B3@ C1Ƀ8Qs s j@8B3HOH O oKy K9t?U1CSp ʨSh/'P= 8B3HO@ G 8B3!^_[]WV@t$P 8B3A uyW  wWh#4*'h#j"Q Wh#j"PMRWY uL$Lx4*'h#Vh#jPRWUSWV8B3@1u 1=A3tMtݡ8B3@xuUj @jhÉGpjTaC+t8B3@tj (pƉ^_[]h#8B3t$p0h#_>USWV8B3@$ u8B3@$EŃCߡ8B3@$('$ 8B3APUj ^á8B31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjjljF j0G5jGt8B3xJjG B u08B3x,u%@2't@/@2'uh#jÀ=A3tjjj 8B3H0+H8O U 8B3p0jR@ 8B3QPI H pGu58B3~ h%vm|$F8B3xujD$ 8B3Hu 8B3H L$ qx0j@8B3HKH K {@;u.8B3x }8B3x|$ T@0GjG 8B3@t(HS u 8B3@8B3x\$\$j 8B3HK @0Cku8B3x ux,uh%p\jD@u:<$ t=u$)jWP |$l$$uS\uN@sNH @sN'\Fg u%@sNH @sN F4A3#á@sNH @sNƈF t=v4A3=t h*' u4A38B3HH @sNH @sNf=LA3)FV 8B3x4A3+D$^_[]USWV$$1҉T$ T$$D$(54A38B3r0=/'t1$|$ fw|$1/fFn D$j8fNLA3 PA3 @sN=1'u ƒ=@sN$‹nD>  $ )'=.'u f|> @sN4A3Bס8B3=.' f|> SD>fT$ NT!uhЃ`)0N,05,/L>=0'fu @sNBn׍MN|$*@01fD T.fTT.fTT.fTD0'fD1AL$1(ljƒ(M @sNFD @sNBvNO|$`@81ɃfD T7fTD1'DfDfD> 蕖 = @sN\GęT$ t$>Hff @sNT$ Bf|>D>u6t$< nMn @sN}f|>  @sNBFfL \ D$$D$f|>tD>t @sNBf|>u D> @sNB @sNB:Ã{t 2' @sN}E+=LA3 @sNE{|$ðD$ #{w#}cD$ 1@Xftf|>u f|>Iu6v $ nMnD.=.'( @sN ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD/'fD @sNT$ B1AL$ Y) NjFfL @sNB)H 4A38B3@8xt xpN xpN$,9 Nf|C\:`1" $}f|  @sNT$ BFu6$1 Ft$HFf5D$$D$UP`ſ1۹$H)'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD/'fDu6t $ FHF @sNB^= t]譑\t 'u 虑 t =u 4A38B31Ƀxɉ xpN$ 7 @sNT$ 'uF|.' @sNF$o0'$< u @sNT$ BT$ @sN c/et$1  4A38B3x5xpN02'ωD$Ѓ 谓}\$f0'f|t @sN @sNB\0' u @sNBNf|t @sNB1@D$v @sN @sNB݃"XŃ'K D$0$Ү nt$T$ Mn @sNB1@D$t$xpN$ 5U @` Ń< ?\u\ ? \$1跎HЃ w&Hw ÃHÃéOu \ @sNvNO|$@81BfD T7fTT7fTT7fTD0'fD\$ I'L$ ur%=V =@sN D$  $ swF @sNP?ˀ @sN@F @sN x?ɀtw @sN@ @sNW?ˀg^ @sNGJT$ :,D$sNsND$D$$sN1z2't.@sNH @sN!LjG 2'u\KЃ w4@sNH @sNLjG ÃЃ D$ u t @sN׃Zn @sNH @sN=Gt/ up}tk@sNJ @sNi#@ǽh#tE%t@Ń:b D$D$$*'¸U1#, 9u茎1|$Nf|uf|t Ms@ LA39T$ vNK؃|$F@11fT T3fTT3|3|t3ft1BfTft|.'fq fq ƋT$ llNH llN~plNH plN 茊ËFD6\$D$$*'1*')G @sNx ?ʀtw @sNE @sNO?ʀ @sNGZ @sNx?ʀtw @sNE @sNO ?ʀtw @sNG @sNA?ʀtw @sNA @sNH?ˀ; @sNx?ʀtw @sNE @sNO?ʀtw @sNG @sNA ?ʀtw @sNA @sNH?ʀtw @sN@ @sNA?ˀ[" @sNAD$ ??s@sNH @sN~2G:@sNH @sN~$_1:B ܿˆB1.'nD=1'G=.'tf|cf|.3@sNH @sNk5LA3Gf|uNT$ ؃t 4$t$Kŀ>ts4$Ol襉T$ )B8B3L$H,L$H $貾8B3pM tΉ$B Nu8B3xĨ^_[]1HE;qN} ;pN~pN>uxkjy1$&tu>tyu6EBE9E0E"EEEA N}8B3h$ Ή$ Nu=tuS$D#$[#4A3 8B3A0$#^$h#K$#?$#3$g#'$~#V 8B3xt@@ ^Ãx t#xpN$)8B3@ @8 4A3H0llNH llN~plNH plN0ƃ~0:=F $)'蓃 t=uԆ럃F~t\u^d 4A3@4A3 8B3A0ytxpN KxpN$(*;|u0d|8B3@=t*4$D$D$.'4uۡ8B3@1v u4A38B3HH @1@Q&8B3@-8B3@8B3@&tQ;ub8B3@ H8B3@-8B3@8B3@ 8B3@u菁\u?腁 u64A38B3@81Ƀxɉ xpNP&藄jjh_"薄 /Vȋ 8B3y8~0 @sNQ@sN轹@ 8B3Q8rq8^USWV\ӉΡ8B3@D$ 1,$$kND$資+LA3D$$UP,kN$~Sʼn$S5LA3P l$|$tD$$$kN ,kNu=0kNt8w4A3D$-LA3PA3@sN8B3x t*xpNP%8B3@ ǃ[~!\u9ǃ[C tJ$Q u"4A38B3HH s`un=ub\tX`tS4A3 8B3QQ NDt""u$@sNH @sN~E\E \@ŋ @sNA@sNٷ@@sNH @sN趷ELA3@|$t~PŴt$jP D$pŋȅut$ j蚴E8B3xtH@1D$4A3D$j7ǡ4A3D$4t5 8B3At$ D$AEx蠄8B3@t$ Ex PA39ًl$蕵 PA39~=LA3@sNt1SUWK )@sN,kNU $ ,kNt\$=0kN\$t 8B3T$ Q$kNNf|u%Du @sNQ@sN@Vt$+t$ @sNQ@sN@~.F@sNB@sNȅɵAJ։ȃՃ\^_[]á8B3L$H0h#WӃ<$t 4$ /8B3@D$$kNjPjj jjVtQ躛 N^V 8B3d#ytA5xpNt7t u(vNwN54A3P5xpN #^USWVt$,|$0l$Uز5PA3ݱ1BW;LA3u(VGsN9w&sNWVS% U跲^_[]Áw: t9v$P5sN tãsN$sN랾"#뤾0#USWVT$L$ -$kN'Ɗ*B3@kND$1|$08B3D$|$ljWtJD$8B3*B3Vށ-$kND$@kN(kNd#jU\$t$l$=$kN1F5@kND$08B3$V\$S茀 vzVh/'P 8B3A |$t|$t=A3u #@݅u:T$1rIJ$JB *B3VVRK -LA3=8B3D$*B3t$܀D$$kND$@kN؅tȁĤ^_[]j|L$1jRfL$1tT$9Qt uÉV sN1t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu sNtu(Mxju PQ.Ex PxSU, uF^_[]USWVl$ t$\$|$t|h@VS VSDžt9u 9t SS9u95DB3}5DB3^_[]Åy|0艱 PVShe#WRWVSh#USWVt$ |$\$l$j蜭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jH@ sN$sNM|$];qN};pN~pNEu9] usNtX9X5sNt-pt 9^t6SLF9t SQ sN1tF9Yt? sNtHt 9Y jjSQ PkD$($@t 9XjSP1x,kNsN  bsN pN9|AQjSP ǃt;=DB3~=DB3x jjWkP j蹫$JBXxp ,kN|$u=0kNt usNt$(WUN mC1O ntuK5sNjSO DžD8t 8ujjSO Dž0蘮 PSh# \$t B3tB3|$t B3tB3^_[]j W PSh# /0 sN1tT$9Qt uÉVt$5sNj V O u sN|Qj VN u8FPj VN u$j j VN ujj VN t;DB3~DB3^h# WV|$ t;G;sN|.GPSƋG9tVPWwNw^_WV HB3 A HB31F |71FPWWN y w;DB3~DB3PXNgfff  sN^_USWV$$$~,kN 8k$*'n  sNt9i V sNtQt 9j b Y<(O8=A3tNnjUZLƍD$PV1#D$ =nhh]n$SUKoƅtjVL!SjVoL $/nhh nhh UK ƅV;5DB3~5DB3|'u" A39uu-jjWL 9t1jPWV ,kNuQ=0kNtHA1jPWUy v 0褪 PWVPWK ,kNt Ā^_[]Ã=0kNtĀ^_[]4hh j R PWUh#~)06 PWh'#c1F5|kNV0 PUhs#98VLK8|kNj0 PUhP#USWVPlxa|$\$;DB3~DB3oU= VUSX 1jSSܑ t!t$J$^_[]h#z4$J1EUjDUj9UU/Uj$Sj Vwt$  SVD$5sN,kNPV]sNVՎ  ,kNt^Ã=0kNt^l1=sNSWV5sNt4|$t^tCx PIjV6u^_[SWV|$ DB39|ȋt$|9}9| DB39tVsIjjVW 9u^_[WKIS PVh#WVsN |;qN| psNt$ Pj VH y28t 8u>sN jjVtH ;DB3~=DB39t VH^_Vj 蛣tL$ T$5sN0sNPH^ásNtT$sN9Pt u[HP IHUSWV$|$<\$81D$ $D$1F57U5$3h#WS讀 !1tbh$WhE#Wuo1h+$Wdthv"WRt D$1p@|MD$K}h&Wt8D$D$h8#\ j5B31CKD$D$u}h[#~ v11 t=t8t8t6~ tNr1tNhkN ,kNt^Ã=0kNt^9USWVt$1u=tNtN1ۃýsNt6sN8t+,kNSP] ,kNu=0kNtsN=tNru t^_[]^_[]V1=tNu#sN1A:t2>u tNr^WV|$ 0=tNu =hkN1=hkNu0u+t =sNu"=,kNtW=vNuN0kN]tEQu95B3u V^_5B3t$WVt$ Nfu4vNFNtF t0fu^~,kN ?NQP膏F N)N,kNvIF FF ,kNu=0kNt V N^_Vt$F t-)t'VfxQPR yNFN F^5B3t$USWVP|$t$j'V評t~th#VQs<k>t!h+'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=B3uUWMGHO W]H"WVGHO W3H"^_[]WVh+'QHj'V諓t)19<>^_hLB3oh`B3bUSWVD$~@|$l$1SWU. t 8tF r)~1H^_[]ËD$)D$,kNXB3tPu 1XB3PB3 ,kNu =0kNRPD$L$ T$$RQP XVPt$t$V2 tt$ P4$Qu ^h#ePD$L$ $QP5B3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+wN+DvNPqq h#jhwNwNSWVPLvN,'C PVw u,$$wiCGσCGCuh wNVh#8 u*$ wNwNwNwN^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<wNt>7t9^ uSUv*A t61^_[]ËD$t8SV .ƋwN`uwN$1s wN#t#$#t|&hwN㟉wNt$D$$# ^[WV<5$kN1$|$PWt $D$PL$LT$H=$kNPQR 5$kN$<^_USWVL$T$tHtA|$9t912'Írjt/9t+12'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UӳV Ƌ $A$~ C@ $Q$f=t @UPYWVp ^_[]SVh#WV<5$kN@kN$|$jWu"D$LL$H=$kN@kNPQ5$kN$@kN<^_USWVD$ èu|$=ZA3uÍD$PQW Ƌ@N4,kNNt%݁ uF @VSPу F`u vp NFtʁu F11ƒʎ! stځ ʉV~t&uفuN AVSQЃ tvNt`vNuxvNt j} ,kNuk=0kNtb[r2jXxL$H @ $  $#`uWo `u Wwo fy^_[]vv h#z D$@!|$$~L$( t 9-uD$@-=TsNu0@=LsNtc@=pkNtf@=A3ti@=A3tl@=pNtp@=B3ts@jPh#,WVt$|$ ,kNtwVP~? ,kNt^_Ã=0kNt^_(WVt$ t|$Wv 6u^_USWVP\$,kNjwƀ;-u {l$jPS5 tjNj@F GFGFG0 t uuO tGT$< =uFR,SP}j=SӊSUPfu< ؉G@54B3蘃54B3hTA3Pz ~ F1gjt$vNuQG L$<=u5HvNHDvN2UjS $81F FFDvNvN~wN5wN ,kNu=0kNt\^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ tkNt8Q12<08uF=u =ut j=RMF^_[1VVP tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVwN1tr:1҃ЉuwNr׍PƻwNNj+t7Mȃu%EttUЃuEmŃwNr^_[]SWVwN>tLGu% uwj Gu#Wj @tw"Gg;uwNr^_[SWV|$tfh#WceWX9uWh׼$V't*tUj'Wxt8)WPh# h #GhO#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhi$ctUhi$Q>=uDB3HQP~ j( P B3j)n~=uGuthj#EUB3HQPPB3Q ^_[]USWVPwNuwN h wNT$ t$\$wN1<$?tIOt !T$ ttуt݋ wN9|QP~T$(wN%wNt=t @sN>:G @sN:pUSWVD$(01r$11h#1t7ptnuO1Gru=t*tHsN8t$jUt$VD$D$^_[]áHsN8H HsN(tϋ$ЉD$D$D$ P1PU L$ \ =u4)Ftt.L$!H=tFt=t Utvtt($t@u7=t $ H 4$VU HsNH HsN(e&UQh#\ 1@D${1 Uh4#9ru Qh#Qh#V tX1h\#膕Mt(IuNt xuփуVPHsNH HsNu1^hJ#TUSWVP\$jPS9 1NjT$@tуu1F,kNuaՋOW | uujh('S GuGOu' u wd  $Wd G ,kNu=0kNt^_[]SWV5wNwN~tFu7jwm54B3v hTA3G v d ENtuV _ BWPRу G u wc FGF GFGVc M^_[ËD$ *ÃuD$jppk 1h`#USWVP1$1E1h#Qe~ft&vtxu teuԃe$뺋-HsNEt=$ ˃1$u P: ƄuWu ƋEu1^_[]fSWVt$|$h &6Uu"h#t@DO1@$,'N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h# h#WV|։π9!utNwNtfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPAI1>?f u%PV.1u%#L$1PV-1t1Ʌȃ|^_1@Ow$,'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$ t$h19{USWVӉϋuwNfx@$ -'$PW,1ۅD$PVk,r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW+1ۅD$PV+$L$$t$<|$@11$;D$D9t$ aZ$PW=+1ۅBD$PV%+,$3D$ $3L$ $$3L$3D$1 dVW詡1ۅTVW虡1ۅfVW艡VWu1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]ZQ9-u1tQyt8ytBÄth #Q}X.'t1h jjh@.'Qh jjhP-'h jj h-'RWËD$L$  )VL$D$ 2)u AJ)^USWVPj PV lj8t"ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#Vh#USWV׉荾t 9Fup  ^^9uM1PP~ōPqPU~ LH;NuS/[ #~^_[]ÐUSWVt$(hd#jq D$,^H $x?-Ok-u)sstdluu~xwGWÅu"3DHt'1Ʌ SكhJ#h3DH\ƃ~ƀtV=tVVh0#jރ $h&SX1Ʌt:Su+$891V5B3IV|-$K$8ʉT$h&W1Ʌ9ufمu$1D$\$ $,}%urUXDžl$UWhu.{&&|u" $4Ph% 1@D$l$t jW_j D$PU ljӋD$9t-ف8ur1u 8tQ##xd#UPh# 1@D$\$ $4hk#1@D$F \$ t$lPh$jWpkNPPPPh#5B3j4WVPΉj WQ 9u=у|=}^_Vhz#jXQh#j5B3 jWV@$xlNLlNHlN5|V>t)j=W7tthW}>utPhf#j@VjVh# VhB3hE" GA$VWh# p#t|&VQh#a j,h#h#M VWh#>L^_<=(kNt 1llNtlN>8B3tsN1sNsNtsN9sNtj=sNuB3LB3B3`B3B3tPU B3Vj15`kN=CP0kAQW1^_[SWV|$t$5'$4'Vw vVw d_ t"Vst Vw?w@N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u5'E$l5'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tQ Ã|$Q USWVPu }wNwNB3f`|j%vnm O1@ 0wND$,wN|$@t$(q%v>%L$ h#V<*u C hÃ#S1N .u{*u{ 1HD$ChÃ#S1HD$  t$CD$'C`L$&~QF0 $06'. D$׋L$ jj D$tfL$tjWt$QPhxNTFu$6'wNl$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhxNܡwNL$ Q05|$wNH wNT$ l$=wNuM|$L$ jL D$tbL$l$tf|$ L$D$$xN>d\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$xNL$\$L$$X8GwN0wNE ƋL$ cjl |$D$VPt$wwNwNwNwN1  wN wNWt$*|$$xN \$$@xNwNt PM VڏPT= wN҉D$xF\$wZ$6'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V@xNwNT$t PL T$wNwNt PL T$15wN5wNЉ\$H\tF5wNX])P0tXM\$u/^t-u#F5wN벸^tic\$>T$ j5wNF5wN{ 31:DYt 7GuF5wN\$DF5wNȋ\$+1L$ jlD$t1L$t5WQg@xNL$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hxN PRQt$QP  wNFPJ: wN VjxPŘ 7swNT$t t$L$ t PVRQhwNMT$L$ t1PRQhwN.VWhxN1PQ*t$P PQhwNc twNwNT$z \trB<]*<0tu$6' ?$6'."'#Eu uShi#wN 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h##\wN\),ҋ4$u|$ uWh>#,wN ^_[]WVPwN0tpwNM1ɉQPV迶 Nj 3#DQt$c#r& wN+ wNVQP蠿 wN1^_SVˡwNH wN u:B3Prp~r0 PWB3Q 밅uwN)B3HQPP B3Q^[SWVPwN0t"wN<'t<"u1B^_[11f1ɉQPVx lj+t:<-t6 3DAu)wN+wNVPh#z wN $ڃ^_[SWVӉQǃArVh#1wNGPVhxNg8 D$wNwNƇwN^_[USWVP׉1PPP ,>UJ@PUQ x$tG9tCwN+wNVPh#蚽wN+wNVPh#< wN$^_[]WV9t"΀:t9wN+wN9t\VPh#ZwN+wNPh@#Dl8"uD=wN+=wNj"e\ PVWh#RPhd#ټ wN^_USWV\$$8l$}h" j jhD7'Uƅu!h" j jh(8'U٤ƅH h]D$hP11F ntD$PD$hP^_[]WV΋=DxNt0VarIr6h$Vh׼$ߚ*V5HxNhE#ƚ Vhɇ%趚DxNDxN^_ø*#tfAuRhf#jhLxN?LxNyfLxNM-NxNuf^?^@P@LxNÐUSWV|$$71hd#V0F 5 3ދ$391D$D$,h#UD$ U"q9D$ urh#WV" wU$<'$j57U2l$D$y1E$39zD$1 $3l$|$HL$Oȍ$WQ\y h&jt$VhBt @vb y h#3D$tPhht@pnb y h# D$4Pht@pHb y h#Ert&u+;?UVt$<$PW W19D$@D$<\$SUYu{SU[umSUu_3 $1DHu$jh#Vep VWVPW,VWrD$<$H $xd|$<tWjt$!P y hD&s|$@t'D$tPhgtt$a y h"#j苎57Uh׼$.1D$@D$#uFj PVO y8u$8u؃^_[Vh׼$jWVh#jUSWVe fTNdxN LNƒ LNhxN LN€ш LNlxNL PNpxNtxNhG#[-t h#C-t8ƿA'#PVjtG uVh#j $$1ɉh4#SU P6$<'xxNkj j57U ƃuQx8"5dxNxNv 7UflxNWj j57U胗 ƃ _%xNj j57UC ƃuw8"G5hxNxNxNxN1A57U57UhL#Vitch`#VhKxN|xNBxN|xN/lxN#v8"tD5pxN  9upxNrCjh#57Uh##VhR#57Uh|# 57Uhc#ju h# txNt 1ҁ‰xNLNփ95lxNu<9hxNu2TN9dxNu#PN9 B3t B3|xNxN=xNu\1ɅQ舅h# $3=xNt)ͅt=xNut 1jhhxNP4- $yhxNh׼$jb=xNu1D$(Pt$[Qu#D$0=u |xNxN1N1$=' $$h #(/"t$h$Qhԓ%hV݋V贮thP$P`$Ph׼$B xxN4~N $=4~N=xNp|NB=hx@#t訏t1@$$Phmdt$ hh#h|tWWhJ$ $=,}Nu ,}N =0}Nu 0}N 4$h|N TxN $$1 uWhPh|N$F 1|N|N|N|NtjVh|N> h|N\ $RhS|NhxNVW0 5xNVWF5 W bl$t$D$ 1ɉHHD$UD$ Pj] Džy#q8#Bj* x߉DžVnx9ujUj  1|$nhx@#$Pb<hjh|Nm ^ W2at $h$h|3B(3H (3~$3H $38h$3"bljt9 t4(3H (3~$3H $3h$3aƒ߃NyjUj h@#1|N|3hxNVW4. 5xNVWj3 h|Ndtd($Ph׼$9$PI1@P jUjc +P PhQ#:$$tǍ$PWh%V(D$uh"Z$PƩ+%jPhg_#QQƃu W4 VaWVθm#>'PVtxNt49t0`#`#9tL#9tL#QPh#k 5txNÈJ9|6{u;[tVPWhE#D$(ffL$(D$ 1ۉa)D$u!)tPt$h#L$4 <)ǘ΋I<9vt$h#蘍$N<.”T$9vt$h#l$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h # D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ,}N0}Nt$(L$QhV?  D$ 1h$VtG<$h0#V薭4(1>tYj:W1D$AL$\$h0#SN,1tD$h1l&WXtkh]$W Xhv$WW\D$Ph$W> D$q;pxNef*}Nujhd]&l$!U l$B'1tUP* QF4C'r܉1hD$ Pj <$Wh"$D$ D$t$ <$}trÉD$h"U6* t:h"U$* t/h"U* t$UWh`$蟊 F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh$+D$ D$|NFʼnD$uf5|Nl$u D$l$l$hk%WUhu%WUh$WUh$WUh$WU h$WUh"WpUTh$WZUh"$WDUh/$W.UUh"WUkh3$WUh=$WThJ$WThU$WT<w ~W|$Whi$p T1<$|NjD$<$rt$Wh8$A D$f|N@<$Wh$$pxNf*}NjUh|NjUh|N(. <$t$ht$0V J21jD$ Pj< D$|N뜉1jD$ Pj D$|Nq1jD$ Pj uuD$|NJ1jD$ Pj uND$|N#1jD$ Pj u'D$|N1jD$ Pj^ tt$W|$Wh$ĆD$|N1hD$ Pj uD$f|N1hD$ Pj uD$f|Na1hD$ Pj ^D$f|N11hD$ Pj .D$f|N1jD$ Pjc D$|N1jD$ Pj8 D$|N; pxNsr"jW|$Wh$W|$Wh$΍L$$ t$4}N|$HNL$$ L$8}Nt$HNrh0#VDl$}}='1ۋ>t.WDOLt t uPUW Á>'r D$3MDHu D$"91hD$ Pj t4$h"$aD$ \$"r)Ut$h$B h $5D$1ۋD$@}NND$@}NWlN4(t$|t%h0#V  L$1Ҁ<tʉT$D$< w'<$$='L$ L$<}N<$tL$$L$ L$<}N|$HNcL$$t D$|$HNL$<}N16FL$<$C fF|$HNL$! L$<}N|$HNt8L$$ D$|$HNtL$<}N11A<$D$ h|N1D$ ȁ(^_[]4$h$mD$ WVPθWEV|N$}Nf(}Nh|N f(}N=|xNu=xNu#$}h|NhgdV 1h|NhfdV y#\8t \8uv$=xNu(PhmdVn xX5B3h-Z p1=xNu$h|NhgdV2 y <#1G^_ù+#h#1 뙃=B3tt$ t$ t$ = e[1HVD$ t$=|NthPh|N. ^D$L$01LV[t,uVh#-t"uVh#Vh׼$VhM#Vh#舀^hDNhmd5B3& USWV8 $RPh h8~NQ8N xNv|Pt$h# lj D$T$1D$ XƉ 11 ‹l$N 8N8~N98~NhWD$P-- $;D$d#=4~Nt =}t=}uЉD$$#=xNtȋ xN=WEVuT$tf9pxNrD$Pftt=xN%4$t$Uh#~ D$t=VEW=xN$t=VEW4$t$UVh#~=xN|4$t$UVhF#v~=4~N$D$PSt$Ut$Vhq#=q=xNu $hxNS|3V 5xNSVI SGSt$VhVW+ 4~ND$ L$D$11t4$h#8^_[]USWV T$ $11F1Ń=xN|Uh#f} QPWD$Pt$9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=xNtUPhI$| Ɖ ^_[]Ã=xNtUh$=xNtUh&$b|ċL$T$tPh|N11@Ph# t"j QPu uMV8"t1HhxN1Yh#j~Ph#s t"j QPu uV8"t1HdxN1Yh#j5SWV։ϋ\$+xNtItEuxN1tGtB8~NN8N9w18~N 1tth|NQA1@^_[Vhi$jjL$1=lxNT$ PG1ɅɉWV8N~( WRPh8~NQZ 8N9u ^_h$uQVh$j PQVh$jUSWVPӉ΋l$|$uj WV!t EuT"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h0#VG<t#ƍFh0#P1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh;$Wh$py1۹HN؃^_[]ËL$9/up|ND$\$A/jPU u$D$ |ND$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh"$xHN!Wh$xHN1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh$؜D$$Th$Sut]"C'WBPWSC '> uۀ$U-$T14D'D$XP# tpC"uD$TPhQ $i$T$끹5 $D'j" $eFMu SQЃ {Sh$Tih$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$hR$/$PQhk$R~$ $u ~ˍ|$@WV99t"b&J~PH k$C'1OJH w@$C' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=\NuHr8jVSW1D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph? $[hN $ [~USWV|$t$t$h"V] Gw4E'h "Ph"Vc] GPSh"VK]GPSh"V8]VjjhEa&&GXtVjj h" GXtVjjh" GXtVjjh" Vj iw(h"V\ w,h"V\ w0h*"V\ w8h?"V\ w4hU"V{\ wu 1<1A71Au01<  $jj@PD$PxD$ Ph׼$RC9u<$u43H 3~|3H |3 h|3j sW1^_[]h $j:fUSWV $ $ D$-@1`NdN`NhNlNhN$pNtNpNt$ h $US c~!P$|F' xN˃PtdT]=7U?1AJ57U觛|N뒹 .7UpNhd#n xNb xND$NT$:@=`Nl7UD$ Tnt uBxou D$ 1Ɉ Nh%V[Vt`Nhd#`ء7U$j:WC-hNtWu)tmhNS c$ \WxNtxNt |N$39$ 1ɉL$tVh$P tj/Uu Uh"ho%h$ UMVDžuV$Dž7h$P# Ƌoh#W't(h/"W'th $W'pV 1QQ$ 4PU7L$9C9$ $ 9tUelj?,$u1QhD$PQV[ hNhzd@P tq$ PhedAWs W聞|$ W$%D8$9",lG'uW/8N,$ho h 5|NP Ġ ^_[]h $j$Ph׼$jVh! $jyh"h"ʍD$ Ph $ D$ Ph $j~D$ Ph $롍D$ Ph$땍L$ Q4F'hC$USWV։ϋl$j Ve UZ CCCOK G^_[]E2hG'Phs$hԦ3OjCUSWVP׉΋tAS#W#4$4(VS Wh{$Vt$ PJ W É^_[]USWV|$1_h#S$t$h/"S$th $S$u\`NtoU3$t[u=Nt .=Nt%pNtoU3x$t [u^_[]USWV$D$|$hNd#tW30$t CÅushS$t$ $uD$7%D$ Nt L$ mt L$ ^$D$ D$h $$ t$hM~%hVI$0|$D$4$L$h%QoP1G@΍K9|,SP Ŋt><-u(GD$tj=Vt>FD$ GD $th%D$POu|$1F1B,$֋$$$,$DxNtPd#tH"P$hL $\I xF1Ë$4hɇ%@IC9uj OHWt2ƅ|$t t$u 4$j tA710h\ $&|$t t$@ 4$5 ^_[]ÍD$jPVy x!L$ȃtuuh#묁tlP PUhE#KU 끉 xNutD$P$NuW$P$+!u6Í$Ph׼$蒾؁^_[]hx$hZ$.L܋NЋ$ t9‹-N҉T$։鋔$ t$ t $9|ȉ$mNu\$Nt 9Ct,Ph$K$PnUu$ȃt1{ $ t#Qw wwh$I>$ȃt*t&t!Pw wwh$hԦ3@ OtHOKtNG8=N t$w7 w, W# CNH N{ t t N NI N;D$\$9NMŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$PS\$tqNc8d#t[$h$Ph$hԦ3)?5N.>6$SWV։ϋY Wss ss҃ Nt~j Wss ssԅuA N^_[ÐWV1t$|$ ɉ @4u)ȉXȉX\ȉ\ȉѲ豲葲 PQ40]40<8=<8D@D@LHLHTPݱTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40C40<8#<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7艰Vw wvV FwwbVFwwNVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu1SCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0ѮS4C0EHȉCHudh$VŋFNHNtbSQP HNx N~,=ХNtffOfGG@ Չn,~$N()ǃ~$N(=N9<$D$hP-N>N,ș)N,)n$F(teh$V$FNHNtbSQP HNHT$<L=ХNtAf=ХNt4f.<$ ^_[]`NNF,)F$N($fOt@ `N븋D$L$t$ QPQPUSWV$$$ $$$(hi$SV\1j o*D$SVWUhPD؃r_N95NrPSV Pt7=ХNtf% #=@tt|#WQh%d Wh$T^_[]USWVP|$\$s s@=ХNtf9uRȥNt=Nt=Ntj:D$1PPPs sQs s6O N3C N3K u B3&=ХNtf% #=@tt|#Qh$胣s s/)SUh$) Nu =Nt:yj (h$NthE$Q[=Nuh$u=NХNt7t;f5`ND$ȥNjh$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=ХNtf=ХNtGf #@tt|#Ph$/SVz.=Nt)1=NL L h\$'Zh$$p$l tRQf@ NN 1VW B3L$@D$DD$ t$|$ Npt95ХNtʋ N5ХNT$Htt tɉL$LL$QPh$=Nuh$515B3PPPj NN  5B3RPjjt:tN=NhQ$XD$L$ NN5 N=N tYjj=NHХNtt,fI=ХNtftfI=ХNtfIfHVW51 NN9Nt-j J% NN djjQP NN AQP=ХNtf%=@5 N5N8,$t$R=NN t# Fjj WSި9ݹÉrFND$P9|$P$d닔$hjj RS蜨 )ˀ0^N9whE$訞hc$Ntf5 NN15B3WWWj NN CRP5B3jj_h$hn$1`N1P^_[]Ë$d#N N$tҍt$PtV$lSUQP4$SUfH1G@u5 N5NhQ#SUu.$l#$pthQ#5 N5NSUq5 N5NH=NХNfA=ХNfh$`Nh$hlj_{[ |$t]SW!ljUVSW3)SWlj?UVSW )Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV N1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =ХNt SW PNL$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =N<$\$T$|$(t$,DpLtL|Dx=ХNRS*TtDpPND$0X0vvRPVFvv RSБVFt|tx|$8趑D$T$Rl$$D(D,=ХNtFB\pTtPNB0FN FNDxD$L|׉L$L$؉D(MU =ХNt]RQ2 PNI0VPU EMhɡPN@0 ȃ=ХNt3ȃ=ХNEhD,t($PN@0MU EhEhD,=NL$ tL$D$D$=PN,$\$ 1QOP\$  t19}#8@#pLp0l$$ HNɋD$taVt$P= HNx4ƍ$5NpS5 PN@0fPt$t$ HNx5NSp N=ХNtf؋NfB3PNB09}+^jhB3SP NPNB0N9rF =NtL$L$ L$ 1YJP|$ uL$ 19}#8@#rL HNtaPt$t$$ HNx=Nt$,|$(DxL|DpLt1҉TxT|FN=PN<$09ХNQP蕎)RP肎VF^vvk )RPZL$(D,D(D,EM =ХN\$QP  PNI0)RPU EEhhȋ5PNN0 )ȃ=ХNt^ȋ5PNT)FN^FV )S\$L$4$*5PNV0)EM Ehh )ЋL$Ev8QS `N1Ą^_[]ÉjhB3p $Ph*$k=Nthk$Gh>$߻F & PN@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F3 ^nFD$hF$D$pFD$lFNpt =ХNtɡN=ХNL$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=ХNtf)9F=ХN\$tAf)=ХNt4f=ХNt'fL$=ХNfVT$Rt)f~T$JR>>fD>=Ntq1@1$CD$ƈCCEUL$ q/G9<$u1A=N=N\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=Nt Vt$t$Ut$h$1Ƀȃ^_[]1A=Nt1=N<$\$ HfUSWV $8$4}tE1ɉM4M019 N‹DT 9 ХNtRPM$U(E$f M$E$U( u ^_[]%=uLIPN(9‰|ǃ=lNt<|u=NtFNFh1 tNtD$hVP> |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =ХNt RPÆ PNI0VQRP芒։D$D$ ЉT$t PN=NQ8k=NL$$tL$D$ =ХNt QPE PN#8t@DQL!!IT u‹$8U t#DT tE=ХNt!RPޅD t(=ХNt1҉EU}@U=}@|$`NEM QPQPh$3WWhw$聇h$'uQ{u u PNy0ƃ=NХNt:tMPW ?UUlCD$T$NQt PWӄ~V ~V ho$?ĥNLN@ 뛋5PNF8E -NT$$tT$D$ =ХNt RP]v0 I)؉$ʉT$t*DT tZ=ХNt RP$8D t6=ХNtȋ$81҉AQSt$t$tv<$8}@ud<$D$|W`NE$8I QPQPh$3UUhw$薅h$<$<t7PNHt)$|$-NCq qƃ=Nt0FV=ХN|$$tJRP)RPۂ4FV =ХN|$$t&RP蹂)RP諂)FV )FV ho$<ĥNLN@ USWV|$ \$tN9NaN N ‹-PNt9ˉrux9ˉ\$؉jL$QWP΍ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סLNt`v0WUL LNPNpxjV|$(WSL)Љ NN=NjVPS$ LNA^_[]WShG$LN@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$PNp0vv_ $G PNy0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPƋ19rÃ=ԥN$t$ \$ti=Nt,ۉ~A1_t4T\$F9uۉ~1O ɋW @9uG W5N萲t$ D$x PN;Xt|$#=Nt JًL B tmt$v vhN$hWWVt=Nt$$B1ɉL `Nt$ $$Bt$ B CPN;Xt`R5N踱T$\$1ۃ=Nt%JًT tN=ХNt#RP?~Bt/=ХNt1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb`NL$AI QPQPh$7W]Whw$h$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=Nt+FV=ХNtGRP&}+D$RP}1FV =ХNt*RP|+D$RP|+D$ډFV +D$ډFV ho$27ĥNLN@ 1@$5USWV\$41F~3|$0l$,|!N N9|)S9у} ȃ^_[]ÉދPNK89}=NtOI.A!1‰9)=Nl$,|$0t!t$4PWUh$PNPVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=N!$l$|$ T|$0tN# $ND$T$RPWUh$f PN<$\Ttq!qIVPt$ Sh$$@l$19=Ntk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh $PNt$Sh"$1Al$,|$0USWVD$,\$( $N Nփσ5 N=$N11 J ,N9(N6 4N0NN98N@D$ 8N=PN\$jD$ PL$QT$Rց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ ==ХNtfPh#$=NtqPh#1Ƀ=NDT =ХNt RPJpRPh,$ =NtF(F=ХNtjP|tPh7$^_SWVD$H8=ХNt3P PP0p4u'11C9}QBRQp< P0p4^_[USWV|$_8+t]Cw=NRMT$=ХNHRP_9L$0ơPN@0 T$D$=ND$0T$T$4=ХNt$$t RPa_Mt$t$$=ХNtȋMD(PN@0T$,‹t$(΃=NХNt+tMVR^uVFt$t$ ^7KVR^MQ AD$:MQqD$T$AQ!EL$DT=ХNt1ҋ PNq0RP耐 ƋL$ jWSQ'Ӄ=ND$ t7~SPt$t$$NjT=ХNt RP^|$)~SPt$t$$̼=ХNtȋ|$1҉\$$ t/f PNq0RPݏ xËD$L$ L$0|áPN@0 T$ʋL$ȃ=NL$0T$D$t!D$4=ХNt)PQZ]D$ T$8=ХNt@ɉL$ D$ =Nt h$X=Nt h5$XhX$X/=Nu h|$WX=Nu h$W3=Nu h$W6=Nu h$W<=Nt=Nu h$WT PN|$Y8֋T$  SP5N5N5 N5Nh$Wd,$kdыPN@DWSQPpD$T$iщډWSUR5jj RPRPt$t$t$t$t$VD$Ph<$$=N PN+N NN NN N tQPhr$i =N-PNKC)s, N-NՋs4HS8\$ ډD$$+N$T$N $ $ډ Љ NNtRQh$ =`Nt8h$5`Ntvvh$~ 6j =hNt8h$Z5hNtvvh$= 6j O15hN5`N5dN95NtmjtZ PN405ԤNh QVe 5\NVʍ=ХNtԤNPPҞ5ԤNzؤN=ĥNt `Nj PNy,t+N1TtRo N PNF;q,rNPo N=ȥNt =ĥNth$SHN1=N=Nu h-$S=ĥNt hT$SGRtgD$Phb%u1D$t)L$ jQPhb%h7%5ot-=Nu ht$SS' ^_[]1USWVXND$45PN~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B Nl$9؉|5PN|$0G;~,$LHN4H~KT$މ)1@ N9׋T$9|5PN1҉t$L1F NN NN9S,SދD$4HxL$HD$81ۋjV PNׁ\Tډ\$tQ!QЃQ SPhNEPN5N|$D$Xt1NPSWUʼnFظ|߃\$ <$w4FN<$t LX FuWFsT$ N N$@=ХNtfL$fAf|$l$$j R hX hNhNT$ =Nt| $=ХNt RP0DRPh$l=Ngq$ʋT=ХNt RPCWURPVh$m($DX=ХNtPh$H`Nh$Eh$frT$ '|$@@u' T$t$SUt$A Nt$D$, F=N=N$@=ХNtffu$@=ХNtfft}SU{$@=ХNt?f=ХNt/ȃ=ХN $ApfAAt$f=ХNt $ApfAA $AtfA1ɉ N N N Nl$T\$XNpt4$9 ХNt ʡN ХN$tt4$tʡN ХN1ɉ$dtX$t $D$LPt$衹=N=Nt=xNu,$$@\=ХNtȅSUh"$C hA$,p~SUؾ19 ХNt1ɉH\H`HdHhHl$f!B=N,$(E\=ХNtȅƄ$E\=ХNtȋ PNI0H111҉,$L$ D$t ߋ PNY8Om\=ХNt͋ PN#8߉@DYL!!ÊIT u,$\$lD`Td t<=ХNt RP'@D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9PNH4 D$|$׉D$|$=Nt݋AQ=ХNt-RP?!Eh=ХNtȋt$|$1҉11 ˉl$$WVRPSUhi$uA=Nth$hW"$m|$t;SU蕼ƃ=ND$|t1$=ХNt RP>FV`N=ХNtȉFhܽ$|$jj$$$$SU z $A`Id=ХNtEQPP> $plph7>1$D=ХNtWUPVh$  $AhQl D\$C5PN;^,T$$L$ NN׃ƃ=N5N PN9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-Nt$| ؋T$(tu3D$1 Kl$@؃,Ut$HwU ƋD$9\$(s+l$ UhV$>j3SWUt$@hz$hO$m=j[sUSWV |$ ow@u Xw VUp D$t|VUh"$w wN NʃǃN=N|$ |:w wh$= =Nh$qjG $D$|$tjVU¾ N<)1CVUh $D$,p p*N NʃǃN=N j KH hp dNtHdN `N9tDy1Y1 t 9u,NN$|$ ,dN`NQ1I1 ы|$ tdN$G0W4L$Aڃ]D$ p ph$J< =Nt)h$f1C+`Nh$;h$h1Ct ؃ ^_[]`Njpj^fUSWVP$T$1B@B `NNPNx,11=Nt>Q:PNx,$kd1PWSQh$hԦ3RNPN1ۃVU聶tzljl$ t$Npt=ХNtʡN ХN1ɉT$HtttȉD$LVUz8tD$PWbu(CPN;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$NŅtTM1ًU1 u3VSh $w wNHPUMpXN dN9tmu1 dNͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $H'h@$F9hc$eh$ejj聴=NХNf@=ХNfh$8he$eeU1hPVPVҜ1Bh)$8hc$'et21VWhVWVW莜1 tah$+7`Nh$du<tf@=ХNtf @f=Ntjjxfh j5N5pN~hT$1B@B+ -pNN  $N$Wt>E6+5pN=NkdPWVQhu$hԦ3ANuF$h$vv 躑 NA1ڍF$h$cvv 6ǃ=NF$ ХN&jPv41 NI F NQPQPhSt=NF$ Nt%QjPSh,2$h$>6#`NQjPSh,2$h$36=NthE$O=N1F$N I1)щN$uh$b-vv *ǃ=NF$ ХN$Wt jPg31҉GW1҉GW }hjD$\PJ =NХND$tt7fD$T@jv$3-fD$T@jv$2fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=N$tD$\=ХNtL$Lu$D$PD$PD$XPyN;,$/`N$W=إNvإN5pN;4$]|$T{$AhjW* -N=ХNtt0fD$T@js$0&tPfD$T@js$0FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=N$|$TtD$\=ХNtD$L$|$TtD$\D$PD$PW٧;4$=pN;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhQ#ss oOCK =Nth$ss QPCKhQ#QPss fN `N;<$=pNN4~^1ۋ/uu q]]8u9rۋ=pN/CK tS  StQP HKX9rjj轄`^_[]`Nj&ejӭPhY$/L$D$@, +A,USWV $0 n8$=Nui=Nt`E=ХNtȅtNE=ХNt$;NNs&E=ХNtjPo@E$F0N4 utEh%P)$0 F=ХNtȍL$A=NAAhh%Q(G N ХNtD$D$L$L$D$h6$v v薉 E=ХNtfM9v%}EPhP$.w$hB$4[4/E=ХNf)=ХNf=ХNfEtf=ХNt΋$0 AI 1 h$QP辈 h$Z$0 F=ХNtȉE$B$PpZEL$fAWQUJ> $)fEPUV(> =ХNtfD$fXWPU> $0 G0W4w wmfH$X`N$0 =Nt>}t8h$v v贇 h$Yu EB`NF0N411G9 v vGD$@=ХNtȍL$A=NAAhhQ#QD ХN N tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=ХNt2f)=ХNt%ffD$=ХNffХN )fD$1fM$0 A0Q4MT$ tjQkfHD$=ХNtfPjUZ D$fEutEhQ#Pيl$L$Aq $0 JR ωtljh$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=Nh$ڃD$=ХNt΋D$p@ =NX}$0 ~h$v vڄ Eh$VJ`NB$$0 1GPVtXD$T$ F0V4=Nh$ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV9 D$fXSPU9 E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUi9 $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh$ U4$F0V4=ХNtȋ N9Ns5h$juv v݂h%$T4$=NE=ХNtȃu}uE=ХNtȃtb}u\FN U=ХNtʋ4$h,$jRQPX=ХNt}Eh$T1 ХNEtjPgC$0 A4y0?$$0 t=NG$=NJR u=ХNtPjVRQ菁h%$cSƋE=ХNtjP1Ƀ=ХNt fХN1ہ@€@t f ХNfG`N4$Crv $0 A4y0AI U=ХNtʋ4$h$jRQP褀h%$xR`NzE=ХNtjP)Ë@ C$0 A4y0AI $QPQPhRcE=ХNl$\$tȋM=ХNt1퍜$UQUPhScShg$$"Ph]$ %9-Nth$*l$\$ h%$zQƃl$\$$0 A4y0| AI KC=NtaEO9tU$0 AI U=ХNth$jRQP%GEh$Pu $ `NfO4$E  ^_[]ËM PSh$"ȃ=ХNtUSWVT NpN,=Nt>)"=NkdPWVQh$hԦ3菬N}ww cO W $T$ WGO ƀÄ:1=Nt4=ȥNt+=Nt"uGO 1F9ƺw1 tbQPc8uS=NxJ1v6KNj@ $GD$wOG tQPb8u E;-N|E;-N=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$DNpt =ХNt ɡN-ХNL$Ltt tȉ݉D$PD$PRmu h $!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t NN1JQPFafppN9)T^_[]fUSWVT1ۍT$1B( PNx,@=Nt;PNp,kd1PVSQhE $hԦ3脩NPN N<\$11ۃVU衛VUm`$t$l$ Npt<=ХNtϋ NХN1҉|$Ltt<8tϋ NХN1҉|$PdtX 8Džtɋ$L$HQ$I'xtCVU誓tV=NVUhm $^1=NL L tOjh $shNtuQ1y1 t6 u_VUYdtl=NtHVUh $P7jh $$PxyQ hNP: jh$D$P CNL$;JWD$ P$~ E!$L$|t$$J N`JуRҍ;F0vt$hK!$$B=Nt$teVhw!$\$D$O4$~?K`O &hc!$D=Ny1ɋD$@Bȋ@4ư#sLV5XND. 5D$ XNNh 5PN5ԤNt( 5\N5ԤNQ=ХNtԤNPP$b5ԤN.>ؤNNtDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$ 1Ĥ^_[]áNu"$T$TQRjPVDt|$\=N=N1Ae]Džt<$PN\Tu nt1PN!=NNh%$jV NN NVhq$$/1=pN=N=dN$L$ PQj5NSCuSh,$d$$8ffs1$8j h)$V VSh,$ BVh#-u h%$*lPN h P5ԤNr  5\N5ԤN2=ХNtԤNPP"C5ԤN,ؤN1=NtPNPh%$~PNtZ̥Nu6t2=Nu!=N-&$tޜ"Ph&$41OB Nuh2&$PN8< NNB,NNJ0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ N|Nu@,$\$D$=NhS&$?,$\$`L$(l$85ԤNF4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ N|$T$D$DSh,$hx&$"ePN1XǀPh P5ԤN 5\N5ԤNS/95ХNtԤNPP\@5ԤNfؤN N|N PN=Nth&$ Sh#-$h&$"PNPP.=PN1@L1XP\hhP^ h\NW76h 5PN5ԤN 5\N5ԤN-.95ХNtԤNPP6?5ԤN@ؤNPN Ph&$uh $!udPN  h P5ԤN 5\N5ԤN-=ХNtԤNPP>5ԤNؤNPNh'$h*'$ udPNǀh P5ԤNW 5\N5ԤN,=ХNtԤNPP>5ԤNؤNPN@ PNHHщ8<=Nth).$A=Nuh$u_h 5PN5ԤNm 5\N5ԤN&=ХNtԤNPP75ԤN'ؤNNPND@RL҉111C QPhd($[ PNHLщ@D=Nth).$^=Nuh$h 5PN5ԤN 5\N5ԤN.%=ХNtԤNPP665ԤN@ؤNN*HHPLщ8<҉@D1ۉN N|NPN1Ƀ,=Nh($1L$ PNL9| 9Ph'$PN=Nth).$=Nuh*'$Ih 5PN5ԤN  5\N5ԤN#=ХNtԤNPP45ԤNؤNN@h($L$>NPNǀ,04ǀ(<HHPLщ8<҉@Dh P5ԤNU 5\N5ԤN"=ХNtԤNPP45ԤNؤNN N|NG?PNL-=Nth($:h($7NPNǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5ԤN 5\N5ԤN!=ХNtԤNPP25ԤNؤNN=Nt}=pNuth 5PN5ԤN 5\N5ԤN2!=ХNtԤNPP:2PNph5ԤN5NB hܤN5N=PNVhA LVjP;Q G011D$)9|ËLG8 $HLOd t1SRPV5N6t0|$u)h;)$h$s1AL$=̥NtLSVV36 PNA8$HLId t1SRPV5NU=ХNt SVV5 =PNG0ŋ $A9N NʃƃVh NVjPO jw,Ny9 NNtN9؃stNÉxNNC |NUPhƣpNUSWlN Vh XNFPN $N=dN N1Ƹ1ҽhWV5@N5N|5,N=0N4N5@N=LBALtl=lNHhi*$Xh$11IPPQQPV7@Nf@5@N+6 @NfADNFȃtvFjPh*$ =Nth$=NuhW"$nt1F@Nf@5@N5 @NfADNFf=rmh*$=Nth2.$蝛=Nuh*$t0fF@Nf@5@N,5 @NfADNFffuzh*$=Nth).$#=Nuh$tt=11IPPQQPV6@Nf@5@N4 @NfADN1Ff9D> <: \ jPPQ(  jhPQ  FdGdPPHH8<<8@DD@HH0440vhWV+ ^_Ë\1HuT~!TtC 8tVÁTTt*8 t"Tt5݁Tt+ 8t#TušhN= ȉ11Ɂ=hN ХNإNԥN̥N1Åt.Vփ=NtPh#:ZVh,$^fVD$=ХNtfs r.1=Nt&=ХNtfPh?.$Y1F^WV|$ =Nt hR.$4h$W2j Xt=N,=N=Nu u=NtWhz.$DY1@ Wh#.Yh|3!(3H (3~$3H $30h$3O1 t (3I (3~$3P$3h$31 (3 t 03 t^mNt"YAyt n+j }W yWhq.$;XȥN1^_USWV 1HNLNPN$X0Sho lN N1N5 N5NNhh0 -@NDN50N5,N'e=N`NhNh.$=Nz녀x 1=NNĤNh V5ԤN 5\N5ԤNh=ХNtԤNPPp5ԤNzؤNhN5Nh$N5N5@NxhN5N5NW=N1t?Nt71FW5Nms!StNuˡN)1HNLN9`NPN=Nth8/$hS/$=`NPNƀ1TPXh P5ԤN: 5\N5ԤN95ХNtԤNPP5ԤNؤNhN5NR=Nuh0$q `N=tNh0$KNh 5PN5ԤN 5\N5ԤN0=ХNtԤNPP85ԤNBؤNhN5N=xNh0$Nh 5PN5ԤN 5\N5ԤN=ХNtԤNPP5ԤNؤNhN5N=Nt" PN5LNkdPVQhj/$8M:5N՝ N0Ɲ ^_[Ph!/$VD$\TL$ 0P   Lu5PP\RQPy ^SWV׉΋\$=Nu j 9KSWVh0$h$Ct^_[jCUSWV$L$8PND$X81޺)Ήt$ AN5N)‰t$T$ЃXN$=NAD$1\$|$ xk1ɍ1݀s A;L$ |9T$ l$|$8|XA\$rAKu.\$މ1;t$L$nd11[l$D$遽\TtM!M\$8M VPhNPN5Nt$ ̥NХNttut5PNt$5N{ $xU t$U tWh $5PND$T$|$$D$ D$T$1Elj Nр $yU L$ u$K`ى BGNu5PN\$8|$NN9^8u?$JLL8N`D$jPRV 5PN $)Y$) L)\8 h V5ԤN 5\N5ԤN=ХNtԤNPP 5ԤNؤNhN ND$T$ $^_[]Vt$PN5XNv =ХNt5PNv5XN ^USWVLt$h\$`l$d1jZr R:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhb%mUQ=TNuR<sJTN1\$|11 ʍT$ ٰBPVQ D>/|)Ot$L$6TN2TN$!D$h8JTN$ D$tB?JL$h)PRQhSWVD$t$ N95Nr==N PNjSPVL)޹C394v t^_[PVh0$CWV|$ wu$I'1XD$@uPw w Ph׼$*=Nth0$Fwh/$t ^_Ph/$趽NUSWV$\TM@$ 5uh`h`VP =Nt h0$v=̥N1ۃL뀃=ХNt\,L$UPQ  DPPz$\, ХNL$L$UPQ |$u $PP@1LDffLD@9u=ХNt8PP\ХNL$UQP~ t"PP\L$UQPX  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h>0$(USWV\$t$=N!ߋ,t9Xt6@u|$t&jVt1ɉH HHXh1^_[]he0$VD$ L$5N#p9tыR9u @^USWVt$|$VW/PN!t7^Fu+11 33 1u{ Ntqt$0|$,\$(l$$T$XNt9PtjRQ XN(Xxp L$ \Nt9HtjQ5N \N(Xxp ^_[]WV PN1!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$(L'$1Aȋ$sY9UJ'PN1ɉSh2$=NthQ$ah$lt$" PNQP#T$1RQQD$P1AáPN;X0t$~~1Ƀ=NT$DT =ХN|$t RPL$ pL$QSRPʱǍPB`N$|$1D$D$t1)ÉعF@jP谼D`r9w<$r$l$T1C @<$9uG<$;|$}PNX0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡPN@0)ȃ`T$1ۡ`Nـ#h2$b=Nth).$~^h$ ع`֋,$L$t1ɉȉD$ օt$ tH PNi0T$,RQUt$> PN;A0l$,} $L$l$l$,PN@0D$Mt$ |1TT1PD$T$ ʃ=ХNt RP1L$(ωQM D$H 9tet$C9\$t$$h3$ `N4$F4$;t$SD$`1`N0^_[]ËL$ ʋ PNf9u Sh2$褤D$`,t$$h2$lj! PNPhV2$CUSWVT$L$D$0(D$ X=ХNtSUʼnӉ OD$$PN@09ʼn} t$t$5D$PSUt$< PN;A0 t$~QPSU.~t$4SUWt$T$LtL$A L$ Q5ХNt9RPt$ƉT$ 't$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RPʠ$<$G L$;L$t9ta щʼn$;D$t`1h3$辢^_[]USWV N$PNx0UWt$0t$0-Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR٫ `NT$4$1B srl$,$ ȈU1wX=ХNt N!9GX=ХNtȋL$,1Ph3$蚡 `NL$ $  h3$y=Nth).$Yh$t$D$OPWTP1GTGP^_[]`N1USWV|$,#$t#$N1@$PNsll$NtN L$  ƍD$1PQQVK9 PN;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh.3$џ=Nth;4$Whc3$Et3s ss3st$Vn[E;,$u`N7%t##Ph2$0jUSWV0\$T|$HOX=ХNt1D$,D$(D$$D$ D$D$PL$Qs tPst$OGХN҉L$D$td$PQ耜É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ6C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h6$K'h5$hH6$h h4$Ph'6$O4$V0Vh5$h5$h h5$h5$hWVt$ F,t@eNth6$JF,P1~,>d9~8uv0^_h5$h6$h h4$%D$x,u@Pt P軭鳭h'5$h5$h h4$WV΋I01t*N8~2IN8tPQP PhN0G;~4vɃ~8u^_h5$h5$h, h4$h5$h5$h2 USWVEH1Bx,T$1hsM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS聬e^_[]h(5$h@5$hF h4$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hm6$h6$hK h4$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h(5$hS5$h` hi5$hS5$ha h4$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h(5$h5$hq hi5$h5$hs h4$+USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hm6$hZ6$h~ h4$fUSWV\$$|$ l$t$eNt5NSWUh6$USWV5N 1^_[]USWV\$$|$ l$t$eNt5NSWUh(7$DUSWV5N1^_[]V=NthX7$Œ2j5hNHtah7$腌h$+tShNxL~61 dN s"@Pt4h7$ dNhNF;pL|^5hNvj hNt'x,tPhNPhNáhNt x,tt$t$t$t$P1WVt$|$ VW=NdtX=ХNts,PN`uau33 u1@1^_WV Nt1 dN PN1!`u/aʀs2hlpx1Ph7$ԊPh8$h$gJh7$蹊PN ǀdƀah P5ԤN 5\N5ԤN=ХNtԤNPP5ԤNѰؤNPN!1111QWRPjhhNhh,8$h$艶lh7$ۉPN ǀdh P5ԤN@ 5\N5ԤN=ХNtԤNPP5ԤNؤN PNdPs+aʀu Ph8$Phf8$h$蟵hN8$PNǀdƀah P5ԤNY 5\N5ԤN=ХNtԤNPP 5ԤNؤN^_jUSWV1L$ AL$HAL$@AL$<L$ \'L$A \'A\'A\']u }h8$SV褗 ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uhdL'jBƉe^_[]Ãu95$3ujh\'D$Pp u1PPD$Pju95$3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQZRPt$8t$@t$8t$@WT4u2h>9$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Phf#hVnD$@w ww7VPh9$S  1h*9$+h|9$W fUSWV1L$(AL$$t$@L$ D$ }] h:$WSv aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9$3u~]#D1غ$Phzd@  tN|$$tOhxL'jt$ 连t$@賞1Oe^_[]hxL'j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$V],h=$VJ|$$T$tRPUWShJ>$VT$ D$RPV$ t D$11WWPW1@PjPVq$L$jEWhd@t ttۉh=$ $jSUWQ tRSUWh=$V-*hWV hi=$h=$h=$$8hBh=$u\D$ D$8,(VI ,(h>$V8'jV#"tH hs>$1ɅtVA I$ tJ;$T$s?jQPV\u-h>$Vt P3E V1^_[]h>$USWV Ӊ΋l$ jURQtn=Uuq1tu@ yyu݅tj ud1PPhC$VPhc<$V tUShpC$V"W\tUShC$V|UShC$V1@PWPjPUSV D$@\$4$1= uD$ Pt$hC$t$  $|(1RVRUPQhC$t$D $VuVh>$V =B ^USWVօt*uu;#Ԧ3PSU WSUPh#hԦ3 |$t$VhԦ3 tWh#hԦ3 hԦ3j ^_[]Vt$jV%tOjV tAjVjVtt@ hD?$ hq?$h?$V 1^USWVPD$H qTqPl$ 1Ҹt, $] 1H1,;13L'G9uЋl$ $|$AXAA t#1J1113L'F9uҋ|$Q1u:t$WtUWu?$?$PW1N^_[]ËD$uP h?$P1ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vh˾#hԦ3D$4C9uPhW$SM?$D$ td# ?$d#$L$Ru0QSh@$hԦ3D$<r31F4$t0t$hd#Sh@$hԦ3[D$@ F9u1H^_[]ËD$j$,(USWV|$(jWujWth3@$W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ hc@$s,$ʃЃ,$9Չ|ˉ$|$(Wxt h~@$'HP ,$9|ډȃ u h@$$jjjW>$\$SzjPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALh@$Sh@$h@$USWVP\$|$tus$g" $"$j`xtQ1@PVSjPt$8t$8W E1u>4$hUC$W V~ShC$W4$h6C$W 1H^_[]UWV} uOʃ7U|RQPhA$VUJPRvx& $T$W1ٹ|$57Uh9A$ 57Uh"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh\'VK 1OujV57UqMuW?,VQ>~IhIA$Qp1$VQ7 t1Ph[A$Q= 1O^_SWVP|$1N?u\j S57U{ 8u1u/|$8u 57Uh"W ^_[WV|$1N?t57UTr1t^_hC$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P57U у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P57UtxL$T$$$jST$ RL$Q tXS?$$ىډWT$$jD$ PST$Rխ t)t$hD$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jh\'t$G$ tjVt$G$ jQV$Ѓ $V I iTh j$U$  V tZs0whtA$V1t^_[]1;BB ,Fjh\'PG 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0hA$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1PhA$Q= 1HUSWVt$|$ t)l$\$$jWUSo tWUShA$1hA$VD*l$(\$$jWUS< tWUShB$V1H^_[]Ã|jWUSe11USWV\$1s3h%57U@ t^1WQ'<tuWh8B$t$ 1NQ'Q' Ch%j\@ Džu^_[]WV|$ Q'Q'WhTB$u^_USWV t$@\$C ׋C0!K4!T$$ ыT$ ЉC0K4\$ST] H $YTL$Q #|0#l4 l$$ |$ |0l4|$QPW/ t$hB$W 1t$hB$t$ SWVP|$1N?utj S57U  ր ku"B$=?w2 QiuQAր buQ"u1Ʌu57USt$q ȃ^_[WV|$jh\'WA 1Nu.W57UCt57UhB$t$ 1^_USWVl$$\$ |$t$jj hd#USjVtyD$USWhC$;|$tVh$&j < ^_[]WV$3;$$,(hDE$_ $hOE$j$,(RPh`E$! hE$rjV p FQPhrE$d v,v(hE$ v4v0hE$ F8Phf#hWAWhE$vPhE$1$hQ'j`ĈhE$1HĀ^_fUSWVhW$P聤I$tI$Ԧ3hTI$VQWWjj hI$~(R'hl&uj5USWV$\$@|$D$ $t|$$L$|$t$,t$4RQfL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZhqM$P%1D$BhqM$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$HhM$u51fUSWVPM(,|$8O] D$1hM$uSE sujsWVVuutqD$9$31t$ V~Hw'$(Y'؃AtH`Łˠ뽃W hNuyhY'j4돍D$Puqx pD$PuWJ?71L$ L$ {=NhJR#Ot#L$<1QWh WWj WP- L$<99t33=u1H$Qhht@Pn} u$Nu@L$wY'Ns t95$3juVuu hQ$GD$|$|But3L$L$T$xupt83|$H1 @uًt$uWt9wWuVhQ$ue 1HhY'j(e^_[]V  P$h9% P膲 h=$  P$Pm h,R$@D$ P$tD$ P$u |$  L$ L$ك@L$0فL$(|$w7Pt$Vw wE V۱3H 3;3h|3j b|3H |3 3H 3|$;3h|3j "|3H |3 GtOPhP$JO1w7w & 3H 3|3H |3 hO'#D$O1w7w IƋWMhD$@Pt$0w t t$D$Pw 0T$уL$, N1҉L$$9L$,h|3j t$<|$ Wh׼$PV|$Whf#P$WWV*uhhd]&VA Vhd#|$Wh$P$ۯD$xu2hNhf#h$VVhd#Wh3P$螯3$Vhd#Wh3P$脯D$Phf#hVIVd#VWhDP$TVWhSP$E D$4E$ȋ|$gw t$0j d#QRPjt$LV) xVhi$E$gw |$4d#d#t$t.%VRPQh_P$賮 Mt+WhD$@PSw M tPhgP$耮3H 3t$~|3H |3 h|3j |$G8jm$CQj$PJ$?Pd#PVhmP$d#PVh}P$ G0O4 tQPh$P:Ph'R$|$t$ ދD$$ʍ RAt$Qhd#PhP$葭3H 3~|3H |3 h|3j GHt$sG 8-uXG $1҉QQ$$Phf#hD$HPD$r> E+u(ljށD$D$Mj@$PVw tP^L$9wȉD$WMj@$PVw tP'L$9wȉD$u|$D$ ?L$>G CVhQ$tE$Q$PSw71P E$JE$PSw w1P \$|$tD> 1@D$,$t$|$@u  jhWV$ƉE ك@T$dt$`wQj hd#|$Wt$PV x'D$`D$t$ \$\,$Q$t$ tnբ"tQ$Vt$ P|$pWl$pU蹞l$9~?r1D$P$tP$Vt$ L$( PܟD$D$D^_[]WVtfy8tH8|$jmWj$QÞhP$jKƉjWP t VjK$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj hd#UPjS yD$4$T$dWRVhQ$˞;tSh$踞j ΝP^_[]fUSWVDt$`l$\\$XT$1 󫡠\'A \'A\'A\'B0R$` hR$VU' k)Hw]r$uStJPSTu7HsutPD$PSH uhY'jXD^_[]1Hu߅tjh\'D$P t9-$3uPh+0D$PS觷벃luhl&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhR$SWy& a~bt)iuRt7D$PV""uUt$D$PV螺tD$PV蟳uhY'j<e^_[]Ãluhl&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=$3d1t$t$PPt$VqUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H NH N@N NhN1 NFNFNFNF^Vt$|$uD$ hN0NFDNF@NF<NF8^fUSWV$$$E#h"WV ou-7U95$3N 1O$QhV$D$P%8 $~ƋFHt$ $\' ^ hSh&PD$@ xþ1${蛌 WhR$P7 Ph#V+; CPhV$V; CPhV$V: uCPhV$V: ZCPh1l&V: ?CPhW$V: $CPhW$V:  CPhW$Vn: CPh)W$VS: C Ph7W$V8: C PhFW$V: CPhSW$V: <$uܶ $lVt$wA WGU $ɿt$ D$tQhV$P1 D$Ph};$t$0 rp~ 詊 whqW$PY9 fG8Phf#h\$SfShzW$V7< 4GPZPh"9$V7 VhV$ڵ $ D$$$Fo~ 1C OƉShR$V4 )Whf#hD$PD$Ph1l&Vd; Whf#hD$PaD$PhzW$V.; wwh9%Vb: wwh1$VF: w$w h#V*: l(jm$Pj$W$t$Ph$V: ,Vt$Ż C$$L$ AA H94$hW$t$ . t$hV$t$. t$ v8t$耖 t$ hE#Uu$L$4fL$fB$PhFW$S( $PhSW$S( t$( Åt$( $fǀU1PPPEO!ƒ[u$t$ ;$4t$8" D$t$ fËt$01 |$lD$Ph1l&S/ D$lPt$SD$PhzW$S/ D$|Pt$$Ph9%S' `$Ph1$S' B$Ph#S' $D$Ph$S. tj$$Pt$ 菄 D$DPhR$S & D$D9M$ $ȃhL$pQP> t$ Åt$ U$61QQPM!ƒ~t$ M$$VP 9U]$|$$D$jRP3M!ƒ=M$$VP 9E$1SP|$Wf GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uoh\$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ + E0t!t+M4S9rQSP+ 0t,h]$ MHtU4uL9rRQP+ t$|$t%u@uhVe: tI X81tSul|$tDEM9rQWP>+ u@u`V: u@yu@u`V : teEptUt$8ЃtEu8uXV9 t, ^_[]h\$h[$Ah\$hY$5h\$h\$)u\u\h.]$udSh\$jZ wlh׼$j{ fUSWVt$j 1tvt$'l t[SH tCPIv Vt$Zn tPUW{o uW SE 1S8 Woj ^_[]USWVu]Ph\$S2 t$f1j?1Nt}ǍD$ Ph"$Si td\$ t\hjD$PYR jS\$S ShiWJ8 t$E L$Uf jQh\$P je^_[]PPh"$t$ u1$YVPt$ t$t$V tPh"$V u1$^USWVt$t$k t Nj\$ P豆 9v5U? (U1N*Ƌl$W豆 VPUf( )SjU6Q ^_[]USWVt$t$Kk t?Nj\$ P8 9s9Ƌl$WU VPU ( )SjUP T T?1N^_[]UPh6&u: t$IT1H]USWV@uPh5]$V ] h]$Vvj tP虅 |$ P\$$ShiV\@ |$ jS߃ Ph]$u \l VѤ ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP膃 t!Ph]$Sl Vv 1He^_[]h%h]$hh>]$LWV|$$h]$Wvi t;Pg u1V艄 jPV;& VhiWQ? t^_h]$h]$jVh>]$(Lh]$j V8NhD3V V @NhbV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh]$hV->tVh+^$jVBFߋD$t$j7QPh]$hV>tVh@^$ejVAF߁^UVuPhHe$VN t3$L$ AQhiV= u hOe$?1e^]h%hCe$hh_$JUVuPhe$V t3$L$ AQhiVe= u he$1e^]h%he$hh_$*JUWV}W#ƉPh~$Wc tZt4$P<tW@PVp tGPhe$u h t>V[1e^_]h%he$hh_$Ihd$he$he$ he$he$j5 h.e$t$Gf tPhe$t$qh HhKS&h e$hh_$ IWVPt$|$D$PVW tKD$tUh\$We tPh\$V h H^_hKS&he$hh_$Hhe$h\$ju h\$j9 SWV$ha$Sne t]Pa GAsdWt^WPha$StNpxPhiS3; u?V1N1HĐ^_[hf$hf$h1f$j hna$j USWV 1CCj7Shxi P0 uhd$?,$Puhd$#Ɖl$D$Shxi W@0 u hd$j, $L$9~D$~*1t j eSh׼$jfG;|$|j veVjs]USWVHj'D$@j'D$u hc$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=ԴNu11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$P躟u h}l$jv t$ D$D$t$$1|$\$F =I3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$

u Wh{a$j PVD$L$AËD$L$AËD$L$AËD$L$AËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$H@I3 I31SV\$ ShI3IuCЃ r"CrCr E01H^[hI35H?r E ؈I31ыL$t N1ÍAЃ r)Aw AwÉCE1HUSWV1t$ D$hVPYA I3xNt8u^NǁNNNNNNNNNNNNN@whI3R&uhc$0hI39&uh d$htI3 &u h8d$j $5I3tvhD3%61ƴNǴNȴNH3ttI3$hI3$U ƃV B~>CNȴNF v/FwD$`'ʹNAu"h]_$9i$|`'ɴNxu>Wu4D$P1VhVVj V57U  ԴN9t$:*ƀNl `C LvmsI3H3u$F3˴N̴NrʴNϴND$P1VhVVj V57U0 дN9t$taYƴN>ǴNOδNCatTl5$F3+wtzH39tI3 F3$ÿE3؉$H3$3 ̴N$u =ϴNuB=N=ǴN=ƴNu|t =ϴNu =Nuftu^ϴNuS$ttH)ŋ$L$ T$ RQL$QWPU%uR u&h2"hn_$,57Uh &j t$PD$P & u h_$D$t,DtVPyDžuh2"h_$JW WtS)uh2"h[$Wuh2"hY$I3t H9t@h2"h_$$@ t%VWЃ$WjOh`$h2"h*h_$H9USWVO>hQ uhHf$hn_$j ƸI3jmP d#d#tf$jLI3P tf$USWhNf$hԦ3ZI3t VSm#f$ud#WWWWWQWhg$hԦ3mZ$V4 jNV I31tT$q9t Iu^WVΉhjW: D$Phee$V( tZh%%VU tQP)p L$PyRPQ WhiV* u hpe$JĔ^_hKS&h]e$hh_$7WV hzb$QT t;Pto  u1Wo j PWH Whui V^* t ^_h^d$hQd$hih_$27hd$j h*a$<1ÃD$ 1ɉJJJ JJ BRhiP) t1haa$j $1ɉJJRhiP) u 1Đhna$j^ QhI3cUSWV΅t RtP N N 0($D$P6!\$D$1t$$tsVd.sD$tVPG.Vh"$W trC=ɴND$uCt\=ʴNuCuM=δNuCt>=ʹNuLhj$V88 VhiWn( t!$uۋt$$4u=̴Nt ~ j Sh|3s)Wt& I3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPha$h$VVUhBb$S jl$U$V Vhit$  t$,$t!Ph`b$XSVhOb$,$jt$VV Vh~it$ t$tPhkb$Sj Rꍄ$P$$ j:QPhb$h$P$t'$Uhc$RU)E}uj:$$hb$h$P$t'$Uhc$/RU)E}u-I34$tVWUmuj|$W$V $$ DŽ$@Vhit$VL u$ h&c$Q1@Pl$U%jWl$0U 1@D$81D$ƉPV5ܴN$ ǣشNV!1u ܴN$h(#Z1H^_hT%hNj$hhvi$5%WVPt$T$hh$VB tbP)] V\ PWtIƉPV5ܴN| ǣNVy1u! ܴN$h(#*+1H^_USWVt$T$1h]j$VmA thƋ-ܴNP\ VM\ PWt6ƉPWt>V ݉-ܴN11H^_[]hT%hZj$h2hvi$#hd=$fSWV|$ tU*1H>t$|$\$jd PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VY tE$$PwCt/$F ~G F1) r) 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP  Ɖ׃с11E9r (8"t$8t(1H^_[];sC| C 9s} ("WV t/t$ L$Ps(,tD$$F ^C F1k( USWVuD$ tV} ]CtP7> tEC tP7> u/D$ Ph6&7 u$D$1$'1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$VHt|$,$h%WMFD$&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$#kD$4D$4D$ PD$8Pt$ t$ ÅuD$ xc&1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr%1X \$TfD$t7|$0j WPs t9t1ۉD$=rs%"11HD$$P|$1OL$L$D$L$T$PQRhj$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P"NjD$fVSP sD$ t Pb4$WVT WX<4$uM S]s {te|$t^t$Vt$t_@PWS WtNVsE0V< ߉Vut ۉt3EF ^C F1Vt$hj$hj$hj$he$ hj$he$j虽 WVt$tVYr,#1H^_V t3t$L$|$ Pwt΋D$F ~G F1" USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'!<$t@1@>!.1-t Pr 1GG GGe!1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7)7 t+{0t>-uUs~t>Vsnt)u|  o 1H^_[]Ís s(CtP76 uCtP76 t1@뿋C$1$8l'4v6 !6 PZ  v6h tMtk $t$ 4$UQk W/k  1N^_ÐUSWV$,h$k$U<0 hk$U,0 ÅVAK S6K ƊG:FhjP \$yPWS $yPVW |$u9D$0;$$t{|$ tt1FVS VW PhJiUm 1u1hk$԰"j`hMk$hGk$~> 1N^_[]hWk$ hk$hk$j覲 WVNhK3VVNhÜVNhWVW^_USWV, $@ 1 8ȴNt1ۈ$+$*|$hjW, WhKiVb l$(EPƀ}u jU@ $GL$$*SjQhRPUVu jW $L$ $+SjQhUPW1f|$0t,L$f|$ 0t,D$ tvp$L$ T$QUR$6QPhk$/, ^_[]hԦ3jj7hk$<jhIit$  t1h8k$j WVt$ HK39tEtt$t^hr$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhzp$j 1Hx^_[]hr$hq$j跣 WV0t$<|$jWhm$V萴t8W t7HfJBRhiV t!10^_hiq$hVq$Whtq$jC hm$jg SWV NhK3VS(NhK3W@VgW^0NhlV38Nh°W@NhðSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW> Whi$ U $!h{r$ $HQPۍ\$4|$fGWhiU t$r$f|$*ur$=ǴNt P fD$(WhiU t$r$f|$*ur$=ǴNt P|$fG WhiU t2D$*=) Phr$=ǴNt hr$fD$(IWhiU> t2D$*=) Phr$Z=ǴNt hr$B1Shi8U |$Dhr$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh r$覲 uVhr$t11t j,DLxPtT h r$>v<u h0$ j 6$PhiU tDhr$$t$hr$ hd#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR} Phr$O$=tPhs$2j H$=tPhr$ ^_[]PhQr$jN hԦ3jhh s$wÃD$1ɉJJ JJ fBRhiPm t1hm$j 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hzp$j˝ USWV,$@$PhiV tr$A jjj"v xgljj2 xi$-hSW5k xB$/uE$0uf$Ciu.hm$Ӛ1H hn$辚h"n$貚Wl 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hn$h%hn$hn$h>p$hm$hn$QL$4QhWn$(D$f($-D$](E!L$:!PS E Px $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q HNt HNEINtIAtcAtCAtPA tSA@tBAyAAT$hHNUWt$PVt$D$VPRRhn$+,l$ }"E!Ê<)\<$m'=ǴN`Cs|$[VPWl$Phn$ho$#<*<0<2=ǴN<$n$<tn$sQh׼$kR#1L;d#yo$QRPhJ#6G%9u<]K%C=Phn$h׼$=ǴNS<$CPh'o$KPh,o$K s k t?L$D$F3o$PWho%~ N &܋L$D$(Mu} L$D$D$F8o$PtPtPuvo$Io$ io$"QPho% N &D$ŋL$D$(ȉ</=ǴN%<C<$m' p$=ǴNCPhn$=ǴNCKSRQPhn$h o$EC~@sFNuQPh o$  IRQPho$Muj>l$ L=ǴN?CPhn$(shn$h׼$=ǴN<$CPh'o$KPh,o$jCk tAt$D$x3o$\PVho%6 O &܋D$t$)E}twt$D$p8o$ttuvo$Io$ io$"QPho% N &D$<t$)ƃl$ rPh=o$|j><$€o$$m'o$rQ=PuJC<u;hn$h׼$=ǴNyCKQPho$ ]=ǴNPȹn$6<"<op$o$ p$p$!p$)p$1p$9p$Cp$Hp$Qp$Zp$ap$hn$h׼$-=ǴN<$CPho$ 1D3 d#to$T3 ׃l3 URWPQq'ho$uj>l$ +^_[]ø wDr'ø"øSw\r'ø"VPt$ D$Php$V# tD$P^h%hp$hhp$<VPt$ D$Phr$V֭ tD$P^h%hp$hhp$WVt$(|$WhiV tgD$Phq$Vn t7D$D$WhiV 1uhq$ 1H^_h%h q$hhp$ghp$j+ fUSWV8ܢ y hs$辍hΊ%t y hs$蠍jht$! t\UL$jQP> D$tPhu$Hjht$ɥ  DM31 VPh  VPUSWQRPh`$1EVRQUh#BVWh.. 1H\$(C CCVWPPUPP P P PPPPS8VSj[ |$www wwVWj VWj  Vr] Si] W[] D$ @ )T$VVQRWP81I9u 8tމ5hN DM3tщ1@8^_[]hv$臋j -jjģ hu$ף u8u$jV tu$jhs$hu$Vh"h+%K j j USWV`~ZD$=hNtIt@ƍD$H@ L$1jQRRjP:ut$Vh[u$< 1t$HFFF FF1G>\$SVj l$ UVWz BƅZDM31OjUjf; t:9uB$=ht$jVZ  8uh DM39tttn1VSj VD$$Pj DM3vht$@jjj: 1VSj VU6ht$1=DM3u$=|$ u'1VSj_ VWjS `^_[]Ét҃t̓ u1Ht$8F FFVJX Phu$u1s$WV臡 tt$D$8x xx8WPVX "{jht$h&# +%SW Whit$jLV)SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP/ $H $u˃^_[álNH lNt$Vt$VPhs$ijLV}DM3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjַ 觷XWV1N=hNtED$@ L$1҉RRQWjP茴t4$ h6u$^_VQY jhtr'rW jVGW tPYyt^Vhu$>jZVhu$)jEPD$L$ $QPj ŶXPD$L$ $QPjն 覶jJXÐUSWV$$D$D$D$,1H$11D$hv$WS f~/P w`1A$r'57U' D$u[FtR=57UD$,D$낃g7U8#u(@j L$ QPI $D$8L7UP讃@$)7U8#u)@j L$ QP D$D$87UL$QP j D$ P57U贅 D$D$8c1Fj D$ P57U} $D$857Uh9v$8$3<=pNu-tN~q5pN1ۋtVPuJVh׼$FtPhw$FtPhx$j -tNC 9|?,u)É\$(k <D$j, D$P Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4L  D4D$8u 8tz`Xt$7pNu pN-tNCPVNt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP," j@ |$tt$ VUW*  UWT ~8C|$$8D$@PWdtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW3#t!t$ VUW萗 #|$$tS9u$UWS RWU $D$utSPWU uWhv$褀1ļ^_[]Ë 3DQu ~)D$ u|$ jWt$> 탼$u$(h|3P c|$($(jPV t"$(؃tTu*tGh#.n1C؁^_[]ÁttP9PWhE# 1ۃ$u1ۃ=|Nu Nt$, Pt$,Vs t$, Vhy$=xNujB$t7t$> 1FV> Vt$超 u hy$Tm%Ds'$($(SPhԓ%hWt$Wzm 8tD$(PWh $l u8u$(QD$,PQhy$ljuUSWV ˁD$Pj VL$ Qhy$P#+t$1Xs'Gt6t =|Nt#$t#FwPho% G!Ņt G t'rt4$t#Ud#ti#FUQPhy$1tK$t#FPhy$pt 0h׼$ hf#^=|N$t#FstspPhy$.=|N$t#Ph׼$sds`sTsPh z$slshs\sXh'z$=|N|Ut$ 1|$$hVPPh"Pt$u(|$ t!j V+tVWhFz$u h.%HtuTN4 1TN^_WVD$ 18nuxou TNPut_1,tu@APotCƉ8j,W*1Gt@Gj,P'h|&ih"iW1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3Wh"~ uWVh"jHk D$@t.D$t$QPhLw'hVzVfjUSWV$$$1hWS 8D$$81G=7U=$3D$ C|D$D$1D$h1|$UVIr T~H wV$tu' $׃Gt!M57UL$ 뱀L$57U-$Ax|$뎃UL$57U($At|$_ $V $M57UL$|$0P$hu'57U`&PZ` $$3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PVIt\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]h5"jnh Vh$Phy|$hԦ3a jfWVPt$jWVf 9u9t x^_Vt$he"jg Vt$Vdt@^h##V^Vt$Vit@^h7%V|^WVPt$jWV9f 9t9u x^_Vhw"jTg WVt$|$ VW t$?/tWh*"VhC"^_Wh"j;g fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7Vh7%z u$|tu!D$"t$Q"jF@"J0WPVt$ h"jNf USWV\$ l$|$t$1E1@7U$3h"WV n ou%jShw'57U/]tEP\ǃuA$3)ރu4t$$V4Nut$(t;^_[]h5"je Ph"hԦ3 jSfWVt$|$ VW t$?/tWh*"VhC"^_Wh"jge fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Why%y uWVh"jd D$@tY$$QPhz'hV D$ FxD$D$D$D$D$h|$WSk L~)Hw;$py'57UFt1@D$Ã9tGN|므N|멃MUN| 둀N|57UL$1@D$kjuhy'57UpZPZ=N|457Us,1@D$57UFp1@D$57UL$ 1@D$$3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ CtuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W_W肚@$N|dže^_[]h5"ja t$h$Ph}$hԦ3 jEWVPt$jWV"` 9u9t x^_Vt$he"j9a Vt$Vs]t@^h##V^Vt$Vobt@^h7%V|^WVPt$jWV_ 9t9u x^_Vhw"j` WVt$|$ VWS t$?/tWh*",VhC"^_Wh"j` fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWhϯ$Ot uI8KD$  =N%D$ Vt$S jHSt$D$@D$ $p QPh~'hV1oD$tS\$O$oj j ShWt$ PtPPhj~$t$ SWhz~$t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h~$81p^_[]WVh"j^ jSWV\$D$@u+t$Lht;SP t7Vr1 XNCXNC^_[h|&j^ j'USWVPL$$T$ l$\$1$1M3֍zh}$USf @~7W$T{'OӃ23=NN먀'룋 7UDF@N@늋 7UIF(NnOe 7URN3KF ? N30O' 7UaF8N ܶNO 7UgfP3D$ p4t$ N @OPt$(h4|'57USƋ$t ܶNt'tOt@tOsO t=NN s=NNg@tOy  N3sg st1A T$ J sh##VQN$fyh0%VQL$ A$I$sh}$VcQL$ A I$sh}$VAQL$ A$I$sh}$VQL$ A 7UwF N" 7UxF0N=NucNgu\5$3)uOht|$0W"j t$,tWD$(0t$(^_[]h5"jY Bh}$jY SWVP׉Ήj SQBX 9u ~^_[WVh~$j_Y ʽh $h$h$h$hS$Ph9$hԦ3q jfWVt$|$ VWô t$?/tWh*"VhC"^_Wh"j Y fD$Htu L$fHQh$jX SWVP\$$CxP' Cjjpb 1Ox\ƉC@HtuMKfHjPjjV3ppVb' ujt$ t$ V[blj^_[Qh$jX WVt$F1GyiD$ PWQ & 9ujt$ t$ vQ 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAAضNBضNʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RShPQh`Wt5v%NɅuNɅt(QhK$h;$l 褼H1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w20(PhT$hE# H1HD$pȁ^USWVt$\$l$ |$$ǻWUSVt$$1N|I; ضNu=OɃu3_˅t( ~8w0Sh$h`$%Ɖ^_[]VD$L$ T$r؉1Jf^USWV D$jQSlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$Dκ8jR|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3jyR)9}h^݃D$,|%L$,9QPh$h$<1H ^_[]fUSWVd$xj[Vh0N"d j@Vt4$Fj:VA $$|1D$hhhhh hh(K H|$WPhϯ$VtP4PVhۀ$ #CD$D$ @4$D$ UhD$PX D$,$Uj$lS VӨ9rȉ$`WVS jD$PW$lPjt$hD$(P t.2,$AuU=NuLD$D$ 1@D$  $t)ɋ,$t;|$ h$1N$N,$ ND$ @tL$L$fQP$|BD0ND$ HJ@BBNuNȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 57U5$3\$ \$(&\$$} ]D$,D$D$D$D$ D$h$WSX H$'P57U,] 3$L$T$,Jjuh'57UGPXG뇉=7Ujh&$WN t5jh+$W: tZPW\ $T$D$0PW,D$0t 8D$ D$(JD$0PW,D$0t 8D$ vD$$c5&$T$$MA QD$57UD$o57UD$1@D$Q57UtD$ 1@D$35$3)h4u%_ }WtD$0PW/|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]57Uh $h5" 57Uh0$jwN Wh $PWh߁$Wh$ PWh_$jN WhJ${Ph$hԦ3; jSWV$t$$$$\$VPWS$H$HTj S7Vh"a D$@t$hg$(t$t$ht$ t$ t$ h$ t$Ot0h$jt$h$ t$It0hÁ$jt$ h$ t$ hс$1$^_[Vh[$jL WVt$ |$7H WV1^_U0E\$D$,1ɍT$ QQPRh9$/uUD$ L$$L$D$l$`&\$ D$L$ |$D$ fD$l$|$l$D$T$]hF$j@L WVPt$jWVJ 9u9t x^_Vt$he"jK Vt$VHt@^h##V^Vt$V Mt@^h7%V|^WVPt$jWV5J 9t9u x^_Vhw"jPK WVt$|$ VW t$?/tWh*"VhC"^_Wh"j7K fWV1t$|$ ɉ @4u@ȉXȉX\ȉ\ȉ@q@Q@ PQ40@40<8?<8D@?D@LH?LHTP?TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40?40<8><8D@>D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7I>Vw w6>V Fww">VFww>VF^_USWV\$l$EffEffCEffCEffCu u=S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu<SCuu<SCu$u <S$C EDȉCDu,u(<S,C(E@ȉC@u4u0<S4C0EHȉCHu D$(<7U1҉$PPhPjN =N=7UjhNh$N3W<6P57U12$PPhPjgԷN7U1$PPhPh9Nu7UNd1@D$$V7U1D@%PPhPjN+7U1$PPjcPPhO3=7Uh7%Wؕh##W• NȷN=NN=N=7U}W9@7U1$PPhPj طNE7U1$PPhPjpO31GhԦ3Wj>h$jo=ķN<$=7Uh@%WƔu̷NG=7U1L$PPjPPgdO31@D$ 7U1#PPjPP4Np7U1S$PPhPhзNP<7U1$PPhPj ܷN =7U=Nj:W]mEj/WJm2?}N7U1Ht$,$Vt$S1KS\$W|$P< NNr3DH,WD$h"%W'hh&WNW NN1x$PPhPj lO3,N 3DHWJD$<$Nhr$$3=dO3_=NtVh΄${57Uhd$k57Uh$[h$Qh5"j: WhN$:WhH$/D$=Nu1=N@N$1󫍄$BNA+L$Nt1ۃ$ 1D$9|Pt$t$$ )̓}4$:It$ \$ NNɋ|$ N=N N5Nσ|,@σ|1ҿ9  зN9|щ Nt$ |$7ƍD$0jP .hNh$N=NtNNt&hQh$裿 NNt=|hPh2$z =Nu1=N1@N=طNu NطN=hO3,=Nt#jh$h$hv$N=ԷNu=dO3NԷNt$t$ t$0SWt$t 9t Wo t Sa =NO$PD$tE3tƃh*$O]j 葨<PhƇ$jd$ PE j j j hb%H N$зNNApQtN@jxQP$Ph*$F y0VhƇ$jd$ PJ$\ $|$8j^<U$Pm $PS脉u/jZ$P$dP覈 u$<mfsjWV 9uD$8(%PI_P$Ph͇$!h$|$t$/dev3N N/ ѹNtNL$4~t$0 @$jWh" u ƃrt$Wt$8V~\GWVkIt$ Ɖ\$0Ë$H$|$Nt$ L$u DN$dT$=N=ȷN=зN=NK.-H!1SSjhjVS{4.SSjhjhSW4thP 2VW 1PPjhjVP4ǃ-=N-h h[N-h jP聍 hh[[Ng-}] hjPL N=NdO3t>dž,<tx(=Ndž dž,dž(Ɔ lO3pO3u(jhÌ$4=ķN-5Nu"jh$=ķN,5N NN0NF4Qt$Qh$Ϩ=ķNw,5NF4Ht$PhF$褨=ķNS,5NF4 зN9}"QPhr$u =ķN+,5NF0=)hPh$E =ķN+5NF0=|)hPhˍ$ =ķN+5NF0N49}QPh$ =ķN+NN;N|QUUUU)ʹ3333!!сis{09\~\{0\\5NsXș9}%CX=N~Qh1$5NsX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hI$J=ķN**N{4$=зN11F9tA uPh$j_' $Kd=N5N u։<8=dO3[ WVh$蠥 =ķN)N<$C4$8=зN`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPzNjs8ƒPVRWڨ)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh$Y=ķN'ܷNtm NyxH1҉$q1ҋ8$$)$<$$1C$I8$ طN=N_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$Wix1C1 t׉Ë$$QPV$$VU%9s($$$VxÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP@#ƒ$$$$$$׋$$$RPVQ"$9wȃr$9‹$֋$r‰$$$$$B1WRQP7uË$Ë$ʃQPRS})ÍC4$$W$$P$Q!@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQsj$P$$ @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh$趜 =ķN NB$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=dO3$_|HL!ʉG41SSjhjPS$NN NI4QSP%~ NH N N NP44Q5Nщ N`@#HL 9| Hh hO3H< NHX ԷNH\ NPTXH fǀ$L%=NO4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=dO35O _(HLJ$N$$$t!LJ^F=N$$߬$$ڌ$&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$$U N$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$B$=NO0 9| IУNN=Nu\Tu))УN1VVjhjPV\  NuN9NN5NjPy =ȷNGN N1ظ|(RQh|$" =ķNN N5 N5зN~ ș)dہ|4ă'GuȹC=NtL1$PP$$5NV1=зNVhZN зN1u;1$VhjVu&  = N5Nh`VWO =NtWV35Nx\ NhhP*x 1@$=Nh֐$f=N|o5NN,I\Tt~!NȃN׊Nd1 t1WPhQ$RR赒$39u1H$Whht@Pu] PPftu!ѡNt $ Q$=ȷNu$|&NH,$$DŽ$%$ NI,$1$ DŽ$1h|3)LN$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h $=ķNY Nj5NIu 5NFU $F +$^N$~J`^p=dO3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=NuFh$ NlK`ڍOȃ$ډFd;v&h$=ķNN5NF $11ہ~U uv`щSAN$~!ـ1@ NIl N5NF=dO3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5NN uҋNB8H!tk)D4NB8)Nj5N$9sE)ȉـ1B~U uv`5NF$CHu͋NB8$؋N9ȉ$J`~U uv`щSN$~!ـ1@ NIl N5NF=dO3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45N;Vs2р1@~U uv`5NF$BɋN$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$ NH NV$P V PV~x; Nup=NtNs4PP NN@NKd15Ns4N N Nq4jPm N5N{0 9 NPVQD =Nt N5NP5N Ny0 N$ryxtG$\X%TuCl$AP$ NOu$ց\TtQ!QЃyId t15 N5N3 5N\TG~8^xN`1?9'N+$~0lj$Ɖ$)ى$= N$E%Gl NN9wߋ$9w$N$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=N} $H$$$~A=ȷN2$=|j.蝆扄$d#t\% Nׁ\TtQ!QЃYId t1RP$Vh$$$;$$|W=N9NH,t =ȷN $$ DŽ$j 蟅DŽ$CN;X,/$~ j q=ȷN $hjPi dO3 N+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A~$h?$ldO3fDŽ$Q3ttO3$_ lj$DŽ$NH4$ $ H5ND@VL!! $`Nd8b}>fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$tO3@ lj$DŽ$ NH4$ $l$h  5ND@~L!! $߉$Nd t1$Sv4$j2N@0p9w Au1H$$DŽ$1$$t{=ǡNN@05NV$SQP$h$l Nɉ$$$t RPN$CPKT$l$hߍ$󥃼$$tA$ȃ=NCX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$2$pthj$Pe N\T$$i$$ $$$$DŽ$H0$$_$ N@$D$@L!! $`y$h:$l$  NId$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h N@$D$ @L!! $$w$s9$$h$lNHd t1$S6j$$V N$ȔȐG$11F$t =N$$=N40=dO30w4w+_1 N$`SWP 9 $PjSa =Nt$W蔴=̷Nt Nǀ\8 N= Nx\hhPra зNQP TWV=NtN Nq4PP 5NHLNd t15Nv4t5N95 NvG=NtNp4VV谸 5NN@N=NOd1Vw45N5 NvN@4P5N]e^_[]ÿWjVT` 1=зNVW\hQ#|Bh$zj&sj%sj(sNj sjsj'sjsh$Lh$Bjqsjjsjcsj\sjUsjNsjGsj@sj9sj2sj +sUSWV=ȷNua΋\$=NtзNNSt$P 4׋ зNUPSt$$5N4 9u^_[]b0*PWVhv$l{j$rUSWV"=ȷN΅ $NuNH4H N $N =зN;NNN;}FWh ԃ'1I!;HtG#P;Pt;H uV9R_1ڍ_5 NP=зNWh De^_[]USWV΋L$l$=Nt=ȷNteUjQ]p׋ зNSPUt$$5N 9t?a0)PWVhP$yj"pзNNUPQ ^_[]SI`wD$$'1C:Qh͏$hԦ3{ .  [SWV1ۃ=N։ SjQ\ =dO3@fF F)f ^_[USWV Ӊϋ5NF Nd t15NG=NtN5NPP NyU +y/\$|$y1U =N1=U L$D$uq`|$ G`Ӊ $u щw*l$$'р4l$skPh$hԦ3;z =NND$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ ho$h$11҉ ^_[]ÉՁ|$U u L$I` L$w$'ʉـ1@BPh$hԦ3Ay 8ʍ 6ʍ   1$5N$~3%)1@ NIl 5NNK=NOd$sC=dO3CNdЋT$ t1҉t$VQPRK{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRyL$|$ щT$ՉD$ȋL$D$VW|$RPryыt$ʋL$Vt$QRPJ$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45N;F8|$}X1Bσ) NyU uI`1@5N;F8|$|=NtNVPPV 5NF Nd t15NUSWV$΋=NG Od t15N=NtN5NPP軮 NxU t)h$=ķN(NxU ‹l$(H $t@\$=NtN5NPP9 =NG Od t15NwNNHC, $9r%UQh&$1r =ķNVN $\D$jT$RPQMD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5 NWN\Tud Njpxt$0t$ 8$<=NWVV1L(ɉL(@ u1LXɉLX@ul$ Njpxt$0t$ <8$,;=NtrUV軪1tttpTtDpC u1Cu) 赕% $D l$hVU* 蓕% $D9Pl$NT$5 Np0^_[]jfj fWV։σ=dO3ȃ@PQR=* =Nt'ȉGffF=dO3u GffF^_fUSWV$8tW9 ƅuWh]"j $$<$4D$Phd@U( tj1OLVhedAUy8 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;L%t$9l 1 Sh"U CPh "U+ C Ph"U CPh"U CPh"U CK,C,Qh"U C0Ph,"U $@D$t PS 1-Uhzd@$<WS7 t1 VhedAW87 hjUQ D$ P$4D$, 9L$L$9u0$S11:fT8tx$0ht"Pb$11҉ $ƅ*ŰPj PUL ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW I t$?/tWh*"xVhC"x^_Wh"jS fUSWV|$$\$(SWt$(t$(A3)jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVN 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$PUh st$hl$ _ƍD$ jP uhPNh$t$/dev3PN TN/ ѹUNtPNL$$t$ @$jWh": u ƅrt$(Wt$(V ;GPV ;|$t$( Ɖl$ ŋ$HD$D$t$ $xL$,QPjVhPNuhPNhp'=9|Pt$t$ )σ}4$ ,N-(NuU-,NuY5LN=HN9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣDN5\NXNS3t$ƺQ=tND$xND$ N`ND$xN|N1 N5ND$8NNNSNNNN5NNNN[NQfNfNN S3fN\$H$SWЦ 93rWhN 50N|$t"VS0YjVhNz 1NXN$N NND$N \N+ lN 1҃r1I15xN~σRVPW5\NH19w+5xN|$OL$)9r΅u Nf5&N5,N5xNVNYVjPl; GD$AD$ 11L$\$xNlNtnNtHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& xN@Nt &N xN@ N1HNL2 ND1\$;|$txN)áNf\0 ND1 Nu\$fT1 NT1fD1L$ G;|$tD$ N|$11t$dNhN=4N~i ,N i{5(NQ5LN5HNPRuh7$>V xN ,N5NPQWht$VxN@\NN1QQjhjPQNI 5NjPN9 =8NukLN HN1! V5h$=4N|(L$ xN lN1PQhQ$PPSD$$39u1H|$LWhht@Pv PPftu!ыt$4NtL$QT$=8NuL$L$D$ 1D$L$ 11T$h|3b =Nt$tXNtOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5NxN1lN 5ND$ hhXNP` 5\NtNP5NVt$> =xN=lN pN15 1 Sh"U CPh "Uo C Ph"U] CPh"UK CPh"U9 CK,C,Qh"U! C0Ph,"U $@D$t Px 1-Uhzd@$<W  t1 VhedAW|  hjUS# D$ P$4D$, 9L$7L$9u0$S11:&8tx$0ht"蔾b$11҉ $ƅ*ŰP<j PU ^_[]$0h"j] USWV81ۍD$4ShPSu1NtAljSPSWuW2 uMU D$t$$$Q1e^_[]fWV|$ W4 t8WhhOk tPhhO t D$1u^_hOWhE#jv fUSWV1@D$D$Pjj? Oxjjj( Oy h$j jP8 u h$趼 P uh$‹} ]7<\ 1HD$D$ 1D$؉h$WSn H41B$|'؍|$W57UO8h&} r؍|$W57UO} 8!M ؍|$jW57U肼 9D$=} ؍|$jW57UB D$} 8e؉|$L؀ O 7U14$PPhO؀ O؍|$jW57Uɻ 9 O7؀ Ok؍|$jW57U臻 9=D$؀ O؀ O؀ OءO@ O؀ O؀ O؀ O7U1s#PPhO4 ءO@O7UO|؀ O@q؍|$jW57U荺 9O} ؀ O-؀ O"ء$3HD$ ؀ O ؀ Oh$ OOuzp&tOt TOv =O~ O|$D$ fD$"l$"|$0l$L$0T$4dP `PT$,L$(l$( &|$D$ fD$ l$ \$$l$D$$hP h$ 57Uhf$t\$D$$$ 57Uhؘ$Lh$C57Uh $457UhD$'57Uh$57Uh$ 57Uh7$j跹 hT$OЩu h$8EOtO OD$ Ku9$3t-hp$h$9}d#hhOhOP O%O=u OL$ u(OOOOOOOOfOO8tω=Ou ~ 1ۃ| ‰T$ OT$  O5OVOu Vh $WD$ @ux=9}b\OC9uUOzh|35Oh$G9}%\Pi-@=B'\OC9u\P\POt.D$jPjh5O u h"${Ot.D$jPjh5Of u hA$DOt.D$jPjh5O/ u h"$ Ot.D$jPjh5O u hA$ִ O t+fPPOPDP#PDPt'ƀP'(PƀPDP((@O) HPTO)PhPQ D$jPjj5OC y hN$KHP DP@L$H O@fP\$1ҀڈP@ OP OP ; jhOj j5O hњ$31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh̢$P Hơ O O9}1Ҋ\<\OB9|1@9uOh$z3~"1 O\OPh(#Y3G9uj j2s*D$<jPj j5Os y hj${t'D$jPj j5OH y h$POt'jhOj j5O y h$ 5O 5OPhOh$2jhY3hh5O y"Y3 Y3=h$jhY3hh5O hj15LP5PP5TP5XP5`P5dP5hP\P8D$<8@ppp pVPj Wj%<95O~hpPjy CF;5O|/USWV։ϋ\$l$1EE EEfEUR\t tMOu6jjUGe u##Vet)xu:H Mt0t$VS ^_[]57U PVh $Wh"$j4 Ph<$hԦ3_3 j'=Pu-=Pt$ht$P9O~Oj1jh\Pj~ thx$jޱ USWVXUOPffZOP3tP P3 pP TOPfXOfVO1\OЃuȉf VO1t$<jVjP5O 4jhOjjhTO5O0~ yOt h:$覮D$<jVjj5O hPjTOPfXOO r&sKxPdOtP`OpP\O+ pPɸMb-xPʉ \O`O OyfVO|$qD11TOC9ut O‰fVOHPT$1A xVWhOh^$ ; hW$=hԦ3P1B 0PP@PpPPtPPxPPP P uCءxP@PtP+ PP$$߬$xP+PD$`D$`5&D$Dw\$8O$fDŽ$jhLPjTv D$8 (&|$&D$& fD$Bl$B\$Tl$&t$Tj$P w SD$lD$lPD$,Pj5O5O5Oov <hpPjOD$8<BC97)؉D$D$8 T$P'\$A9PI؉L$A PIff9uPxPPtPPpPPP PuxPPtPPpPPPO 1D$1H 8 3 8l1A h4$hԦ3AO<1A t$, PVhX$% ΍T$(jt$>Ph<$`%D$ Ot$؉T$΍T$(jt$F$'hӝ$΍T$(jt$Jh$$΍T$(jt$bF$'h$΍T$(jt$$Fft$NfQPh&$.$ ΍T$(jt$؉t$hA$΍T$(jt$^؉t$hY$v΍T$(jt$z0FT_hr$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h$΍T$(jt$؉t$h$΍T$(jt$d؉t$h$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h$)΍T$(jt$-؉t$h)$O"h$;"Ph$'"L$lL$AQ D$iPh$!h$ h$h؟$!NhDPh$!t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظy$L$dT$C;Pu#PhPQD$X)L$$ D$LPPQhP T$Ҹy$u1Gz$T$P L$r |$ rI3H 3~|3H |3 h|3j &(  }T$A{^N2D$ˀ) h$ uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$hc$9 |$ sS3H 3~|3H |3 h|3j $  }KF߉Ήs(T$hk$L$T$؅t%3H 3~|3H |3 1I h|3j >$h|3ءP;O*؅tءO!^L$AQ T$Q=P P t+)|$L$p|$tl$pP)ЉD$PD$P5& P P(P(PY3vY3PvP\$CfK%0Pf!t0P PT$ .KfKf0PD$ HP@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$JHP@)t2(uK 4POt1 4Ph}$ 4P O PVhӛ$\ Pha$h$h $h-$AfPhJ$ho$h$h$h$hΞ$h$h$h $h$wh5$mhO$c 4Ph$1BD$D$pfY3@)f~\OtSωL$!ȹT$V!RPt$ h$,T$ D$,Ot1RT$D$fxf5Y3OruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BOC9D$=O ؉T$5 O|$7\O)RQPh} GD$9L$~D$8:\OuG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5 O)\Ot$>RQPh-$ O;O}0u h$Ph#$mCы\$1B\$D$\$D$T$jh=$j踚 1AhN"WVN8P~bPP 3Q3; 3h|3j.P |3Q|3.H Pby`)PP 3Q3; 3h|3jP |3Q|3H P|tN=Pt43H 3~|3H |3 h|3j PPh|3hԦ3pPPtPPxPP8^_jj1A1=PPUSWV׉E\$1AMO]E uWVh$@t h$/Sh$!Ot5@D$ (&\$D$$Ŝ$OfyuhԦ3jX&e^_[]UVh1AtD$O$Ӝ$PD$$$|PD$$ $g0PtD$$$NPt9+ P} $0$!L$LD$L &D$Ht$H\$$S$ $  PO 0PL$DD$D= P@|-(P(& Y3 P\$,D$(\$ D$\$D$\$D$$f$KOP P t5+ PPL$XD$\l$XP+PD$@D$@5&P P t7+ 8PL> QPha$lOtkD>L> QPh$F|>uGD>OufPh$"L> ffPQh$ ^_[WVOu8jjVE t'86 PWhɡ$hhDP-"6 Ph׼$hhDP ^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h$B$t$t$ t$SPhѡ$ UPh$ t$t$t$ h$t$ Ph $t$ Phi$zr0G9s'GPh(#T| KG9r߃$^_[]fUSWVƀ8-uFhA#V9u lPhA#V1u pPT$,11CD$D$h$Rt$0 Hw؉$'\$̃duE뻁뱀=lPt\랉\$떁댁낃u1 $31;L$(uj1L$ 1ɉT$Љ $PXL$Au $APÓD$t2ڋL$ PWl W f uމ$DuY|$ujs Džu象 Pvp$t8=lPuIj VhA#辽 Wh($T1FVrPh׼$Vo SU8` hA#=pPMj VhA#h Wh5$Va \$d#ۙ"i$VWS jjVWS\$u[ 1GWWWjWjWjWVWj VW1] u hk$j轎 jj] uWx$8jP uZ joP j j\ t)qtOQHP j j\ u$8t1Aj jhA# ukWhZ$jh$ut$U^ ˤ$Q蚋0WW9\ Ԥ$td#V腻PSho%W聍 SWhG$j觻AV]&=lPud#VPh$hԦ3jfD$tPh$h<'Ph$hԦ3DjUSWVPu } h<'WVÔ cR~5StET P͍Hw4$('P벃LPP둃ftTdL PtPePVPGP8P) $3P=Ptjjh%v%(Z PND$ jjj"ٕ PjL$$Qh@hP u h%hPi )ލ<S H $L'=Pt1Aj D$<1CPSeD$D$ PSND$D$$PS7D$D$(PS D$ D$,PS D$D$0PSD$D$4PSۗD$8|$ |$z |$o |$ d |$Y |$N F PD$8gtj5PqZ rD$ D$d#D$D$d#_;-PS(St.H$1ۃ=PuWhA$h%$h%8 >h&SHg =Puh$h$h% 1CPFLCSS H3 VT$W$t' \$@1ɍP$D'P1A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12P#PL$L$# 1AD$ PD$@PD$ D$<+PR D$ Pj$P[3P[3P[3 PP׋t$#D$ PjPd$zT$ ED$ L$TL$@JL$CP"[3-L$#d$d$d$L$׋t$P:P@.P"PP P\$ PPP t Pt P1SSPV  L$Y\=Pj$)/jD$D$ D$d#D$d#PL$9a|$u qP Pta|$  ‰4 D$=PT$tD$1@D$ 1ۉD$0hxSh(P atgcuL$+P 0P*PP@PPSVh$h|3辥^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV&+D$  PCq1PPWSjV|$dt$ \$h$D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9[3tE[3P{y$L$t h$h=$QQhJ%PPh$X C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPE#PPh$ 3H 3~|3H |3 h|3j $T$h9t$ h$+L^_[]h$ jh$jk D$t'T$tt h$h=$QQhJ%PPh$ ËD$t%u7$%tu'$PhA$$1$Ph#USWV|$<\$8D$4t$0~u/jU* u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR"Ph׼$PWh# ^_[]USWV|$4t$0=PuMPhhPtt P'j.hPt@hPhPy t"^tCt0Wv`rhhu%hPy ^_[]1w)ȉPjQm SVU耢 fEu jU蚄 WUu&VhPSh_$hhP8P^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhPSh$hhPP[SWV$L$4D$1G't$"tZ@:t9rD$PhW$,^_[SWV|$t^D$uFD$jjP t1Nj0j.VAt@hPP謿u7ut$ u%hVhPw P^_[VD$L$ 1Ҁ0QRRhhPVP, thh}%hP1 P^Au yuyt$Qtu ȃP Q APh$hhPFPSWVD$PQ4$RP4$RPƄRP.r|I1AFL$ tWWVWhL'< u;D$ D$ PW]WWVD$PhL'< tt$mĨ ^_[]h\%t$ 6 tԉ1|$l$Vh$PVSDiHt$t$Wh|dD$Pp \$tN1D$;D$ 2i9t$sVt$gt!ʼnD$t$Wh|dt$ ul$$WhedAP f$a$>ukSt$h"h &h$WƄ$tP5O$ {$t迼$QPW $Kà9Éu|$$Pe' 1h\%j$5 Å~A1ۉh"P蕯ujVh"ho%h$WƄ$|$tP\O$ {$t$QPW C;\$ mUZk|$l$|$$PUSWV ? ujD$$D$<$sh$V詮thz%V藮3hUO Ƅ$hz%s_ut s hz%Vtt s h$Vt P` PD$ h$VtHáPth$Pԭ(j,SAtZ S_,PD$PU6xD$!=`ÉUh׼$S S7_Dž?tG<$tSWUhï$h%h$VV5 tEUhӯ$Zh$?Uh$h%h$PO15Pt ,WD$GPhs$ }(|$HD$ L$ T$[jj hd#PQjR D$L$ T$Cjj hd#PQjR \$d؋L$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hf$h$S\$ =PuD$m$D$ P$P 8\$t$Php$CPPU uUh׼$B1@$~#QhL$u1@$\$$$Ĕ ^_[]$Ph׼$jD Ph{$hԦ3 jIUSWV L$P$T$t-P*jhPj' PšP$T$1i E$48t!u6$t$P誛T$ uF$t$P莛T$ tEM<ǃ h$A1 ^_[]ËD$ t 0P$4$݋D$ t 0P$$ؾPPhhP2< uhPh׼$jjC fVD$t.})zhBQh$54QP QT5\%%l'PQho%54Q#u54Qh\$*5Q^ËD$ H^WVθ%l'PVLt)uVhE$54Q QSGt8tPwhڳ$z wh$huj whBQYR GdQhQ^_WVD$ t;5hQD$= Q DQu  Ql';pt8@uVh$jA @u=آQthآQPhڳ$ŀ Ph$赀u5hQ= Q^_Ã|$t $色QÃ|$t %hQÃ|$t $rGQÃ|$uhQh$54Q' QÃ|$uhQh$54Q QÃ|$uhlQh>$54Q 贱QSWV$$DŽ$HH$pƋ$ ƒtS!=Q$t${$atσ=Q =Q PSj $;rtr1Auu($$hd$PQ> te$P$$ho$PQ t8$(1;BQPVWGV5SNQ^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hh2Qtrʄt<$1ۊ Qt8tCu 9s1QB+$=FFu4$D$|$ 1 BQ$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ BQ<$؉D$BQ$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$54QhX$-<$?uhVWJ x^_[]USWV0$Du%$H$Dh$PQ y1E-0Qhj8UhP t$H4$=dQI1VV$P< Í|$0;=Q=0Q$H5Q5Q5Qs =Q$t$9ƒ= QRPSQWy=0QuE=0Qt< Q Q$Hct0Q Q 0QVV$PC Å 4$j0QQ0^_[]Ã$D|Ã=Qt= Q;1 T$󫋄$HRjh4 |$D$=Qʉǃ=0Q$H[L$05Q5Qj =Q$t$9Ã= QVPRQw=0Qu9=0Qt05 Q Q$H1t0Q5 QG=Q-=0Q$H$HL$05Q5Qj ƃ=Q$t$$H9= QPVRQv=0Qu_=0QtV= Q Q$H1t0Q= Q$$H4h$D$P9 E;$Dnj%=0Qt#4Q@=u1Hjh Q QP$t$l$ jhUVx!|$ toSjWj@r!V wh#$54QY Q ^_[]Ã|$d#tێ"Ã|$t!hY$hN$h>$54Q11HQWVt$D$ tu51>#t5 QRPh|$QO Q#54Qjj6hE$1\ Q1Q^_h$h Qt$t$ Qh$h Qt$t$QWVD$ tZ}UuZt$~hێ"WtTtOhd#WbTtBWty7vhĶ$54Q{ j1H_1=DQ1@1DQ @Q1Ҿd#tێ" щ @QPVh޶$54Q1=DQQ^_ËD$uD$L$h$PQO tvD$ph4$gu<=Qu0= Qt54Qh $D$ph3$vgu+Q(Q(QNQVD$ L$Qt u]H tQHQtsP> t8=(Q4Qt5h(QhL$Pߨ Q(^ØVh;$_%Pjj$he$YVo;^ËD$tIDuD$L$ho$PQ t$D$ph$WfuQ@QSWVD$-uD$L$h$PQ  1G=0Qhj̴WhPt t D$1VVt$ ǀ?tx=0QtyD$thWh$eu Q=0QuB=0Qt9= Q QD$bt0Q= Q 0QVVt$E DžaSj0QQ^_[ËD$uD$L$h$PQ@ tmD$_D$L$h$PQ tI|$BD$ph$}du8D$ph$dduQÃtHQUSWVt$ |$.E1ۈ$54Qjj,h$U% u v1.ĔQ^_[]QUSWV D$ #D$$L$ h$PQ L$ ȃ#D$$L$ hd$PQ D$ L$$|<$DhE#t$zt3$8|t+4$$H$$ 3D$$h $0[zD$1E-0Qhj藰UhP? t D$$\t$=0Q1D$ H9=QP$t%$9t$t3$T$$VVP4t$Q0Qu?=0Qt6 Q QD$$" 0QtA 0Q QE_t$j趯0Q$9t4$5豒Q ^_[]SWV$tKjja!tK~S诶 9uWj81uh$$;1HQ^_[þV5 Fujjh#: +%tj/Vg t@hQW0 =DQt854QV4QHQP~ Q Pj 襤|j5ܙQhg_#WV9  jWV+ Vh$QjٕSWVPD$D$t&D$t$hK$PV rQ^_[ËD$phT$^u|$h\$0 tD$x|$Whg$^W[uPjWo uP|$ho$ t D$x |$Why$K^WuPjW 1ۃuM|$ Àu*D$p Vhy$ ^VtPjV܀ Q54Qh$D$Q=(Qt =(Qu=(Qt#h(Qh$54Q聟 Q54Qjj%h$_PËD$Q==(Qu8=(Qt#h(Qh̸$54Q Q54Qjj$he$OËD$uD$L$h$PQ< teD$ph$\u<=Qu0= Qt54Qh$D$ph$c\uQLQËD$uD$L$h$PQ teD$phM$[u<=Qu0= Qt54Qh"$D$phL$[uQ袍QËD$t8uD$L$hT$PQ tD$L$QPhd# RQUSWVh$V0, $|F$$h1Gh4V, 9}hh\%V, G9$uVh׼$Zu j\TQ^_[]ËD$t8uD$L$hi$PQ tD$L$QPh$ ]QËD$thuD$L$hd=$PQ谿 tHD$:D$L$ho$PQ茿 t$|$D$pph$Y Ãt݋QVD$t$5 Q Qu h$Y%蠋QD$ ph$Y5 Q^VD$HrfQ>5 Q Quh$:YD$ ph$$Y5 Q^VD$t$5 Q Qu hʹ$X%QD$ phϹ$X5 Q^Ã|$u|$t譊QÃ=Qt 1PP)jw=Qt 1PP j|$u|$tTQÃ=Qth׹$5X+V1VVcV豎VPD$ D$t}uD$p*Qh$W4t+hK%W4t h$W4u7 1CvttXQu\Qxz1H!\QP5XQh'$54Q^1Q^_[VD$ L$QʃuCuDZ$Q0tƃu54Qh$'54Qh$~ t;=Qu254Qh&$J QD$@9G= Qt<54QhQ 4QHQP~ Q Pj Ƈj 6\$S $Q$Q05YQV =YQt'~t!4QHQP;H~EQh@D$PhQB 苄YQ$(@$Q$,@Pj#븃<$JE1A;$(@t4fUSWV1$D$jh|Q` t%=Qt 1PPI<$~KD$@$Ahjphj a<$t(=Qt$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:483txP=<Qu <QD$ Y$- Qt+hE#UnYt}|tU Q<$~D$@$D$<$d-SWV։jh$Q jh$W tlh$Wxtjh$W uYt F t8t4h$]t8tjh$W t ^_[((11VPP ^_[)WSh$j USWV$\$@t$<|$j h$W |$D$ 1D$D$S腮Ɖ$P^VD0VǃV=WHƉ$WSPW Whb%V PjOxD$<1ۅt$1Gl$8D$ UjIQcwCD$<Gu7j hN&W |$j/VF t@P葭D$-t$|j:VF t\ÉGWfD$C/GPj5D$<L$AQj褾8Q1ۃcVh$葊1CVD$t P؃$^_[]USWVωT$L1$\1J$$$$$D$D$D$D$$$D$P$D$`1C\$TD$lD$hD$dT$pfD$t$h$d$`$lf$pM $M$t$$$|$xD$HShP褑 $t$jNj$t$j 誋$t$j荋$t$jp|$t$$D$dj$uV1KP* F|$@t$d$`t$h$dt$l$hD$d|$p$lL$tf$pOG8>h$P'(t$@h($$t$ $t|$Dt$t$DЃD$; Qt|$tt$-D$L$dQ.$`E.$.$tu.|$Htt$HD$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$@UuD= Qt;PID$HL$H+ QtD$Ej/t$L6B t@Pt$@hO$t$HD$t$ QL$@|$D$81QQQQ$$9 Qt1$Pt$au$\$` QQ|$pyQ$hx@#t$L6D$|$t$$QPB<u5$8$<$$$\$` QQQ Qt+t$肿j5Q5QPAY= QtPt$Hh$54Qz QQ tQPh$54Qz54Qh t=@j $QP} ~޻t?$9u3;$u*WvM9$<r$)PWR t/h%V|Džm1Ft$Hh$1$t P $$u |$p$$Q Qt$Lt Vh$t$dt|$dj%W't Wh.$1$GGG fGd$P$xPW# $u2$t'8t"$tJ?t1hb%WMtVhn$证$E(2W DŽ$t$@$F|$d (1D$$L$d$,|$h$$$|$pt$\$BBB BBBB QJBB D$$PRW$8N t ] [0#RtD$$Z$$Pv-j j WhSvv= t%h"PS j "PW = Qt+D$$xt!~$t$WSP54Quv jv Åx`= Qu~PvvSѳx)$P$P$Phd#ykSZ 1KW$Ph$ Nȉޅɍ$PL PW$4h$Uh1N= QtJ$t$uP蚡$$t$uPu$Q~R4QWhs$JtNu1h@h$hQT t$Q05YQދ$tPDŽ$$t4WHPjWT $tPDŽ$$t4WHPjWT $tPsDŽ$D$$t PJK |$@$$hj8$LQ<tQh$$.D$$\t$ jLQtV= QtWh;$54Qr t$$tI= Q D$tPt$hh$h$54Qr1@t$ht$hh"$t |$dwh6$Vh #hH$VQhV$VC8Qxt'1ɉϋ4hL#V! G8QЉ;zrۡQ Q54Qh$! 5Q5Qhj$VӴ5Q5Qh$54Qq1F&1t$lh$$V虴 $`*#=HQt"D$$$t$QP^|$h$A tPh$W: hY$hN$h$W D$$0$|$Pt1$t$t#tD= Q$tPh$54Qp FWh;$$8W诳 $$0t-= QtPh$54Qp FSh5$Wn t= Qt54Qh$$ h$t$ =t$ִ1V|\$D$Lt$P5b3Ɖ$$ىD$$$$$$D$$8/t$-HL$$x*\$u4$j $PQsq ƉӅ$$D$$8$$Q Q\$|$\T$X$$$$JNjD$PtPID$PWDD$PD$D$\D$ D$XًT$ D$t$\$߉$(Ɖ$ ˋD$X$D$\$$X$$P5b3G$$$$($$$ $$$g$$D$8$D$4$ D$0$D$,$(1@$΋$  \$ۋ|$(Z ;Q xPH xP h$5 \$D$ D$8L$4D$ D$0D$D$,T$1@t$|$(L$<$$D$,$D$0$D$4$D$8$t$Jt W=t V0ߋ$$$$$$$t,,t$ht$hhv$er $$ˋ$$H Q;D$p|$Dhjt$hj{t$ |P\Qt9tP PtQC\Q9|ʉ׺9օt |PQP1 Q Q5 Q$t$jsDŽ$jkމ|$`$t$5|P5Pî $IKjD$(P5P \$$;PWK8"NF؊ u@;ut tH@D$$h$P<-$$u 1É.1ˉ$$8$4= Qt/j$PL Q։щ ы|Pu|P1ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj5P肪$L$T$P Q Q$)$$PT$DR1Ot1$VSW $u*I#tu'VSWݯ t߉$ȉ)u$$P9=Q= Q$T$L Q$9= Q}#Ή54Q'$Pq4QHQP;H~-Q# QΡ Q9= Q}Pj#{fЋ$$L$T $|$`t)։>ډ׋$$|$|P‹$4$8$  QˉƉ$D$@1S$P3$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$茦$|$`tCt$5|P5PƩ h$5P(8M|$`=$@$Dt$hl#KhE#t$7D$8|jjj n$D$@hP$P' D$D|$DDŽ$%Q Q m!ڃt9}M#$H5QQ$$!;$$= Qt54Qjj h_$eD$TLD$D|3x=Q= Q Q Qƒ Q9}%4QHQP ;HQ#4QHQP<Q 8tB$ڋ$!t Q5Q1ϋ$H1 D$h%P hP$t$_D$D|$DtDŽ$ t$oD$@Ph$h$Vh$OC"P)PSh$h$%Pt$Dhm$jkh$h$$,ibhr$ iL$D$ D$8t$4D$ D$0D$D$,T$1@މPj at$thD$Wjct$D$= $#$1V$W$$$$$$t$DЃt$DWt$ u.54Q$P"P-PhQ$V] Q= Q| jjQx& Q QQ Q; QD1 Q Q1\$  Q Q^L$T$ T$8t$4\$0r\$ Q1tt$h$54Q\ L$@|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Wh$fD$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#._7tt$h$54Q[ t$@t$&vǍT$d1D$TD$L$ L$8t$4\$0ËD$D$,T$1@hM$fD$L$ L$8t$4\$0h$eD$L$ L$8t$4\$0ËD$D$,T$1@t$1~|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hn$$e$D$8$D$4$D$0t$,$$1@މt$$h$dD$L$ L$8\$4c$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$;USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q$ t}D$VhƉD$j@P~ t%L$L$4<Q@P4ƉD$j:VJ @PD$ t$D$0|$j$jPW4 D$4t 8D$t{8tvD$ t8tj;P thN$PphV$WZh^$WDVWh$b Vh$b1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhb%V @L$ǃuC= QtaD$t$uI$t>th$V;1Ʌ $t}th$U1ɉL$<=<Q=Qt 1PPü=<QS:|$DhPW |$L$D$L$D$ tD$ D$$= Q QL$QPx= QQt=ut$8t$8t$ z t D$,t>D$Pj3D$T$"tQPh$` "D$Pj虓<$l$,|$u'j/VtG1|$t>tFhhia&l$LU l$t$1l$ -QD$Pj貫9-Q*x1l$,1Kd}Z<$t3$DSVWi Shb%W SUW <$hh%t$LV/ t$l$D$ D$<4uT5 Q Q= Q$t$hP|$LW |$D$Pj5 Q Quj/U t@ʼnD$ D$$= QtAD$Pj?>uP=QuDhԦ3jhh$W)1D$PjF8Q1ۃcÍL$%L$0d؁D^_[]1Ehf$N^Ph$h$j USWV օ\$ |$$jh$Q l$t=jh$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CSЀS\$$UP { uG<$WC Uj@V|$$tZ{ u <Qw@PaƋ_j:Sxt@P@G_Ot[uUnj]U9$tYÊ@t<:uL)SUV V,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PUU }t $9ut=s fCt$t$Uh$[CC tWt_uk QKUVh$[ t$t$Vh$[\$ n1HJ3 Q(ud#U}C{u{ c%tb%P}C1 ^_[]h$jw WV։2}vv}Gvh}GF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdja\=0Qt<2Ph$jdVK~ 4QIu1IPVQ jhPDb Vd Qj[=0QtD$|$D$ D$fxtD$XD$0PS}x.#D$8=u$$ QQu h$54Q= Sh$Wh:$Q QP$ t^L$$h$Wth{$WP$u3hQH D$fxL$$D$@щ˅tVWh% Wh׼$@QSvD$|$ 8PXQt9tP p̃DW<$$̏' Q QD$j P57U LQD$8$rV57Uh! Q $9E7U Q? Q01X @QDQHQ 7U Q57U\8$1C1@ Q Q Q1 Q Q58Q57U 8PVMt$j h/U#V t$,57U7D$1CD$h%Pet8sD,@ÃuӻD$,jPSv Zt$m<QD$jP57U b3 D$8$ Q57U 7 QhE#P$e4QԦ3g Q QQ QED$j P57UO PQnD$8$UTQ$4$57UaBXQO\Q57Uh$D$PPPh)$hԦ39 1@,^_[]Ãl$\$ 11FSVS54Q $3)$@$D`QdQ5hQlQt?D$,XXXXX  QH1AHhpQPSW tQxQhY#f t8tP=5tQ7k tPuDžu P5Džt=tQ?74xQ=! QtQuetahPh! Q =wVh$h! Q蓗 9r&5tQj?sPVh$ ! QtQuhb%l4tQ Va5Vh$Po Vh,y$W h$A t1WQhz$j} $S d#d#tWQSA} $S tWQS } $SП tWQS| $S诟 tWQS| h$菟 "tWQh$| h$h $\$ tWQhp#| h$= tWQh$h| h$ tWUh$F| VؘW>VjVjVjVjh\j9$@w$Dj:0蕵t$D0qCjh|Q hj*hj $D8j@W/1t @Ǎt$,ht$V \$3|${$D@CC 1= Qt 5<Q5 Q$@@SP&= Q QtȃujUt$( QȉPQt=u9QPh$54Qb 5PQ4E =QaPQ\$ 57UhF$7U?u D$PPPh)$h|31Ph2$G 8P0tQ$D$Djh|Q# hj\hj M57Uh$Y57Uh$L57Uh$?Ph\$757Uj?PVhE#57Uh$j?ïPWh$j辁 uR0衯Jt$$H$H ƃ= QtjWWV7P1 PVhu$WV =0Qt>54QhQs K=QthQhi$54QJ 54Q蜸jh@hQh$3*/tEt W=YQk$Q0t&ƅu'$D$54QPr /$~ t&$=QtYQj 6W莐 $Q8$Q05YQV =YQt'~t!4QHQP;H~Q~  Pj8hj hj ^_Ã=0Qt4QHQP~Q fPj fV5Qu<FA\t"uAt""tFAQt FAAtF5ԙQ YQ;$ԙQ YQ1tu ؙQؙQܙQ^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4ȑ'RSt$DhA$QP QQȃ Q QD$u݄$|9s0;T$ D$r$|$\$|?؍<)hc$؍<)hV$QPg N+Q QT$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh|Q7 VD$ B J1rrJVRV} $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0V0jr0^USWVh= Qu= Qu }t$XjV+Q~=QN+ Qy@BD$HT$Ll$HL$$D$$5& Q QЃ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иd#ti#|$d5QPRQh~$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQd#ri#+|$QRh$Pt$)$ų i)s<$*<$Hrr޸t1@D$))kd΍ QHQP~ Q P芽ʍHr̃t"1QHQP~ Q PA\t"u5QHQP~ QPQGduQ1G QHQP~ Q P贼[~#\uEQHQP~%Q'H wr? t:,u3Pjt%QGdzh$ 1NQ=Qiu%'hQPҼtu :v2USWVՉhQQݏtDj.V1ۅt6UP輏u&)WhQVgw u1ۀQ1C^_[]USWVP|$dL$hT$4t$vD$D$\$$D$,T$($D$P+D$T$,T$ L$0L$<0׍9@P$Vt$P3 |$St$W t$$D$D$T$($,0?D$P覹D$|$8T$,T$ L$0L$8Ӎ@PWt$8P誜 \$Vt$W薜 \$St$VW聜 ,$\$ SUWm ݋\$SUWZ ;t Pw|$dt WwD$P^_[]Ël$(D$$8/Y $PD$P跸D$|$8\$<\$LT$,T$ L$0L$48֍1@PƉl$$l$4WUP諛 t$|$LWUV蔛 l$U|$WV \$l$ USVj l$USVW D5l$,\$8T$h$hxQd r1ɀwQ.)hxQPh$54Qjh$hxQhh tfjh7x$hxQPh tN=dQ Qt$Qj h$htQ7 uh54Qh$G S=dQ Qt$QdQj h$hBQGe thBQh$54Q+ 1HQQQ QQQ Qhƽ$1Ƀu 1AQu ǀQu Q Q5 Q^Vt$t3DH@tNFuh$VDtQjh$Vf tDh$Vt9h} &V t.h$V~u'QQ Q QQ^áxQt Pk1xQQ Q$Q=<Qu <Q Q Q Q,Qt Pyg,Q=dQtQ Qj"=0Qt#4Q@=u1HjhhxQh_$54Q fyQ20hyQh$54Q yQt$1 UZVh$Uc D$(V虍!у $ Q54Qjj(h*$/}u=Qu=Qu Qtj=DQua54QhtQ= 4QHQP~ Q 0Pj # DQtUh$54Q 4$|$5 Q=Q1Hƒ4^_[]t$h$j2hQstQh$jJ USWV\$l$jWth#WtUh$S6b Džu&Uh5$S!b DžuUhO$S b Vjkt^_[]SWV(Q5 Q=DQu  Q=Qhm#藈(Qu_j htQztL8tGx"uAHt.1Ҁ"ux"u"@(QZHt@r1Ӎ(Q5 Q=Q^_[SWV$h$VX V%T h%Pe1Fta\$SW@ t?|$/uH$VuPVSh 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh&P ƅu 4$~ 1$^USWVHu\$ $Cj j ShWuu t "hVW\P j VSPP pQ]t/M I9Nt vuvvS} jjS ƃPjS \$fD$=LQ~%|$@jW2QLQO$Cuu S VjP6 1D$ PWhp" D$ PWhq$h9$<81\$@jPPhSvv蚇 thh"SO 諤8Sh&$<-D$ PWhf$聤8$\$=LQ~N1PD$P)PT$@L$H+T$+L$x@BѺMbiy1fD$ PjSX u,8t8#tj}udۣ8AuZku<FD$ t:D$L$ PQhhuЄ t\$ ۋEu Y ~D$ PWh"$l; 1He^_[] t$u SWV|$GHO~H0^_[Ë\$1NW7u4G `f@u8t 8#ug GHO~막뭅t΢USWV|$\$GHO~H^_[]1M;G~ uWSu4G `f@uC<\  Cj$jnGٍ$'j  1$'t$'1T$JAjD$ $$ _EQED$$hD$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$hQ$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PVAǍ$$ D$ VVD$PVA94$=31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$hQL$ QhPN hQ11 |$ 1 $R@t1BuڋD$8L$ Qj PY@  Ǎ$Pj t$8@ ŃuuD$ L$ }D$HPYQ4xWt$ PQ $(4$hUt$PQ L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$nE o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[m}j $( PSל M}8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =xQ hh VD EKpCDH@uٺ>$&G=xQ GK4CDH@uٺH$KfCDH@uٺU$GQC t _DH@uu%ƋD$pW0k@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,hQt!9}uEpVkmj hQxt$p@ hQ>GWVt$F1EjhhdQ Å%|$څ,h$|$th$z`Q `Q11s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ V= uF9$Qs$Q^_[]VP Ph$' USWVP׉΋$1m~ w]$' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j G @x b3b3[>u)j H1҉P5b3 b35ojH@b38 b3>u+ j5`Qh|3q^u QP}~h"j mPPhl$hԦ3ˉjQ~USWV\$|$t$ Q1EtB5QWV莔 QQ5Q]1QQHt8hx@#p螉Q QI QKph1d#jhQrfQ"Q ...QQQ@Q Q =QuQ8#uxnu Q  QW1 t,E-Q@J}QQR)ʉ1ɉQ9‹\$kQ1m1 QQQu>#u~nu QtQ1B C1ɾ8f Q@Q1ɋ\$uQ\$t1A ^_[]ÉhQh׼$jM USWV|QuN Q19u:=pQuQ$3$3Q^$Q|3Q"Q1NHQPP\Q=$3P[=QtCQSTS5Qu thQ5Q oQ=QtMQt=|3tPZVQ5QhQ QQ=QtQQ Q@QQ=pQQPrf|$pQ8t0W5QQV~ W5pQV. =<W5Q$VL W5Q$U5 V\  U PWVh`$WhQ9hQ誣Q޻t=|3t P:YhP$hQ(QrH9tt$t$P^ QH9tȋL$!QPX QQ=tQuQQQ|3Q"hx@#P荄Q5Qh׼$QQ$@1Q5QPΣ 5QhQhQF ƅttbQ|0 uNt$@ $@ $QV5QPQ1@|^_[]5Qh׼$j 5Qh#hH$h2$5Qh($j h$h$ =Quh$r hQ腡jKwh$벡Q@ u:HQP~ QPJXt5QP膢 1=pQt tQt SWVQX1t^hx@#3蠂t&Nj@HOWWuWvV[뾋HWP WTV1F^_[V$ $ $t$QPhV}V5Q5Qh$jS V$ $ $t$QPhV:}V5Q5Qh$谋 ^SWVP\$|$Qt PD$jPSW PQVPSW Q^_[ÐUSWVQjhQn91FD$Q`QQJBtOz T$R uW|$+;A QQ,QыR L$y th|$ Q)щ;HT$7D$t{T$A QQ+,Q. Q;H@ QQ|$to,Qu1ۉQ1;AQ1;AT$t1jT$ ,Q=(Q1ۉ__ WjWSQPR|$t4JT$B8 Q;H`QT$,Q5(Q1~>~ VjVWQPoR1FT$1,Q=(Q1ۉ__ WjWSQP RT$t tCsBtt$u Q;HrQxt$tQ1BtȉÅQJA7$'=Q5Q$=QFPj W5 @) QQPW `QҾ5= Q  QR҉Y = 5Qh("5Q| u 1PjhF@+6vFt P趹 uF6^_ËFp vh׼$jj USWV ՉL$4Q0QщT$Љ$ 3(QE]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B DQ9r7 DQP5@Q@Q0Q4Q$(Q0D$SPt$V6 it}ŋ4$L$]\4$L$t&uE\DQ9r+DQP5@Qqƣ@Q0Q54QF1C4$4Q4Q\$D$ DQ9ȋ$r+ DQQ5@Q@Q0Q4Q ^_[]USWV`}$111D$hH$u WF uu57U>ut0Gtg7U;u7U$8u $3ȉL$91t*VLt@T$?D$D$t Vlj|$\$ |$t?1h%SQl t+8ttDGhO$jf 1E L$3 th%̹ u3h׼$jV tD$PW uhv$ۃ|$ tt$h uh$뼅tt$ uh$렋Cu/h# +%tjh$VV VeSP]d QVh$ JPh$hԦ3g j+\UVQt@t $e^]Vh$j WVP։K1ɉQPW/ V?t$8tK1H^_K8"u #Ft1fUSWV\$t:{u4PD4ƋD$pVtD$0pV Cf{~a11C404t?L$qPMt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPUF tvPBv F vvʑF^USWVP1k<jp3~4jp3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùy yUSWVPk<jp3jp3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùzGz8{){hԦ3jjCh$jXV1=`Q|/bhet*jjj$ V!V*5TdQ5T)hQj5Td@lQjPvpQt#1ɺXp3A<.u`Q1 1@^USWV D$0f 9lQZ pQ,I fEE!f ufE(Mt!U1f~ t @9ufE,$ltE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPPy/tCÀ8t? 3DAhԦ3jk Wt@$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$̖'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEugLzfu=m$ 5T芲5T蚲1QQPS*t$V5T5Tt1U#*19}1ۋ$p$ *ŊEt9}1< ˊEE5Thi$1VV5TUVj5TVj5T#( 5T5TC= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hԦ3jh bxu+=dQ dQσqt$V4sVV"5TdIhԦ3j#h ,$,$fUuE 9|)BfUhԦ3jg ,$T$4xut EfEuGza|1x(| E9}ED ufMhԦ3jhg !}Eu)u~E t uPkuf;}]D; jtWcD; tt$4UЃF4; ~ttt$4WZuE tuPu sE uuVEpQ,Et)uE t uPnuEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃu褄EE tP荄E ^_[]at$5hQt$t$h$hԦ3XZa$@ t$St$t$ t$UPh$'a $A It$U5dQt$SQPhr$hԦ3)X$jLUSWVT$qЉD$ qGud$ T$T$ $P%%ǽ)j P)1Ƀ QWl$ U|$ WD$pǐtS;tNt$Cj Sj)؃ QSVWD$p臐t G}uo $ $l$Atl$|$qyKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W !L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SC G΋<$9Ƌt$ufthJ$VSwQ|$Gu1PPw|$ GL$G)VQwG! w< ^_[]D$L$pQ fAËL$1x9 lQ~pQUSWVl$0.lQ9}=pQDP5pQ&Ǎ PjQ5 =pQۉlQt @tFj 1NtjSSP'Q1ASSWQQPS0Ѕ3W =Ѕ3t@h&i%WY t5QW薒Ѕ3Wz Q1^_[WVt$ w?=Ѕ3t-t)95Qr!Pz t;Qslj4\{3^_5tQaQQ5tQD5tQVt$5tQ!QQVLPh׼$^PT$D$ $1APYXWVPt$|$5tQQQD$$WVP;1A4$^_USWVt$R5xQ5|Q->-|QE3\Jك@to@uwt uDZ@t< ty< =Qu =QtI5tQ܅tj 5tQ()=Quj 5tQ)QQQQ?=Qu"5tQttj 5tQ(j 5tQ(1QQQQQ Qf)Q1ۈD$uQC5tQt$L$4 5tQT9Ƌt$|25tQ>VUUU9}j 5tQ'|$uCj 5tQ'KVW5tQk E߃ @ ȢQQ=QuW5tQ*t7j 5tQv'%5|Q5tQPgQQQQ5tQ裢 ^_[]t$Ph׼$VPt$D$ L$ $PVP;1A4$^hd#t$t$t$t$USWVP|$ \$$l$(t$5tQLQQD$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWj5tQn1ɉV,$E|$@t[D$@8tRD$u:h]i%5tQet$@5tQeh#5tQeWt$Dt$ h"%5tQee4$5tQځD$ 5tQ5tQX‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5tQRe5tQԁth &US5tQe/)PS5tQ 5tQ訟5tQjÃ~0L$ZD$  4Ũ L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQPo QtRD$(υ~] $9I\$)RPQ KOuLuH|$@tAt$t$D|$WK WhԦ3j7 D$z19Dzf tN;L$$} 3DXuhԦ3j6  $9A)RPQi $8GED$t+)j Pt$5tQ"L$QQD$t8ʋL$ u|$@t$;D$@u  $L$t$t$PF 4$0^_[]hd#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5tQw~5tQG~$tKۋ|$,;Sc|$0L$Dȃ19AD$LD$Ut$HP#1t$PQQ&$Źt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PtC@j PuL$$)݃} 9WUQS5tQƅ|$ 腤V]ƅtV5TH4$5tQ7PW;5tQ[PWW1PPWF W轚D$E|$ GWUPS5tQ[Pŋ=tQVPW=tQVH[PWnW5tQQQ#WUt$ Sh.i%5tQƼ1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV 4$tWVVQWJUPQWQ^_[]hd#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hd#t$t$t$t$USWVP|$ \$$l$(t$5tQQQD$,$VAUP14$SWt$(^_[]hd#t$VPt$D$ L$ $PVPA1ɉ4$ ^V5tQUy5tQy^fUSWV $$$ (=R15pBR5CR.Ry%5xBRWK2RWVP З'Ft(=vuɸIR9RlBRBRBRh%k ^$|$ hi%SU e~o~1pMrt"CID:R붃fi57Uhx@#Vq#PhW- \$h0#W^N D jPh$ t \$Sh|$W- u4 j%З'W:PWV t }u몋}tED$th0#SM <=u̍4@h0#PM Fhm%VЯ 0t$VW F,=RhBRhBRhi%57U `S/$$$ Dm7U$.sf6jhGA$h$ Qe5Tvǃ5Tv1FVVPW*;R*t5BR5BR+5;Rh0VjVjhj5Tx8`hh`.R聀D$D$@V轢ljD$ V订D$1ÅjP虨 $t|$ o u*t$ %n ut$ k%n jz|rjU۫tc1L$ <:B @9u1PPPPPjPPj jUVPv4t(jvt$WAWU11V/|$ t$~144 C9uWVjtPjjVhX# D`(=RjE|BRj"6:R1V蔛 t9Pj9| h$u譸=,=Rt jӦ jjDԡ4Q1 ^_[]Ét$ h1GQWP蠄 Ph$hԦ3) VW=hԦ3jj,h`i%j¹hԦ3Vjhi%VeV1FhԦ3VhEh#l%VCUWVVp hY#胶 P蚲  }[&=.Rt>VNPhim%WT 5.R5.R.R=VPh{m%W  5& WefD/UWv W!jŋ>7Ptn,$n ;nu:FUW}t^FPvetFljFn ~D$Pq4$cUV SϦ ŅShj]jYj蘅jVsh$ew * vV? 蘊Vjj^4?15,=R^IRVPX~Bjh-yIRjPWyjhy=:RVVu%IRǀ$jhxup豌IRPh׼$jX jȒtOIR)tTPCu2P.Ku#POuTjh0xPo^_[]Ë$l$ D$jP[tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UG9u1PG9uU~U$tG10L$9 t.T94t&zt T98t4t9t9y`$El9rۉt14UtG9uVfVSWV1t$t$t$ t$t$4$5,=RjVՐj/r4PV~8 IR$*tKuKt!PуtIR$PIRL$$Q tXD$t$VTVx)V2Oum%um%t*V^_[À)ujhcu VCt5T蝉1WW5T 5T载5ToSj I9;xhj_jZj]jV'Jh$r m%m%}USWVο$WQS Whm%S誤 WSUݣ Wh%U莤 S1tGUt0VVVVVVVVVVVh"h41PP:t US:^_[]SWV$SQVK Shm%V SVW/ Sh%W Wt VW^_[WV1t$t$t$ t$t$4$5,=ROjV蹍tkjo4PVf5xGIR*tD$$tL$PQt$VqLtVO^_ÉWj ?t1hj`PP~u{fUSWV$$$$1EQt < tEBT$BL$ QvD$l$1@$4VG9D$pPt$V/ Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW  L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt048 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW蕌 5.Rt@W蝌Phim%V 5.R5.R.Rsh%hm%.Rt*W@Phm%VF 5.R.5;R0ջtPhe#ho%j[K1e^_]Phn%hԦ3 jrUWVV蟋 =V訋1Ph{m%V腅 59}OD$hKP:8PXv|$u9Mx{;5TtVWjP|$ۋ|$t ho%c| USWV։5T˧1@P5T)e5T[Csh1PSUW8 /LhP 7LhPS1CS8 KWh׼$蹔qLhH%6FPUYr5TS@)VUPRQ5TjntcjP)1t05T½PVȼ5TJ3PVp/1PPVS VJr^_[]hԦ3Sj+hn%NS USWV-1@=Q$ht%Pj hFD$1D$ $ $?$V9$L%VWu PWt$ 7 VWZ G|$u%$'3D$W7PWt$ ' uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$蘏$艏8 }? jS褈 ƃ $NfF/Ju1ҹhvRRRRQRRQjSD$DPju$4D$D$D$ D$ jtD$ Pt$֘D$ p Q )) hPhQϊ 14H'jVhQt t1GuD$(Vhu%j@$S~ 1PPD$0PD$XPS7] t|$Lub4L'hQho%h.jsk"D$L1QD$PPQQS\ Shv%u1=Qsu=Qlu3 QDH$D$$Phb% u5$nfsu( $D$1@D$ |$$tD$$D$$i jv&h1Wt$TV j!W|$0W iW*]hhv%uRChQPPj%=Q hQPPhhh%hww% Phv%jKp hv%W=phtv%W/phv%W!phv%WphQhv%Wp =Qt!hQhw%Wo $9hw%Woh"w%Woh0w%WoW:hkr%johQh3w%hc DŽ$hQVVj~j hq%VX Qdefa1ȋ Qult1 j hw%hQX Qmanu1ȋ Qual1 Q1 Qnone1 Q tlf=Q tb=Qt`hQhQhw%j`tChQhw%Sj`~$d$3QQhhw%Oh#ighQhw%hw%h [ 8 Qho%D$ Pj ~ht$ hQ蹅 t$zj hQ螦thp%D$ Pj[ ~ht$ hJRi t$*j hJRNt=JRt Qhp%D$ Pj ~ht$ hQ t$ʈ=Qu:hq%D$ Pj ~ht$ hQƄ t$臈j hQ諥t=Qt QhhQu=Qt QD$1@$" hQS$W@ VQPPjxVQPPjws SWt%Q|$$|$ t |$ujQPPjy!|$t jQPPjz^hQ< =Qu=q%=r!ƒq%t๧q%=ujQhQ^ jQPPj{hQPPj}Qu4D$D$Pjܐ|$uhJRPPj|T=JRDm$Dm$tJR=Qq%tQ=QtQ|$ti=QDm$Dm$tQ=QDm$tQ=QtQSVWQRhQPhQhQh"h,$L=QDm$Dm$tQ=QtQWVQRhQPhQhQh"hX(jjj{ xP@ Qq%Ph׼$h hb}<hQhHw%hS S;"jrj!R$H1WWV$Ph:u%T t( ;$P$TshLu%jPt^DŽ$ 1WWV$Phku%S ? ;$0$4&hu%jPhauq5|BRy1H t$et$B1t$Ft$#hq%j<$t$j藧Q1@$F=JRhP$hq%n hq%jgt$(Vm VmPh4r%hr%Wg=QthQhQr%Wxg =JRthJRh\r%W\g 1hkr%VLgVʦW=Q5|$tk1hQhQhQhpr%VQjhr%W hWWVjFj jh fotNjjSP; |$ =QQhQhQhQhr%jkDŽ$ch DŽ$attaDŽ$n/slDŽ$/sbihQSJ |$$h\%W D$Lt$t$L8th\%W ut$LD$LPV =QtQVPV |$ u/=Qt&hr%VhQhs%V |$ t1A&hh0s%h\1Ʌ QjQe^_[]hQhQhr%jt.RtPjj"ht%C1FhԦ3Vjhu%+V 5.RthpVP4_ hYhԦ3P_ jo USWVL$,!ij u!D$@tP jPhQ| L$,%ij u!D$@tP jPhQh| jPP7v ƍ\$1 jhQS-| Sh8i(V V#; ulD$P\hPhQ{ W]t;Ƹ=i$QSPU| SVUw| W]Ƹ%uցļ^_[]VPhQh v%PjWt<CR01ɀ=0R/0RQPhԓ%hh;R 1^ËL$1BjhDRWVt$=Qu jG7Wj u1@lCR5lBR蕷1ɀ=0R/0Rԓ%QPVWhBR c1ɀ=0R/0RQPVWh9R 1^_Vt$V'eЉjhP=R$^WV D$Ph2R u:$nfsu-Vh2RhBRNv Vh1Rh9R;v tWj 1F?t[h.RhCRhls%ju>CRs%h2RVWhBR h1RVWh9R 1 ^_SWV=QhVQu(h%m]u5hQhs%V=JRt hq%=Qt hww%ٷ|$hQhs%hW hP$W ƅzWPhs%j\h)$V\=QthQhs%V\ hkr%j\QuG"WPhs%jg\=QtDhQhQhQhs%VA\=QtChDt%UhQhPt%hQhQhs%V\hkr%j[h%hs% |Ph t%j[ v%SW[htv%W[SW[=QthQhv%W[ hQhv%Wl[ =QtLhQhi$WK[ hQh$W8[ WƸhkr%j [h$t%0[uhQh1t%T=Qthgt%tThQh{t%bTt V_jE^_[USWV։ϸjPPl tCËl$hjW ojhQWr WVSy S1 1H^_[]USWV T$ˋ$ Ph f%ǹu d#$$t8hq%jP?x t&D$hq%蟴$D$D$$S^\$ PWS. 2R|$uCRPVSUh]v%t$Uƀ<$thq%~P81 ^_[]ýYv%+T$L$t$"u/Átu*$Ãt6u8h6h/u uh}%!w'hh5V D$L$FFhXV~ ȃ ^SWVP1ۉSSWSjhP'蔋t{4$c1ۅtjSSWPjhP'itEh\%V&= t&|$\$PS׃th\%j= uVs Vs1ۉ؃^_[USWV8x%H'\$|$jSP)O ƅt Eu$wS7o wh%7gp G^_[]WV4'|$uD't%|$ jWQN t u1^_ËL$34USWV1td։σSPSWٵ t u6P1PhPPj D$PUkG D$t΀8uɃ<$uð1^_[]ËL$3w4USWVl$\$1}$hnW6StOD$SWPHDWWRt.ljFt(V$'EDx%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ $V1VP 95,=RD$40$X@hP@tt$45T~Qh$3p 5T639r ,=Rɉt$ =1MD$Ni8D$$11t=i8,4xBRtǍXUS谳N݉|$|$l$$2RIRƀyH1ۉLPTXVUQk IR" .hQPk VUh0=Rk ,IRL$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPIR$()1HD,048Ƃ(1 ,=R<52R\xBR|$c[ 2RP$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً ,=RɋD$L$ӾV Wd#QSPSl$GU IR$H@ VWd#RPQSD$BP .Rt% IRQUHDRhx%P1 =IR$0xơIR$p^L$*QUPVWjj:XD$ D$D$ PjvD$ t.-,=RL$QP5IR u<5IRh`tS$Pdž$l$IR()8 2R xBRVU[2RVjPڹ L$ D$@D$9 ,=RyuƇy$u4P4 44S$똋D$IR$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$/D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4/El$L$),$|4xfDŽ4DŽ4/T4E,$DB8t$ 9zt$D$tj$Dx[fDŽDŽ/D4B=ND$?P1D$ +D$D$$|$y+DxYfDŽDŽ/D4B1hPPPPjPPjjR$PjS4$1K|$$8h׼$j菤 D$Wt$rD$tvl4u^u3h1PPPPQPPQjt$,$PjҀ4ÃtCD$WSrD$lxS螁1H$^_[]1M4$老$<t4u/hhPhZ3md IR831@멃=,=Ryu,=R,=Rs19dL$w BsÁt1USWVD$$IR*t1G.$ )$Phx%hV 7%jt(hgkNVhx%h j$ b%W\IR$Ph%hV WVhy%@ ]hb%Vjj\ R1PP3Ahkjl1q{$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$Sڡt$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$d'hy%D$P y%D$y%X3|$0tPhx%hWa Why%D$PN 7%D$y%zhzy%D$P y%D$y%i3|$0tPh y%hW D3t#Ph'y%j\$S S\$W, D3t#Ph.y%j\$S S\$W, L3B"tGA$@%tWRh5y%D$ PW D3@y%tNy%D$7%D3|$0tL3tQh[y%hW Whay%D$P o%D$ty%Q|3y%ty%PD$P y%D$y%!hy%D$P y%D$y%D3 $t!t$PQh%h+t)$j4$ctQbd3U$ ޳=,=Rt$ $QD3$t<|$t4øSS$PW$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhG~%U` EtjP~d t4$ b؁ ^_[]Ê$ h7%W蝥$D$jV ù D$jQQPS! S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uha~%SGVUhu~%S7$ Pu1Vt$hU~%P4$a$ l$Shf#U hrUWVjP5L1PG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV IR1G*ZƄ$hy%chP$hx$3謜Phz%jC 5.Rt荜 IRQPhz%V 5hSz%SCIR)\$J$WP[x$L$@PQ$ $d$ PV D$@Phz%SBC D$0PV["D$0L$8L$D$h"P訢w\$D$H$194$h"WuFuށǐW$Wc S^;t$$ *h薙.RtPjjh7z%|1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#td#$z%\$t7ȉL$7 T$wXy%D$ 7%D$$'d#$uht$$PzY z%Pt$hz%t=uD7L7qQPh{%uvp$$#dD#t $D$ o% $T$hb%R肠T$ D$L$ 1@D$hB{%T$y%D$L$ hb%R2uD7#t$$D7d#@tq{%d#yv{%d#t~{%T$(d#t{%T$ |$$d#t{%L$,d#t{%d#t{% d#t{%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hI{%t$D?@غRPhz%t$?ClE;F{Pp\$CPW( S\[t$0|$4hiܕL$0QjP. P8W[tVhz%t$? SZ=h{%S>h{%S>= $ 1|$@VVPWh:~%g) ;wd#r#t#Qh|%SB> hL|%}hR|%phX|%c=FjVpR1Ktljt$"h|%NG$G7%G w"Gh|%vNG ${$7%C(s4C8l'h|%LNC<{@7%CDsP$sTl'Shq|%U{ UstlSh|%U_ "UMF$F^ FSh|%U+ Fl'UMF $F$^( F48ihy%hq|%U Utly%Wh|%U "UVMF$F~ ^Wh|%U Fl'U!MF $F$~(^48+4$iƷm۶|$9`.R1Khy%Wtzhx$+tiD$hx$PjL Wl$UVt$t$V6VOu4$VIRPh׼$h 1PP}#IR)t5Ph%hU蝿 鋔$ 1$ 91AP蒒uDFl9Ɖr:IRPh׼$hn 1PP"ݖ69ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhch1}%h%}%hh|%詠L$T$jt$oËL$T$jt$XWV׉κ7%jujWhd#Vhw@#< ^_VQ1ɾ 9r^^VD$QtU@8xtlIuAH1FVVjjhhQ0QRx tjhQjR tQ^À=QtjhQjR QUSWV 1WWjR &iPCSPj R t$ ݕá3D$x1/dev4$D$iƋ1N/ u1FSt$$PM!/dev uDL$DAt|tE`R|$$t.jVjQ t 3L$Nj4$D$/devG4$D$M[1O4$1O1VS ^_[]USWVPD$tPpP11OFtFhb%Pyt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|TW}%wd}%Ph#"hԓ%V ^_[]Vt$D$QPNt(D$t%t!h.hPQfD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5xBR.@ujPJD$1҅D$t 9tL$BuT$ЋT$P]1hPPhKhjjAPjQQh3w h4WPZw PM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hPuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPHD$1҅ӅtwULt\P,40Ut5L${|$P]>$tL$ST$Dځ8Nut/$E t$ OЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W"GŅjW G{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ %D$$@$;E tL$ A;L$tI1۸hSSh&Shj VShɡ$ht$覭 }G8@É؍e^_[]Q=}t'fy".Q /QNuEt FuXt1€1ɾ1Q( Ӏu A'w'0Q ' Àu A&r  uȃsƄ\$,04t$jj hd#RPjV $PVSh~%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj hd#RPjSy W$mPSVh+~%ht$ ث -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hw{%q Y|$hb%u =Džtohl'6(tkDŽ$v/rDŽ$/dev,$$VuP*> D$/devf@/VuP > Q\낋E\tu xt@@AED$5xBR$ttt$PуuNIR덬$WPUg= t$/devfF/IRWPVD= [S8\as )a9aO$CQPU< {PWVIR$t(tt$Pуt Nj5IR,$1D$0$h@hP5tt$GIRPU/tTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVSo; $WD$pV: l$ Uh%Vr ǰD$h/"Wh $Wˁtyh#W蹁tgh$W见tUhz%W蕁tCh"W胁t1%D$t~%tD$VPS: VWS: Uh%j>q DžED$4$v PS~ t"vh׼$jx jt$t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=(=RSWt$t$l}$1PWt$t$S}|$9 D$VpW-9 u\$t&Wh"%V 9 WuSW8 W}N9|D9...Wh׼$v? e^_[]fL$19bUSWVP\$1ɸ'tǛ't›'tэ Q'ƆQBu14QB9u,Qju0Qju4Qju8Qjuu1@GCR*@u0Rԓ%VPWShBR蝡 uVPWSh9R臡 1^_[USWV |$ faa@D$$1Cd#=CRthف%jCRVsPWho%hrvD$PUAD$hD$ =mdt2Vh2RhBR!2 Vh1Rh9R2 1$hVSу t$t$t$D$ PQjVV ~;Ƹ PV.D$i jQP趤 e9]D$|$h"UWwB5o ~#u4hPQhVMktPQPh\$tt21ۅ1C؁ļ^_[]h%h{%h2h%=USWV|1ۀ=u1@;/R%h2RVWShBRD h1RVWSh9R/ 1^_[ù1@t QIt1ùtAQt 1ùD$QAuQËD$QSWVhlhy1$hWVj 㹼3WSChWWh2Wj65DQWjWPVW1I4SP;V"Jİ^_[USWV|$1i/t\1tWQtI1r rr2X0u&1q1ur1ۃ0݃gXr @뜃|$tB XBB(Y^_[]USWV|$D$L$BJ 0uQ=@Q1۾d]&-8QB0t#1urFQtu@Q9u'Cϸ8Q9t0Q4Qt0Q0 5tV\$S询 Vl$|$);\$u ^_[]h%h%hG h%uSV531/t.T$ 39u9t Qt q/u^[V1ɍt$QQPVh0%J y1t1^USWV|$(1$PPWVh0% $D$(1PPWVh0% Z$LF1d$Pj%3$>$t'hdH%UdhghԄ%dhgUdW@5;RBD$hjU5;Rb ڛ'PPqhVjU5;Ro7Vjt PVW' ϚWD$ PDSt$5;Ra 5;R;5;R Sjh% j D$ PU Uh%_c D$(SSWVh0%" $j h%dfMuQ1AtCjV1* u4Vh %"1ɉtjV * uVh%j舉 D$(SSWVh0% u$~hD%jTLȁĐ^_[]1USWVhhJ%IE14KR0KR,KR(KR$KR KRQ3/u D$83ڃ9tQu@ KRQ/uD$/u.0KR KR19haj~ 31@|$>ZQM $KRL$ ,KRL$j5T5T5T=CRthف%jهCR4KR0KR6P5 KRhs%ja0aCRWj /D$ttRN1ҋ0t1t /u oBrgQuƃQ4KR1QuAuVwD$u,D$ $KRD$,KR1@Q4KR^/ ,KRF KR0KRQR5$KR54KR5(KRPhz%h!` jj.~_5;R]1 Qtvh%hVu>h-t_t$FVj0.~th%jh%jh#%j1GQyQtfh?%j辅hb%`L$QPu{hX%`$QPruYD$3$L$3$ t?h]%h|%Ugt!h%j6h|%hǁ%'b9裩1=CRthف%jCR]$1L$VVPQh0% }t|$ thD%jT蟄jSe^_[]1F]VD$FVjl,F^SWVPD$$h%h%bt@Ƌ|$^1PhƂ%S9 4$WV Vchkr%S^_[USWV-3ta1F3t&U7Re1tUh׼$h8] 111Fo u1tjh|1@1^_[]VhW%^t$hPV hhQV5 x(QƀQhj%Q规 j/P\>@f%T5;R_1N^_[]t$ Zt$ ZV_11N4$t$t$t$4$VD$FVj"F^SWVPD$$h%h%Xt@Ƌ|$>U1Ph#%S 4$WV8 VZhkr%S_^_[hC%h%.Sj%)1ۅtH"t]" 1ۅÉ[USWVh&# Pn D$1Ʌ$l$h"$Uk ti\$WPS 9s?hhb%S| =w%hVSf =wjS t@h"$U u4$@1jV 1Ʌȁ^_[]4$1AVt$VX1|TsrLc1f ^Vt$h9%VyZtV2Rt 1R:R^WVt$ D$wǃr9t\'?tSPQjtD V5TAV5;RAV5TRV5;RC5T5;R5T 5;R^_WVt$ V8 u.>vg0/PVWhs%hԦ3܂ %^_WVt$ 0!PpPGt$>FFVjSF^_SWV=3/t/t$ć3GtPVXt /u?É^_[USWVj$t$ +21ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$V1ƅu1؃^_[]VPT$ D$t$4$?VP ^USWVӉϋl$jU tMƅtPt$Vx9 SNVUP tP׃SV^_[]VPT$ D$t$4$VPv ^À=QuaQg"KR%DOR(%KR6T$@ORW$8KR&"HORSWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW $L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPx $LL $UT4L$ L8L$T$T@Lƽ$$hVWUzP uD5<w |5L Ku1PPD$P )ƍD$Phd@VSA |$D$|PhedAV+A V@f$1 GaD$P$,h%t$V 1PPV $C]su PUhhQt$t.QCD001 Q1 u=QtZF9|4$Qja$,h1%$0u~ EPP蒃 jOhQD$4Py) D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h1%uN~ EVPhɡ$P8~ EtE @E w-G$9@  VX؁^_[]1D$L$I@PQwʀuQAuQ Q1USWV$$1$hWVX E jSohWWh2Wh5DQWj jPVWY"4SP6VJ#1Ĭ^_[]ËD$1ɋ0t1urQA1ËD$1ɋ0t1urQA1USWV ։D$ $6D1$  D$$ ,$D$%g| $D3%uO%D$$(%B%uw%D\$$@KR \$\$$&HD$\$$)|$=0=R=CR=@KR$ <$D$D$%-<$ q|$4$D$ @KRD$ԓ%T{ |$D$ 0=RD$CRD$Ʌ%=Qu$wD$1Ƀ ď3\$3C|$D$$$H%@C\$$({|$!<$D$@KRD$3S=ď3d#|$l$ D$D$%$niljl$4$1 K=Qu $>vD$|$D$$$$H%B\$$' |$u1=CR=.R=@KR$ <$D$D$%+<$* t|$4$D$ @KRD$ԓ%y |$D$ .RD$CRD$%$ahuLl$ t$<$D$?%@h$ \$<$D$z%%h$. l$4$} > ^_[]Á=3ftp]Yv%=Í3PFSWV|$tyQGO4VSuItRVH t{S5QQVhQ5Qhn%hSn jShkB#+ fG3~"PEptVBVI1^_[ËD$ QƁQ RfH RfH1SWVt$QQV~)S4:Q  FRFRF1^_[ËD$L$01VHfSWV1ۉShPS$ OtD$$P8 t V蓿V8VV81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6Ju61^_ðt$hzd@t$  SWV$1ۉShPSWbt/S$SPWH6V譾y /U81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=(=R1SWt$ t$L$ T$BD$T$SWt$ t$BD$ ׋:Rt$ t$(莌Ɇ%L$\PSWt$t$,t$RPPQj $(=R1WSt$t$QQQQRPRPjD$bi+~V|$jPWRUvPQd@( m4)WP5$Rh%sT1hhV)P5$R5$Rh%sWh^_[]Ës=$Rh)PWUh%VҋFHP5$RUUSWVP $1jlv D$~ 1ɋT$RL$ QVPL $@L$T$t$(t$t$4t$ 4$vP|$,|$~1ϋ^1 u)~3|$u|$ t|$ ;>t~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$vjD$F@ F5|BRbpe^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|z94$ukGllPw?GX FPvt~C $i)ىQRPU 1D7D77rfD7 D7 z4$~Efn'  V)RQP fNfF V ^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A 'bOu\$ RfA |$tArfAAz 1AA tAfAA){ A {AvfAA) 91jEVVhۃhhrjJVjVQPhR4C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Chb%P.uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0$ƋEp$PVjWGU:ƃu4UtUƃuEtDjUуƃu:C(C,SP{,1s$nC$10s$SC$s(XC(1ۅÉ؃^_[]hW%hB%hlh%`4USWVt$ kFllPv[Nj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ - 1/D/D/D/ 'b{l$ }$Ffs$fCEfC S USى1M1^_[]WV$|$hWP t,1HhWWPjjPh+ WP1^_USWVIRt$ 1$V蹕/} V7$T$GD$ pjVvD$D$ 1ɺ<t$Zt5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$V諗؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWd#Vd#RPPQF EHemL$ U UWRPVQ tD$8hL$8jPPQn $l$P tRL$8jPPQ Y0ƋpǸd#<$u heL$8T$ RUQPWVSjjA$jB@ɡ$ L$+5:RPWVQI jCL$5:RPWVQI j-L$5:RPWVQ~I jDhV"Ńw-$RW!ã$R~$Uj-P. ň$E Eۉ4$~Sj-P- +@$RPhf%jPSH -$R5$Rj.SPWVt$UD$)PD$:PD$KPh%hhRH 0hH%'^_[]USWVUu @(D$=$Ruj$R]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;RD$0BD0 Cfd0 j5(=Rt4/LdI9LhD$$r1CExhPSt$t$h͇%WMA9RD0 tfMCfL0 L$ D$$(=R1RSD$PL$QD$T$t$,|$(1PSVWpD$T$ t!|$ t$jSVWOT$ D$1L$0]D$ uuut$@t$@hj2j3j4Nj $Ut$TBDL|$D$uCD$0 ttt$ Vh†%D$DPGp D$8D$ D$8t$XjVt$(1IQjFj QP D$89D$ t PV$Px |$YtZV MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV~A )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Qb ơ(=R}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP; $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋(=R1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSrD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hQ$jVk8 C `L$rL$DPh%uL$DPh%jQ.8 D$D---D$D$s:RCjOd SjPX ƋEx tjPC SjP7 1jQ' SjP ÍD$ tSWVh%Pj SVh†%Pj VPWGS>(=RD$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hQ$j$P6 t"?tt$ Wh†%D$LPi D$@D$ D$@|$tjWt$`1IQjFj QP` D$@;D$ t PM$PW{{ t|$uuxD$t HL>@D> >jhT> wE%rh;D $uR1jPPPhӛhPj jjj%VjM}4x!t$PSWgVG1@^_[]h%h܆%hh%vWVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 0'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh$jSE/ t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-h%jlu t1@t=)Rt@u.1}hjؘu tEx %rt%t%M u@=Uu,>t'D$ L$IR;\M`|ˀuK(Ѓt tu tPjZjWkƍD$(PV$1 $$QPVj $Vk9$ul$`=u]tP$PSb $5fǃU'VFkWh׼$hĉ%f uGe^_[]SWV0\$@1҉1 F FFF =)RtjP4D$VjRRSD3<^_[USWVIR(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h҉%jt1e^]USWV8=)REM 0~klP1ËE E8؃lklQSP3 ߾'IR$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C ,SPSU u |==l$UhV  uUo t$V|$Wh%N .RVWh%P 5.Rh%A0NPVho%j[1PP.rvV2D0$ t$t$Vh؋%hWJ t$ .RtWh%P& 5.RxWh׼$h%k 1 ^_[]SWVt$|$Fpk1V%t%;J.RtSh1%P 5.RShW%hD%@k WV1^_[WV1|$hVW2 hWVhd?t[helCR`$jjۭCR %t%WPQhWh*%h 1^_iy1hX$o1hhĊ%hVUSWVu|$\h jWP t 1T3D$D$ Fw$T'}39;FKh3Rh4RhgPR# D31ɋFtu:v߅t$1G GGF G D$ 0AD$ 5T1VV5T 5T$5TցD$\hLVVhhj&jFVjVWPV謸4ƍD$PV腪V虹e^_[],=Rh6jPR/xVFuhKWUSWV|$L$D$pƋ%%|$t0%SVPUW蜣^_[]USWV`5Tڀ1WW5T 5T5T謀D$$USWV D$ =D)Ru RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS肒 F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h%h%heh6%&USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$pQRu }pQRD$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth|1Ot1L$D1 L$8ɋT$]t"9tjQP T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(pQRu *{pQRD$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$Ğ't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh|11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut%1^_[]Ãt ux(tth ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD? l$(Ph%U hP$U [Ɖ$Uh%j q D$Ph%Vp wXw\w`h(%VpPwdh?%VpwThP%Vp f1ۍ{aE4'WuWuWh[%Vyp E< t<uEMPWQWhs%VRp$<IX%9|t9>u 9>t0uk9uVΈVƈOV辈UC1@19$,|;ЃV聈t$C؁^_[]USWVHD$1Pu蕄Rhji;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'u} FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h\%h%jg6ht%h%jh(h%h%jih%h%jj h%h%jkh6%vD$T$ L$DrRQP5 ËD$Djt$ P謣 USWVl$j/U 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=D)Rui"sv<<)R hQRlQRtx(9w4Ju1AQP~ãlQRhQRH hQRk4+$1 4+VhZ&jR 1D+ <+ hthVPh'%jW 1D+'<+(D+($D+,t+0^_[]V΃=D)Run<)R) 1t(@"uhQRt lQR9t 4Hu1^USWV|$4L$0Rt$`VQWQ ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=pQRu hpQR~V19|(1@@89|~@w1A^_[USWVP=xQR|$(L$111='"\$uӀt0t u@ tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVihh'h*R *Rl+R11Kj%mƃwDݰ'DtGCuޅtH=tQRPlxQRt)1ɀ<t ͬ'AuV8}^_[1V tQRt(xQR1t ҡxQR tQRF9rxQRP|^fUSWVPt$p1h_4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$ho%jQQWRjjh%x,1^_[]USWVhu}WWPHD$T$IRL1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvIR@u ǀ@>1t$(F F>D$,Vt$-|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W/D$0F;trԋL$4T$B9rwP.|$4r!1FD$0P-F;t$4rD$0=0D$pD$6ٲD$vʲD$  d#1ۺL$#PWVSh0RQ t$kPWd#PShPV IRVL$'Qt$t$t$ t$PPhc$hH%IR$0$IR$pFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC ffC C .CfCC<=tQRrC fC*C,JG1ۍD$(hvSSSSSSSjjWPh裎48Pt@,Tit$VWcWwFuQ1K5+R9vt P'vt$25+R v1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h%hؑ%hyh%USWV$(E]0 ƋEpljl$E@ t Pd#PWVSjhX1U5(=R|$ ww %t$R5:RRPSQV+ U5(=Rw$w 训l$45:RRPSPU G\$skh@SjP4@ PVl\,Rj!h&%V詑 V`hF%L$5:RPRUQq hƦ$5:RPF%PUSF h蛦PSD$PhG%hh+R 1҃9Q\,RA \߉$4QPWh P$j$W hWh+Rh Nw@EƆ\,R Ft3N$t.1@Ƅ\,R-H9s Nr,\,R$EBL$ ;QU+RVhY%W h Vh\,RWg hH%vİ^_[]USWVX] E81hd#PPPPh^%PP 9_ vSL$QSWPL t@D$ tWD$8uN ,Ruh ,RD$9H*hd#Vh P$Epn+D$8u RPt QPVW҃(=R1VSt$t$ڪD$$VSt$t$L$8QRPt$ t$h^%EpmD$V9p1h$YQVu WPTtY$UtOwGD$VPz)vVQj P胷 W@ )Q$YQPe H LCF;puD$VPh׼$Epl e^_[]USWVLt$`T$d\$1*kvs0C41GPjh3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP蒀4ōt$ VPbrUvSVh~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5+Rh|$.+RL$`ʉAfAD$ 1Ƀx fJ1O Sg1L^_[]USWVpU t$01^F4jj`1AǾԠ'D$ǃ@$'SPHD$ $IRL1OًP|T$|$`1 |$0jP4D$DD$ (=R|$ 9ϋ$|$1HPPVt$t$WRQjD$% 1Ht L$ L$$WN $f} r= jhǓ%Ul u&UShԓ%D$P uh#"? WYN Ņu>L$4t&t u$Ut$ t$ h˓%jt$TW $ ^_[]USWVՉfD$/D$jh%D$5ht&_8tUSPhԓ%hU载 VSUP 991j/U膇 t5ÍD$9tK9vH8/t@PvV CߍD$ PW}!D$%= h$PW  FƄ$/u&t$QPho%hUռ /h$PUO hh%UO e=@uWU x*|$VW$PnO 9r>?0|$W WRڤ01Ĉ^_[]hUN t}/u }$$tcD$U襔W蚔Ɓ`|$tVhb%UoO 9=VWUWO 9%|$W x(W 7>1F1S0jh+j SWVύD$ PQ1xVD$)tOjW x@ljj PW  W  u $=rɁ uƉĜ^_[USWV hljPhW@jx \$hjSK jhړ%l D$ƍD$ PhW@V+ t$1hUS ,$L'tWP脔u-,RD$C E,$ !u1L$PPPPhjPPjjj!Qhh4t$t%j荋t$VWWZWki6V  ^_[]VD$@t(L$ 4@D'VhW14 F,R1@^ËD$ ,RfH襌 ,RtPPQQQh%jñUSWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj WY>D$48T$y:D$ػ˺$L$~D$<P t3d#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$d#t$DRQPhS%jV贶 D$ T$Bj5(=RQP.d#t &t$DQRPhS%jVp D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5:Rt$ho%jt$hVD$XP1WWjjj0,(=R|$4D$0IRL$QW<W,D$DPV{ljӍD$DPVC|$߉څu D$$H؋Pٸ"D$<h%t$|$,] {t+[1hb%S֏t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$ho%jt$hVD$XP1PPjjj0菏,j D$DPV$ D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW赹 )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5(=RPQ7|$ RPhQ$jWG ;:RCV蔃SjP jPPh-RE VH(^_[WVt$ 5T^5T)~$uFjPAF$1O~(1h-RQQhnhChRjFj WjPv$h,Rl`4F(x;F,VP@Rv(Rav$0HF(F$~,v$HF$1^_USWV4ˋA@Pjq$ C{$t%K0 u G PfG lJu'fG G5G)G G,*G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QP^+{$4^_[]V$j)Nv811Fu >tlIut5t.j+j, L$PVh%jPQ蔯 'u tEj,j+݀L$jPPQkB hPSWh %j&Q%j5(=RSWL$t$>QRPhS%j&V $F|(,u)|$hhMPhy%j(Wڭ <$1e<(Ou*?D(Ltۍt$hPWhv%t$t(Tt(P/PWhɡ$j(Vu 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%vGt 4$C|$|$upd^_[]1؍L$>PWho%j&Qܬ  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h}t$PWhv%j(V\ 4$h}VjP lj|$D(dph}}PVh~%j(W *USWVIR$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPváIRH1WjHDWWQZơIR$1$ IR@u <@TX uDHXT=,=RtLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wd#WRPPQ1ҍD$*W Qd#QRhQPqD$$W Qd#Q1Qh0QPI&)ߋIR0{D$pzL$$QL$.QL$QPt$SPW+ IR0zNjpzL$$QL$.QL$QPWSSj'+ hH%j~0{z|$phzG$DŽ$$T$0<$tT$@BfBB,ffJ B -BfJB-B fJ*B,'-=tQRr~(uB0fB:B<5-@1L$0hvWWWWWWWjjPQh W4t8PV@,Ti$PSHSW$X(؃u IRTXK$Т'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VPz*D$0VP9*VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u hb%P>T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5IRN t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Ohb%D$ PGwt5h%t$ 2wu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0 =R)ދ$=R\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$˘ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(* L$)։t$ t$A5|BR 1Fh%h %h]h%sL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4NS tt<1^_[USWVGD$5xBRl|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1QR9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX/AL$D$~@ 1ø11OT$LhvQQQQjj PWWSRh&v149tBƍ|$WPK#V_2x#9}(.Rk<4LE1UЍe^_[]USWV1QRT$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=KRt*= ^R11M<t9\@u 9DDMHEr=KRtO]RD$PP1ipt$1t9 :ut$P9t:,@uލEpr=@ORp]RJ<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@ ^RD WVu)y8u.q$t"y8uqxu Hu^hU#hW%hm h%ZD$x8u@hU#hW%hm h%ZV 2R; IRtDxBRt99t‹9u€xBR2t xBR^WV΋$tRttyu)xBR9tЋ9uxBR0u1H|$5xBR,1C1҉T TTCD (}k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D (}$k81T$5PWW1ۈ\$5$4$4?GL$5Ph%hQf <$o@}t$VU$<Sx Vh\%Si 1C8Ou111$H4$8 8tsuV4v8)ω$4VRQWh%hSCf M1T$5SPP$@PGG t$5Ph%hVe }AI $4jj hd#QPjSPSVh%Wuh+t5$4Wh$SO WVSD Wh.%S5 uD$ L$ $4jj hd#QPjWƚ$4WPh%V$4w$hZ&Vn |$$4wh*X6WjPL ƋMjs,s(D$AP-VfuhN6Ph׼$V$ Euh=uhV51T$5PWWWT$5j SX-4^_[]ËD$@0.RUSWV(.R=xBRtp1NxtZ$tIP$xt.jVVQtPu wƇxu=KR00|$1ip]RPi]Rt(h{%jWgc hP$Wg t$Wh%j ]Rt(t(l$t( h%Vh™%V0=]R\$t$| |(P$P]q D tWL$tN1FVVV1Wh$,WQPRx ]R T :<$VVt$j1WjQt$RD$ Px $Ph$V1 =]R,MQhЙ%V0=]R\$| |(P$Pp D tYL$tP1FVVV1Wh$,WQPRx ]R<T $VVL$j1VjWt$RD$ Px $Ph$Vc =]R,MOl$ t/$t/ t/t/hޙ%V1h%V#hkr%1VW9 V]Rt(|$Wh%hY\$t$uq ]Rt)Ph&%hYuK]Rt(h;%hxY u,]Rt(hN%hYY u ]RD(Fp=KR11 ^RPt4 ^Rt(tiD$Pt>Sh%hmO$\$ ]R$DL$4L$0]R0|]t$VPh%WN ]R( ( PQVh%WNt$\$ CCa5]R.> >,>(>$> D$)Pt>Shޛ%h[N$$(t$,t$(r .Rt P(.R1`.RtWWh)%CtbWh%hԦ3$Y .Rt8Wh%P Y .R1Ntjh?%PX ^_[]1N=HORtt$h%jP|M SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ IRV;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$$ytPhptYWtDžtFE tWPV u WVjVSB E t VPKVE1HPPSw ƃx(.R0^_[]hU#hW%hm h%O5USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tI܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP$ Qkd)Qh%VH ^_USWV$h_E|$hPW $$$t'{ha VPh%{hbvvPh%W[hc1~,t[hd1~0W[heǃ4Vuh_bV0FT~Phl#hW= shf[hi"1~`{hgvXPh%WF\~Ph%hWy= shhmFd~Phf#hWT= shjHFh~Phf#hW/= shk#Fl~Phl#hW = shl\WPh%V/[hmB1~pP+PWh%S9^_[]USWV$@1N R$qT$' 1jWWVVjjhn|Gl=OlIR,1۹oWS<S1,G,10G041jWWVVjjhp 1`G`rX"s\td uhD$4hf#QP|; 1PD$PPVVjjU, D$Pr x1pGp1^_[]1wwVt$F~|F Pt1@1FF^SWVT$1ۉZBr 1Bl@Zp菬Qkd)QhĘ%V[D ^_[V 4.RDF 1<^USWVH$`${04.R11҃y t88A(u3L4D4 D4D4/k<44EB,0u|$|E11NT$hvQQQQjj PVVURh<]49t\ljPW4WHx=9}9ku L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%h|%hh % SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FD'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$L.Ruh]L.Rs1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IO sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW &Ow$$$'@21^_[Ã!t*Wp1@<QWPV* rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ Z}jUP |$ $$$tVtw S@$A=3Do@u\u\FFCu$RàSh%àSh%8`1|$$GWh|dt$ V t$;t$tji9t$s#Vt$,$$D$t$Wh|dt$ Shx%QSP Sh "QP) 1D$i,$$x,t)9ttUPtAhj$V  jUV4 Vh{dЀt$  t$D$@9v4$ӿl$ Uhydt$ V Vz1^_[]hƜ%h%hhƜ%h%hh % SWVL$ D$$|$(11CWPWPVVVSS$9t1t$T$ ^_[ËL$T$t$,t$,t$,t$,t$,t$,t$,t$,t$,v$USWVT$l$M,1΅tt1Gt9r19|$G u (t9tu닆tlO3N03V, uO 3N8W3V4 tMBhjvtXhVPZ M0jt$$]t8F4+GN8O E M$^_[]ËL$ t|BR1USWVDD$`l$\|$ t1N11GT$\$XVVuuPWPWW$C ;C4D$ ;D$L$T$ }D$L$ hj{ǍT$\$X,ىPt$d[t^E T$Xu_B G4O8)B J$4$&|$`th |$`th|ZD^_[]ËD$`t%W蠼ۀt9tSWVt$1^ tWWV u^_[USWV|$W D$\$w,tt 1E9t9sEuu&1ɅtttLx%DO,u VѻO0jPtO F4N8G O$1^_[]USWV$1ۉ\$$ShPjuBƍD$Phd@Vu VvE,1Ʌ1J$D$D$ ރu)0t!6u߃t Ӏ\$ <$tAu2uӀ\$׉ $މ׉$1OD$ D$<$}@|$u0t-uv0v,h%jbVauE0],ۋ|$ut-us8s4s0s,h%jHuhj|$ W S,Ws0aD$H3C0L$D3K, KD$P3C8L$L3K4 5CL$QPT1 ;D$t" VPs0s,hw%ja{@D$XPW tVWs0s,h%j-{E4tL$Phҝ%Q* D$D$uPhٝ%jct1ۉ؁^_[]E@USWVx$ H.RU $=8KR$D$d D$`t$0ShW%jP Shi%D$dPjjDjǻtPvW߅uv^_[h%h%hh %! D$ph%j iSWV=<.R5D.Rt^s蕭3苭tE#$t$j(PV臧 4$I_u9ht|$0VPhɡ$jxWN WVV &t Ĩ^_h#@&he%hh %3 USWVσ=<.Ru h 1t0?t+<.Rt!-D.RE WPR tt/|$thh%SM !hvS8 u4$$$$$St$hĞ%j ^_[]SWVD$Qt$Rhٞ%Pjh@j`WV) -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|h Pl$ 3hf#WU WUUjUR H>wѻPD$x0hf#SUv SUUjUR H=wˉIRDD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áP.Rtr.P.RVt$ P.Ru X. P.R19vFt=N`^Rwu1w ^RR^ËD$Hs-s ,'.hU#h%hh{% Vt$ =P.Ru-(t;u2L$ rȃsL'$tuR1 RR^WVP|$t$=P.RuJ-j PVo =v1t-h t $^Rt4 ^R^_Ë $9u։^_-=wRtwRù^-D$1ËL$T$t$ h6.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCShO-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh"A-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh4,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phg,D$PhI,1\$}UM;t;Gs} Sh%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vhߜ%h$P $L1QhPjVx`WhydPM D$V`R|$t;jWS= \$;MU}h%hڠ%h h{%+ 1e^_[]RSQ Shx%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H ^R)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVr )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt t$ЉˉPunlj\$(#D$$jD$PVWt$2>É1 u:L$(#L$ hL$8QP֣ jt$VWt$=ÉW~1 l$\$t$u0|$,D$$P9L$4^_[]h%h%h h"&h%hh{%Y hU#h,%hUSWV4$L $Phjw$X$T$`ljƉ$H,s |$ G1|1M1ۋD$ Xhǀ?ǀWh>SU @$\Cǃ1:k0hWV, D$4WhPW$XxD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(;tÉ|$Uk#D$0jPUQt$(;1 Ⱦu#\$,hPt$ Z W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,͞Po P肞D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhj@rtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x P3tn{ C K$;}sL$4QjSPL t_D$HtW ^R)1ɉAw Puu2S"j@jP fdžUSw1ۉ؁4^_[]hC%h6%hh{% USWV4D$L D$PhjpƋl$X\$T|$H'Wl F|11Kn^؃N$F Fdž?džjh>USԷ @džPW;st%D$ D$D$D$F114^_[]hC%h}%hh{% USWVhED$$11@D$|$ t&1ɀ8>@,19Q财vPWEd D$vP6%d 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[he%hI%hxh{%轪 USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]USWV0$H$D715$R5 R5(RD$D$ D$1D$h%WU0R pu 7U(Re~ft$lt*zD$ƒbtCeubD$벡7UD$ ChjVV57Uh%4$R RzVhVV57Uh($4D$Vu=$39}4D$$D$l$ t%1PPU D$yUh׼$IL$ tHt$(Uh%Vi hx@#6juRh%fD$0Pt$; #D$8=$$ $R RjÍt$0ShV u UPV UjD$0 $R RSy hգ%t$(g\1|$P^y h%H y h%vuWjt$:^1St$+^4$@t$4%Sh #PP?Ft1h%t$t$]4$t$54R50R8R|3|$tԦ3tq1.SPt$  y$ 19u20R4R)u 8t1FVh]%1FVShk%V!Ft$8D$D$L$D$ L$ D$|$tvD$ P1ƋT$ уƉǃtωÁtt؉D$ u W 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj B U6YL$ɋD$tP V| P hd#PVh%hԦ3+ j豺 V jV jRN VPJ^Ð=l3u Vl3pr r11ݜ$D$8d|$<) 4l'RSt$DhA$QP虼  $R Rȃ||=4R0R݄$|=s4;T$D$r(|$$\$ ؍4)hc$؍4)hV$QP ƃ}u 4)humFOKu$t$1VQ$Ppu%h%W 8t 8#u$SjVq tGtV $1E48FB$)Ex t$7@[h%h%,薝 h%h% 7h%h %FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPGuh/%h)%\VÉhPKt4VhjP5Guh/%h)%V1H^_[USWVp $$$!19L$PVW1Hl$U ƃU VD$PW"s tb$UtM$Tt贬 $TPUd t$jW$n tu)$j4'WUy 1Hp^_[]Ë$j-UPE D$L$PjD$L$PjSVt$ t P닆t>PvG-džW1ۃ1ۋt9P+Gdž t^[VF VZ 1u) 19^SWVlT$|$$VPC1Nt/ǍD$P PSW! t W/l^_[USWVӉjh0jU ǃt{jjjVɕ L$ FW#td#|W#tŃq%d#d#t i%؉d#t%|$ud#SQRPhy%jhV{ ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQl C$9u1$WQ{ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)A jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$P3k ^GNON1wOWh}Pw cBvEVE1H^_[SWV$uSh%h=%&Q $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6Ζ 8  89h%h%hPNF G8~ ~u3FVh}jv ;Auh%h)%Pt6hWv l t%uhɥ%OPWVu  s V^_[WVp׉$ftPhY%h=%O jL$PQWL jjP PjW tnjjW t\PjWv tHD$|PWV t2Ph}jp @u6hY%h)%N"hY%NWs hY%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jWwCjWlC5^_WVPt$4%@5@u^t8tW%V$%8Vhm#j%B#45@ubV,>jjP,6 u h%K,{dž,sh%[KjB3 t1t3u5$09$ ˺$1Pha%J 9$ ˺$1PWh]%J^_WVt$ hD##OK8r4@84^_6t8t uh%W蟲j;A^_WVD$  uzuq0x t-@ h%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uh'%ID$n D$SPU6Yt,Ǎۉ,$t1j@SPM: SUhN%JI SUh<%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P} w_ǍCWt$P` ;)QjP薉 h{%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQh%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYh$%Q{~PtVFDtt NLtM#tw%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h,%@jjAVB u h,%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC PhT%>G$C$G>C>>l$ tك**PWQX IWtsDtZƃx t@ Wh&%A>WhE%k>1Bj FNt*HN+Ƅ  h=%t>1KtJV @1艄 1KGOWtQWVl$ GT$tIO9tA tBShj%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhh|d t$h%h~%<$1Ph%<1F\$ MbihS$( EuVh%o<u辂 87t 贂 8 uF띃tVh%@<D$$ \XPWoB5Ƌt8t* SVAuSj$(= ҋ>$ 1GOtHONG PtFA3uUGGtIO9tA tBG|tOxD@UUP# 3WQjj0>[V/t?t$VtS? t@VS@ h%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/蛀 7 Vh%hE#B:T$1|$`F(f9t(~ tωӍV QPRh %9ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$IP\$Sh<%:9 <PUt$W"PShY%9T$ V>t*4$QVR H^_[]USWV(|$H\$@?hv%WGq )h%W1q t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkb$3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtUm t|$>@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp  D$VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4Sih tE9uD$ 9t9~ ux<$hv%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uhk%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/XhĨ%S g hv%Sf l$$hWU;q jDž0ݨ%p31K$ 8@DjW9u1,1@PPxu1Ajj_ uD$$l$ D$D$ $\%t%Uh@'P$VB ?u$\uYM'4tQ6uD$럍Hv H w?$'7U$Tw$'D$ ߭%D$[D$PxGD$ %D$2 $\ $$$$`"!57U $`D$ ƭ%D$D$ ح%1@D$x ˀFD$9$3t$ZSX-$`q-$$h$d$3)$|$t$$V|1UUUV;Å$U$SjVFދ$hS%v D$9$3Vt$(VC$31UU4V^;/$$Pjl$4UAF@h% 1h%$\u($\uh%ʻ $XL$9 $3%ދ$HSa 6W#|$td#|W#|$l$$th%QSh=%j+U $\$h'h˨%8 h% 1d#PPPh=%j+l$8U訇  $X$\$X $3|$tD$$9tD$tnU虺 C$X$\ڃt@  u% 艌$\$X@l$$$hb%uh2"hW%0)k"$jj l UhSjhܰ'$o!$!|$tYUHr?Pt$h%S( |$WVmn 8$UӨ $X$\$X$\$3T$QR$4A $$Xh2"hd%l$$4D$t<t.<unh%谸 D@U uDhf%舸 LHU[T hs%f TPU5{ $Km (Sh#N' h2"hs% h2"h%,'$l$$$Zu UMuh2"h5%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t P\ $$Uw$U(UH$;p3t P$\P@1uhF%%$\t3$Pt'jjQPi uh2"hT%%$H'$`h|3= $$\$S ^_[]Ë$r,u'$3Qj$4J $u*$X1PQQ$ $$[@u hة%$$VU h%&$$X0 $\$X$\UhZjj$t'Uh%Zj$$[h2"h%h2"h%Vh%#U UhzUj2j$rh# j 8th2"h(%#$Xi L${oZi 8 L$X$\$\l$$hhO% u!si 8thO%h2"h^%# hhl% u!;i 8thl%h2"h^%" UtUh2"h|%Uh%^"1$Xr;$\@ щ$X$\UitePh2"h%b"KD$Pjh0j1@L B|h@#%UPh%1" 贪$X$\҃ ׁ u$X$\r>1r$3$L$QPU $X$\=%r $3$d#d#tG% tN%WQRh7?&JUY#0t$$1:D$OhPVu hh%!VhVj$$uh2"h)% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x u%%$4P; C$$|$9|-h8&D$L$$PP% ƅUQh%襝$\D$L$$PQ2l$$UhUj$\$puh2"h)%I$$h2"h%%h9%&h2"hU%h2"ht%h2"h+%l$$t׃z Ruh$\hǫ%PHD$$P$Zh%tRj$tKl$$UhUj$\$9t3'$\h2"hΪ%h2"h٪%h2"h)%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$R] Ph%V$X8uDu4$\@h%PED$$Pl$$+ɍl$$t#%@tD$$Phm#Qj$t$D$(P4$01ۅ~ tVh:.jj$vP` WVjh%v%t*VPuuVh%Wyh%v%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQ  u!h%hT%S j^_[]Ã~+ajjju ˃ph˭%hí%h% 1m>h%h%h%W <Ph%>h%h%h% 111dh%hխ%h% @+X1BWDP h%h%h% 11G18 4 ى48rPyWeh%hܭ%h%L t0LvPh %-Vt$VvtVh?UjdjQ^jQ^Vt$V;tQPh@% 1@1Pd^WVPt$D$uPh%h=% jP,4 tuIh%h8uM,z ,1dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS* F>)^_[USWV$lt pvh%PW; t=wM$lD#W 8th%h׼$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ UF =wfD @PUhh%Wudh%h.%htI{>tA,$fEC(ffEEK*S>RQP`) C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht h%8~>t$fF(ffCCN*V>RQP( F>4)mC Ph۳%$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0T 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@k t_F1ɉNF FNFF(N(F,0N0F4Fdh@> FXt"uVG1 V^_WV΋I\F`tljt F\~`11H^_Vt$t+1FXt P腵v\7^.^ÃD$ 1@A1RRPQӹAr1D$  щ % ЃUSWVuFh~jtfFi~(tGtx!O 1~u-\O 1 1Ҹ1ɉD$T$ L$D$~it>Nt3yu%ytzy~ ~yNхuFiPv`v\1PPvX誳D$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR uJ 8t2EOtHON,wWF4G8~4~hmFde^_[]I 1+USWV ύD$Pjk; tuD$T$ƋG |$ 1ɉىT$9ڋT$T$sӉىD$t$ T$+V$T$y* tD$ʚ;1H11D$~(t$ tUʚ;+T$T$_)ús1҉W_w +T$stK_t$w W ?u G D$T$ BD$L$J1e^_[]ÁEDDrH T1k$|3Wh׼$t$ |3tv hB 7 [B V1H11Ʌt舀 $BD<IG9uލ|$$ ^ F>L$jPWV uF>*PWV. 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0 VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV1< Fjŋ$@V= $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP 1 tًv\$~;1$D$0Pt0 tF9u19D$$"$8ЃD$P1~11TjT$4R4W t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVhj%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV CG$C D$ jt$ VUp C yQPD$|PS D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0*. R`~/1djT$4R4 F;`|ӰD$|$0WQt$\yWh% $_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh%oW$7t)|$ jVW7 w_ jVS# r9 1N^_[]j:S t/@1UQhQQj QPK G8mti9 (G8GjSP O t 3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS4 F jPS WSh~i tD$Đ^_[USWVP~!D |R xR xR|Rh%F|R xR $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD h%j,jHt ǃL h%j,jgPt ǃT h%t$$Wh'V% D$9rh%h%[H$|$ 7D$PWݒD$t$h0#D$PFR ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$S# J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0h%hE# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h0#D$P@P ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hǚ$U" h%U" h#U" $D1)h%%Um" 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS譹 1Ʌ $1@D$S$@tXtT$@S! $1B*$Dt,t($DS{! $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd+ t6ʼndt$ `Dd<t A`Nh%<$Dt&u"t$ $<. 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U' tu;uHUh-%'D$uuUh#t$$t$$P't$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$($3|$$t)`#L$# $ 1CƋl$ \$18%s%Sh@'Pt$t$Xhȸ%j|$XYt$1VWjWWWWt$t  L$P9>t$Xh%%|$Xt$1VWjWWWWt$tȫ L$P9>ut$Xhr%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPt$ fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$t躨 L$P9>gt$Xh%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\W  j,D$Pt$X=h%V h%V Nh$V Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh&#W4 t$P^he&W -h%W h%W Wh%D$PD$PzD$Xt$P jP#h%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\W4 Ê@tC< t< u CCu1j h߹%W j h%W 0jh%W ojh%Wx ejh%W` Mjh%WH 5jh %W0 jhA%W KjhJ%W jhT%W j hh%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjPU 'L$ r L$rL$ T$t$XV%1I $j/V+ uD$|$P jP L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;p3t P 11j|$\WtdƉD$"V[ jWt>th%v%VV  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb h%b|$XD$Pn<a't$Xq <PD$P/|$Xh#|$\WS  t$1VWjWWWWP2 L$P9>t$Xh%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/Pp 1|$Pt@j/PZ tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 h0%|$Xmj,|$\W 9ƀx-9l$Ps%ƅ |$1WShSjSSt$t ,9h>%{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP   L$ j / % < t< nGG|$X{t$P$t$X $ hr%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU  8ut$Xh%t$Xh-%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vh%pD$PR |$XG D$P2 D$P" |$X6t$Ph%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV. 9+aVh%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t) L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t L$P9>t$Xh%Rh׽% %Pb|$Xh%T Ct$Xh%W à \$S ƅ|$PPh%SV+  j Vflj/t$\ G1|$P# 1 t NOGN|$XC1j:W t4A|$1WVhVVVVQQ 97Xh% j=W FD$, h% @1 t  H@Wh$%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQ HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh-%ZT$P   Vh@%)D$,hr% h?%aƆ }hĹ% D$Pǀ`hd%f 1H$Ta Vh+%rN D1DDD DD.u h%  12D$,1hW$W>h%W(1h%W(hR$Wh:"Wh3%Wh%Wh%Wh|#W7 h%Wvb h!#W`X l$h%|$WBX hm%|$W(l$ ht%W f hz%t$W h%t$k h%t$ h%t$ h#t$ h%t$s h%t$Z h%t$A h%t$( h%t$t hf%t$b h^%t$P h%t$> h%t$, h(#t$ t$hM%t  t KC  t KCWhԺ%Ɔ  gt$Pq1pƅhih>%ottC< t< Cuh%GDžhr%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉h%W t-h%W thk%W t h|%W t@Chś&Vv th%Vd D$P@ tsFH t t@@1 t  H@ttC< t< Cuh%ƅhhG%sF< < F1$SUj [ tUh%t1C CC"$f8l$1USjxSjSSW9 $D9]$ƃWhu%- # t KCƆ L$P1SnF D$ PVN   7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hFI#1E1؄t  H@hͻ%%1H$$<^_[]ËD$PǀǍ0PVjqW Zhg%F -{L< < Ch'%11_Ho@@V ыD$ * * hr%2 C]{/< t< tCCB؄t  H@h% yt$1VWjWjDWWS袈 L$P9>OShY%L$ 1SK 1I $ԉljUSWVL$D$ T$114É~ GE9u1D$P$tj~>$ 1W4L$ Qs 9s: $T$э A@)E9uы,$t&h%hk%h hɷ%R 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P詖 T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vQ 71M^_[]USWVՉϋR j=Pq ,$|$D$ V 1ۉ\$t?t9D$ 1j=S/ )9uWVS D$\EuVͪ4$U t5ƍEjPt$  4DL$h%Uh%h% |$$t#4$ tzSAD$ t$tC/1)1ۅt#t7Uh4%\1K؃^_[]USWV׉t$ tkƍD$0h#P" tN4$P tMŋ@jPW= tJƋH ,h#D$P u4$V7hK%蠲0hK%蔲4$hK%育4$Uۦ^_[]USWVPӉω1UVjVVVVRf{ 9ut2jS~"1GtGG ȉ1N^_[]ÐUSWVhR% D$tHTNPRshp%h%hhR%v WVt$ t)1WWV tL$@Tt8QVW ^_Vt$t$Ƙ^h%h%hdhR% SWV1SSQy t&WV艴W荢SSVU Džu^_[WV|$ t^ǘ1PPW. tPW>h蹑ƅthjV9 ^_hþ%觭1h%hþ%huhR%G D$t L$tHThp%h˾%hh%h˾%hhR% Vt$t61tpT^h%hԾ%hhR% WVt$D$ L$zVP芰9tV 1^_ËD$HTt1Pt$ h%h۾%hhR%T USWV\$tF+1PPU践 t.jVU襵 9^TuVU贲VWu^_[]SWV D$4toHTty9|$0uPLjPWJt<Ƌ\$8PWVSh%%j W VNV ^_[hp%h%h h%h%hh %h%hhR%E USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t EtuHt4t uxjh`'Pd - /1h%hB%hh% D$tEHt;tu&xÃxu x uxux /1h%hP%hh%% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^J Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=RuD1FFFF FFGFRSVrVW_uPRމ^_[]Åt 1u19[:Rt1h%h_%hh% hk%h_%h'USWVP|$G<t<$ $ l$W)Ã|WhV$ ۋ|$t(ٸF\$$)؃|PjV 1=Ru+RW9u!R /1N^_[]h%h%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ` ^_[h%h%hh%h%hh%6 USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQ9 ^_[CPh$WV3 1t߉h*&h%h{h%h%h|h% D$tL$tf Hh%h%hh6&h%hh% VD$t&L$ t/fqPp QPI H^h%h%hh6&h%hh%{ fVǚ$t'Ph% u^USWVD$t$V\&1Ij0Vu'1|$/ooo WV'5't-1C ܰ'I?r h   DE9u֋-'t/11C 'I?r /   DF9uWt$V' 1ɉt$\T$\RVQ2PV%t 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP5 tbL$1tHhd%h@%hM8| /IG?uWG9rD$^_[]hP%h@%hh% USWVl$t$|$t1ۅu>t7NLw%tun&M#tÉS1ۃ1Ct:tVtXtShx%t؉8txt@HtPt؉CjVat.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t 1NA~0jh%W uWO) W G9rh|3R ^_[USWV |$ 7u ;l$$Ujh%U] \$C UPWh%;S$t^DžtnjSW&  8th%h#z9h%k1HzSlt$h%hE#? tG11CGt0WD ؃uh%h%?Ņu1 ^_[]Ë$t|$u%tPWhA%h*% =mQPWhA%hO%論KUSWV֊B D$L$$t W` *QP踁NjD$$4$7@uMh&#詐%tQh%W ^ Ph%Wb |$t$h!%W= $D$ D$h+%$U t$hx%U  U |(6h%U^ 1,h$%SD hM#S. 'hw%S h%U hun&U h0%U h%U 1ED$D$AtG~DtAD$D$D$D$D$D$sjSȉD$4D$, ED$D$KD$D$D$D$$1D$D$D$1D$|$t<$ Ph9%W u4'hF%W W$7$@|$L$ uPD$@tEL$qPt$h%WA%D$ |$t4$h%W詰 |$tJ$t=8t44$t%D$pHpDt$h%Wj|$t4$WND$ t7t1Ph׼$W D$ 0uW! Wȴǀ|$WD$(P D$ U#t%PhR%W; $HL%t_$d]&tRhc%W Y$pHhp%W <$@PPh|%W $p$h%W 4$覞Ph%W ${Pt;CQt$(stPhhV tVh%WC t$Ph%W tt$7@#ǀ\$(h0'S臒$t0ti~ tVt"PSo9uvh%!h%1OĨ^_[]1D$D$h%W t1VVS  t]VVS 9th\%h׼$WE {ET Ph׼$W' ]jUS貘 ŅuVSWV .h%$VZ (h+%VD h$%V. hM#V h[#V hun&$ hw%$ h%$ %tt|$"D$<u D$xuZ|$t4$euD|$"D$<u D$xDu*|$tjt$u%U#(U#U#D$ U#U#t%Uh%W_ Vh%WG 4$?%tPh%W u$0?%t@ $ t1tV>%u vuPh%W #V@th%W|$"D$<uPD$@tEL$q Pt$h%W;%D$ W|$"D$<PD$@LAL$qPPt$h%WXUSWVl$t2E1Ft/׉˃PWh%StEu11N^_[]fUSWV\$l$|$ttUPW| 1tk<.tgh#W tUh$W tCj hZ%W! t/tj.WI tUWv 1t^_[]D=|Vt$ 'Bء3H 3;3h|3j |3H |3 Fut$3H 3;3h|3j |3H |3 Fshe% Fsh]% FshR$ F sh9" Fl%s%y%%% %@uwxn%rh#r]%rR% rG%r<%r1%r&f{#r%r%Q F sh% F sh% FthV$ Fsh%v Fs h2%` 3H 3~|3H |3 h|3j h|3 ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVh%hW%h%US 1N@t+9w');@MQP'At9w :)߉h%hW%h%US ^_[]USWVD$<Pq t$ $h#V ]NjD$@HD$?1jh%W ujh%W u|$D$4Njt$0tNF tA.t;\$SP茿 D$P1U1HPUUUUSkP 9l$u9t[,OuD$,Njt$(\$Sv 7 t-D$P1U1HPUUUUSP 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#V Dž4$z14$z 1H^_[]4$z{ USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ? t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$W V J "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DHV \\$ $2f\\ $$$T$$$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1, T$$t4<$t s%|$$u1F 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Vp 18a 1H(D$ %t%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS C@G jPSf fC $4CCD V$4P܎ UShip貝 C O*W>RQP襎 UShip{ ! 1N^_[]WVPRQ ~u~uF $uG*SVP? tuL 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$ϣ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS袟 |$jjJ`Ƌ$(@h@h% ljFuJ1ۍl$Sh%j Ue h@Ug FuC 8tǍ\$($PhqB@W f<$f|$ jUSL ShlBWӄ txD$PhpBW资 tZ$$VЃuBD$PhfB@v胄 t(D$FP?F u+ h'%[Ft Pe VP1ĸ^_[]USWVt$fFtV)vv v  AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ t FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP$ ^USWV L$@T$*@h t$ Vh|%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PǑPVhP%S'1I/ދ$0$4Wj$@U t|$r $,84$HPXP$0Vha%W说SyGPVhs%W芴$0$4|$WjU $,t|$w1Ћ $ Q͐PVh%$4'$4#]S蛐PVh%$4T$ }ltE$u?ClhPhhWzWVh%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph$Vt$$@$@$L0 >}k|$`$0PJDL$L$QWh$Pt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph$St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V]d t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$誐  蝐 V1(^_[]ËL$DtD$L$tPVQc D$ƅuR SWVD$ L$tT$$w- .11t$|$X+9s "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`F`^SWVjh0jJK 1NǍ\$PSPhWotrjSjjWot]jSh@hWotBD$$1ɉ $L$ L$L$D$fD$DtD$jPWe t W^_[USWVt$+VjU=Chu,$t#tVh'PjJ=^  r%s%PSh%蒈PSh%G 1Bh' ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%F ^_ËD$$PL$1Bh': SWVt$tgw]Vh(ja<^ w$sPSh%E GLhT ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGHi%_0wF SPh%?E _0G89+\$8D$<l$8 0&|$ D$ fD$l$|$Xl$ D$XG8N PQh%D w$w(3<PSVh%pDG0GH>% w$賅PVhE%@D G0GHb%c1HG8G4 w$zPVhq%D 8\$0D$4l$0 0&|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( &|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ &|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P_w0PVh,%B w$@w0PVh,%Bt$6u$HujGtGht:?P%tPW%I+%GHPu萪j19c@O;Au<t M%?uI%GH0ts]Sh(w4Q 8Sh-/w8P7Sh/w0P7C w8w4Ph]%A 1HG8G4]@uPD$u>C wiVPh%]A wwhV3uVh%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;th%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh%C SWVt$^ Sh%L?G0+G8PSh %> VhTj%51Ghd%WFiP7 Wh&%>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3VhUjP"/uhe%h)%=^_[]he%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(hd%hX%h h%| PPV&5 tSE EdP $PEt]U$uu h2]CF Ph%c<6u%EHPVQ Vh%< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$h2VD$tF9tAtIdtI;u D$ thd%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V><'C'C'n w${PUho%: y1WVVWU0VhASU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLihJ D$ɀwȈGGV*QRPtQ T$  |$t t?t`t[\$XSjoD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$P#i PL$|$)9 OGPSQ8L ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSP.J \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Ph%/t$=$]tVSt$Dj`%e^_[]Á G AQSP.I ǃL$G)ˁ+),PjWq ,1OD$0@hX|$ 1|$CD$PjwǃSt$PH G D$G D$ GGDCff_f_1ۉT$SfGEh fGG@D$ffGScf f_ t$WhD$wK*PQt$ u)C Pt$h%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Pxdžx|tP~dž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5(&D$\$$%&WhOHVj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GH$%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWh6ejPh8%h)%$sY EX>@P UB( A J*R>RQP=  ]rts4 t*Mq @T$hRQPPV]ho%2C>t2Mq M*T$hRPQPV]h%O# Pj[1wLw !w wL$u]rruG XixiF SPh%" D$h$PS61Rh8%*#@uB3EpCP t: @ NH M plYhH%"u VhD%"h%"23=u1HL$h$QP t=w:F h%Ph%c" w}h 1Ƀ8tmF SPhE#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQP; h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$`PVh%; M+1C%j7quHWn댋Et {WtstـT$sO$tPЃ8u)ʃAr ta N@H@USWV׉΋D$$E t @9u ;M$^ P[PShq% EiP6բ$u!}@uHhjjWV Džt jWVjj|$=$tDd%EHPV#8#4 u2jn1Vh&jjv؃^_[]ËL$hTYWVP֋T$D$WPt$K 1Ht<$u 1t ɉ^_ËL$h-USWV1{\t^_[ÉjhQ C\t4WhVjp4 uh}%h)% C_ 8u"53hp%  Wh}%hE# 1NcD$T$ PUSWV$$($$$$_\ftPh%h=% ch$US迼 t'sPUVZt3_\t,Ct$?tF Ph%hE# V$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h=% t `xjW0h tD$ WV h%6`(^_[]WVD$ t01r9wu f΅t0^_USWVӉ΋$$D$~ #5;L$GTK9u@F>$wGKV*PRQp T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9D$ %t$t$t$ V%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$Pk( 6Vh'j|$XtVhdPjhej|$ GPG $9OsP4$L$ A t=|$ $OQt$P' G@Vjj*hR% D$ @\$ sCCCC C KCK1{ {+%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$h%R)E \$ t$t;ED$PMP $,uzh% $,tKPC Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$L4$teSPh#Vt$Wh%t$(C #ۋD$t$0?.% PwL4$L$ t/PUVt$Wh%QSPh#t$Wh%t$$$PUt$ Wh%Q h% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWPQ$ +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$CKPVh% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Ph% v 1F FFL^rL$heËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F Ph%lOhGL^_D$ȅtȰ (1SWV\$C rN 1H4t${GPhVJ ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh0'|$,WDEdx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVP  VVP  ƍF8Pauv3TV[hVP SWVG| WD$,P\WjVPK  ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0S  tzVS ~xF| uF|EhtF|FXMdQPeV$9tVTVGS1PP\$0S  ƅu\$ C$t$|h0'D$P1PPV  ƍC D$~gV_Vn8U_B1PP$  9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j Vt$u.jt @h%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGh%1lj$gL$$\$ G Gw u> Ʌt ѹ )QPh;%jV5[ D$h @$\$tu"D$$0>PSVUh %WjtGt $AG8y-iC 8th%h)%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQh;% 2C(K,QPVWutAhAd 2B 8u0t0t 9Ft!6u Wh\%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$} n PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&@ G@ 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u:L$( Ʌt ѹ )QPh;%jWW ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]hw%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yr> t$ $ q>YtiDD$ \$fl$Ӌl$ hm%WU( > 8th%h%t$@s"j@{Dž@7| D>tSPjjS> t'O N ONWVHHN@LF |8 VUSWVD$1tW8tQ\$l$G@tjUPD u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y 7 V1H^[ÍQF*v.q Au41USWVL$,Afw\l$t o*Sh'U Sh'U詡 TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUf/% V "% 1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPS譠 t=m<$hj.PSjnz 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p;$ 4$U $ 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPU tKd(1tD$ @`C`|$u%CdtC KhQt$(PhO%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$8" 1H1^_[]SWV\${C KhQPWƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h% GdD$ D$1xG O4SQPl t $tsOdtYG %t%%OhQRPh%"Wjz[u!f 81t\ 8t h'% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPh7%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhCQj苹D$ t;t$(hL%j6h%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  sh%V*^_[USWV] D$@Cxt$rj.VL$0Qj^ |$,wVhw%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPh%h%9e^_[]T$rRQPh%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPhv% RQh6% \RhY%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVPH L$  uhj议ËD$CNC KFCF CCj.L$vQPl Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj  $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h)%|$$HL$Xxp jP$P D$<t$hw%|$rst$h@%$p΁Vt$ h%t$$蚻$x|$D$ƀt$hU%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h^%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h%e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h+%t$TD$u%D$6jϬD$@`L@O|$ut$h)%誵몋sLߋD$,9CPut$,t$V5x VqGPD$$t$,әGLtbt$,Vt$Pp wPD$(À|$$*"D$$ h%s|$$/W̩!t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%Դt$[t$4t$t$h3%葴|$$tL$11BL$jOD$(D$$UWV}u WYh@ ƍG 4$D$,$5(&D$\$$%脳WhVj覩e^_]WVt$ Vh;W辩VhW觩VhW萩^_SWV|$G Ph5%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWP tF F^_[hS%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%RL$jQ_ u h%許$BHJAWhjj G Phc%۰WhWh iSh%,Yjt7UhjP*@h%h)%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhq%ï t#@uUhI%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%賮j봋4$VUh%Ю Wj`Du!L 81tB 8t hw%L$o@G WQSRPUitDD$GdՃGdD$ j.PUjJ t'OQPh;%j.V) h%z)h:  WhPj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWp uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuh%Ph%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h=%藬 jSW}Z tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh% PUb D$C,9r|$t"w 7h% PW, ,Nu^_[]WVt$ tqwgVhjW1GGG G XGtl^_# Vh@%hE# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUj!F \$wWh%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVk t0 D$ PSh,%̨ ^_[]h%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PShL%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%觧$ WShl%8 F PSh%y t){4t#D$} t*tu Vh% Vh%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]E?%f,'9t Qf9Au<< <\$H $('|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p Vh% D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPh%D$`$T$BWhW˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Sh7%P o1@GGG,G o$ t5?t/ShY%hE#Vhj jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPSh$jPAh%h)%$1ۋ6<$tD$D$$t;F SPh% D$$hPS6$Ch%舜Jh%23=u1HL$$hQPJ Ã37@$:VL$QRP,$ \$\$TSjj\z D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F PhR%КT$E|$wD贏S(GDtL$$SQPȴ _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u2 8tn 8tdD$ Ph%hE#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh%讙t/Vh!j j`1Wh%hE#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$CJ4$h\%hE#_ f%1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 tV%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5Fdž ^_[]Én ^_[]L$1jSWV|$Whj׌txWhRS豌WhS蚌Wh9S背Wh5Slws^_[SWVt${Du ?~ Who%P͓ 1@1ɉKCCS(C|S KtHd sHdit x|t^_[Wh%hE#諕 ^_[ønL$x|tBL$54SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O WhjPuh'%h)%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vh7%Ph$ D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0g D$ L$)1Hi t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$|'m   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ PhQ%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@9 VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%S D$P4 uOt$ pffBfBpɋ<$tXQlR臥 ڃ p7t$ffBfB<$tD$WVPRE ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP荤 |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPdtKWUP蹙 D=l$_D$ fǀ<7 1fw ')hp%R|$Qh\%j WW D$l$ f9<t1}~ QWh%P(}t$sf< fu.Wh%~(Ex(Et(Ep(El6tjsuD$0^_[]USWV΃|$$w Vh"%~1H׋ 1ۉt$$S1ItU $]h]d]`\$,Džu\$SjUƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh=%&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh%f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%t|},WVh%} ^_[]V΋Qhjr1ɉHH@@ @ @$t ^D Vh(%hE#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth\%VP6'uVjjq-wx9Dth`%Vku Vhi%|{^_É1j9VދL$t1Bhf%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1`%8WjjpD$$Pj腲<$w$'8uJ%=ǃ8^%8u+c%8uj%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%y ؋?ut$u {`<$uhs`t$ h5%y 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%q:fD$D$D$PjUVD$0T$4)̓w! t$h%qfjPD$DP1 D$LȉD$LD$PȋL$LD$P9v)護 t$Pt$Pt$h%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀCfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%o t$h^%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhq%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph<%Ent}u^_[]8Vf6!^_[]SWV΋y WhU%0n 1CCCC CC$t^_[Wh{%hE#0n ^_[Vt$F Ph%2n1B^L$Vt$?N Qh;%Pk 1B^_L$}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀCL/艈L/f$HC;,T^_[]SWVt$Vhljvb1CC C XCC~ ;u Wh%5l Wh%kt^_[Wh%hE#l ^_[ËL$Vt$VhjaF Ph%k1B^]Vt$?N Qhk%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%h=% k tjS0 tD$ WSVn h%j`^_[]ËL$VVt$?N Qh+%Ph Vhj?`1^L$nL$@%|$u.D$8jPj+j)5Tqu>h%P1|$L$8jQj*j)5T=u h%TrN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5Tqy h%QTt+DŽ$j$Pj&j)5T3uK1ۃ|$$3D$,tD$t3S?(Tuh%h%ƣRR|$$tF1FFFFF  F)F.N,RR9rF t$ƃ|$t.t$L$Aut$h3%+3D$,|$,tF)F/3F T@;DŽ$jjj2E y hN%TTȢTT̢TTТTTԢTf¢T'u TآT|$tjt$ j.j)V薁=3ujhTV  yPh%UPh3Pj)VPuY=3tjh3j j)V/th%$PhTV yh%hY%hv%V@ D$ 3 | h%i$jPhh5T葀t$8jVj$j)5Try h+%Q7 jVj%j)5TLy hH%+7 TH H r8r 30 s~|9~ h%t$jVhh5Ty h%jVhh5Th%d83PQhf% TЃ1۹TPSSQVRhTTt"Qh%蹶 TЃPSSPVPhT蟀t"V]t$0tWNuVj͚ Vjš 1,T0TL$?V1FhԦ3Vhh%i VF USWVX TDTt91ɉ R R1GH DT TTTf T r+rm ]1sqRRYRRTRTĢRTȢRT̢R RR t1R $T TR RfR3UfR Tff RfR=Tu"t$@jVG ȣRFȣR3RTR1L$@A ARY RRPhR5T ƅx9t&y h%j3 VS5Th% TuWh3W) @ThT%xTxTTT3v3XTD$vXTȉL$|$fD$1@L$|$(TL$ωspT lTL$L$ |$(TL$ǡT=L$|$(ݜ$ЃTP1PPhWjRqt"t$|W|$Wh%莧 t$h %} T1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃTPWWhVj$XPpt"Vh%˦ t$|$\$,=Tu ݄$\$$%虦 D$D$(t h)%肦 D$|1|$ ;|$Dw|$D|$x R8j@9uD$ g ȈT|$Tt$ЃTP1PPhVjR pt"VWhN$ t$Ffff9fDfPha% 1@Ph3P:Ph<$hc% hn% h}% h%w h%m h%c h%Y h%O h%j.$Wt$|j uj.h"W6 Wh% j.Wt$,juj.h"Wc6 Wh%"h%諤 h#螤 Nf%fw 'Px TGNju j.$Pt$ j.]hM%<h% h# Nf%fw 'Pܣ TF h{%Ffff=fh%fPht%FffQPh%P sFPh%8 L$$T$ /Ftc|$ umh%h% Fz$4'h%t$Ɖt$ t$QRPh0%Ģ h$Ph%`4t'h0#莢 TF<<%h%R TtF?%s+%P, K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( 3D$0LA B$s%PQ膠 F9uEPh6%n h% h%h%Q |$ FPhD%: 6Phe%* |$ "h%h% h$h-$L$$ 'j.$Pt$ jF$Q4h'h<%ThW%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Pv $@D$@|$ Phd#ho% t$ 9|$ohq%hd% D$$$T$ $@WjWh$&P蛞 Ft h2%舞 𡄦3H 3~|3H |3 h|3j  )L$|$$t1 q΃j.PL$Qjuj.h"$P/ $Phȇ%˝ |$u"tVh\%豝  hP%袝 3H 3~|3H |3 h|3j  t$GNjL$+{h%&ihvp$7 Tt$Nh$ Ntu%&P 1L$1΄u j, D$H%x%%sVQ觜 D$9D$t$uKj,诛 h%肜 D$4L$:D$tHj,膛 D$4WPh%P $D$4D$ uj,W h%* 3H 3;3h|3j)象 n|3H |3)hq%hvp$؛ T؋ 3Q3~ |3Q|3 h|3j A Tz|$h ot$dc~)/F1#ty1h%n2td3h%) ^ F N t$~WRQPh)% \$SQ>ƅx*VhN%ݚ 'h%Κ N h\%贚 D$@Pho%螚 ~`1St$[>t:j.$WPjruj.h"W+ WSh%O Shx%? C9u\$,t$ |$d|$h19wƉ΅h|3R (MlTT$p1Ʌu9Q V&jV#~ % VPjʐ 5Th%臙 5DTh%t 5lTh%a pTtPh%J DTtI lT9~h0$* 0D$D$L$d$ & \$$S$ 3H 3~|3H |3 h|3j t lTTtzpT$$xT|-T3XT$\$\$\$ \$$ %A $h|34Q h|3'Q USWV $$919gՉ $t$ $;8t$hh%$,2* =&GШu+$ ؃?9?)9K9si 3LA B$s%PQhV =hV$,) =GC~ 9r9$$ul&hh%$,VO) =wDG$8:$ t-؍L$VSthV$,) 1 ^_[]USWVP։1|$4$u9|.HPhL%d %wS$X'W )1@1sC9uÅu.PhZ& t$߉E1 `^_[]USWV4)ȃ'h%軕 :։ϋ ˉ hZ%rˉ $Wf_oUSRQt$Ph=%S Gl$j.UPj>uj.h"U& Uh_% Gj.UPj uj.h"U& _U()|c؉<+<'ueh%0<9#<,uth%谔 '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5Tt$PV;hD$$HL$L$ 1x1PPPWZ jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$TD$PVPL$@D$D$ 1 G|$<$D$=3$TD$j=hUa&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hUa&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPy SVUn |$|$t$ "+Hj=hUa&P Ņt$,].t 04$Q"t 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4m "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H l dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=Tu t11jNtT1TTt P豔1@hx@#ht%談 T1USWV1=TMT$ l$(L$DžD$5ThhT  |$t$5(#j hT6 D$Th5(#VTtUP ] uTWVTWVt7j L$QP{ x#L$9uT;D$ D$uL$us T8 TAPQ~ PQ[  T tuQhhT  |$uT1^_[]TTT1Ҋ+~,u"1t$L$t' t" t΅tAL$=TuT t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=Tu#TTtP/Y Tt T1^TTtPX TVtJT$1Aj<ƃ=Tu#TTtPX Tt T1^t Tt D$T1@1USWV D$,L$(l$$~ )$1H$`t T1A\$9|ωL$ tgp9tX tt$ PZ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$TTtPW TD$,L$$ ^_[]f11f11Ã=Tu /t(T11hhTPjNtT1TTt P1@hx@#h% T1USWVT$1=T+\$0L$ D$D$|$(D$5Tt$8S) l$,D$ D$D$t$j S2 \$1 h5(#V]E|$tt$(PFX u~5(#WV3EWV&t^j L$QP貅 xJL$9uAE;D$ D$<u/h5(#Vtj L$QPq x L$9t[ T8 TAPQ~ PQV  T tuQt$8S E h"$VXEth"$VCwh"$V-ah5(#VEHh5(#VE /h5(#VE$j:t$ L0 1@|$ uT1^_[]WV=Tu et3t$|$ 11t$t$Wj1tЉ^_1@PPhhThTt$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=Tu+TTtPL$S L$TD$$tˉ01C؃^_[TTtPS TPPhhThTt$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=Tu+TTtPL$R L$TD$$tˉ01C؃^_[t Tt D$T1@1fUSWV\$l$t$VR PVW UR PUWz SR PSWf t$ VR PVWN ^_[]WV t$uRt>DžtA="Tt ^_Épxj Ph" ؀= Tu1F1=!Tta 1맋53_` d#QQh%PփH^ USWV1ۀ=0Tt ؁^_[]a D$ |$GSSPh$TjW&u $T 4T 8Tr1Ht%ƍC!t2)É$)t*TL$ T$)PD$p xPhT=BT=DTWjD$hpj Ph" 53W d#QQh%53uW d#QQh%Pփ^U 111{PZDWhVT ESWV 1L$ |$ ru\95|Ts(>tGǀ=BTu.;=TrN;=TrD(T DžtVjWFT =!Tt^W 1ހ="Tt& ^_[À= Tu1Ffu]pxj Ph" 뺋53V d#QQh-%PփT NUSWV|$4t$0Ë |T9s&lT9 8Ս1ʅ/dT99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95T95TH_ŋ lT!9r؅ HT9s9s_8T 8!9t.M9wI9rE`T8! 3!9u!=BT=DT(TRf ʼn9rPVU(  8!!ōD$p TPVL$]D$PVt$8kpTPt$jUVthŋ$L$Ai QhTp=BT=DTu=!TT 1="TtM^_[]t$hTO= T1GDu3t몍D$0xhj Ph"V 53R d#QQhZ%PփP 9U7)SjZP)MPjSKP :9/ $)QjZP)PjSP tƉ111USWVˡlT!9ta)‹ N vjZv )N VjZSN V t$="Ttt ^É01ɉHHj Ph"艻 ҋL$SWVȋlT!9t+)֋ V$T (Tr!1F<u. (T$TF9r^USWVP $1N=lT1!׉) _;Tu >9uP"_;TFjWVj *1ۡTt  T8TH@; Tv@jTH@ T 3H hTHPhThT9rWV_ u="@ j@S06 -3> h<t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á3D$t$PfWVL$T$ ‹q~y ;q~ t 1~9 QP[ ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'WB. tF u1^_ËD$t w$Ű'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ d#d#tƀ>t"%7; 0DPWVh&hԦ3{V ^_Ð1|$w L$t9tø3f|$3%W#td#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]U 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PS! `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P5 t F;'tm'D$'D$'1FthPt$$Vf V) Ft$N tVD$PS< |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-t8 01H^_[]Ë' r ,$'t u‰,$''<$t9rPQt$s 1t/<$t9v7 |fL$%9 ,(v3fL$%9 |(vȠ3føÃD$L$L$ L$D$Vt$ t$VhԦ3V hĠ"V It"^7 0kPh$hԦ3R Ԧ3Vj _V ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t5 0 5 1$^ÐWV|$ W4'D' tFu1 ^_D$ftL$Qh'1USWV$п$$ u V%  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#[4$Y(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$TL$L$ tU |$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFFTTC><% ^q{t|~F~F ;^r~uFTFF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFTF^9րրw t$rI{i9s <$=3]D_\,<$t~uF FTTAu~uF TF>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF TNPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF TF"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF TFЉL<$USWV t$ ^h.\u/;nr~uFFTTEMŁ'$~]$D'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFTFF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFTFωωD$$xt~uF T.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF TN$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF TFVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFTF~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uTF4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQͺ F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA TQ^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FTFUSWV\$1=39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh 31҃9v1B 33Dh1҃9v)1BuG TG^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFTTT^_Ã~uFTNUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFTF1^_[]É؉D$"%'t$t$U< u U/ t/uՃt~uFG롋$USWV 1=39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytSh'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq tF^~uF TF1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ z ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4趭 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ U ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t Vٷ @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhTlTø%Vt$1Ʌ1t э^fffffffVYT$<ws<^ÐUSWV[Øl$,D$(u1T$|$;D$ T$$75,PW辭 EPW覭 %PW莭 PWv tPWb |$D$ tH PW) PW PW iPW tPWͬ |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [õ$ @$ $ ,19r 胼$ t+$ $$ FhPWb D$D$D$j1҉$ xfD$4D$d /$$ AfAfIsQPRhWrt$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ VhPWYa j:WN D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP#t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.rqPh$P9$$,$9s|$$$,$9s|$$ y;L$ɍ$ P1,$ L$LZ9s T$hBJ R RQPUh$P $$,$ 9sL$4rqPh$P$j$,$o9sD$l6$,$/9s狄$ @rPQh$P$$,$9s狄$ @<h,$9suF9snF9siF9x|$B$ y*,$9s%NM9D?<$ @<L$|It$xjhQPRt$Ph$P$$,$9sL$tWrQPh$Pd$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ 0,$$ |$jj Rjjt$,$ $,$$$49s獃,$$ g3,$QPh$P$$9s獃",$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP"pRQt$Uh$P%D$hL$HL$0HL$,HL$$HL$ PH @ Al$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH_l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P`$,$$_9sjjjhRt$,$ 諍$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F PQhWo1ɃD$D$ D$1 v fffUSWV`[t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?rM  l$8D$UPjo tCL$HD$ QPV t2VY t+jPj5 1ɃىK'輨 (jD$LPV譧 襨 (l$8蚨 0jUj 膨 0`^_[]fffffUSWV< [eD$yXXD$/Xty$/devjPt=ƍD$4PhFtHVk Vt|$4l$8$<D$ oD$ $<T$${PhQRV=D$ t@D$D$D$SD$pL$T$ t$F9t$D$0l$WE?tD$pD$ jjR tkD$tSt$PD$P ut$D$PuPujjD$P7 k6諦 8[ 萦 iŋ$\ $X $T $P :)tt$ P?$` tVjQtw 1tWhgtQm < ^_[]ÐSV[L$t$ t$ t$ PQft+@ ƃt;u"t$%4$:01D$L$4$^[fffffffXo@ÐXO(!ÐX/ƀ,!ÐSV[ @tPaǃ@ۤ (!Rǃ(!^[ÐSWV[ì@tvtEH 9ujjj@C !ƒt#@D CPQV@Q 1u衠 0蕠 04$N^_[#䐐S[n[ÐS[Nt$[ÐUSWV[ u } D$<$ t$u$$D$P 8ut=k<T$JL$|D$x$L$x$PQ2t$$$Pt$oslH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $DD9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$h D$@j PW56 K 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQh|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRαѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6耡W8G4jjdv6r jjdRP[WPGLjh'v6r W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,u L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$<2 ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[ëL$@tEׁ<u$C t+t9u11ՉL$!։1^_[]ÐUSWV[+|$GtB#l$%t$P8t!G t7t9uӾ^_[]ÐUSWV[ûXtC#l$T t$P7t!G t7t9uӾ^_[]ÐUSWV[KtC#l$ t$P67t!G t7t9uӾ^_[]ÐUSWV[ؼt$0t$, ǍVP‰t$D$(%D$1퍃<D$ <$l$@tg|$ !RPw6tG t@/t;L$uЃt'D$ t$jR…<$uNt$0t><$9tR a PUW >&t1<$W^_[]fUSWV[Ût$D$hEt'1PV5t%D=u10!uVPj] D$@ 8^_[]ÐUSWV[|$ D$hEt$1PW 5t%D5u0!^_[]ËD$@ 40tMo D$jPt$Vp ŋD$18txuo r"u##0!uB"tt$0!a4$WPjуHWPj SV[t$ vv V^[ÐUSWV[èD$,8tD$,1퐐8@uj HƋ|$(W F$"jUF D$ D$,F>D$Pt$O1}nu1ɀ}ouL$D$j=U49 tǃ|$D$,t1PU2tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ80!t 4$TVK1^_[]ÍUPj USWV[$4$,l 0jPU uj:U8 jPU} tKt$}/3t$UhV jVPUb\ P t$UD$PX|$ jjWjjVp1mt$ jjWPjV@1t$/hD$PVǍED$t$jDžjt$W\ uj$4$4jWMtƍD$Phzd@VM VD$(Pt$\ u9P$0>$0VPW= FD$ GL$ jjQPjR(0tqVUW Rj 0M$0Xj 0ksj 8uj/UKŃt$ $0UW :j 0QPW 111j 0M$0P$4Y 11,$j$4V$4WjUP.PWN{t$t8HPQ膏&i 0$0P$4 1,$D$PUMi 0^_[]Í>,$UPVW茀1i (WP$8$8^VcfffffffS[۳D$D$ $L$T$jjPQjR.yD$[fffffS[{D$D$ >$L$T$jjPQjR-yD$[ÐS[D$D$ ?$L$T$jjPQjRQ-yD$[ÐS[û$L$PjjPQRyD$[fffffYoT$4uM4ÐS[>t$wSWV[|$Wt$t$_ 9rf ?bWVPj4^_[ÐSWV[̱|$Wt$t$ 9rf ?WVPj4^_[ÐSV[}t$ ) ƅuPj4^[ÐSV[=t$t$U ƅuPj4^[ÐSWV[|$WƅtuWPj4 ^_[ÐUSWV[ûl$|$UW ƅttuUWPj4^_[]ÐSWV[l|$Wt$ ƅtu WPj4 ^_[ÐUSWV[l$|$UWt$ td 0< UWPj4^_[]ÐSWV[̯|$t$W胀ƅu_ WPj4 ^_[ÐSVP[ÌD$L$T$$RQPZ ƃup Pj4^[ÐSV[=t$t$t$ ƃup Pj4^[USWVP[Pt$0t$0t$0t$0t$0jt$4@ Ɖ׋,$t1c ( t$,t$,t$,t$,t$,t$,Pj4 ^_[]ÐUSWVP[zPt$0t$0t$0t$0t$0jt$4- Ɖ׋,$t1:c ( t$,t$,t$,t$,t$,t$,Pj4 ^_[]fXL$"wÍpffffffUSWVHXȭD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjGy~D$ |$4R|$D$811|$<,L$4L$0GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjj"r\$Pʅ~D$ |$\$0VRD$ PjjqT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjj#q1҅l$D\$0WRD$ PjjpT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjnD$ u|$,L$ t@;L$s3$ >"\$0\W L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[.jt$t$t$t$t$8[fS[L$T$ Pt$t$t$[ÐUSWV[ø|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuU H8 H81^_[þD$t@:$ðfffffffSV[8t ʭPAt㋋QXQP)& t.PT$06ʹ^[ÍS P4 jvTfffS[~D$ ~ L$u [ËPQ2  [ÐS[>D$~ L$ u [PQt$ [ÐS[jt$ 0 [ÐS[Ύjt$t$t [ÐSV[Ý0t$t$V* tD$~ L$u  PQV ^[ÐSV[=t$ t$t$V`* tD$~ L$u  PQV ^[ÐSV[ݍ0t$t$V) tjt$Vh ^[ÐSV[Ít$ t$t$V) tjt$V ^[ÐUSWV [8t$4@|$D$ L$jjjjQQPPt$(v$[ÐS[D$ L$jjjjQQPPt$($[ÐS[ކt$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[Õ$\$Xt$QP8%$ % $$`t$PR&$  $t$PR贁&$  $$dt$PRp&$  $$l$htD$xPR( |$x  T$xtD$PPR |$P  T$P$t$ptD$(PR谀 |$(  T$(tPR|  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[5$U$tvu $ 󥋬$$tvu $X tut$ $ 󥋬$$tviu $0 tu=t$ $ 󥋴$tvu $ 󥋬$$tvu $ tut |$h |$h 󥋔$$E@mHt ։t |$$$$Xt t |$0$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XgD$D$L$$$\$`l$(D$@D$ D$ D$HT$8B$L$D$4Q[x$h,1T$L$,؋ $LIfDL$9$D@4dL$$LD t;hPu$h,$D@D T$v$D@L$fH|$p1j $LII HLIA 9t$ u‹T$$D@ʍ f|$yS4OD0 0L0Rw| G, $@fD0f|0$vxt$(x‹O,$L$@t$)֍ L~;|$ _L$ǃ!<ǃ!^ǃ!vǃ!#ǃ!:ǃ!'ǃ!#ǃ!#ǃ!#ǃ!-ǃ!-ǃ!_ǃ!|ǃ0!oǃ!-ǃ!-ǃ!<ǃ !>ǃ$!*ǃ(!!ǃ,!f2Ot^t8tjtfx8!؋tvQjPW;1D!QTpQTtQTxT|=u^_[]ÐVYd1D!T$tpqttqtxqt|1=u^ÐUSWVP[Êd@!l$j+}GG(ujj1QP upPj j3"QQP&ej>!j< !j^H!jvp!j#!j:h!j'0!j#X!j#!j#x!j-h!j-X!j_H8!j|8!jo(!jp!jr!jy(!jzP!j{x!j|!j}!ǃ!!ǃ!+ǃ !!ǃ!,ǃH!!ǃ!-ǃp!!ǃ!.ǃ!%ǃ!0ǃ@!%ǃ!`ǃh!%ǃ!aǃ0!ǃ!fǃX!ǃ!gǃ!%ǃ!hǃ!&ǃ!iǃ!%ǃ!jǃ!%ǃ!kǃ ! %ǃ!lǃH!%ǃ!mǃp!<%ǃ!nǃ!%ǃ!qǃ!#ǃ!oǃ8!#ǃ!sǃ`!%ǃ!tǃ!$%ǃ !uǃ!4%ǃ!vǃ!,%ǃ!wǃ!%ǃ!xǃ!ǃ0!~ǃ!#ǃ!pǃ!#ǃ!rǃ(!d"ǃ!yǃP!e"ǃ !zǃx!ǃ$!{ǃ!`"ǃ(!|ǃ!ǃ,!}2NthtBt'zx@!:!ϋtuQjPV p8! 44L$ 4H 441;4f8!f1jD$` `4rփփ19‰4 4f8!fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f8!f1[ Pjj!Q j/S[.St$j[ffS[S0t$ [ÐUSWV$[R|$u2t PzR2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍ{RPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(} P谺tjjP/ ,GT P膺tjjP GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PjD$$<$$u$P HuǐuUs PD$$鐐<$$u$}Pc Huǐul$Ut$VzVU$|$KD$H$\ H HT HX` Hl` 2t p2~"14/;>|V^_[ÐUSWV[IfǃL!hQu$ DHDHDHDH uǀ2ǃP!ǃT!ǃX!1IT<,$j T<TV$2@4tV =wlj<$hVt$ V V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í Pj S[H0[ÐUSWV [G|$ EG8$u%O9OuO9Ou9$uxWo/t W貋`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PHGGMIAG GAE3t4\10xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R*G4$&=u8 $A @11 $<x=D$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a U" 8uE3 $tԋ\10vL$Eǀ3뤐SV[D0t$t$V t V^[ÐSV[ÍDt$ t$t$V t Vr^[ÐSWVP[KD$t&T$t$2PWj $^_[ÐUSWVP[C1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[+CT$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[EB1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[øAD$0>ƈ2L$ȉT$ D$D$ D$t$%fG T!9X!L!f$t|$u!|$t'QL$ )RW ŃuRG @tG 8u=D$3t.\10rD$ǀ3G @|$tmG  fP!\!HȃP!T!L!fftVW=VtX!\!HȃP!T!9P!\!HȃP!T!f9ufǃL!f АT$ftiLjfx_ɋ4f>t%fG t~t-P!19X!fL!D$DhhAX!\!Qʃʃ19X!P!fL!^_[]ýG @tBr 8u8t$3t)\10)pǀ3g 룸! Pjj Qs jSWV[=|$WƃuOG @tD 8u:3t)\10oǀ3^_[ÐUSWV[{=tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐUSWV[ë<tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐSP[;$tT$ 2Pjj $[ÐX; tT$QT1øUSWV[V;TAx43fTFT$P蔘j 莍+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]ø Pjj , PjjQ j PFjffffS[Î90[ÐUSWV[h9|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW&"W1^_[]ÐSV[70t$t$V t VN^[ÐSV[í7t$ t$t$V t V^[ffSWV([i70Wt$<3WV0^_[ÐSWV([)7t$8Wt$@2WVt0^_[ÐSWV([60t$11;3}:tt3PT^_[]ÐS[NT$t$t$ [ÐUSWV[93|$0t$,T$ $upXMDH@utl$4D$ U觴 鐐t$ D$PL$ QD$ Px)t$`tL$9D$)<9u AT$)RUTgt( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[Ø8D$ $4VjPj.tSʼnt$U`ƅtMD$ $t$UD$PVtT$t$$V Vq^_[]ÐUSWV[ |$3t P 3~/11퐐440p0;3|4p<3ǃ<wwLJ3j0ji4tW2Ht<@xX3~39tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ^L$1~t$ ~9J$u9r ^ÐUSWV[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU7x71^_[]ÐUSWVP[Út$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [8t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[T$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQ&EE;~} K(t$몉SV[ýT$L$ Aq D$t$jVPt$ ^[ÐUSWV[{l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[t$D1Sl$HGL$\$jD$@, ! jt$UWV*|$ D$$hxD$0\$u$py1,>;i|+A;D$D$$x8A8 $T$\$Wt$ D$$xuL$|$  $9hL$l$,T$9JыT$,uRq9~K9}Gph\$jG, \$jVUt$8U|$)T$@D$$p P֋|$ 9'L$i95X9<$uL$I, tE\$ \$jD$@,L$  jUQVQ~(T$@D$pD$$pt$$<$;T$(Ջ\$t$W"tG‹yuD$~ $\$D$@i$@\\$jBD$@0j!V *΋L$0IvXh2tjt$$l$,A8\$tjD$@8L$<$ }1;|$Lt$tWH y~@bPT0VjQcU T$t$ UNjD$@Vj4U -t$$tuD$<H@!QP>0Pjt$@T D$|$ x xD$<;x}x@,L$4p!F!fFV!!Z!!fN! 49D$<;x||$G,t$wp#O, A3T$t$ t$;|$LofrfL$ f|#udl$0T$(ft$ΉD$8)jVl$UQU8%T$\$D$ PUKL$0)ϋ\$jWUVU$|$(D$@f|$ut$8Qq0QjPT$t$ VǃD$<L$,;HL$}hD$$pyiW9u9l$ u A,t>\$jT$ D$@, !D jUt$t$V $L$$AʋL$$ ABAWd0PjQ(R f~XGuRD$$Gh2u@9u%PD$@0;7A?w t60?vut$@u tAGj>@0jrQ ytdt0PjQHQ @듃xHpo9u9uD$@@,\$jL$ D$@@, ! jWUt$Vj"L$@I1f|$X,,Et\$puED$@H9ƋT$@Zz,1f1Ճ9G9pPoO9u9uD$@@,tC\$jT$ L$|$@G, ! jt$Ut$VT!wWD$<pP`1l$t:$T$ $\9Gx,1L$(cL$< q@A\$jRD$$p( 1҃ډЃh^_[]Ët$ ;p tZ$\$([,t$4$;subpt{j\$WUt3ul$dx,t$ |D$Kl$dt$1PJ҉t$p,$T$J׋L$t܉|$8${[,;{ubxts$h\$VUt(ul$dp,L$il$dT$t$T$8ʋHL$N1T$9x,L$\$9|ʋ IT$TRZ3YttL$<$׋\$߉|$ x|$<$<|$()˃$1ۋL$ L$|$9$t(ً\$([k3lډl$u\$ \$|$)ߋL$9׉\$ }<$1D$1%|$,1ɉ11_D$8d|$\$T$,z<$Xڋ\$|$D|$49T$,<$|$,|$4|$4WT$DT$+T$,|$ |$9|$DT$4T$B;T$4T$4\$ mD$/t$t$(؉$ C9ӉtD$, L$~ыD$0dD$ P,y,\$ًt$[,;]u ;L$|\$ډ$T$T$(;L$l$|$DT$4vptEL$0 I,$ y@,L$(h\$WU%t.uD$( $ȉ $;L$} D$ 떐l$\$|$DT$4L$$9t t$(dϋHL$, $t$(9$<9L$8L$ًT$ 9щL$ L$0 QD9!\$!!Pq|\$!BfBD$0ALfBt,jAD\$Rq|\$l$uvdx;!D$u!T$P~1r01덭!Ph U ǀw !PQR d I!D$P!D$0݋D$\$T$)ډT$HNjT$ )׉|$8)B|$HD$0p@D$+|$D$@H0t$(ɋT$xpuFt0t'|$  T$d?;WߋT$HT$Rt$$Qf 0VjP!H jjjt$t$8D$@t$ VjppG jjt$ jjlD$@WQ{ft$ jPG t$D$8|$HT$ )׉|$|$l$H|$TI,|$DD$L uLd T$9Quul$U0VjP> |$08|$|$E@VjL> u  x B PQhR> B USWV [hD$41\$t$LL$H\$DT$@|$L!PQJ t*NjD$9T!t#WT# $~ 1ɋ$0PjW+ P!X!L!T!^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃT!USWV$T$ [T}\!`!T!X!D$PBpL$ t$tIT$$`L!t)ʋL$ ׉)}=)9hgʉt$T$ 9P!4t2t$ t$ )t)WP!D$)1Ѝ /9L$|9l$Pjt$) ǃX!ǃT!11ҋ`D$8L!tlj)D$4>$,D$8 $<t$u;P!} t$Ћl$)$t$@@9 9<$PjQ0) @xX!H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃT!D$X!;P!;T$ 9<$\!tod!j Ptwx)`!@ltQjP%( F\!t3d!j P)wx)`!j |j mX!X!ǃT!1;P!d!$l$*ǃT!X!;P!X!@@ltWjPV' `!yA\!t`j t$Lvx`!)ȉ`!}u D$8o@@lU8 LQj `uT!;L!d!"UjP& T!;L!~U`! T!@@xuă\!tjWsux)`!j띍X!;P!~-X!@Uj% `!yxD$8L!T!)ȃ,$D$d!D$4$jP% T!D$(19 ș)Љփ<L!9D$@u\!t!j t$Ktx)`!j tT!D$@,X!@D`d!D$,$.`!`!T!T!-;L!!D$P,X!t$j<L|$ tv\!ufL$L!;H@L$uSDuLf~54tT!X!t [L$ fu-@t!,$UjP# `!\!t0j t$rx`!)ȉ`!j ǃ`!\!tD$ T!D$X!`!$^_[])ȃ|,9t$,$,@tUjP# <,$\!t!j t$rx)`! j fT!;L!~nUjP" T!;L!T!@@xu̓\!t!jt$qx)`!j룉PS[ntD$\!t#d!PQIqx)`! P1[fffXtHy8~DyD~>Hlt htðuu냹tt u1ÐXs@ xÐUSWV [ÈsAP8p|$hD\Alt huu |t$r/ǃ!4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|L!fp"Nfr"Pt"ǃ!ǃ!21CdD$L$ /jt$YD$L$ T$R29t9tT$! FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p !p0!0 !0(9uD$t4$L!L !Lq1tt  ^_[]ÃttِUSWVP[únL$9 ft$9|$ 9l2uCUw$-4$t$skwh|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXxm2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYk|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[jL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZvf1^_[S[iǃLǃP9t%!DŽp"DŽt"!t!1[ÐUSWV[[iT$L$l2uI~w-ssw!ff fffLfNǃP>t*!f0p"f0r"DŽ0t"!t!1^_[]ÐXohh2ÐUSWVP[Jht$!t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[fl2tu6@t!|$0QjP (!G@f@d^_[ÐXef@dffSWV[ÌeD$ yOQW~ ;O~ t Q WP8W^_[ÐSWV[e|$D$OQW~ ;O~ t Q WPH8W^_[ÐSWV[üdxWt$WQ^_[ÐSWV[|d|$Wt$W^_[fffffffUSWVX;dtLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j GxL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$蚾7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vVx;l$tl$l)"P*x‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ {T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KЙ~ ƃQWT$H ^_[]ÐSWV[ÜR|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[R!!jt$t$t$P1[ÐSV[Q!!jVjt$PJ1^[fSWVP[ÛQ|$t!t9t QD$PL$QjPWeL$N|$kK)l$kK) ;i)PUt;y t0q$t~fuUvu1 q ^_[]ÐUSWV[OD$$L$t@1D$D$>D$PL$QjPWdL$kL|$kC)l$kC) ;i? )<PUt7q tAy$t+nuUwu A@y^_[]USWV[èND$(L$1҄t@1D$D$8>D$D$P~L$QjPVcl$-?L|$ ) i)ʼn) i)k"{"lj*SiŠ)ǍDPD$Pt1D$HH<tzp t:h$D$t}suPuYD$uދ} مt3l$,t+Et$WP=(uVaEЃ^_[]ÐS[Mt$ t$t$ [ÐUSWVH[Lt$\lD$PlND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPU aL$ȿNt$kK)kK) 3i)PUL$D$$ED$j=UxtƉH$$D$<$|$WL$QjPW `L$Ƚ-?Lt$) i)) i)K"s"Ɖ*SiŠ)ƍDPW6D$5tcL$f <$|$W?L$QjPWN_L$ȽkLt$kC)kC) 3i? )<PWtD$EHE!D$@DG $$D$FPU-PU PUPUbSPUt PUtr PUte PUtXA$PU}u^O1<5.' D$URNj$tP@ 1L$;D$v==wL$L$Qt$sL$uD$ 9D$ tf, UQ",$t'UW"|$BU觪4+1t$ 1 t]|$uf, FM $QP"4$>  $LD=uVQ!V $4D$ H^_[]1|$t4$1USWV[öFhKWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$4 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]ňA2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[?1l$E<%uEpuEπ r?уstlu~;|$~,|$ts릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[-?L$ T$D$$Pj [ÐUSWVX>$1h ։ͅu4$!u'$he!5 @0t$E4}0u"$h-E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjPV l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $LȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $$t"A$|t+H$D+$1$uՋ$1ڃV$(!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,jRE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$j1L$ ʀŸw Dʀ¿~4r$&1ۋu0M4A9s E,u,߃$Vu,芒rE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,ftRE,}0M4$V$0Pt$QE4E,M4},$}1^_[]ÐSP[]3T$ D$$1Pj= [ÐS[.3t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[2T$ D$$1Pj [ffffX2L$TÐUSWV[Ø2|$(t$ l$uʭPƅ>l$$uj[hj蘎L$tfjVP NjD$uj(P/D$@ x |$(u VqE\1F4 9Pk1D$tGuP|$(# x |$(tF|$(mG V|$(t Phht@UV t$t$tL$t RB(JTtRKRPtjjP~ IA(VRPtjjPo~ IA1t^_[]Í Pj VSVP[L0T$L$D$tRQPVƋ$t P.^[fUSWV[/t$|$t$jt0ʼnVU|$T$VŸ Pt$Wt~{Pt$@tk Pt$)t[ Pt$tK Pt$t; Pt$uA1 @VK^_[]ÐUSWV T$L$[Ý.ǃ! P̗Ņt'}/u{L$$ t$   P萗/P܆PV+uU謆DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ 覐V`'u 1V=' P莖$|$ $~:s1퐐Nt:t됐tÍMwUPW) D, L$$ t$ [tuYPޕtG T$ PQhR~)T$ L$$ t$ $ t$ $:uw1퐐Ot:t됐tÍMwUPV) D, L$$ t$ [tu$ $ȁ ^_[]Í !USWV[h+l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%F\$L$ A ZAthhP+jj! G(hhP|$ Gt\$h(jP|$ "\$jh趆|$ G9ouG)o\$UD$p貇|$ Go\$UVPX W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjPe ~ gC C$ދ\$P'F$ދ\$P ~ F$D$\$jW+F$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$VST t6u0,1(Vr9ſuUt$VT ^_[]fffUSWV [#D$48H L$@ 1퐐/t <,tEPuUWP! .,v3l$4uWׅEED$\$cD$1 D$|$j|WȢtD$4@ T$L$ tp17t<,t\$RT$D$PttDl$VWQ& Ut$P 1<$WNjt$D$Pl$8uEW|$WV謩 WpD$D$D$ Džt$N\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0}\$<u3D$u'\$Ur\$8C k$K($fC K(K(|$T$ t$4 Pl>p1\$91\$-4$ςK\$% PlD$P蠂D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Qz ^_[]USWV[8D$t uyp1 |$ 1퐐/t <,tQL$$P~pt2ƃ$UWP 4$t$P  1^_[]ÐUSWV[{|$ t$FN,9vtU6zuCu;Uot.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$GPWuLt}D$x@ȃǃtVot$ UT)Lstƃntfuă뿐1ɋT$z H&D$8l$|$ u)1|$5 WuPt$D/WprP WuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ë|$ t$FN,9vtU6su]uUUhtHnNT$l$f,Ninf|FFWRP臝 ~F 1^_[]ÐSWV[t$FNy9vtW6jruCu;Wggt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[xl$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1m bGj|U)D$tL$j|Ut L$U踸=rUPt$P 10^_[]ËD$tP肸L$ =r "D$t+P^L$=r QUPt$T^jjPwott$ $@ 1D5t <,tFPeD$4 VUP D5$(L$tSD$HtJ11t <,tFP e Vt$P辚 D5$h|$t+D$Ht"t$j $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0th$@,t'<$O 1҃ ҃f91wуu蠿<$O G$1҉L$‹O(Q9T$0RD$p g$D$t$HjjjPjfWjQ VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[*|$!$!ftGt @1@WG(f!hwU` =wb,ŭ!Ƅ!|)ƋtVPU_ 9vD|ŃƋGtVPU_ 9s D|ŃE$^_[]ÐSV[-t$ tav?cv4cv)cv cv$cv,cVb19!uǃ!^[ÐX!@ÐY!@upUSWV[e$(E$$4D$$0j:WtjQP0 t0V$0Wk NjE;$^_[]Ãxu 1\tMudt6ultxtf$O:t @t@uS4$l$w$D$j@UP] <:t$EF<:uEl$4$D$D$OtuXPcxPqc`MǃX|D$O3$$,PQhW t" ǃt SjUXfX7\(j|/x|]Pc^]PqPetzj/V荒t|$u$jPRQV0'T$ę$jPRWUQVVPj%KSV[t$ j:V|tjQP轡 tt$Va1^[ÐVY~T$փ1u\t^1x^USWVH[8t$dl$`L$\D$Dȃ=\ux<$yL$VPj@Q3T$tLT 9 $ƅtID$\WUx ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\x\DŽxDŽ\ $;D$Du ЃH^_[]PUSWVT[|$pL$ll$hD$P=\ux $t$ uL$WPj@Qt$t$ T$Ijj wD$Wt$\ $t$j N9<$u-;D$PuyL$T^_[]WQU ;L$PtNTxM\>DŽxDŽ\谭;D$Pu T^_[]pOUSWVD[ÈL$`T$dt$X}|$@uM\u xt9ƀRQt$dPj@W tRQt$dVn M;L$@uD^_[]NSWV[|$=uj\u xtVw;}tL!x\DŽxDŽ\W^_[ÐUSWVP[(D$hT$dML$LL$pL$t$lуuc\u xtOz=m8@tW=mPT$ vPQj@R x. VPRԍ b[<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$lx 4()uT$ff׺r$σߺfDfu,$tу$$1#E;D$Lu^P^_[]Ët$dxe\VDŽxDŽ\ȩ,$1,$KS[ÞD$u&\u xti-[P[ÐS[ND$u&\u xt-[t$ Pb[ÐSV[t$ j:V6ttjQPݙ tt$V#袨-^[ÐSWV[Ì|$t$j:VstjQPx tWhV WhV ^_[SP[-D$ L$ $L$ƒu&\u xt-Qt$P [ÐS[þD$u\u xt1[P蔃[ÐSV[mt$ j:VrtjQP] tt$V""-^[ÐUSWV׉[Rjj D$UWt$\  t$j 19tG4$x\DŽxDŽ\w^_[]ÐUSWVL[VD$D$H1,<jUxK u} t @u D<@u^x]\NDŽxDŽ\D$;D$HL^_[]Íl$ E< us{Ui8|$jWx  u|$ u}Fux\DŽxDŽ\Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:00"D$t$DRL$D00"A @`? 19<$40"D$D@ @`ƒ?9130"D$D@ @`Ń?+920"D$D@ D$@|$`D$?;|$  ՋL$10" <$‹D$Dp50"D$L$ D1 <@4$T$<`Ń?|$_u+19QL$ T$D $L @`ʃ?|$_u19 l$ D$L(D$<_D$$D @`Ń?+19 ՋL$ T$D |$_$D @`ƒ?9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$H0"VRPQT$T$L$ t$ ?3|$D/? D/ ?D/D$/T$T$L$ t$ ?3D/? D/ ?D/D$D/D$L$ < L/ ?L/ D/D/ 00"<$<$r?USWV[Å$D$$! ǃ0"ǃ0"ǃ0"ǃ0"ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"@P0"V31tBD>׹@P0"VD,|t.tkŷ< s݃1@ttP0"tр‍ 0"1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ0"ǃ0"ǃ0"ǃ0"ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"V|$| t!qtAD>1tBD>׸@P0"VD|$t=2t$Fi%I<<fw1@ttP0"tlj瀍 ;0"1ttD~tW0"W  fABsW w~4ABsW w~4ABsW w~4ABsW w~4ABsW w~4AsW wʼn41 @ttP0"tlj瀍 ;0"1ttD~tW$QsW$AP0"sW$BP0"$u1 @ttP0"tlj瀍 ;0("1ttD~t⍃WS0"0pQPQPQug0"D$pf0"D$le0"D$hd0"D$dc0"D$`b0"D$\a0"D$X`0"D$T_0"D$P^0"D$L]0"D$H\0"D$D[0"D$@Z0"D$<Y0"D$8X0"D$4W0"D$0V0"D$,U0"D$(T0"D$$S0"D$ R0"D$Q0"D$P0"D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف$Xр3ʉрUɀʈǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"΀0"D$0"D$x0"D$t0"D$p0"D$l0" ʋD$h0" ыD$d0"D$`0"D$\0" D$X0" D$T0"D$P0"D$L0" D$H0" D$D0"D$@0" ʋD$<0"D$80"D$40" D$00" D$,0"D$(0" ΋D$$0"D$ 0"D$0" ω D$0" ɋD$0" ? ? ։? T$ځ0"$T$ 10"u0"E0" Qu0" ƃu %?? lj%?  $T$ @D$Xƃ!$ ΃!! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0" 4"J΃ " " 0" 4"J΃ " " 0" 4"J΃ " " 0" 4"""!7"4$l$T$ L$ Ń40"x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]#.USWV(]8D$<X%UUUUʁUUUՍ4P᪪0"4"x " "x 0" 4" x " " x 0" 4"x " "x 0" 4"UUUU " "$؃0"4"x " "x 0" 4" x " " x 0" 4"x " "x 0" 4"T$H ݰ"l$ ݴ",1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y("$$"D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 30"30 "30"30!"3<$t$3~30"30""30"30#"30"30$"30"30%"30"30&"30"30'"1#t$t$D$|$811t$3=0"$3=0 "$3=0"$3=0!"$3=0"t$$3=0""$$1L$t$|$l$3l>l$|$l$ 30"30#"D$350"350$"350"350%"30"30&"30"30'"D$t$D$D$$7֋T$ Bl$l$l$$xl$ 0("4("$x (" ("x 0)" 4)"$x )" )"x 0*" 4*"$x *" *"x =0+" =4+"$x +" +"x 0," 4,"ȃx ," ,"x 0-" 4-"x -" -"x 0." 4."x ." ."x 50/" 54/"x /" /"D$@P1(^_[]ÐS[ËD$1ɐȊt tT Tt t t4 uP1[ÐSV[ D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjRJqD$HPj &ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWF D$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPtD$0Pjt\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjptt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]#USWVd[$|D$<$`0"hjD$@PI DŽ$@D$V=%$@8$u H$@D$$@UV,ljD$P]qt;uHWPsWPruD$WPrD$UV蹟ljD$jPWq D$,u:|$$@PW#x$@L$,UV_D$l$0t$\$UV?D$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V+1$xUm$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-PQRc_h$DUt$@VJP j jW hjU} hj$Pf D$@hjPR D$<;$`u`d^_[]D$RWOD$tT$@PQhR譓l$ $ fffffSV[D$ h`rƉP)Ɖ^[ÐUSWV[l$0#jD$PUl thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,]kō*2"4$t$L$QWPjbVt2"L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃3t$ Wt$t$Pjbt$(V2"2"2" 2" jQPR ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQPS ;2"2"2" 2" jQP  Ƅ;2"jjt$ ^_[]fffffUSWVD[|$\w x2t$`tD$@jPVT NjD$@9t8txD^_[]x8"u tr׶D$ɶD$ 軶D$D$諶D$<D$8wD$X$2a$>WQjP艏0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ t$,QjP蓄3H3"$E09sQ +EH<9s9 +EP? EH9r"p pɊ E$D3"D$P\D3"$E09sQ +EH<9s9 +EP? EH9r%p pɋ$ EhHjD$LPg T$ |$;$u ĸ^_[]Ë$l USWV XvD$1/ 1\$tR\$ f9r1Ef9r1xf9r1,*  ؃f;|$ r1$D$l$U$D$U$D$ U$D$U$D$U$ D$$Un$(D$,UN$0D$4U.$8D$<U $@D$DW$DD$D rٽW$D$ rӽWv$D$ rӽW6$ D$ rӃ ^_[]ÐUSWV׋t$3),3 31),3 31),3 3 1),3 31),3 31),3 31),3 31),3 3 1),3 3$1),3 3(1),3 3,1),3 301),3 341),3 381),3 3<1),3 3@13D^_[]ffffffUSWV[$D$$$U$jD$PUU u1D5t<$t tD$tPl$+4$$W|$|W胞 jt$Wt VUWi l$U<$W$UH t$Vt$U6 W$U# $Ul$xWަ~*4$PWU F~|DŽ$DŽ$DŽ$DŽ$<$t1$!j$U葝 v ƨtjWƃ3"$fǃ3"$13"D$3"Pt$Q  jxPl$UD VW1ҍl$?4$$U UVƥT$iȓ$T$) L$i<@U5D$uj$P4$$Up +t$D$fǍl$tt$t$UND$ fƍ$t4$$U+D$  jVD$3"<4"$$ $ jQP <4"<4"$$ $ jQPk <4"<4"$$ $ jQP. <4"<4"$$ $ jQP <4"<4"$$ $ jQP <4"<4"$jQP <4"H<4"@jjVA D$;$uD$^_[]KfffffUSWV[U$ $$D$$AO$W|oVUWo W$$l$ UqD$\6666D$`6666D$d6666D$h6666D$l6666D$p6666D$t6666D$x6666D$|6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666DŽ$6666D$|6666D$x6666D$t6666D$p6666D$l6666D$h6666D$d6666D$`6666D$\6666D$\\\\D$ \\\\D$$\\\\D$(\\\\D$,\\\\D$0\\\\D$4\\\\D$8\\\\D$<\\\\D$@\\\\D$D\\\\D$H\\\\D$L\\\\D$P\\\\D$T\\\\D$X\\\\t{E6L$\4\D$tdF$tB$ڹD 0D \0D D 0D ]0D  u$t D 0D \0D $VlD$\j@PVl $$Vl VW(nV_lD$j@PVl jWVl VWmD$;$u ^_[]fffUSWVP[Ú|$l$t.jPU{ Ƌ$9t8t"b\1^_[]@\8"u t7ސUSWVPXL$ |$t$Q̓t2$1ې?9u)ދ$r`??V ?V?V^_[]ÐUSWVPXJL$ |$t$Q̓t2$1ې?9u)ދ$r`??V ?V?V^_[]fVY~T$ t$tt1ut ^Åt^Åt^Í^Í^Í^ÐUSWV,[t$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[8l$|BUƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP+ $tL$tA$D$PW$5t!UV W$  UV 1V H^_[]ÐS[þjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[njjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Ρjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[~jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[.jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[ؠl$hUEƉD$ D$PRljD$VCD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$Ct$ 7U.T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[>jt$t$t$@[ÐS[jt$t$t$[ÐS[ޝjt$t$t$[ÐS[îjt$ [ÐS[Îjt$ h[ÐS[njt$ H[ÐUSWV[Ht$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[ht$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Èt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wÍÐUSWV [x|$(l$$t$ D$4q?D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[ޙD$ hPt$K [ÐS[îht$t$! [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[8mD$pML$LjPt$lv D$h|$df$D$VL$)L$D$PVW D$ |$$v=D$t$.D$lp8L$ QjjVV|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>VnV|$)Ƌ $PD$2PL$Q+  $ $,t=D$D$lp(t$ jjt$>VV|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VV;|$)v#Ƌ $PD$2PL$QU sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7L$R)уtuÐWVt$  r!̐cw^_fffffSWV[Üft$|$G@hjP kj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[ud$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjVw h$$VVhVU< hV1;$u Ą^_[]輹USWV [bl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_^a$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$kL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQe $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]ffffffVT$tz tz$t Jt9t^þqwA BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[xO|$ G$xom9}dMST$ x0} $-$tуM8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGG,H tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[ûMD$81|$ 8l$tsEE tl}$t|hju(Ѓ twNjt$hjP }/G8G4?VUtGWu(U$E4-|E E(}$uM$v1^_[]ÐS[Lt$t$jt$[ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]L$D$l'~ '~$x'^m'93e'KS'|$~ L"T$4"|$4ߍC??u @?@?D$V^G<$G@D$GD$,4D$\GpD$L$D$D$D$ GXD$XGtD$TD$PG\D$`$@D$dD$ T$D$\$(\$8|$T$l$$#DnB E L$  $ɋ\$#Qt$>L$ y#t$V$t$ӋL$ uL$ Z $#T$2t$Y $#T$B$T$\$ËD$ T$ L$ $\$L$ \$5B$L$ |$ $"L$L$ X\$T$T$ ōA|$"ˋ|$WET$WK"|$WET$OY|$T$",$L$AL$\$Ël$$L$5\$ ـl$ $!T$2t$s "$T$rt$ލKw,!$T$rt$ލK T$$ L$ Q$W!T$2t$Y $!T$B$T$\$ÃD$ T$ J`BlL$9ȋ $\$ S $L$L\$ ׺)¹)t3L$|$l$$\$;D$rZL $ӋT$(CDL$4L$4T$(CH?L$ B JD$|$ \$ $Qt$>L$ AY $t$~D$ H@ $t$~D$ H ҋ|$t$V$t$ӃD$ J \$ D$L$ $\$VL$)L$  FlFF?1D$ |$L$FdVhD$H‰T$@9VPNX֋$D$t$|$;D$ r؉,$ыt$t$)ЃJL$ 9ȋ $s0t$>t$|$l$$;D$ rЉ $ыt$)ЅaL$TYrt$D$ |$`JL$ 9s(t$>t$|$;D$ r؉,$ыt$ t$)Ѓ1҉D$ |$l$$;D$@A΃t!|$T,_1fT}9u)ދ|$D$rfTXtfTXvfTXxsfTXzupl$D$D$ $L$L$#|$|$l$$\$;$r;L$$$FD$Q?\$,$͉ $Ct$ʿ $#|${H|$)t$$ډ|$D$ |$$D$L?L$(D$8)ȋZH)v;J0v't,/D$4)؉ӋRD׋L$(+B4)v B,)B8)B8ΉӋRD9֋L$(w9w)SD|$t,1L$4899uL$4T$)\$L$(|$ra1L$401\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$4\$L$(+L$L$(ڃ{Dt$L$ KL$H?$ 3\$Gl$$$T$$ً$T$\$ZuKL$ \$L$ \$T$D$$L$T$$$T$L$9D$BDBB?D$ $D$C?BDt\Ӌ$9wD$(9w΅Vt$t$fL}tT$;D$ $|$$b\$ w\$ { $T$L$L$ڋl$덉\$ LFL$Q?T$ B$t $L$t3B t-f\$hD$hjPD$40isL$$T$ \$,$6?11ۅL$ L$L$ $D$Ӊ\$D$PL$ ,$A|$ˋ|$WET$WKf|$WET$O|$T$}L$AL$\$Él$$T$D$wL$ApATA\AdDAtt$Pt$dt$TqhPj<D$ k FL$Q?T$ T$t$$|$$T$tmuez(uB(jjjq L$,fD$hL$hjQPqT$ L$,L$5?D$D$ rL$ J$tA0\$t i{=B t$$D$ T$b t$$L$ |$$L$(T$8)VL$Q L$tJtF\$L$4)ыD$x@t RQPpRQP`x L$AF0I L$\$tT$zt 1D$ L$(L$8D$T$#;JB1D$ L$(L$8D$L$O?zL$|$  $Qt$>L$ As~$t$~D$ Hw`&$t$~D$ Hw7ҋ|$t$V$t$ӃD$ t$$D$ t$$L$ |$$T$1D$3;Z *\$_FL$Q? \$JFL$Q?D$(D$8 L$l$$|$T$\$$B$tXBL$t/B t)\$hD$hjPD$40nL$$T$ \$,7?11ۋ$\$ $D$$\$\$Ӄs3\$|$A$L$AL$\$ D$D$$T$\$B$tT$ʉHP T$Bt0B t*D$fD$hD$hjPD$40mT$ L$,B8?B1۹D$D$$u"$B$L$ t@L$D$\$ $D$$\$ \$ӍPs3|$ \$D $D$PD$؋\$T$D$ T$$ZDJ$tY1D$uD$ L$>B L$t,f\$hD$hjPD$40lL$$T$ \$,1D$ 9?D$BBD $9wƅыz$tL$ \$YsCҋ|$_ t$V,$t$\$ӋL$ $l$$T$ t$$ً|$$l$$T$\$B u11ՉډˋL$, 9uY11ɉ|$L$ \$J$t A,A0jjj i L$,F0L$??T$ \$ T$FL$Q?|$ D$ D$G?$T$- D$H?<$L$(D$4F ND$$FD$BL$ #|$0D$D9rщD$0L$ oD$0t$,$ʋD$ ȈL$@D$Dɉ\$fD$<ȃ|$D$?D$D$ zjjjlT$ L$,F0D$??|$dzt+\$ ـD$\$ L$N?D$ L$ \$w: $`D$ D$ $L$L$L$ ӋT$L$؃BL$ t>tCuH\$t$L$\$ T$BG?$u8D$A?D$D?FD$Q?D$L$L$ \$L$ L$ *$T$B$T$D$؃ X$D$ $NL$Q?D$|$ڋ t$$NL$Q?D$ |$T$ x~|$$D$ ЋL$щL$$D$ D$ l$$|$T$UD$ L$<͉l$$D$ D$ l$$D$ ȉʋL$щL$$D$ D$ |$$$D$ |$$\$$ыL$щL$:D$ $D$ D$)D$ $L$@ˉ\$$D$ D$ l$$|$$T$d$D$ D$ |$$T$l$$=ًD$ 1\$P?L$D$ t$$D$ D$ l$$$T$|$L$ \D$4F D$(FD$$FD$B?t ^>?u(jjjRb t$WPDb ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[ L$(D$y y$Q9 $JsD$(xu$z@VS?t$u$plL$( $BS?zUP4)r*9w $с4JPMT)с4JT$Mp) 4Bpt$tu0u8V辤T$ r8W1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$t+D$PtD$ff|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,t‰ЉT$P9rD$L$hT$Z)|$)|$L|$|$@)|$)|$D|$|$H)|$)|$d|$ |$\)m|$")^|$X|$$|$<)G|$&)8|$8|$(|$`)!|$*)|$ |$,|$4))$D$0t L$0 $fD$nf\$pL$LfT$rD$@fL$tL$DfD$vD$HfL$xL$dfD$zD$\fL$|L$XfD$~D$<f$L$8f$D$`f$L$ f$D$4f$f$$t-1upt!LEtTLlzf|Ll$fQ$L$D$<D$TD$8D$4 ك19tTEt|Tl_f\Tl$$fzTEt|Tl_f\Tl$P$f~뤸|$ 0D$<D$oL$4oD$8D$TD$0>|$ D$0D$<D$ToL$4oD$8D$TL$(D$TD$8D$4D$<D$0FD$`ʋ$D$XD$@D$D1T$\D$ D$d|$T$PL$@t$HЋ\$D)؉$$L$@?? u)D$(L$(É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃdžl$l$T$ y_V8Vt\$U%FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+}D$T$t01tI ^_Átփ*tWVZ-t$ t=~ t7~$t1Nt*91u&q~ǃ8w}T$1t ^_Át*tUSWV _ǸL$ y y$q9NQǃ8|$~|$$N9l$(4$Jى\$!4$f ؉\$V_AL$1)t,)9멁f*] ^_[]ÐUSWV[Øl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9z4&G,OL WDqL$ $t$ 1fj94$J)r=* jU L$T$4}Gl+G\Gt0GDOLfDHɃQjP8 1)t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$sT$,n$1 fti9,$tQTi)rftiTi)rftiTi)rftiTi)r뢋T$,LJL$IG|1USWV[8|$$ $w9>NQǃ8wHl$(e tWt?t u(t#IO5t*t#F(n(~taV<NG9wͅt2Uvw } o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj4 G0FqoUO;,$Eo9wŅt0UD$pw | o $ho)o)hu $AA~Nl$(9jjj, G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0% G0F FEh1҃ҍ,j1҃ҍB9 l$(@G; FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoUk8,$Eo9wŅt0UD$pw 5y o $ho)o)hu $AA~5 Nl$("|Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQx F NFy,t)vNPQw0# G0$F oUw7l$Eo9wŅt2UD$pw @x o D$ho)o)hu L$AA~> l$+,$V 19> $ $F@F N $UPQwL$ nnFx,t)vNUQw0*# G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0" G0oU\6,$Eo9wŅt0UD$pw &w o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0" G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0! G0oUC5,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0 G0FgFx,FH;N v[oUj4,$Eo9wŅt0UD$pw 4u o $ho)o)hu $AA~41O0Vhn G1NVjnjjj% G0FqoU3,$Eo9wŅt0UD$pw t o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(V~tu"~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQV54 $FlF\iU^2l$E$ыj9wŅUD$pq s $i D$hi)i)hL$AAxl$(Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV2 $FlF\iUH0l$E$ыj9wŅ(UD$pq q $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVwuF(uaV;/~l$(džMN\hF8`jjjV,uFFDNLfDHɃQjP dž~tuFlF\džoU-MG9wͅt3Urw T$ nT$ o joG)G)juJJl$(1NG0NVjnG1NVjnG2NVjnG3NVjnGNVjnG NVjnG NVjnG NVjneF(1^_[]øV$nUV$*FVjn G0NVjn$NVjnoUx,,$Eo9wŅt0UD$pw Bm o $ho)o)hu $AAF~؉F1~;l$(HN\F81Vl)jRPV- $FlF\iU+l$E$ыj9wŅt5UD$pq l $i D$hi)i)hu L$AAxl$(~1Vl)jRPV- $FlF\iU:+l$E$ыj9wŅt5UD$pq k $i D$hi)i)hu L$AAxl$(1F(WVZMt$ tR~ tL~$tFNt?91u;q~ǃ8w3D$T$t$|$A|1^_Át΃*tUSWVP_L$ ƃ9r\$ ƃΉ9ƹrt{ t{$t st9t9wʸrЃ^_[]Ë^kǃ8w6 $~1tGt&u81Ƀ~l<+*t΁uċ^ۉts{tt{q^0nPu1u,A ȉ9QN9w u$/,뛿kt }muk$t }mu{,f^S[t$ t$ 6[ÐUSWVX$l$,]M U,T$9wL$t$0KL$]|$*{T$)Ul+U\KT$ щʁr9w׉;|$|$s,…ր<4T$9&11 ‹$T$RjjU&EMTEMtЋMUD MUd unUJ'E~9wDžt)$Wuv h ~ }~)~)}uEEL$ tFD$9l$,w΋EM8M\$VQp g Ep )ppu\D$)l$,D$t$0|MQ $P+Ex )xxWD$t$+sM,9U~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUuElE\~WGn9wŅ$Uwv ^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUuuElE\~WGn9wŅt)$Uwv n] n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQU>mAlA\uVgF}9wDžt)$Wvu 5Y } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu W } ~})})~uFFD$(xy1)Ћ$jPQU+mAlA\uVTF}9wDžt)$Wvu "W } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XOÐUSWV^(L$4t;T$8\$0Ӄs3I͉у1&Ӊi913ƒT$4zR13ƒT$4zR13ƒl$4M1ʉ3xT$  1ϋL$ 3Ã1ؐ\=13\=139uЉЉ̉D$ ,׃}l$D$D$D$11|$ $333.3 $3Q333 $3A333D$ $3A 333|$D$ $3A33Љ3|$|$ $L$l$11D$D$333333W133333G1333ȋT$33W 1‰333\$33_1ˋT$ )333É3ϐÉ13W13W13W13W13W13W1Љ3O13RЃ^_[]ÐS[t$t$t$ [ÐUSWVXD$L$ \$  $),$9߿ʼnˉ$sRt҉L$1ځ 1Յt1Qu1^_[]ÐUSWVXD$L$ \$  $),$9߿ʼnˉ$sRt҉L$1ځ 1Յt1Qu1^_[]ÐSWVL$t9T$t$1ہ 1ޅt1_u11^_[ÐUSWVXD$T$(\$$ й$+,$9޾É$sMt։T$1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]ÐUSWVXD$T$(\$$ й$+,$9޾É$sMt։T$1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]fUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[>t$t$t$ [ÐUSWV[ D$ x_|$l$jhPt$(;T݉Ⱥqi)Ǎ)w B4vv 4v ^_[]ÐUSWV[;D$ x_|$l$jhPt$(kS݉Ⱥqi)Ǎ)w B4vv 4v ^_[]fffffXoÐÐX?T$J r ,ù)ы,ÐS[D$D$ P[ÐS[μt$ [ffXL$ T $ h, | 0 |8 fǁǁǁ &fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXȶD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV[N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$xP` Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tk |OWrw ~OWrwfLJLJ^_[]11fTfEf6f 'uUSWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1x\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +p)9~P fHpnh1pXkh (f  fыt$r t$t$ x|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +0)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX;\$T$L$o>o4>o>t>xfr x f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[ìt$xƅt|$7V?G sO ^_[ÐSV[]t$ )tt$PV?F1$O O^[ÐUSWV[t$ԯtLƋ|$$l$ $P>D$PWU1 1uN(Vu N(^_[]ÐUSWV[{|$GtE/D(U8]wUzt#V譡=yarau D$0VSN1^_[]ÐUSWV[|$GtE/D(U\wUt#V-=tcidu D$0VӞM1^_[]ÐUSWV[{L$A1t3)D(U6\NjD$pUtt D$82M0^_[]ÐUSWV[l$M1tMuD1V[uVt(WJ=yarauD$8L W1^_[]ÐUSWV[ël$M1tMuD1Ve[uVt(Wڟ=tciduD$8UL W{1^_[]ÐSWV[9Pt$ t$ n. t6D$t7<$D8WZt$W!tD$ 01KK^_[SWV[ùPt$ t$ - tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"KKVq9K^_[ÐSWV[Pt$ t$ N- tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"JVћJ^_[ÐS[~L$T$ jt$t$ [ÐUSWV[FQƋl$$P;:D$PUWW, tgV&D$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6I 4I8Vu 댅t D$ 01oI^_[]ÐS[NL$T$ htcidt$t$ [ffSV[t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[˓t$t$#_P=loobul$VEloob^_[]ÐSVP[lD$Pt&Pt$t$` D$VbD$1^[ÐSVP[t$t$Vt$t$` D$VD$1^[ÐSV[͒t$t$t$!^VP8^[ÐSV[Ýt$t$t$]VP9^[ÐSV[mt$t$t$]VPg9^[ÐSV[=t$t$t$]VP9^[ÐSV[ t$t$t$a]VP':^[ÐSV[ݑt$t$t$1]VP7:^[ÐSV[ít$t$t$]VP:^[ÐSV[}t$t$t$\VP:^[ÐSV[Mt$t$t$\VPW;^[ÐSV[t$t$t$q\VP;^[ÐSV[t$t$t$A\VP;^[ÐSV[ýt$t$t$\VP<^[ÐSV[Ít$t$t$[VPw<^[ÐSV[]t$t$t$[VP<^[ÐSV[-t$t$t$[VP<^[ÐSV[t$t$t$Q[VP<^[ÐSV[͏t$t$t$![VP=^[ÐSV[Ýt$t$t$ZVPg=^[ÐSV[mt$t$t$ZVP=^[ÐSV[=t$t$t$ZVP=^[ÐSVP[ D$QP0t&Pt$t$\ D$VD$1^[ÐSVP[ìD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[LD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[D$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[Ìt$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[,D$QP.t&Pt$t$Z D$VD$1^[ÐSVP[̌D$QP.t&Pt$t$IZ D$V輒D$1^[ÐSVP[lD$QP0.t&Pt$t$Y D$V\D$1^[ÐSVP[ D$QP-t&Pt$t$Y D$VD$1^[ÐSVP[ìt$t$t-t&Pt$t$-Y D$V蠑D$1^[ÐSVP[LD$jP.t&Pt$t$X D$V@D$1^[ÐSVP[D$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[Ìjt$.t&Pt$t$X D$V肐D$1^[ÐSVP[<jt$-t&Pt$t$W D$V2D$1^[ÐSVP[t$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[Ìjt$-t&Pt$t$W D$V肏D$1^[ÐSVP[<D$jP,t&Pt$t$V D$V0D$1^[ÐSVP[܈D$jPT,t&Pt$t$]V D$VЎD$1^[ÐSVP[|jt$+t&Pt$t$U D$VrD$1^[ÐSVP[,t$t$+t&Pt$t$U D$V D$1^[ÐSV[͇t$t$%SP=gntsuVj!t L$1^[ÐSVP[|t$Ht&Pt$t$U D$VtD$1^[ÐSVP[,t$t&Pt$t$T D$V$D$1^[ÐSWV[܆t$t$4RP)=atadu,VImt|$L$tVl1^_[ÐSVP[lt$t$tkt&Pt$t$S D$V`D$1^[ÐSVP[ t$t$jt&Pt$t$S D$VD$1^[ÐUSWV[ët$t$QP=gntsu?VŃUt$UPVi t D$8 Wo1^_[]ÐSV[-t$t$PPz=gntsuVt L$1^[ÐSVP[܄t$t&Pt$t$aR D$VԊD$1^[ÐSVP[Ìt$xt&Pt$t$R D$V脊D$1^[fUSWV[;t$t${P舌=loobul$VbtEloob^_[]ÐSVP[܃D$Pvst&Pt$t${ D$V҉D$1^[ÐSVP[Ìt$t$Vt$t$k{ D$V莉D$1^[ÐSVP[<D$Prt"Pt$|D$V6D$1^[ÐSVP[t$t Vt$|D$VD$1^[ÐSV[ít$t$t$zVP(^[ÐSV[}t$t$t$yVP(^[ÐSV[Mt$t$t$yVPG)^[ÐSV[t$t$t$yVP)^[ÐSV[t$t$t$QyVP*^[ÐSV[ýt$t$t$!yVP*^[ÐSV[Ít$t$t$xVPw*^[ÐSV[]t$t$t$xVP*^[ÐSV[-t$t$t$xVP7+^[ÐSV[t$t$t$axVP+^[ÐSV[̀t$t$t$1xVP+^[ÐSV[Ýt$t$t$xVP+^[ÐSV[mt$t$t$wVPW,^[ÐSV[=t$t$t$wVP,^[ÐSV[ t$t$t$qwVP,^[ÐSV[t$t$t$AwVP,^[ÐSV[ít$t$t$wVP,^[ÐSV[}t$t$t$vVPG-^[ÐSV[Mt$t$t$vVP-^[ÐSV[t$t$t$vVP-^[ÐSVP[~D$QP t&Pt$t$v D$V܄D$1^[ÐSVP[Ì~D$QPP t"Pt$xD$V耄D$1^[ÐSVP[,~D$QPt&Pt$t$u D$VD$1^[ÐSVP[}D$QPt"Pt$]wD$VD$1^[ÐSVP[l}D$QP1t&Pt$t$:u D$V]D$1^[ÐSVP[ }D$QPt"Pt$vD$VD$1^[SVP[ü|D$QPt&Pt$t$t D$V譂D$1^[ÐSVP[\|D$QP!t"Pt$uD$VQD$1^[SVP[ |t$t$t&Pt$t$s D$VD$1^[ÐSVP[ì{t$t$tt"Pt$AuD$V褁D$1^[ÐSVP[\{D$QP!t&Pt$t$*s D$VMD$1^[ÐSVP[zD$QPt"Pt$tD$VD$1^[SVP[ìzD$QPpt&Pt$t$yr D$V蜀D$1^[ÐSVP[LzD$QPt"Pt$sD$V@D$1^[ÐSVP[yD$QPt&Pt$t$q D$VD$1^[ÐSVP[ÌyD$QPPt"Pt$sD$VD$1^[ÐSVP[,yD$QPt&Pt$t$p D$VD$1^[ÐSVP[xD$QPt"Pt$^rD$V~D$1^[SVP[|xt$t$Dt&Pt$t$Mp D$Vp~D$1^[ÐSVP[xt$t$t"Pt$qD$V~D$1^[ÐSVP[wD$jPDt&Pt$t$o D$V}D$1^[ÐSVP[lwD$jPt"Pt$qD$Vd}D$1^[ÐSVP[wD$jPt&Pt$t$n D$V}D$1^[ÐSVP[üvD$jP4t"Pt$QpD$V|D$1^[ÐSVP[lvjt$t&Pt$t$?n D$Vb|D$1^[ÐSVP[vjt$t"Pt$oD$V|D$1^[ÐSVP[ujt$Ft&Pt$t$m D$V{D$1^[ÐSVP[|ujt$t"Pt$oD$Vv{D$1^[ÐSVP[,ut$t$t&Pt$t$l D$V {D$1^[ÐSVP[tt$t$Dt"Pt$anD$VzD$1^[ÐSVP[|tjt$t&Pt$t$Ol D$VrzD$1^[ÐSVP[,tjt$t"Pt$mD$V&zD$1^[ÐSVP[sD$jPTt&Pt$t$k D$VyD$1^[ÐSVP[|sD$jPt"Pt$mD$VtyD$1^[ÐSVP[,sD$jPt&Pt$t$j D$V yD$1^[ÐSVP[rD$jPDt"Pt$alD$VxD$1^[ÐSVP[|rjt$t&Pt$t$Oj D$VrxD$1^[ÐSVP[,rjt$t"Pt$kD$V&xD$1^[ÐSVP[qt$t$Tt&Pt$t$i D$VwD$1^[ÐSVP[|qt$t$t"Pt$kD$VtwD$1^[ÐSV[-qt$t$hPzy=gntsuV t L$1^[ÐSVP[pt$t&Pt$t$h D$VvD$1^[ÐSVP[Ìpt$Xt"Pt$%jD$VvD$1^[ÐSVP[ZL$1t91t^1^ËAQ^ÐSVPYYD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYlYD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYXD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYLXD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YWD$t9u@H@ty1ËT$ BÐSVPY|WD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYVD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY\VD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYUD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y?UD$t9u@H@ty1ËT$ BÐSVPYTD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY|TD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYSD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYSD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX/ST$t9uBJBuy1ËT$JÐSVYRD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYRD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY RD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY}QD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXQT$t9uBJBuy1ËT$JÐS[PD$t9u L$ t9t1[QP*Y[ÐVYPD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYNPD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYOD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYOD$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [SOu t1D$D$ D$~N~(DN+t 0tV-usD$WPv% T$ D$1ɿ98"yxuD$j\D$WPvK% T$ D$D$9T$rF=8"u<3WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[îMl4"jP5q4"PQ_1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ÍLD$04"VPV蓯1^[ÐUSWV [HLt$4NswD$8t1@tQ@uppQj WWjUVEZ tWVWWt UVI[1 ^_[]ÍpPQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[>KLPQql4"Pn[ÐS[Jl4"Pn[fD$w sÐS[îJD$ ;D$uPt$t$k{ [1[ÐUSWV[hJD$ t$tPkD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPy 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔(Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Íw8PQhR3USWV ]ŨGD$ \$$p1}<"$N<\u< $1ۃރST$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ8PQhR USWV0[uC$Du w@j011<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} wԧ$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p D$D$Ews 搐<<}jt$W) tfjt$W tSjPW E $AEtLt@<-Eu<-u}>u$h\t u94$螢10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$UD$m$hōD$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$ħ$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[<jt$ [ÐUSWV[;$j$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjUYtjVU_^ |$t'jjjhjt$P角|$t-$U~jWU^ WUkTVUkCS[þ:jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[M9j@ƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[8t3Pj"tjj@UDžuUɛOj@:1t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[(8t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[5|$oU[1tIp9u?$jj t,HWs;~$9uG+D$t9u L$ t9t1[QP3[ÐS[*jt$ <[ÐUSWV[*l$}t^_[]j@b}tƋ|$pPV^0jPOF,F0F4F8F<}(t7h|tL$7PUrV`0bUSWV ։L$[*|$ *?u-wG"}MG]jjWU -#jPwwt,ut$$轌ejPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'ejPWX t4jjWG t#jt$(P6t$>t1t$$豋U. ^_[]Í!(PQhRS[>(Pt$ [ÐS[(jt$t$T; [ÐS['Pt$ [ÐUSWV[ë't$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct((PQhjRwQGP5LW 1^_[]É.k(PQhhR((PQhyR ,(PQhRS[^&L$A4tPQ4I,Dt*Pa,[Í_?(PQhR,?(PQhRnUSWV,[%D$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jj葁tt$ At$DVL$*L$ql$$9.|$F(PQh!R-{>(PQh7RSV[} t$D$ PEVE^[ÐS[> ܟPQF4"PC[ÐS[4"PC[ÐS[4"jPeC4"PQ菐1[ÐS[ÞD$L$ PQ^[ÐS[nD$ t$P2[ÐUSWV[;l$}tQp97uGWbDEtS90uOH<1;M uM;H4w\t @,4ȃMW.D^_[]Í(PQhR5(PQhR(PQhRSWV[l|$wVCGt$p9uG@WUP j>mDžt!PW> Gwo 1^_[]ÐUSWV[Xl$19}EuBM1tDm $t: $Ult^Ut$D$PJ U;1$D$jnlt"WPt$ED$E E^_[]ÐZL$1t 9tËA ÐZ_L$1t 9tËAÐSV[-T$ t19 uL$t r ;t$v1^[ËR1ttVRQC ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDU4kt؉Ut$P֠ ątkPQhRkPQhRZL$1t 9tËAÐS[D$t9u L$ t9t1[QP: [ÐSV[íL$ t 9t1^[ËT$19Q ut$tRVqNH ֐USWV [Xt$(>t~(t  ^_[]ËF=jQvPgt҃~$tD$jPv p ʼn$u 8"tD$N N$9u8"t=kPQhR'1jPj N,$U*i7ǍFPD$PU tcD$;$uZFUjPV tD|$u WZy1,$jhƅt-PVF~n Wyt W yD$$0USWV[y1D$4$G=w XՍPjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[D$0FuFt PvVv1^[ÐUSWV[èl$(Ewd|$, .jD$PU! 8Gw t$OL$oD$PPt$,VD$L$?PPVD$?PPVqp?PPVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$PPl$,UD$0 ;PPUZtsL$=tD$PPU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í(kPQjtRzSV[L$t$ 9t8V 1;Q u.FtRqPA 1uyu"^[ÍQ?kPQhRy?kPQhRؾffffSV[M|PQ6|$ u4"4"V^[ÐSV[t$ 1t9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[nD$t9u L$ t9t1[QP[ÐSWV[,t$~uo~(tijPvvMt4"!jPvv*t14"|$|PQf5V7^_[ÍPQhRSV[}4"VPƃ4"4"VPƃ4"1^[Ð1ÐS[D$L$ yt0@QP`[ÐVZ L$1t91u T$ t92t^19^ffffSWV[Ü j@4`ƅtEPWV4>jP2F,F0F4F8F<^_[ÐUSWVP[( t3Pjqitrj@_DžuUpWj@_1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[h |$1tvP9uloU1O4ƅtIl$44$t*1G,D$tP9u L$ t9t1[QP [ÐS[jt$ [ÐUSWV[l$}t^_[]Ët$j@^VtdǍPVP^ 7t$jP(G,G0G4G8G<>}(uL$UxUSWVP[**։ $|$?uwG8]u<GcjjWr tCFjPwwt,t1jjPUt$t1U^_[]Í"!TPQhRRS[^pPt$ þ[ÐS[.jt$t$t [ÐS[pPt$ [ÐUSWV[t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t% TPQjmR迯QfdGP}&WQd1^_[]É.TPQjkRsTPQj|RWS[D$H4tH4[Í TPQhRUSWV[ÈD$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jjB\t\,AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð#I#PQhRŠSWV[<t$~ t 1j Vt ;~ r^_[ÐSWV[|$t$t0t*PVtuj Vm^_[1SWV[Üt$F|$uLPVujVm1^_[Í$I#PQh$RSWV[|t$F|$uEPVtiu]jV}1^_[Í<$I#PQhERUSWV[Ët$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]ÍX$I#PQhdR補USWVP[D$1ɅQh Dt$7j@1Ƀ#hq@$GGG wtHt$WՃj W=tjW$$<~$PWtiu千%PQWq tDj Wt5D$h VPW`tj WZ7OWO $ȃ^_[]ÐUSWV [Õ$($$WtEP舑x=ŋ$$t$t`?t[Wet.H|/t+1]$,9/;9sfD$ .t$ VH r̠?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ 8t$h t U 8ܟ8VN̟8$ ^_[]É,$9tG9t iy/t)rD$ UWPr D, ,$S[^jt$t$ [ÐS[jt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jD<tUhxL$ H L$$H*s3uFˉ,|\T ^_[]1%o%1%PQjAR螗%o%1%PQjBR肗USWV[T$t]D$ |$L$tKutUtMtM L$$tEUKL1Ht t L t L |$$t L2 ^_[]Í%%1%PQjZR蘖ffffUSWV[D$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PHRl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$[fffffS[Þt$t$jt$t$t$8>[fS[nt$t$jt$t$t$(>[fYXZQ̀QQrS[3t[fffffffS[t$t$t$t$[ffffS[t$t$t$r? [ffffffS[î1;D$[ÐS[~1;D$I[S[^88t j衏1[ÐS[.88t jq1[ÐS[88t jA1[ÐS[88t j1[ÐS[Þ88t j1[ÐS[n88t j豎1[ÐS[>88t j聎1[ÐS[88t jQ1[ÐS[88t j!1[ÐS[î88t j1[ÐUSWVX{4"?) R44"ѐ>t1 @u~1ɍ4">t 9u#;T$t$RwffffUSWV[e$ÁL$(s_L$, L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$L$(+t$0QUjRV/3?Utq0$l$T+jP141ɅjWjjWj聂 jUjt }|$T l$TjVt$ T u'8t$jWj jUj jD$pPjC $ȁ^_[]S[L$T$ hPt$ [ÐUSWV(T$ [âL$<\$%t$@|$t;D$<|$"v+f1t$ \$VP]n\$u<+t<-t D$1 1ҊD$L$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj=S[NL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[t3T$8tOl$@to*VPt$DR*t*f*+*PQhRs멍*f*Ս+*PQhRs뉍*f*+*PQhRsT$HkXODH@uyD$ j PW $T$x8"u,x"x0@EPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)*WVPQt$H蛎11҃^_[]Ë$T$|$(9ыl$,}*|$09Njl$4}*UWRPVQt$Tt$TD 맋L$8fffYimNA90%ÐXL$ffffUSWV0Xx$t$DL$H|$PL$%1|$L$WD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$G T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ 1$cp0^_[]Ë$c+W++PQhR^j$q+W++PQhR4jL$XUSWV0X$L$Ht$DL$1|$L$WP D$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU@ T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U"1$i0^_[]Ë$c+W++PQhRcL$XffUSWV<[Øl$X|$Tb D$\}  |$T  D$u D$4tǃ$ǃ(T$PT$$9L$$pT$,mT$0\$|$ <$D$(\$(ǃ$|$ l$XL$1L$u HD$4;L$$D$T4 >-u FD$, t$0E<+<-~(L$ $XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő(

 $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VgRD$\(pD$D$ 1T$ $ $.T$tf\$QURS uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:RQP" \$(+$L$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tRQP蠆 1L$\|1uD1 <-t<+::BtD8tD$X8:tORPA?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:t-RP莅1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8p D8t}:ty4$P $E<-t<+u:}:1<: :+++PQh_R-Yw+++PQh`RYD$l]+++PQhaRX|$T;+++PQhRX+++PQhRX+++PQhRZXn+++PQhR3XfffffUSWV[T$t$7"ǃ7"0;D$}? 9-u7y4I7"t8--?0p4^_[]Íp4j-R(tǃ7"--+V,׍ ,PQjRR-W(^,V,׍ ,PQjSRW7"447"::tlQR'tXx:?u'1x:t0H0;L$|鉻7"p40T$?u0?,::Zk,UPQRDwǃ7"?tq0cp4:D$8:E?,3Z,fffffSV[mt$ tj jV0 ^[Íy,,PQj/R^UffffSV[t$ tjVP^[Í --,PQj/RUfffffUSWV[˥t$l$tyjj 1trj;tkNjD$oGG E ] \<[PjQRjWtKjPj .Z1^_[]Z8l$u9EY8Y(W|$7 Y(릐USWVP[út$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ U E $}E T$)9w΋MVRP, E E MU9r‰^_[]ÐUSWV[T$L$t$ D$t0tUyy{-l-.-PQhRRpxA)9}8yXTi t?-l-.-PQhRQx3rH HPp 9r@ 1^_[]X䐐S[t$1[fS[΢Xt$ t$ P w [ÐS[ÞXt$t$t$P[fUSWV[kl$|$t$t1UPWVN0^_[]Í--PQj4RJQŐSV[ t$ tjjjV/^[Í--PQjARPfffSWV[ü|$t$t1hPWV/^_[Í.-PQj6RPfffSV[]t$ tjjjjVܐt^[ÍW.O..PQj0RDPfffffffS[t$j t$t$P[fffffUSWV[ˠt$|$tBjW/~G0t ujW0^_[]Í.d.PQj/RO띐USWV[Kt$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H T1^_[]ÐUSWV[ȟj`1L$,l$(D$$t$ T$wGo Ouu u&t,t+$\atatڍauft?$L$ut: $fH f@xp$L$H,h(@DaH SW1^_[]ÐS[ޞL$ D$T$rRQ0P [ÐUSWV[Û|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[>D$t$t$t$0P [ÐSWV[ D$8pPtWփ1^_[ffffffUSWV[˝T$l$t\tE0~-},t xr }$t jr2Uڮ1Ƀ^_[]Í.֍.PQj;RjLu..֍.PQjD$.D$D$ t$5x9L~8000P>FFHANF )PQj,,^[ÐXOL$x9L~8Í0Í00fffffffUSWV8[L$Xl$Pt$LD$4ut |$Tu0VP?0VPr?%1VPZ?L1VPB?o1VP*?{1VP?1VP>1VP>1VP>t2VP>f42VP>XW2VP>Jb2VPj>92VPR>2VP:>q2VP">` 3VP >O` t9uuh/l$t'j2pU0 0QP { t00G0PQhRPEL$h@F00G0PQhRE l$rPQj2UbU:ƋD$XtPUt$\ ;D$4u 8^_[]YffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[||$t$t2F)F31uF FF^_[Í33N3PQjYRGC뭐SWV[ |$t$tg~uP\$wGN Qt33N3PQhR.B~uр~|$^[ÐSV[͒t$ t ~t/F33N3PQhRA~uN .wu^[ÐSV[]t$ t41~t^[ÊV u.wL$~9|ԍ33N3PQhR'A먐SV[t$ t~t0^[Í33N3PQhR@~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[L|$t$t@1u6T$L$9w"QjVRB FfFF^_[Í34N3PQh.R@뜐SWV[̐t$t>~u/L$Fy |y|9IL |F1^_[Í3"4N3PQhMR?랐USWV[Ht$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍD414N3PQhhRQ>O414N3PQhiR'>SV[ݎt$ t"~uDNu;V9r1-3[4N3PQhR=~t^[ÐSV[mt$ t31~u(NuV9rT$x 9v ^[Í3o4N3PQhR8=fSV[t$ 9y ^[Í444PQjTR<אUSWV[ët$|$t.l$tGMϸwG)o >1^_[]Í344PQjbRz<뱍444PQjcRY<또USWV X$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ=D$0 28t p׾$VPU 7+D$p)t5u+VQA$RjP= 7D$)smH1 ^_[]Ë$34֍4PQhR:D$4$54֍4PQhR:g$"5΍44PQhRa:D$a$6L$5Ս4PQhR+:L$USWV[؊l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQy; D$ }+$x)t6u,WQARjP,; l$}<$)s8O^_[]Í3F5֍4PQhR8"5͍F54PQhR8렍6L$5Ս4PQhRv8L$;SWV[,t$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú93Z54PQhRz76m5Z54PQhRP7)뒐SWV[ t$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[13{54PQhWR76m5{54PQhXR 6VL$t"T$ tփuQ^ÐUSWVP[Ê|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP 7 D$$L$(l$0O}^_[]Í55$4PQhR4T$L$8D$4VU55Ս4PQhRo4\SWV[,|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[ìt$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Ø|$$D$(t9D$ L$,ň̍5L$5L$4 $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[Ìt$|$D$VPt$  ^_[ffffffS[Njjt$t$t$t$[ffS[jt$ t$ t$ t$ t$ t$ [ÐUSWV[ՁD$$$$$ $$$fZt$pPQj VMD$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6)t&6P(EPVQ[ D$@t%7"hPV $0$$ڕ7/PQ#tO9xuJqP$ $$6`L$U$$$t$ (D$;$?Ĕ^_[]Í^66,6PQjiR.$l66,6PQjjR.$|66,6PQjkR.6,6PQjlRs.ƍl68,6PQhzRJ.D$|68,6PQh{R.D$(ƍ8,6PQh|R-z8$T$@PhQRWC<$D$Pjjj:tD$PjjjxkD$Exit$蓜t t$ 胜jjW&| t$88WPQX 88 88PQt$ jt$xjjy88PQej 1t$›ujjx*jt$~xt$莛t$ 肛y89u^$puS*P$0#uP$$#u6$@$8jA0$89pQRj/VtDžtwjPQ ę$t$u5WWj$$2$PQWV ^j$$1$PWVf8+j/Vts_j$PQV,8&9VPQ j+/USWVh[c{E$dL$$|$$t$.D$LD$PD$TD$HL$8D$HQPj l$$D$ 7D$$D$ D$l$%7PymjuD$PQ Džx|$ ]$$juD$P D$jPRrt$t$X4$PjVDVPVWn V9a|$(fD$,t$t$0fD$4F-D$(jjP肕 ~ D$64-8H8PpjPWؓ $l$$|VPVW诓 $VPVW葓 $VPVWs t$XjVW裔 u2|$X;jVW臔 u+jVj5 |$X uL$1P'<$$0|(8Pt$D$PD$dPVl VA$(D$a<t<jjD$`Pjjt$(D$xPbuD$XP%=8P"Ql$<$7`8PQV誔l$W蝔D$8jPjg E;$d-h^_[]Í8P$먋D$p*07PVQRFl$y77,6PQhR$;^67,6PQhR$#Ǎl67,6PQhR_$|67,6PQhR6$7,6PQhR$S[tjt$ t$ t$ t$ t$ t$ [ÐUSWVH[ÈtD$D|$\,|$dND$l|$hfl$tt$`fƍZt$$PQj V@D$D$D$D$D$ l$D$ D$L$PQVt$h6^t#6PEPVQnN Tl$p $At"8"hPV D$\0t$\ $Ut$pt$pt$p4$s;D$DH^_[]Í^66,6PQhRK"|$dl66,6PQhR"ƍ|66,6PQhR!o6,6PQhR!XoSV[}rt$ tjjV` ^[Í66,6PQhRk!̐S[.rjt$t$ [ÐUSWV[q$E$$$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ ǸxVtuTfD$D$PWL,$D$f$%/,$$ffD$UD$PW  yQ%80uN$=uW%#,z%,$(Wߎg%(,$WƎ,$M;$u2Ĉ^_[]Í66,6PQh REHUSWV$[ol$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRVuT<$t6t$t4$$$WPVEP)$$PhQR$NK$@l$$hp V 7hPVq Y3D$$p C$p 0m$pPfPV=tbōD$ PV聝x\#D$=uXUTL$ QP&xED$$t $;Au=D${70=O&71C;7T7i79"U+WBt$Vl$E;$ļ^_[]$$$$U똍66,6PQhR ƍ66,6PQhRq66,6PQhRY[USWV[hkD$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[j$D$$D$hP1$S$k$$UhhWDD$ D$$GƄ4$$$UhhWDj W[t$X8D$1$0U t u뜐44 w$|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&Pص$@|$L$ t$֋$^D$PjL$Q$&PfD$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP觴+JtD$Hɋ$@tD$$L$Q$jPM؅$U$ 1$$׋$$Pu\~$P$' 1u7Yu,N$P$ t/t u $Uhh$$WA@11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύ77,6PQhR^67,6PQhR7n67,6PQhRV賻USWV[dD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[];USWV4Չ[AdD$$0qƃ9"9"Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/u9"[9PRQj,14$ D$;$0u4ȁ4^_[]Í6M9,6PQhRh^USWV0։[ab$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$P uo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1P; E;$,ue0^_[]Í629,6PQhR$T?929,6PQhRx肷fUSWV[Ø`|$,D$(/D$wl$GQjP G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=p݋t$|$<$$t$&$$1 $+L$ r#9΍99PQj`R1D$,H$$t$,F $)ʃr#999PQj}R F$)N)!r s.^_[]Í699PQjCR :9׍9PQhRa 몐USWV [^t$ ~Nƃ<>"V҉$t`L$FшT$?r?鍋="$j@UPQP\$+="~t0|$>L$:$u ="uL$>͍ >T$1ҍ<>"-9si$:07U;L$s>t 9sE.9r9s34$07h9s맋 $<>"9s$=" ^_[]fffffUSWV[û\t$|$lUl8PPWVGUL^_[]fSWV[l\t$ W!PPV- W^_[ffffUSWV[\t$tLD$F$V~nF=>"PUWRt$t$QjV&($^_[]Í}b:.:PQj3R 듐USWV[È[|$,L$T$ |$l$捃z:UWRQL$QVPt$H 1uA$L$O>"O>"P>"L$Q>"L$ R>"L$S>"L$T>"^_[]Íun:.:PQjBR [USWVH[øZl$`D$ D$D|$\SrE$MUu}m:UWVRQt$PjD$JP&$$Pf:PQ+jjjjP&qƍ 0VjjjjWpƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV'${D$L$ D$D$D$?D$D$@D$D$AD$"ffffffUSWV[ØSt$,l$(D$tjuj!ƅtRUP8K1 F LFuF ;D$u6^_[]1ꍃ=;5;;PQj4Rur辩USWVp[R$E$l D$P1Ahh@Vo 1lj,$t$\hVWo Ņ~UVD$ POA 50Wp%0,$xj$uj!诤ƅth$\L$QPI1\F LFuF E;$lu5p^_[]1㍃O;F;;PQjNRGUSWVl[XQ$D$h$U?$$U@ uj!詣ƅtXD$XUPH1LXF LFuF ;D$hu2l^_[]1ꍃf;];;PQjhRJQS[nPt$ t$ [ÐS[NPt$ t$ [ÐSV[-Pp;]>"jPVm D$ jVPjZ^[fD$ȉty!fUSWV[øOt$0l$,D$tjuj)4ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ=;;;PQjFR?urޥUSWV[N$ $$P'h@Vl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$k ƅ~.V$P$P |) u84$l8|$$uj)&ƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1ؤãS[Ljjjjt$t$[ÐUSWVt[èL$D$p$U$$U= uj)ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃf;;;PQhRG螢fffffffUSWV\[èK|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍtfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[ 4t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP謻 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWr ;D$u ^_[]sfffffL$$Yai qyD$A(tQS[Rjj#9 [1ÐT$D$ Zbj rz $z(t RPS[ØjRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj>8 [1ÐT$D$ Zbj rz $RPS[þjRj7 [Xt@ffffffSP[ÍD$ L$T$$RQPo[fffS[^jjt$jT7[fffffffS[.jt$t$jb|[ÐS[ht$t$j/|[fffffUSWV [t$ D$D$$|$jjUVjW1D$D$ $jjUPjW返D$D$$jjUPjW舔D$D$$jjUWjPOu8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRœ1u ^_[]ÃtOw OsҍH^ ="hVt$ t N81^_[ffUSWVh[3} pB"uj'N\pB"D$PjIpB"L$@B1lj1L$ED$$1Mt$ƉqD$PjxxpB"L$@B1lj1L$EHD$$1t$ƋEp jPwu(pB"L$@B1lj14$e^_[]Í=R=PQjHR%pB"USWV[l$zjPUw u @t tQUu=jPUPw t 1^_[]ÍujPV+w DžtjPVw 1uú!?E1u<-ut<+uXMDHt$}D$j PWb L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ~L$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[t$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVZ ^_[fffffffSWVP[;t$tBtB"PQhRjx>L$ $tB")QVWRtB"PQhR(tB"tJ"t@tJ"^_[fffUSWV[Ët$D$D$I@t NQw ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í===PQjbRUSWVX[8D$lD$ 8D$DD$@D$ǨPt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í===PQhtRSWV[|$t$t5$D$ WVjjjP1Ƀىȃ^_[Í^5>=PQj:R衶ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[Èt$(l$$.PT$(18D$8tTP) ukt4)puD$(8rl$ ugPt$Yŋ$t$b0?uD$8tTP(Wg4$&#t$#袹01UPt$ŋD$G6"oD$ G xJ"xJ"D$8tTP(G^_[]Íu>B>PQhRPu>B>PQhR&T$(# s_Á+jUPQRVjeUSWV׉L$[â2jeVj+Vt-1|$WjPj%eyFu<$|$1jrV聙t@P $UW`ft1jUu%07\!wQ!ٷ01^_[]ÐUSWV׉[÷xJ"tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8tTP%gt/D$08rL$ ubPt$ŋ$t$]耶0D$8tTP9%Wd4$t$A01UPt$葢ŋD$G6oD$ G xJ"xJ"D$8tTP$G^_[]Í|>B>PQhR|>B>PQhRůt$,|$(T$0VWU jUSWV[Xt$8$8tTP#xJ"t9ut>mt9uu+$8tTP#h1V蟤EuxJ"$8tTPy#|$jWu ƃu 膴8tUbtt$^_[]Í>>B>PQhRvfffffffUSWVH[(D$`|$\t$$UVPWaKtUVt$aǃu.ֳ8ujD~;$} VPaǍD$9tLVaA$jD$PZt&UPt$hWJ{D$$oH^_[]Éƍ>>>PQj>RafffUSWV4[D$\l$HSt$XoL$`uptȮuu֮t덻tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ tphL$ Vb 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$ɟŃ|$jt$ RU謟|$tUjt$ RP蕟|$t>jt$ RP~l$t%jt$ RPetjt$ RPPT$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQ臞щ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP1Ɖр|$ul$э2?4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0Lo0ŞL$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$nL$,T$$ Q=?4$Qt$(V0WRUt$hm$[4$|$2jjdQUыT$,t$$r2?4$Rt$(QPVt$dVt$d 9wijt$ QR脜щ9|$}T$ 4$T$\jt$ QROщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\ijt$ QR輛D$ ы4$T$\B*.>PQj8R辦D$l'?.>PQj9R薦mfffffffUSWV[E$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í@ύ|?J?PQhR}>USWV։[1$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ| D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í@?J?PQhR謡[??J?PQhR股4??J?PQhR[USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRV@uD$t @ t$?D$ h |$t$($YPXt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVP@)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPMt$FPMF^_[]Í??J?PQhR襙USWVYkT$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWV։[]F,F tv蚞FUPGl$~D$uNtQjP葚D$ L$$t$ F1퐐f$t=tsAuE @u1$P4-$hPQ> E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=Y??J?PQhERM lt$10蔐D$/ Njt$$E @D$uPPUu G8t E u;$6Ĥ^_[]ÉNjt$몍? @J?PQhR$? @J?PQhR|@ @J?PQhRӉ$c@ @J?PQhR襉O? @J?PQhR~7??J?PQhERWL$ ?#@J?PQh/R,L$0USWV[T$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍^΍J?PQhRІ-@΍J?PQhR襆T$89@΍J?PQhRsT$8ffUSWV[%$$c$$tu1D$$tŋD$3l$ vh@PD$(D$$D$ iL$L$\QPgtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPzPWuk uh(D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$@jPv u|$1D$Wt$/Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$@jPD$p -jPD$p D$ |$t$ztG$`L$tZ@jPq@jPD$p /1ҋ$t@jPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8݄< „Y1D$ D$l$t)蠄D$D$\PjuU |$~8|$ $%|$tHAjPu> |$t&?D$u|$"8|$ $tt$Dtu V\t$jl$ U 1$u U1;$uEČ^_[]Ë|$|$[|@@]@PQj_R}yQ%S[njhjt$t$t$[ÐSWV[<J"t-J"jhjVPt$$t8|J"0jF3J"|J"tP J"u^_[ffUSWV[û|$J"jjj J"l$J"tUQJ"ӟ J"t]1i J"9J"wHt Q_0 J"WJ"t$UWPx J"u 1T$ Ɖ^_[]Í@@@PQjAAPQjERy*ZA>AAPQjFRyffffUSWV [XeAP3pt\ƀ8tUT$D$j PV tŋT$t|zt)oAVP襤1ɿpkP&wA$@ʹ&/up@9~ $AjP,$AVPT$t$$D$ t AJ"RUPjQaL$ t>J" ^_[]ffSV[J"u*ǃJ"PfPV|J"ttJ"_ VP1^[ÐSV[mǃJ"J"tP9PfPVJ"u_ VP 1^[ÐUSWV [$ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"J"J"hhUD$ 1Ʌ$t$q N"?PQt$$q L$ ZQPt$ q xNt$ PV$Vt"BPVVu 1  8O"V7j:Pt$E^ t8O"l$ UPt$v tL$O"vUPt$v t D$O"UPt$gv t D$ O" UPt$Dv t D$O"tD$ PVt$o dt$ 8p]PVirh{PVGrFPV/r9PVr,{PVqPVq PVqPVqPVqPVq$PVoq*PVWq+PV?q/PV'qZPVqPVp.PVpHPVpSPVp5PVp SPVp;PVgpu aPVOpeX1DQXVVJUVt$s tD$1fN"5lptx|^BwBPQjhR6Zme/@BwBPQhRY6.&)fN"t$ UPt$@r tD$ O" O"O"UPt$r tD$ O"O"O"UPt$q ftL$f(O"FUPt$q ftL$f*O"ӯUPt$q 1tL$f,O"UPt$^q tL$f.O"qUPt$4q tL$0O"UPt$ q tt$4O"UPt$p tL$lO"UPt$p tt$pO"fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&tO"aD$ `|$4$L$ qL$%L$)L$-L$1L$ L$5D$ PWt$p tD$ UD$,Pt$o tD$FUD$0Pt$o 1ɃtL$Nt+D$PD$4Pt$o t D$1vF UD$(Pt$o tD$ 1L$ F L$ D$ PD$(Pt$iL$ L$ t$L$ B1PQwkt0EuዃX 1DJtVut$F t$  L$ L$ l$|$4]/@΍BwBPQhRUSD$ fjO"fD$4dxD$6D$50UWt$Mn 1tL$"T$T$W ЃU >6C|$D$ O:D$/D$  46"T$ T$ЃEt$ʀD$l AЍ~Ƀ 'w~N0rv:sqɍAAЍ~  'wNN0rF9wAɍAAЍ~  'wN0r9wɍAЃ='v1lMAD$ L$oEL$|$D$ O:D$/D$  4d"T$ T$Ѓt$T$ ʀD$ T$ w~AЍ~Ƀ nwVN0rN:sIɍAAЍ~  n0 N0T$ r9wɍAЃHmv1MAL$8t$D$ ;N:D$/D$ 4"T$T$Ѓ4|$Ѐ O:D$/D$ 4 "T$T$Ѓt$ʀD$ F:D$/D$  4 "T$T$ЃT$ ED$V1Pt$V D$V1D$Pt$VT 1ɿT$ ]D$IEt$1 \ЉD$8D$<Nt$ʀЀ ws119º !ɺ D$T$ы\$;L$ |FD$8t$ j\$SCjWP S\$WCjWP <\$D$ 0V!'D$PWV AD$ p\$V&D$PWV \$L$8|$D$L$8DHtXD$8\$P\$t?uF \$jPF$F(\$W\$|$y|$zn1 \$TiUB$J(-1 UB )iJ$\$hB(1UB \$1+1|$r$L$ B(D$t$D$L$ȃШ UJQi)1uB,i)\fиwi)\f1uN Vk4ȃ UD$(D$(uBL$D$JL$Bk<kQ)D$$kd)|$$< i)ƍv4A A$I2Ѝ4))΋|$(7$I7u э)ȃT$0 ))L$ȃFL$Ш<L$JQiҐL$)1uB,i)\fwi)\f1=‹E@k4<3Ǡʃ;D} Ur+3вBD$BJL$tRu΋JQi)1uB,i)\fиwi)\f1UJk4JȃB Jkʁkʁk4QkdkiҐсk I4HH$I2ȍ )ȍ 0uNʉ)ʉVD$4;$8uD$e^_[]Ë\$ ffffffUSWV[|t$,D$(X"H9ttkHpw  |$T$ H w ,(,$HP x(@D$US =*CfF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эCQPUt$Wt$$t$t$(R|$,WVfG,9s1=uClQUt$ WRt$t$$P|$(WV5G(9r1T/8^_[]ÐS[îzX"Pt$ s[ÐS,[{zPt$DDqDPQjIRH&USWV[ wl$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[Èvt$$|$(9jVPƿgLjVt$,# t$(<D$l$,L$ t-|$,RUT$rT$t .l$(RRl$(T$tX$|$  tQpT$ <$EFt PF tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PV|^_[]Í0EEPQjKR[?eEEEPQjMR0?efffffffSWV[kt$W葏X"PVpWx^_[ÐSV[ÝkVVX"PpV>^[ÐSWV[\kWX"X"PQpW^_[fffffUSWV[ kt$l$Vv]Vt$Z^1u<$Vt$2^DžtpU7t]wtуUPYt u막t$~utQ^_[]É1ԍ^MFFPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsFFFPQhRFF֍FPQhRUSWV [X`L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwzTtM׊D$L$uD$ `l$ s+D$tD$uc:t)2FFPQhR_' ^_[]Ël$ u렍΍FFPQhR΍FFPQhR S[Þ^t$t$jt$ [ÐS[n^jt$jt$[ÐS[>^jt$t$t$[fffffUSWV[ ^0Y"|$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉ4Y"uj(9ƉDl$Uܠtwn$Nj 0Q輼 1HY"utjh=蜹ʼn0Y"0ƃHY"LؠtMjу4Y"@1t*n$FUQj PA)|$z^_[]Ë4Y")USWV[Û\8Y"|$i)Njtt+~%L$9N$ut1Ƀ|$tΉ3i=)Nj$,tu~EPt$t04Y"tuR:ؠt!jу4Y"tiE$S4Y"uj(Zŋ$,tIEj |$WP WtE@E$L$1E^_[]t$t@ϐUSWVP[:Yl$U8NjDY"$tOs;1҉vTY"ljh9DY"$uƃTY"D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[kRt$tD$tdPV$xaa1ɐ΍,?UQ躯t&UP$y.w8"tV 1^_[]ffffUSWV[Qt$V\Y"PFXY"ƃ`Y"X tj~V:u^tVtDi@u\uRDQ@u말:u~u'XY"t PǃXY"ǃ\Y"1 ^_[]ÐUSWV[ëP|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í*L`LPQhR ]LL`LPQhR6USWVP[êO|$t$t#l$ t?tajUjW^_[]Í*L`LPQhR빍LL`LPQhR]u^L`LPQhR7xUSWVP[N$L$d$p$l 2L$|$$h\$T$8u{XY"tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh蓠$p $L$1xjjjU |$ `,MPQhl$XUjjjh@Ujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$^L`LPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPT$ )ʼnl$‰$L$\$(l$$|$ t t$it$,D$l$ tEF4$hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$ba؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU蕦5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP辠 Wt$DU谠 t$$t$ t$0ɫ/L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PUХ|$u(UV!|$ |$L$1|$04$0r\Y"PkKXY"P"\Y" L$ <$14$襪$lyD$0P||$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW肙t_WVPǞ UUx~1L$ ȉŋD$8L$D$8B\$W |$ t$dUUf |$;$LP^_[]60WHLL$LՍ`LPQhR9L$,8 ML$LՍ`LPQhRꋴ$tL$,LL$|$LՍ`LPQh R|$L$,^L$|$LՍ`LPQh R$|$L$,Ń|$ \$t t$c4$M^L`LPQhR,$|^2M`LPQhR$|Y\$U|$ t\$t$c\$t$0軧dXDL$ÐSWV[\Dt$|$tatY8t1t0:t+|t&9vt:t |u^_[Í*L`LPQhR}^L`LPQhRVSWV[ÌC|$t$tGtidY"tP1ǃdY"ǃhY"ƃ`Y"ƃlY"WV^_[Í*L`LPQhR?uLL`LPQhRpS[BdY"tPǃdY"ǃhY"ƃ`Y"ƃlY"1[ÐUSWV[ÅB$,E$$$(hY"uhY"ȋdY"u!PfQ0dY"XY"t%1`Y"dY"PQA4t $D$uz1dY"VgMVVǃdY"hY"HhY"@MPfQP"dY"u<X1DN@u:t#t lY"<|\lY"XY"`Y"$ƃ`Y"l$L$L$ $Dt\uUdY"3uًdY"t:tuT$ T$V@tfV3ǃdY"ǃhY"ƃ`Y"ƃlY"l$=ǃhY"ƃ`Y"ƃlY"D$:l$VǃdY"l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5dY"tP9ǃdY"ǃhY"ƃ`Y"ƃlY"GV ǃdY"ǃhY"ƃ`Y"ƃlY"ǃhY"ƃ`Y"ƃlY"1E;$^_[]À|\u ƃlY"ƃlY"3L`LPQhR$<ELL`LPQhR$<8USWV _H>T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd(XƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW"ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU蚙tL$(U$W ^_[]Í*L֍`L$PQhR|$LL֍`L$PQhR|$|$(SyL֍`L$PQhRv|$&*L֍`L$PQhRA$LL֍`LPQhRUSWVY:T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd訌t]ƃdNJD$$ƹdEt#<:tu)FdPWJu`)nu N$UWt1L$$8$LM`LPQh`R$Wo^_[]Í*M֋$`L$PQh"R9L$VLM֋$`L$PQh#RL$|$$&yM֋$`L$PQh$RL$*L֋$`L$PQhR$LL֍`LPQhR]USWV[8l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPڼ F(N8D} '~wF^ FPE^ uWv$aR )tƒN X~?:V|@uH)ƒVԋ^ +FF$BBQWP uvvQ K~?:uFV;~t^ a ^ Q8u^ DF,;8u e^_[]Ë^ S[30t$t$ [ffUSWV [2} F FEFUVzRu)ʃԉF:FJFx9u0Ru}P N ;Nue^_[]fUSWV0[#2D$(}<PQXpY"t$M L$ML$f|$ L$T$|$QRj WPDuOt$ rF|$j WPxb u0O L$FD$D$ PjL$Q 79_t$} urt]"tgM9uWM % M[QPR}Wuj19r"y";L$(pY"|jjPC PMD$t$L$ WLt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\ uEPVu腏 ;EsD$t$W;KL$%D$"T$ ;UwRPuF 1ɋt$;D$(u ȍe^_[]覆S[þ/MjPE>pY"i|h PKAt]"[SV[}/tY"hVt$t$t$%t1^[fffSV0[:/t$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[Ì t$|$jWj VW( jW؝^_[fffffffSWV[< t$|$t PPf OPQ ~^_[ÐSV[ t$ tP袱FtPoFFFtPoFF^[ÐUSWV[x |$(?u Pf OPQ!t$$ot .$ tEt@u%PPOPQjJRE@NT$RQjjjuЃ>T$u-}QpQPPQj[R迳T$,$ t|$ tEtHHu07QQ׍OPQhRh|$0EHHPVt$0t$0WRUуt 0$^_[]ÍPPPPQj}RS[hPt$t$t$t$t$S[ÐUSWVP[Êl$t$D$ $ t t@8u'QQOPQhRg@8QUVwЃt 0$^_[]ÐUSWVP[l$t$h$ t t@8u'QQOPQhRձ@8QUVwЃt 腷0$^_[]ffffUSWV[kt$l$PQW t"t$ VW .WjjPtUPQWZ t$fffffffS[jt$t$t$[fffffUSWV[èl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]XUSWV8[%$L$4L$u$X$PD$u$P| $$Pt$Pr覵 :T$$EjP\D$tk|$jW\D$,D$ tND$1ɅujW\t3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWCux9!xt19)u|$T$(l$);$Pw|$$XD$0PNƃjP[tQ$1 T$|$$T@uX$L$0PVQW;ut5WwD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ >u‹D$$t $uCr.P|$<1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Vuq DžL$~9t/;$WVQƒL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j蝮|$l$t$D$P\t$ \U\V\l$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$*\t$ \t$\넍lRRQPQhRA`RRQPQhR"RRQPQhR"RRՍQPQhR蒧`1RRՍQPQhRgꋌ$hRPRRՍQPQhR52RRQPQhR\RRQPQhR=NUSWV[èD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]NUSWV[+l$ |$t$t V*1L$1jUWPV^_[]ÐUSWV[l$$|$ t$t Vڛ1L$T$jUWPVp^_[]ÐS[ÎL$1jt$t$t$t$6[ÐS[^L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[L$(T$ 7t$T$L$pD$L$11jUt$,jP`xD$Ƌ;D$u ^_[]LLUSWV[XD$(L$,T$$>|$T$L$pl$L$T$ jWPjU1xL$ȋ;L$u^_[]KUSWV[|$t$t Vޙ1pL$1jUWPVp^_[]ÐUSWV[Ë|$ t$t V莙1pL$T$jUWPV^_[]ÐUSWV[;|$t$t W81p1jUt$$PW^_[]ÐS[pL$1jPt$t$t$[ÐS[îpL$T$ jPt$ t$ t$ Q[ÐS[npL$T$ t$Pt$ t$ t$ [ÐSWV[,|$t$WjuGكs^_[!t_t$t%<FF ^_[ÐUSWV[ë|$ u ^_[]l$ t$Wjt t- t(WjtWP5 u뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvԽ<$|$Dփ 6D$4)D$4@u \҉L$x MVYht^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉg$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWgu#XDxuGws>4$$^_[]ËD$4  !rfUS [õE$D$D$D$PQ D$e[]fffffS[nt$ t$ [ÐUSWV[5$$%= uRl$0K4$@ƅtZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$ QD$112fOH|$4D$,$t$Wl*t$$U5ƋD$H(L$tXP=ǍHTD$t17YGPPUQs w,L$AGG GJG GGGDD$ GoD$PfGt L$y|$1l$9l$^|$4l$trV$$M(tXP`<t<$tM1QE<$twWLut$ LuVLULYHP@T@,MH@ @J@@ @Exf@H u"jh@Pe EuM(L$ uEQL8+RRPQjR蟝1^_[]Í+aSRPQhR蠗USWV։[QG(u/nPFJt0fD$9j|jUL Exl$FJuЃN $t6UQt^Ԝ8UvYu&轜f )UQ:t(螜8~ j|jUϘ f Ą^_[]E%===@EM $N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u ёG OJÑD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR8l$ǃt$<)l$ D$8D$D$14$D$Lt$78DžN( u" .uGt<.utʐL$tXw PK.ōG UTD$t1 .YMPNQPT$ Rc u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRr84$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$h1t*SRPQh1RlD$u‹.(1F)EHftf },$FtpP9u|$t$u N)$xDuW@8/tOF(uIjh@P tFFU<$U<$u~yljF^_[]FUSWV[;t$tf8}t v$>V }t!v$v$v$ 8V8W:^_[]ÍSSoSPQjBRփvfffffffS [ËhPQt$ t$ ,$ [ÐS [Kt$Pt$ t$ ,$ [ÐS[L$T$ hP[ÐUSWV ׉[T$4Ŀxtb=t= T$4t=uD T$41ԿL$̿L$ȿL$ĿL$ D$l$ L$RPQUWVC/=uD"ك@Tw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[L$T$ t$[ffffff̀rS[Ôt[̀rS[tt[̀rS[Tt[ ̀rS[4t[SWV[|$t$t-9t!t F9u1^_[ÍtSSPQj*RfffSWV[ì|$t$tt1WVjx^_[Í[D2TSPQjBR藀uύfD2TSPQjCRt뮐SWV[,|$t$tt1WVw^_[Í[D2TSPQjBRuύfD2TSPQjCRfffffffS[îL$T$ hPt$ [ÐUSWV(T$ [rL$<\$%t$@|$t;D$<|$"v+61t$ \$VP-q\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXD$|$tt$ht&L$ptCwm\$y\$wPUUPQjxRs뵋\$uPUUPQjyRs$vl$l1 D$͉L$4A\$PgD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$u8UPQh&RqV\$]U8UPQh'VqqkUPQhrVt$xbq$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP  \$R1T^_[]Ë\$ukUUPQhsRd$\$ukUUPQhsRd$LUSWVTXHD$ L$pT$htwL\$ j ֋\$ wPUUPQjxRd$vl$l1 ШD$ʼnD$4֋\$ PS:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ ]U8UPQh'VObqkUPQhrVt$x/b$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Qa 1T^_[]fffUSWVP[|$88tqw$G$t,GO4$6tV1‹n1 uV ;WujbƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUjƅtF PVWo+ u$*jU7t@ PVW<+ 1D$t01^_[]f̀rS[ôt[ḃ̀rS[Ôt[SWV [yt$ |$t[D$D$4$JW0L$jjPWjQ1u#W9 u W01 ^_[Í^UUPQj񐐐9t uD$))t8t)Pt u+D$ PeD^_[]ÍVaVPQj@ROND$(SVaVPQjAR'ND$(7fffffSV[ݞL$D$T$ y9VRVQPR6Q4P 1^[ÐS[~D$y%9V]"PQj@R{R ]"j@4R ]"[fUSWV[t$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)J[DWVPQj?RL눍fDWVPQj@RLq1^_[]fffffffK̀rS[Dt[USWV [(t$ $D$PD@7$L|S_ NL$ 9t6ʉi)iAi ˍ $PXH4L$TT$ o9s9s}$?9r|t$^uA$t209r9r։XHt$豿^_[]É݃t209r9r֋9s9r9r봐USWV]x@|$0||$4$D$PDtH@)1ҋ@P1T$,ރ s;DžDDžLDžPL$0A@TQ1@t$ sAs(1ہ1)L$DL$PD$0Hމˉ@|l$TPt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉XH)D$L$0t$轼^_[]ÍWuW(WPQhXRG[USWV[èt$@D$.̉)ō$$P3DtH@)1ҋ@PDLP@tH1XT4$譻D$^_[]ÍWW(WPQhRFUSWVP[Ú$WSDtIXH010T@$9r$9r$XH@i0mNA900W޺^_[]ÐS[t$t$t$b [ÐS[Ζt$[ffSWV[ì|$t5jWt ctVW(1^_[Í^WWPQjARxE몐USWV[;l$t{jUt=ǾtUWUt1l$UPt$ L "19s#JJ8^_[]Í^WWPQjVRDaffffSWV[||$1t,jPWzt |$t=t=tƉ^_[ÐSWV[,t$t-ܡVW tPW V ^_[Í&XXWPQhRC믐SWV[ü|$GPNtƉx @ܡVP1^_[ÐSV[mt$ t%ܡVPMt L$9H 1^[Í&X5XWPQhRFC뷐USWV[D$01t:>t41 |t$t$ t$ W9 uD$ <=u.|$$ ]"9ttD$0]"M9u;]"s|9v9tfPkǃ]"ǃ]"$jWP H0H8uyPD$0t$C )$jWP` G0G8u4)  $PjQC $]"L$]"^_[]ÐUSWV[h]"t]"1t0ܡDtPVt]"Hى|$ܡjjD$P tE t5jVt$ F:]"tVt$VŋD$]"9tPǃ]"ǃ]"]"UjPB ^_[]ÐUSWV[K81tR/tL,t4t$t$U(7 uD$|=uօt D$1^_[]ÐUSWVP[ʐ|$1|jPWtfƀ<=t^tR)tI1 $ $lt+Vt$Uw6 u|5=uمxD$8.1^_[]ÐSV[PVƅtD0^[ÐSV[ݏPƅtD0^[ÐSV[ÝPִƅtxD0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[ØD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[ØL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[؊T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t WV-1 WV轔^_[ÍXYYPQhRguZYYPQhRAhUSWV[m|$t$tLtnWV虍t3oUV(t"}uG jQWPV蔘1^_[]ÍXZYPQhRu,ZZYPQhRkSWV[t1^_[WV轌tGPVLtۍGPV蛌tʍG PV芌tWVy묍X9ZYPQhRm39ZYPQhRFUSWV[[lt$|$Gt/uTot^REwn01o  u-GFGFFnFn GFG    3FZYPQh$RnTZFZYPQh%RDTZkZYPQh RGFGF^_[]ÍTZbZYPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[it[v̀rS[it[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[i|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1DZtZPQj:R]ZZtZPQj;RqVAUSWV4[%h$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋDl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFZl$0PQjUa3U $\9ȋ$QU$`- FfNsQPR$`U$`21Ʌ9$Fx$P$T)ZPURQ2*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LsQPR$`$`2l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$p0[PQ|$W$`U0t;$Tg$P$T)D$D .P|$Wt$L$QRb0L$)D$D Pt$t$t$R)0L$)D$D Pt$t$t$R/L$)D$D Pt$t$t$R/L$r)D$hD Pt$t$t$R~/L$9)D$/DPt$t$t$RE/L$)D$DPt$t$t$W/19D$F$PED$1$1pD$ .D$0[D$׋D$ tD$ $ 1QPt$t$U.H)D$>Ń19t$un 1f$PL$$T)fv fD$ ZVQURt$.L$ ;$T$ڕT$0L$RQPWt(8W$\9vpD$0Pe;fǍZ$0PQhW-W:$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGZT$ PQhR(= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í&[ZPQhR 6[ZPQhR $$b_6[ZPQhR ;KfffffUSWV[U[$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPRMt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP谊 uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tOfffffff̀rS[TYt[USWVP[:YPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pg 8^_[]ffffff̀rS[ÔXt[SWV[|X|$t.jWG=tjW^_[Ím[7[PQj@ROfffffXXL$rÐSWV[Wt$u8][u[PQhrRVǺtF~tP论^_[ÐUSWV[eW$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W觸tGotP莸܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$ __u[PQhfRF HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1D$ *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RXNjD$$fxxt$ T$@>P\fD$>P\fD$>Pt\ f|$fD$f|$"D$<$$!|$hVWt$8R$XgD$D$$fxxVT$@HVNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$VWP$Pj%R΍Gfwhj$PG DŽ$DŽ$DŽ$DŽ$jND$$%ND$WN*^Pt$t$t$DQ$Pj%衠T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWlYfD$FP[YfD$FPJYfD$h$!Pt$ Vt$8W#UfNjD$$fx$!xVUAV=*htL$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~Vi<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yH{"T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V/L$tL$8$tYt$`~l$(u2D$4t$%Ut QkvF Ut$`)L$8uBffT01l$(E;$%b%^_[]QuTǍ ^΍^׍u[PQhRE^΍^׍u[PQhR$%]]΍^׍u[PQhR.7΍^׍u[PQhR$% ]ύ]u[PQhRx$%~yύ]u[PQhRC$%MTrWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[f|$F$ jPwŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P" ^_[]Í]d^u[PQhR@k^d^u[PQhR|$6d^u[PQhRoUSWVT[&1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8[PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW~ ;D$uY ^_[]Ít<`_PQhR<P<`_PQhR]ffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RGWjPP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W| Pt$l$ U| t l$ /D$D$<F\$hPWf| |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~{T$ \$WjRFT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R{ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$zT$ L$E E$\$l$TU[U/4$UHU$L$$9sD$DQ'U1ɉȃ0^_[]D$D捃``s`PQj]RW\$@SV[ít$ t VT^[Í`s`PQh/R蟠fffffUSWV|[Xj$1tGljPW节t)l$XD$\|+Wy Wc1|^_[]jjWjjUjcHW8t҃LD$ l$<$D$ƅuUW 뚐USWV [x|$$(rl$ NBCD3EB 3M tI1 ^_[]Ë|$,jF4~F:F:t1F;pS[ît$t$[ÐD$@ ÐSWV[|T$|$9W v#wG,ʃt$<u0 Ћ0<L  )r;GvD$Ot$1^_[ÐUSWV[t$,~$ED$\$Pv(t$Q 9qud)$3cD$ aD$4$iUg2藈 t$ rL$$D$4o |$D$ l$aD$$$$`$ttl$$;A&$`t %"l$ Oa$D$D$ft$H D$0Iut"l$ Xa$D$D$Sft$H D$0 ut"l$ \a$D$D$ft$H D$0tt"l$ `a$D$D$et$H D$0tt"l$ da$D$D$et$H D$0Itt"l$ ha$D$D$Set$H D$0 tt"l$ la$D$D$et$H D$0st"l$ pa$D$D$dt$H D$0st"l$ ta$D$D$d$`t|$4tkKhL$DL$ xaL$,$D$t41Nt yI u6J rL$$D$ D$ L$@L$ D$a|$,$軲Nt yI u6ڄ rL$$D$ D$s讄 L$ L$8L$ D$|$,$$`t% tl$$ )"l$D$$t$H$l$D$ $vl$D$@$Zl$D$$>|$Du(f|$@u f|$<uf|$8ul$$ !x^_[]ÐSV[Ýt$ tLtQ 9qu/g' rVQjP謬 ^[ÐSV[-L$t$ t ku bKhtXt4t Q 9qu'i rVQjPL ^[ÐUSWVHT$[Ñ$`$DL$`!ƅteT$|1t3ʼnt$ 4 t$h6i. i&!ihhi^[ÐSV[Ýt$ )tYj(PV;t ytYZVQj(P躝sY^[ÐUSWV4[8$D$0D$I<u t$HFL$j.QPjuFHiT$PQj.R;$tEL$PQVQ D.0;D$0u 4^_[]'USWV([Èt$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍ|щ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍ|щ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$|щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$ii֍iPQhRvqːUSWV[#}dD$|$D$ D$P0LlHHPPj0ppp RQWjV$r D$ƀe^_[]USWVP[Úl$PU΅ PU超aPU螅ɹPU膅aPUnaPUVUoPU>hjPU" 1uRXMDHt?uj PU u8u$8 L$A.&L$0t9^_[]ÐUSWVP[ l$1PU)txF u6=ljPU! 1u[XMDHtHtj PU xt8u $8 6D$t8^_[]fffffffSWV[,|$t$jWMGHO~;G~ t H WRIjWLO^_[ÐSWV[üT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[i|$(D$$uƿ$PccD$D$D$D$ jWLG0u ǀD$PW.@jWqN^_[ffSWV[ܽ_Ht Jt @t A ?t/t5Gt t$P#[ÐSV[  Fu tt$t$t$t$VƄ^[ÐS[þ P[ÐSV[Ý Fu tt$t$t$t$t$VRjV^[ÐSV[= Fu At#t$ t$ t$ t$ t$ t$ V~jV^[ÐS[޹ t$t$t$t$P׫[ÐSV[í Fu t VFnjP^[ÐS[^{" hPt$Q'[fUSWVP[*T$L$I):t$ 4$ t$,t$,t$,t$,WUVt$$QP4^_[]ÐUSWVx+[àE4D$E0D$ $p+E E$D$M,E(U$t$,tH$RP^\$M,u+L$D$ @ f PU0M4:tWׅt3QW^|M,$wt!<\tt<.uwu)ր:|$tb9DVRt$(?U \$ 3)D$E0}4},3trtl<.t t<2t\ϋ$T$aT$ .BE0}4B:D$ @ PU0}4D$|.ϋ$T$uT$|${)D$ lD$BlE0 E4u $jt$jhVD$ \$1M0QU0E4A}4sLkD$E4D$E0f U0}4D$u0}4WVuX D$)ljD$ s1$L$lBljQjhRD$$D$ Ɖu0}4$uu$+PWQjdVׁ9E4vAPVu0= E49s($lBljQjhRE4M09U0)E49L$ u4U0D$T$t$${)D$lD$ BlE0 E4u!$jt$jhVD$\$E4M0QU0E4A}4skiD$E4D$E0PiD$D$,;$p+F:D$e^_[]Ã$"@f E4w,lBl$jQjhR\$E4M0QU0E4A2lE=m U ME4u0} PVu,W?|?=D$f1))lj$}$A!u E .lPQjd$+Wl}$!u D$ E HM HL$HM xQƃE t$ %kV|$Wt$ PQjd$ +W9E4>PWu0: E49s%lBljQjhRE4M01U0)E41u;D$ / u E P&iPL$Qjd$+Wp~9E4>PWu0X: E49s%lBljQjhRE4M01U0)E41u E PrPt$jd$+W}9E4=PWu09 E49s%lBljQjhRE4M01U0)E41u E .lPQjd$+Wi}9E4=PWu0Q9 E49s($lBljQjhRE4M01U0)E41E4u0} MU $PVu,W<CE L$)T$X$h*RQPID$ .}4$V<E0f (E4w($lBljQjhRE4M0QU0E4A$kI.}$$u M QU Qqu I4$tk$QRPVjd$+P|\$9E4;P$ +Pu07 E49s%lBljQjhRE4M01U0)E41E L$)T$Xh*RQPG"}4;ƋE0f (E4w,lBl$jQjhR\$E4M0QU0E4AkD$"M }4E0T$WPo<B|ljE }4v:E0 E4u($lBljQjhRE4M0QU0E4AM }u ;L$:T$$WE0P;$( E .lPL$Qjd$+W%z9E49PWu0 6 E49s%lBljQjhRE4M01U0)E41E HM @Pt$jd$+Wy9E4J9PWu05 E49s%lBljQjhRE4M01U0)E41E E PE Pt$jd$+W%y9E48PWu0 5 E49s($lBljQjhRE4M01U0)E41M AE  L$Z$$`vL$ L$lL$BlL$)M01U0)E41E E |$$V$Pt$jd$+WDx9E47ƃD$PWu0'4 E49s$jt$jht$(D$$E4tE ;D$7}0 $|lT$lT$ BlL$ M0QU0E4AE ;D$77T$$E4PW 9 E E ;D$sƃ}4 7E0 E4u$jt$jht$ D$E4t}4u0E WVu,P6r}46E0 E4$u,lBl$jQjhR\$E4M0QU0E4AMU WVu,E P},}$u E .lPQjd$+Wgv9E46PWu0O2 E49s($lBljQjhRE4M01U0)E41$E HM L$HM pQSE T$(|$$,lVPjd$+Wu9E4?5PWu01 E49s($lBljQjhRE4M01U0)E41|$$^E `vL$ L$lL$BlL$)M01U0)E41E E D$$$Pt$jd$+Wt\$9E4a4PWu00 E49s$jt$jht$(D$$E4r}$u4u0u jM t$)΍VUUUЃ=7E43}$E kPQjd$+Ws9E43PWu0/ E49s($lBljQjhRE4M01U0)E41E $E  8;L$T$D$dD$`D$\D$X)*Ƌ$P$ +Pu0& E49s($lBljQjhRE4M01U0)E41E4D$E0D$<|$rv)$L$lL$ Bl$E0 E4ujt$jhVD$E4M0QU0E4A}4s$@RD$|$XWu u$Q>E4u0} PVu,W()E L$)(|$1ҋ$ՇL$L$ lL$BlL$$+р਀tpRPt$jdVh9E4u(PQu0$ E49s $jt$jht$$D$ E4M01U0)E419T$ (ыE $+$[}$ $u E E $PE  $`k|$X$PVQj2W h\$9E4'PWu0# E49s%lBljQjhRE4M01U0)E41M u4}0T$VW)$ E }4$'E0 E4u($lBljQjhRE4M0QU0E4AM T$$VW(s$E }4&E0 E4u($lBljQjhRE4M0QU0E4AM T$$VW&($E }40&E0 E4u($lBljQjhRE4M0QU0E4AE MU $VWu,P2}$E .lPL$Qjd$+We9E4%PWu0! E49s%lBljQjhRE4M01U0)E41E HM @Pt$jd$+We9E4 %PWu0i! E49s($lBljQjhRE4M01U0)E41E E ;D$$ $`vT$T$ lT$BlL$%M01U0)E41E E ;D$X$$Pt$jd$+Wd9E4E$PWu0  E49s$jt$jht$$D$ E4zE4u0} PVu,W $}4#E0 E4$u,lBl$jQjhR\$E4M0QU0E4Au _E PB&iPL$ Qjd$+Wc9E4S#PWu0 E49s%lBljQjhRE4M01U0)E41u E PPt$ jd$+W/c9E4"PWu0 E49s%lBljQjhRE4M01U0)E41u >E E P)E E PE ]kPWVQjd$+Pb:}$u E E PE E PE ]kT$XPWVQj2Rb9E4!PWu0 E49s%lBljQjhRE4M01U0)E41E4u0} MU |$XhWu < WS:9E42!PWu0{ E49s($lBljQjhRE4M01U0)E41 }$E H }$ T$XPRVQ1-o}4${ ƋE0f (E4w,lBl$jQjhR\$E4M0QU0E4AkD$$T$X$PRVQ,D$ T}4$E0f (E4w($lBljQjhRE4M0QU0E4A$kE4wt$(M0fA  QU0E4A|$XVWt$,u +9E4$$VWu0o E49s($lBljQjhRE4M01U0)E41L$$M M E4;L$s\}0u $M0fA  QU0E4AMU E4PWu,V&E4L$9M r$[E0f )E4B$lBljQjhR$|lD$+E }$t!plVQPRjd$+P:^c9E4$V$ +Pu0 E49s($lBljQjhRE4M01U0)E41E t$9$QjL$ )M0\$U0)؉E4} } 9$Ƅ$ +fDŽ$+ )lj|L$|$L$D$Pt$jb$+P*]ƃc9|$tGE 4+d)8$Pt$RQ\}ƃcvn$|$9u4ZV$ +Pu0 E49s($lBljQjhRE4M01)U0E41$0}4E0)E4u,lBl$jQjhR\$E4M0QU0E4AM4E0.szD$L$.)E0 E4u,lBl$jQjhR\$E4M0QU0E4A~`}4sf E4w,lBl$jQjhR\$E4M0QU0E4AƄ$ +fDŽ$+; |$~.L$L$D$U X0}1b\$1< +9t4 :..x DN.ẗ< +L:xDN.t뼍G$D$t)D$:x DF.t.D$+9E4Pƍ$ +Pu0) E4t$9t$|$b$lBljQjhRE45}BD$E4D$E0"T$hL$D$L$lL$BlL$D$ ,M01U0)E41L$0ЉȉL$9L$ $t$ 2\$9E4Pt$u0* E49s $jt$jht$$D$$E4M01U0)E410|09u4$D$XVPu0 E494$jt$jht$$D$$E4' hL$D$L$lL$BlL$D$ /M01U0)E41L$0ЉȉL$9L$ $i $t$0\$9E4Pt$u0 E49s $jt$jht$$D$$E4M01U0)E410|09u4$MD$XVPu0 E491$jt$jht$$D$$E4 NjE ;D$ HM 3M01U0)E41D$ $+$L$ɃtyL$u2E4׋M0A  QU0E4A D$ kRPjdVV9E4XPQu0 E49Q$lBljQjhRE4$}$ }$.lPL$Qjd$+W0V9E4PWu0 E49s%lBljQjhRE4M01U0)E41E HM @Pt$jd$+WU9E4UPWu0 E49s%lBljQjhRE4M01U0)E41E HM @Pt$jd$+WtVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s'D$D$Q@(D$ 9s$lBljQjhR)))x ^_[]1))lj$llBlPQhR_!뽐USWV Չ $[rT$8D$4 D$L$D$"u$lBljQjhR|$4QA$93<$779$xlD$D$lD$ BlD$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$lBljQjhRMQUA+<$- %$D$4L$D$ ^_[]ffffYoT$4D$#ħÐUSWV[Ûo|$ l$t$~Jt$~2UV1x(ƃ|$tލF9wȉ9v-$(+t$^_[]ÐUSWVP[ o|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }#(^_[]E ffGftC,$RWxǃ9w,$)xD$ hHGftf,$RWšf 8 9Xσ95,$)5|$ oGwtc,$RWS 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [Èl|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.  ^_[]Ð~34$U菟x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quu賞]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[i|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.a^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu[U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XXg\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō6mlPQhR[|$  m6mlPQhR.Am6mlPQhZRfffffffUSWV[ûaD$$L$1w|$ u p.0{mPUWVt$(t$(QR1 X?aL$u<@ÐXaL$w1USWVX`D$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$ -mmPQj>R7;\$mmmPQj?R USWVP[^t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]ÍmmmPQjgR 1fffffX]"ÐS[î]"ht$ P [ffffÐ1ÐX_]"ffffffUSWVX[8]l$lD$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: r\MnsL$"jWRPj2Q) 9D$"PD$tPp7D$p$)$iǓ$))ŅtVT$sT$"jDPQj2R()D$"Pt$t$V64$t$ T$T$D$@L$)L$tOt$ s|$"jHQPj2W()D$  W|$W}6D$t$ $D$kTWPڋ$+D$pffffffUSWV[Yl$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[UY$$$hWP! x3l$hU$( xUW<1Ʌ;$u ȁ^_[]襯ffUSWV[ûX|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[;X|$t$l$tt$$PW%t ^_[]VW t W LJWVUF ͐SWV[üWt$|$jW1Ƀ PVW ^_[ÐUSWV[{W|$tt$O#PW$tG 0l$VW/ t WRLJWVUM ^_[]ÐSWV[Vt$t5|$r#u#jV#tjV$F1 ^_[S[ÞVD$tL$ ttu H1[i [ÐSWV[LVt$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[üUt$tAjVq"t2|$jV"wsf~ 1c ^_[ffS[NUL$T$ hP[ÐUSWVT$0L$@[UuD$\VD$ Pǃx\$D$t6T=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$ $D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5QV t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$t\${t$,PVD D$,\$FPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$N\D$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[N5|$  7 >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[l4D$HrM %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ý3t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[2D$ L$t9u[ÍYoKo oPQjpR9S[î2D$ #L$t9u[ÍYoKo oPQjpRD$t&L$tu1u 1tÐS[2L$ D$Qss)ǀ[Ãuu ǀ[ÍYoKo oPQjpR5S[î1D$tL$ t 1[[ffUSWV[k1j 1tQ@@jjPl &(8t(W:(^_[]ÐSWVP[0|$tcOGQ9u0$jQPHl 08t  G $GT$pw1^_[ÍoowoPQjZRySWV[L0t$tRtC|$t3~t-0L~r43;~rP V^_[ÐUSWVP[/t$t@F$t*.1tt$Vt 9<$u1^_[]ÍoowoPQhR뜐USWVP[Z/T$J $Ћ*1|t$Wt94$u|$ l$tW%E$F;$} $)Qtu<|uprP $كU|v|"u|"PDt&D$j.PWV!tl$tqq$|"D$PL$QRPD$PWUA $t!Qyl$|$TG )|$TWT4$yl$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j"6D$0$Do5Vd5*^PW|$t$8t$HQj%IT$T$@t$$P6#tt$6Pj% $D$@9F f|$0u D$(8gt$|$u$L0V葮ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP}T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRf l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V =~ $!D$1$D$$1D$\$|$$Rj1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<$=(ƋD$L$,)9Qt$@P7e D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURP踍 4$zhl$l$$T$8)ƒ)19s@QNh1$X;$(,^_[]Ë$LnRPU5 1‰( ^^֍pPQhRֳ^^T$$pPQhR詳T$4z?|$46[USWVT[C$h>Wt1T$ T$G j(V¸hl$D$D$ D$$D$<$1|$ D$ l$Pt$ Vjǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tЕPW5jt1ɀ8 L$L$D$D$L$ t WP賩tT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍrarPQhRw]rarPQhRPBMUSWV։[_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUEw$T$ E ulD$;tM ǡE=t܉t$L$4QP~t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP}L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tRMD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQMD$e ߋD$)D$Uɐu E;D$UqtjUzİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QLE0EEEe jUz1뙋t$uyb)EۍUssPQjGR菘]sUssPQhRhD$D$ D$NtsUssPQhR1EtfffUSWV [t$@|$4u>FD$FD$\$jt$8w1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$.u^[ÐS[^t$t$t$t$t$[ÐSV[-t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[D$t$ P[ÐS[þt$[ÐS[Þt$Z[ffY ÐX_L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$8t$4D$0<D$|$щ9t9}E.L$ D$D$$<@t<S3A6D$!t  9$<@A)ߋD$t‰T$$NvPWL$Q|$9L$ 9T$t$|$D$)$(RWQPݒ|$L$Y9OErt$\$t$X( ;!ЋT$ )$RvPWRQH݋\$ƀހ:w6$u9E\EQ~߃^r}};|$tE\<< $:ukdT$Ɖ*t$i $:|$ui (Ћ4$Uh|$9EQ\$( ;!ȋL$ )$(PWQRL$9D$\$t$;)$VvVRQPӐL$xW9sQxMl$ŋ|$݋\$\$ҋt$4L$8T$9u ~n.9s E)$ y(^_[]Ë$xᐐS[jt$t$t$[ÐUSWV([è|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ Rn0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[L$T$ hPt$ [ÐUSWVT$[ɉ$t$4|$ |$0t=D$0|$ "v-f1T$VPR\$u+t-t$0u#D$ D$t$0t@D$u20u- iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF#:-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F#:-00u҉u#11Ɂ<$)ȉ#^_[]USWVP[~D$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zwT9u_1^_[]Ã1ҐdNzw_eNzwQfNzwC|gNzw5h9u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[|88tWƅ~102jj!jPu W蹡^_[ÐSWV[\|88tW芡ƅ~,102jj|!jPfu WI^_[ÐSWV[{hRƅt(T$jtV081^_[SWV[Ü{t$08Vx08^_[ÐS[n{t$jt$t$[ÐUSWV8[3{M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3#11uPz,R4h#H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF#JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[*x8}tl <PQ諞#$l#ul#;Dž<$}t+P ƅ,$~,01K#,$|$1jPUjW /DžuP誜^_[]hmPl#ZQWFFUSWV[ w88t P9ƅ~+01Rl$|$#u1jP UjW [DžuP֛^_[]ÐSWV[lvt$|$<\PQ#1WP(t 4h#H(^_[ÐSV[ vt$L$#t$P'tt@4h#H(^[ÐUSWV[ûut$8#8t8 <PQ8l#ul#ћDžtA,<\PQ#1UP't 4h#H(^_[]htPl#8tW(듐USWV[tt$|$l$<\PQq#UP&tt@4h#H(^_[]ÐUSWV[{tt$l$8#8t< <PQl#ul#荚ŅtQXl$<\PQ踚#WP%tt@4h#H(^_[]hstPl#tU냐USWV[Ûs88t(Pɘƅ~k(0z|$1jP t j&<\PQƙ#jP}ljՅuP6^_[]ÐSV[rt$D$ t"<\PQK#jP^[ÐSV[mrt$D$ tF t"<\PQ#jP^[ÐS[rD$t@ PN[ÐSWV[q|$t$tF <\PQ[#WP^_[ÐUSWV0[uqD$($,ɉ\$9ΉT$y |F 3&D$D$l$jP$PP$PW*|$t ֋|$ωjD$P$PVV*ʼnր|$t |$|$G D$ $DG~$,\$PjQ! G>D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[in|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ <\PQ踔#jPo|$x ,^_[ÐUSWV[mT$D$t$>O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[Jm88t+Pxƅ~"0#u1jPI4$t$|$ t6BR lP~;yQi|1)΃<$uPّ^_[]ÐUSWVXhlL$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[xk88tV蜐Džt> 8#ujj}l$(D$$$ t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$V腏$^_[]ÐUSWV[jE$$fBt π?:t c?:uʀ/\$ uucPW%DjPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ WuD$HhPW荅 ,D$(W跆$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xW%~t$D$(0W~DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[[tK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9uw<;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$ip/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףiQl$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$iQ9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[S +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍp1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށd1i4Q9uB ^_[]ÐUSWV0T$ $XND$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$d|$ 9|ځh1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[Fl#PQPll#[ÐSV[ýF\#j}twj^[ÐUSWVT$4XlFD$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[9l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Íxx`xPQjFRqxx`xPQjGRj|$$bq+x`xPQjHR@>ffffUSWV[8l$t$|$tU6^_[]Í yxxPQhRʐUSWVP$[Õ8t$l#UB\t,jtPx $Hp l#l#17"l# xuxt)txu8u밾U[^_[]Ã듍.yyxPQhRKUSWV[ø7l#D$ Pm[l#l#l#$l#L$n#L$ǐ|$$tD$$9G t GtOl# tGwЃ GЋl#9tl#DžuZl#u';|$r$;|$s<$$<$C<$1l#t$ ^Zl#u#t7W蕙u^_[]ÐSWV[L6t$l#WY"l# xuxt&t xu8uj萈u $p@@ l#l#1W~Y^_[Í.yyxPQhRIfffffffUSWV[e5$$$$$tD$$DŽ$DŽ$ $$jPX$@jP5YDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^yty;yPQjPRhMty;yPQjQRAT $ ;$u ^_[]踊S[3ht$t$Pt$t$7[ÐSWVP[Û3D$L$T$t$ 4$hVRWQP^_[ÐSWVP[[3D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[3t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[Ü2L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[=2D$ L$ $XQPRv[ÐSVP[ 2D$L$T$$XRQPV`D^[fffffUSWV[1T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQKP֍yPQj=R*P׍yPQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]ÍyPyPQhRL$8AffffffSP[Ý/D$ L$T$$RQP[ÐSVP[l/D$L$T$t$4$VRQPA^[fffffffUSWVP[*/t$|$PV13ht$t$ GL x=|P3MfF FfFfn vF$F,F(F $tjjjV|^_[]Í'z!zyPQj>Rq)ffffSWV[,.|$t%jW聼w jW}^_[Íjz4zPQj;RfSV[-D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[Ë,t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍzqzPQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$PQ\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPVƒD$ƒ;T$,v$ƿD$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P|\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$-{z$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$-{z$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$-{z$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$|B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$-{z$PQhRBU|$뉐|$UD$xT$ Ӌ$|Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ0t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P4E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PD<^_[]þUSWVP[HD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [D$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$YB$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }$6{j?{jD$܋¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[m|$hE t$p |$<$ MM$U86{j?{jl$l$܋<|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[`Ex\$t*\$4G=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$6{juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$?{j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃P܋D܃L$ۄ$܋T|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wtD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋0|$$ ʋ|$ ʉ$ڌ$؃Tݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃XD$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋0|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك0|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋\|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋0|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU!$t?$L$U-'$1xL$^_[]þTx0ffffSWV[üt$|$ty8L$tu1 1 ^_[Í{{C{PQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[M1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1F6{j<?{j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃P܋D܃L$ۄ$܋T҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉\=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋d|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$كH|$tT$L$؃Tݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكHD$!؃|$8=؋0ك`T$8؃XD$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋0|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9ك0|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋\S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋0|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ D$1r 1 9vW<t8Ɖ^_[ÐSWV[ìD$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[{SVH[D$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQjH&D$$D$ D$D$D$D$D$jPj-\ j[j[S[{S[fffffffUSWV[˧t$|$tK1tt (h1^_[]ÐUSWV[}uu\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$XΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ{t$(PV'T$4D$(FPV'uD$(D$D$ƅL$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[s |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[3ru }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[Kqt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXopǀ@o#ǀDo#fǀHo#ǀqo#fǀuo#ǀQo#fǀUo#USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[P!ƅD$t/Fn?tP#FF ^_[]1?tPp#)ʉʁ oΉoUSWV[mt$tbF!r VO8}t3Wm}Fp#p#tWKp#p#^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[ll$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P}T$,Bp# p#ti4$\8}th$Pӎ1}Fp#p#t14$譎$p#T$, p#D$TG^_[]Ëp#p#1␐T$1Ɂsrr@r"y(6s@sރx @tS[jj,tL$H@[ÐUSWV$[iD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU#<8?t:V譈?Ep#Mp#$t#V興D$p#Mp#$^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[(dD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [saE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[Õ^$t|1q1}|PQjERx P$1D$jjW+| ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[N]t$t$jt$0[fffffSWV[]|$t@jWqGHO~ H0 WjWR^_[Í/ }PQj=R 럐SV[Ý\t$ t%FHN~ H V^[ÍT} }PQjIRy ffUSWV[;\t$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) p1^_[]Í}}b}PQj>Rw fffffffSWV[,[|$f jWrG0ǀǀ 1G t WƋO twуy y wܽG0tW@9t QýG0謽G0ǀǀjWG GG:}}PQj8RW f  ^_[f̀rS[Yt[SV[Yt$ t;F0u ǀVNuFH^[Í~}PQj;RfffffffSWV[\Y|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WhG GGfG u WG t'DV}PV}GOQPwW$ GO fO 1!t Gf@f  fG ^_[Í\~&~PQjJRSV[Wt$ tF Ш u Vk1^[Íf~&~PQj;RSWV[ÌWt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWP覈6@VRQWPL^_[ÐXVL$aFm~j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC/p(1Vʹ(1^_[]14dž$j$tJp|HH,H lH H0hrPt6_t u8~)1 9}8tQ݋t PmVбt81^_[]ÐSWV[|N|$tOW膱^_[ÐSV[=ND$ p|$s t.jt$ 1dž,dž,^[S[ML$tAt[[ÐSV[ÍMD$ p|$todž,1t$t$^[ÐSV[=MD$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[øLl$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uN3~׍y~PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $w@ύ~֍y~PQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRԳu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[ÌI|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[I|$(o(o(OG0!D$;G9} $wD$D$ Pe$L$L$D$QPt$荠 $L$QjP t$虫$D$ Gjw趤 $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[Gt$ t$t$ #F,;F(~#F0^[ÐSWV[ÖG4aAm~j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr[QPQjbRrUSWV[86D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í[QPQjbRPfffffUSWV[;3|$oEtjPu7 EjWu,EtPE EtPߕDžDžtP踕DžDžU蕕W茕VP^_[]ÐUSWV[82|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[-1D$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_ǽ0D$tL$ P1,1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[/L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$[QPQjbRT$(L$?[QPQjbRZT$D$[L$ QPQjbR*D$L$_yffUSWV(["D$i LE9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$LD$$t%ht$W, $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$jW.LՍPQjXRgꋌ$!1Ƀ8cfffffffSV[ D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[è D$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]ÍVPQh<R0j$jU0 볍P#VUSWV[$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$rPQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$rPQh|RƐ\$T$\$[QPQjbR蕐\$T$\$rPQhRa\$T$\$rPQhR-\$|ffffffUSWV[|$8D$,hEtjPu_ E wJrr G&E(uI1G T$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc[QPQjbRɍI[QPQjbR虍w8[QPQjbRn;E,jjuK[ Ǎ[D$wsZtvG GtfAjWu\ jVuZ DžuEQt$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9t[QT$ PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtP>E EE($}fu E(jQt$xsB tt$t$jbP臈э[QPQjbRdD$[QT$ PQjbR8D$T$Ǎ[Q֍PQjbRUSWV[û|$l$t$FtP;F FF($nf~ F(^_[]USWV[ft$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7[QPQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ[QPQjbRR!fffffUSWV0[u~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍[QPQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$[QRQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ [D$QD$$D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$`P\PXPTPPP LPHPD@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^L$<A$iA D$AQT$QT$IL$1t$$dl$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$L$T$ j [ÐUSWV[L$l$~ v$W V$F ?t.GD>(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYOD$P|PxPtPpP lPhPd@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[^t$t$t$ [ÐS[.t$ t$ F[ÐS[L$T$ j[ÐSV[t$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVXu$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[=t$ tADj@PV{D FPhjPHm F@FDFHFL^[ÐS[޻t$t$t$ [ÐS[ît$ t$ [ÐSWV[Ìt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[ðMD$$&ydḰ ~? gL$? \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <y#1D$D$ D$D$L$8T$jjPQjR11tD$8y#D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$́FL$ہL$L$ L$RhjjjPQRCD$L$8T$jjPQt$R/L$81 ujPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR0/t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR.D$XL$ L$,hjjjPQRuMD$D$ D$L$8T$jjPQt$RP.tD$8he^_[]fffffS[î [ÐUSWV,[Èl$@D$D$ D$$D$(L$ D$QPj( PW 1|$D1҃|$H1‰|$y#2y#y#y#y#y#y#y#y#y#ty#t}y#t{z#ty z#twz#tuz#ts$z#d1`YRKD=6/( !    s#4Áƨy#uH< |$9T$vQ׋(z#jjjhjPj! y#t+f@(z#fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tlupl|$Dtxx1|$Htt$jWj ,^_[]þ |$ $(z#ljjPQjR*<$(z#ȅUSWV[+PWltV6udP7ƅt3ttUmuW0|tUmujW^_[]ffS [k,z#uoD$D$$,z#T$jjPQjR)t1,z#u,_PQjAR'^,z# [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[;l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP: OV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP t,NQW QRP FEE1^_[]ÐSWV[ùD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [hT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[xL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[h|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[ät[̀rS[Ät[S[nt$ t$ jt$$t$$t$$t$$t$$  [fffffS[.t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[x$D$D$huET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR"!ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ԬЬج|$ W$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ` $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PWo |$ u9nuqF$hPWN nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0v $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP7 t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWP, t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[<tM΋uA~8t:~4~"`N4F8 I9rPF8^_[ffffffS[ΙD$L$ AQ jQ0 [ÐSWV[||$t$t+jP6 tH  W6,^_[ff̀rS[t[̀rS[t[USWV^՘$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQwæ1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q4SWV[<D$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[Ȃ|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,蠤L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[ýt$ V PtHP tQ P V1^[ÐSWV[\t$>gthGt tww$Ѓ gpNjPQwU;u<tww$Ѓ 貝4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[ D$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[Ø~t$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[}|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Íe.PQjGR(T$4pe.PQjHR}(T$4USWV[;y|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDWP=W1fu- O @1jW^_[]ÐUSWV[Kxt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]Í|PQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[üvt$8uEN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[ÍPQjbT$B=sD$ DP[Í[ÐS[aT$B=sXDP[Í8[ÐS[îaT$B=sD$ DP[Ídž[ÐS[^aT$B=sXDP[Íц[ÐS[aT$B=sD$ DP[Íن`[ÐS[`T$B=sXDP[Í[ÐS[Î`T$B=sD$ DP[Í[ÐS[>`T$B=sXDP%[Í[ÐS[_T$B=sD$ DP%[Í.[ÐS[Þ_T$B=sXDP [Í[ÐS[^_T$B=sD$ DP [Í[ÐS[_T$B=sXDP@[ÍX[ÐS[^T$B=sD$ DP@[Í![ÐS[~^T$B=sXDP%[Í+[ÐS[.^T$B=sD$ DP%[Í3n[ÐS[]T$B=sXDP%[Í=&[ÐS[Î]T$B=sD$ DP%[ÍF[ÐS[>]T$B=sDP[Í[ÐS[\T$B=sD$ DP[ÍQC[ÐS[î\T$B=sDP[Í[ÐS[n\T$B=sD$ DP[Í[[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[Zt[D$t8t9@€tuuuuH+D$ÐffSWV[ÌZ0t14jWQw t u1^_[ffffffS[.ZUoPt$t[ËD$1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[KSl$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍJPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[}Rt$t8D$ t|$tT$t121Ҁ9 11^[ÍuJPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[uQ$pЉׅtϋ$t$RWPQ$$$4UhVH$yPVjl S[Pt$jt$t$PUSWV[P$$$$pЉՅt$ t$$RUPW$,$<QhVt$t;7l$VPQhUJPUjk tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃؐP趸҃¿+w狔Dу̃ǃƒӥS[Nt$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[jND$ D$D$$jVjj 0z#uƃ0z#tjljj0jVjCj jIjfffffffSV0[Mt$̀rS[Lt[S[K|jPt$t$t$[ffSVP[KD$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[DKt[PS[-K[fffffffS[J88t3[Ë[ffff̀rS[Jt[S[îJj1[ffSV[ÍJLz#u#Dz#V>u1Dz#^[Ðfffffff1ÐÐ1Ð1ÐXIÐ1ÐÐUSWV,[èIl$D|$@8|#|ƃ_& =sdfD|#Fw%@|#=uɋH|#뿐<|#QUhWL$L$뀋@|#|$@l$Dt1D|#t& 9s8u+p<|#ƃ8|#D$D$(D$$D$ D$D$D$<|#D$@|#D$ D|#fD$H|#D$D$Uj(P׃8^_[]Íu_&PQhR]fffffffUSWVXG$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$@78L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$ƿl$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$07D$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$07D$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$$4$4$4$4U$0R&U׶=r,j$ ?I;$u;^_[]Åt|.u|$PUPQhWf,hffffffUSWVX[8$L$p|$lGtG,t$x<t$|H<PVt$|UQ$$E$ 5BBWXfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$vCxnNj$L$|PQG$L$xPL$QG$ǃ$fB$) $W 9$A A L$|PQ G$L$xPQF$PjF$PQF$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPBƅxՍ7Pj 9F7Pt$&F7Pj5F7PjF$ 1۸$IUSWV[ l$ |$t$D$@tPN ) l$$FPj)uEF|PQXEfFD$@ u1ftpP VPEVj EG fffG )^_[]ÐUSWVP[ l$0t$$T$ |$D$@tPX T$$։)͉ $9L$(B99t$4D$,WPYDGPl$UHDGUVP誔L$4 )΁r&P?PQh=RCL$8QPC+l$ ^_[]fffffffS[ jt$ [ÐUSWV[õ $ $D$0$jU!CEt U uEEEj]U U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhU]tkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUAD$ djVUp PQsƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ PfP tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$P1$<#t<;t΋$doma1$in $sear1$ch #Õj P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P% $< t< 0$< w A< vhQt$8 ƅ_ЕPt$NnD$ kc$< t< H$< w&A< vhQt$V襇 ƅ_j VtuDU`1aL$ t ut1P&;L$4r$< t< L$;L$ $F< t< tΕPVd< D$<@@@@ @@D$@D$8Zj5Pj $PD$PD$;t$ s E$EtJPEDt%uHݕPWu퍃ޖPPBitccV[ML$0 ;$u ^_[]VUSWV[Ût$xPdžft91 9s)tQDŽͅtMtt|5X9utfxt PRWbdžtPadžf^_[]ÐUSV[ÔEuX|#jP<_$D$F$FWfF e^[]ÐUSWVx[3EL$ L$puX|#D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]TUSWV[Ût$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[tD$Att$0UP EO $L$(T$ L$L$L$ F< t< tjt$V &jPV >j PVҡ jPV踡 &yj PV螡 (ij PV脡 YjPVj  jPVP jPV6 j PV ijPV jPV jPVΠ jPV贠 j PV蚠  jPV} jPVc $`FP5d$/FP|Gt^/GddGtAPt$'F P;|GGtHPQX7< < {$H׋$uXt$0UP $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]|$ t0oE1tVPtEuv|$tT$D$D$L$ 9AD$$A D$(W街)D$ QPt$z |$|$D$ @1tjD$#gRKǃ)|$ KWQl$Ukz L$l$$XD$ @TȃuD$D$+D$L$$L$;ED$ @ ;D$ |$ OP1Ry L$l,G )D$ L$D$D$l$$X|$#44$#F(|#th|#9tF F$FNj(|#|#r|#R|#|#|#|#^_[]19u뫐S[nQPR誦 j0SWV[<t$8|#t3|#9t^t,|#|#z|#|#t7|# 9u |#~t ve8V\8^[19uΐS[t$78[ÐWVXL$ tsAQQBQQAA,|#tD|#49u4|#4~|#v|#|# |#|#^_19uSWV[\t$trT|#|#t/<t)|#|#z|#A)VPP.T$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍̚PQhRoL$4T$0^[L$QPQjbRyoL$T$0z̚L$PQhRFoL$ffffffUSWV[t$nEtjPu> EjVtE 1t u1@u)6d1Ƀ Vt^_[]ÐUSWV([8t$@l$<}GtjP71> G ujU躌0 81qujWjjjV 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP%` u !1(^_[]fffffUSWV[K|$ t$tGw#jPdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUV&u^/|$$KQ;v RPt2MQUQRPD EG/1^_[]ffUSWV[|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$[Q׍PQjbRi\$8=$oD$L$,td;l$tX14Eju77 t%MLH4jP7^9 ;l$u*oL$1 Gw)f_ ^_[]ffffffUSWV [|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$Re $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Ímc(PQhRgT$믐USWVhXD$|$|G =tŋ\$jj$W_{$jj$W;\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$o ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ# DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$W臅O t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$<1T$ (PQhTRQbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$=|(PQhRa끐USWV[fD$lAB9w}) >P2Q7 D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$Lj1Pj &`1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V#1Ʌt‰ D$0L$ЃVhP|[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08 1\$$(PQhRX\$T$ D$4@USWV[XT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJDHjWPVfi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P] L$,1TEMGDHjWPV.h t&dž(@f8u$dž  ^_[]ÐUSWV[֗zA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVf t׋@f8u$dž wSWV[\|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQLetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[øt$0l$$D$jPj |$"uOƃ\>"Įt%<9HuHP X>"@[fffffffffffUSWVY[T$r 1t\z:_X"_X"_o ݃xX" 9stǃuƁX"^_[]ÐSV[ڋVjV輯l#VPL^[fffSP[Ýn#u;$ n#jjPQjRft<$ t ǃn# [ffffUՑܑnnnnnnnnnnnnnnnninnnnnnnnnnnnnnnnps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleanersegment %d: bad seguse count %d%s: inval seg %d%s: rewriteseg returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALLusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ... bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: failed to read cleaner infoRead cleanerinfo: %d clean %d dirty %ld bfree %ld avail flags 0x%x%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: must clean%s: enough clean%s: dire straits%s: busy clean%s: failed to stat ifile%s: idle clean with fs idle %d%s: failed to get load avg%s: idle clean with load %f%s: default no clean%s: fcntl returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segments%s: fcntl returned %d (errno %d, %m)%s: errno %d, returning%s: reclaim failed with errno=%d%s: wrote %d direct and %d total frags to clean %d segs (%d%% recovery)%s: cleaner not making forward progressSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such error%s: coalesce: LFCNFILESTATS: %mcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodes%s: coalesce: LFCNREWRITEFILE: %mbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpwritepseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lld/home/builds/ab/HEAD-llvm/i386/20260712001445Z-dest/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystemillegal inode block size: %d cannot specify inode block size when version == 1 %d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblockidx < lfs_fi_getnblocks(fs, fip)%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedexamine files in%s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260712001445Z SMALL REJECT_NULSLINENO#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.6xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %spkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-30s %40s%-50s %-10s%-30s %-10s%H/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646tolowertoupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist.|../4l/$$/5%5%0l%l%K0011>1I1,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9c-o %s: option not supportedS]]S]]]]]]]]S]]]]]]]]]]]]]]]]]]]]]]]]]]]T]]]S ^ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU B||{Spp\bh 4W %<,ߥߥ5MS7) !llllllllllllllllllklӼllllllllllllllllllllllllllllllllllllllllllllbwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb neeeeeeeeeeeIeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee@@@@ @@ @ @ @@@@@@@@@@@@ @@ @@@@@@@@@@@@@ @@@@@@@@@@@@ @@@@ /@@@@ @@@a@@@@@ @}888|88888888888888888888888888888888888888888888888888888888888888888888888ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c``bwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%  :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'       !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                           OrpheanBeholderScryDoubt6789:;<=>?  !"#$%&'()*+,-./012345 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gyɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[                                         58Nt;#h>[~}A53      inflate 1.3.2 Copyright 1995-2026 Mark Adler  #+3;CScsK !1Aa  0@`@@`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @)))))))))))))))))))))))))))))))))))))))))))))))))))ccccccccccccccccccccccccccccccccccccccccccccccccccc======"@@@@@@@@@@@"@@@"@@@@@@@@@@@@@@@@@"@@@@@@@@@@@"@@@@@@@@@"$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH      o2$$$$$$$$$$$$2$$$$2$$$$$$$$$$$$$$$$$$2$$$$$$$$$$$$2$$$$$$$$$$2$ deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@` ԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶԶ ηηηηηηηηηηηηηηηηηηηηηηηηηηηηlŻ|||ٸ (jVssssssss\\ss\ssssssssssssssssss\sssssssssssssssssssssssssss`ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/truefalse * * * * * * * ! ~ * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * ,,,,,,,,,,,,,,\<)=)=)=)=o<)=)=)=<)=<)=)=)=)=)=)=<)=)=iacuteicirciexcligraveiquestiumllaquolt>@@eAAmAAQfIgIgIgIgfIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgIgfIgIgIgIgf !#&(*-/14}7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG0F=F:LFFXF{FFFFFFFF GG0GBGTGiG~GGGGGGGHF H5HYHnHHHHHHHHRIdIyIIIIIFF*LIIJJ J1JBJPJFFZJEE5L5LE5LEJJF&F&FE*L*L*L*L*L*L*L*L*L*L*L*LJJEJEEEEEK*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L*L KkKCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ((((( AAAAAABBBBBB BBBBB@(((((((((((((((          (((((((((((((((((°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°°5Ҷ ݹ!7,W!R8RAM?ýr{Ou````````J&QJ&dJ&wJ&J&J&J&J&J&J&K&K&(K&&C&*C&S&_&e&#H"2C(((((((((((((('<2h2t2$2y&&&&·&&&&&&8&L&_&#R#y&&&&&ň&׈&& &&)&G&[&z&&&&&Ӊ&H&&&!&B&\&z&&&NJ&&&&5&M&k&&&ы&&&&=&V&p&&&Ō&&&&0&C&P&a&u&&&&&&&&&1&K&^&w&&&&Ԏ&&&/&=&P&g&|&&&&Ə&ُ&&&&6( 2TT83T7U@" ?"@<"К3t38zVYU3cԫ38T2 T`7U83xT 3t" 93T$3T3@OД!]U7U30\303" 3-%H"""<"J"p"~"""Ÿ"""dd#"3-" X".##.$7%+%%C# (prog_root)`Ԧ3.C#l&C#C#C#C#C#C#D# D#D#D#D#%S#S#aLT#T# T#3T#:T#fT#mT#T#T#T#T#T#T#U#U#+U#2U#cU#nU#U#U#U#U#\5&U#{$U#U# V##V#0V#QV#^V#V#V#V#V#P$S# W#S#W#S#W#%"W#%+W#T#2W#T#=W#T#DW#T#PW#T#WW#T#bW#3T#mW#T#tW#T#W#T#W#T#W#fT#W#T#W#T#W#T#W#T#W#T#W#T#W#T#W#T#W#T#W#T#W#T#X#T#X#T#X#{$"X#V#,X#V#4X#U#;X#U#BX#cU#NX#U#YX#\5&bX##V#jX#U#qX##V#xX#QV#oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ( 3b ( ( ) ) @3 _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|3z  * . ` d f o 04?4sz p3""(3(3(3(3@3@3@3@3X3X3X3X3 e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it)33s`#$`#`#`#{#`#`#"`#>&;$`#`#1$`#;`# p#7`# a# a# a##&a#23a#8Ea# Oa#_a# ka#(|#}a#a#!a#a#9a#a#i#a#&}%fa#)a#a#5a#ea#:b#ne#% b#b#6}#b#4a#(b# 6b#+Db#,Vb#-eb#.xb#*b#b#?+/%b#E#b#/b#/b#'b#F[i&b# b#3~#&c#_$1$ #b#b# &}%fc#""2c# c#p#L`.3L\p#zp#mh.3Lp#p#p#np.3"DLp#p#p#ox.3 q#O.3  q#p.3H!P.3u'#q.3Lq#?q#kq#r.3"PLq#q#q#s.3!0Lr#.r#S.3!`LKr#[r#t.3kr#T.3qr#u.3L}r#r#r#V.3Hw.3"tLr#r#,s#x.3(ucs#os#X.3AhL{s#s#y.3}#J}#P}#\}#g}#v}#}#}#}#}#3$}#}#}#}#}#~#y#=|#~#~#.~#=~#F~#|#TLT'''tags(03403403643#x U| x} <<C###!+/%jR <]#l? >{#H t#E p#M |ǂ# G $؂#N C#{P +#{P c#S .*#T *#T 8#W S#W sl#T ?y#n ##V i#xLb#E #F-"P#c##a"l(&s#h#|L !"$'(+-.03569:#tL#%###`#-"aL#@L#H#j#   o#    S#i#s{##A##Bٙ####C$#B#W#f#mw##D#E#ٚ#d##r$#2#gM#Fe##%#M#-Л#R##a# %# A# [# l#*#A#Ɯ#ܜ##H83LP.P<3~ W#(  5 3  U#(۝ ՝ ` ( ؝ O  > 5 3 ?X  [#d# p#%$###b#j#ja$c<"f#h#kǿ#l׿#m#o#o#p#p#p'#q5&r%uZ%t#v#w1#w"x%x%z"z>#B#C%$JO#OY#Ph#So#Ts7%Vyu%Vz#X#Z#Z###p#d# [## # %"#/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8PATH=/usr/bin:/bin:/usr/sbin:/sbin0lNDqNHqN#a##EV#e@#F#I#i#L@#l#m#C{%n#f##p%#b,#u4#"=#H#q^$sU#a#h#v$VVj#xtsN@=dLB3`B3 #q$ ... ...#$#$8$8$9$N;$;$d#F$*F$I$d#3Q#L$M$(M$tO$O$$O$>R$LR$$R$R$$3Q#U$[V$W$l'Y$D3Y$]'C3l'Y$p]'C3Y$3M/QR,R`l'Y$D3Y$`l'%D3% s%UvXOYXYl'`]$D35]$_'D3xl'^$D3xH3`l'dcHe$D3 He$`l'ce$D3 e$`l'Fd~$D3 ~$`l'ee$D3 ee$hl' ee$D3.e$hl'PeP^$D3\$Xl'ea$D3a$Pl'fb^$&#Pl'mgo^$&#Pl'jx^$&#l'_$$F36&HN`F3hl'ij^$D3%%e$%%hl'j^$D3.e$%%.e$hl'Pe^$D3\$.e$\$Xl'lkdc$D3dc$l'm~$_$Df'G3xl'R_$0G3G3F3G3l'>_$D36&HNxG3TG3D3l'&G36&HNG3xl'^$G3H3G3G3l'l\$D3_$d'H3l'lzb$D3_$`'DH3l'&_$f'pH3G3 H3 J3LH3hF3F3F3$F3D3$F3$"E$#B%$N$%R$&6&'Y$(O$)b$*0$+k$,o$-s$/|$1$1$2$3$4l$5^$64 &'-|&'H$'/65&'%' zq#'!$' $'5{#'8ia&'K&$'>"'3~#'5%' #'8&'v%&c#''i%' *#'5>%'"$';$'P;$';ө%'5Ŀ$'GͿ$'C _%'> f%'B$'#%'Wq?&'6%a&'X"i#'ҿ$'4$' ׿$''Wp#'BD&'JCۿ$'0B&' *$'?$'(F$'+$'"'^1 $'+,$' *$'Gd=$' $'"B"'BD$'$'$' $'C$' *$'Y9$'8V"'&'BD$'a:&$' *$' *+$' *#'V%ܞ"'#p#'#^$'6N&'ܿ$'0}#'51$'2TK%'>K%'OE%'W$'7$'_H,c&'c)&'ȿI&'>?$'/5E$'2K$'BS$'A<t$'[$'#5%'Fd$'3=$'A$'OE#'!!nM#'oi$'!<+%'_?$' q$'>k#'8"1l&' #'w4.#'FHf$'7%'/#'l#$'OE"'z$$$$$$p#$$@!$QQ%y%{%Ƅ{%܄{%{%{%w{%4MU]evɅ&х'()*-<KZxՆv.DUfwʇ LpوLމ Koۊ!/= KYgy%u7%Ӌ8\j}kՌAbpӍ$$)$P$w"+%W$`$Ȏi$֎x$$7[`UÐҐ -U2GTi+%wW$`$<=>?˒yْzwxyZzl{|}Г~'9ykz{'|f$$-$;$I$W$e$s$'$2$1$<$&#ǖ<%Ֆ};$;$7%F$ )7ESao}ӗv@dvfuvՙ,D+\O$uT$Z$`$f$m$ϚӚ*Kb3(c3o| c3t|& c3d#8d3y|d#Xd3|d# xd3|(d3|~d3} d3} e3o}d#F e3z}}d#Ff3~~ g3 8g3hg3d#Fg3d#Fg3jd#F8h3d#Fh3Tq! h3$ Hi3?$ xi3d#F i3Mˀd#F Hj3O% j3; k3Hk3d#2$xk3:$d#2$k3:$d#2$l3:$d# l3d# l3d# m3d# (m3d# m3m3(n3vd#Fhn3d#Fn3ڂd#Fo3 Ho3 (o3Ad#p3d# 8p3$$$""nk%$'R$&#%5$$$?$$%$$$$$$$$ $i$$y$$""$ "e&$$$0$$$Z$$$$JE$č"$$ $7$H$S$b$$$$$j$$$/$O$""v$$Q$<&$%$8$"j%${"$$$$$5$\$m$$$(%3%G%p%0%%%%%%w%%=%L % % %y"/ % %a % % % % % % %%%4{$%%d%%%%%%%-%:%K%X%%%%W%*%?%L%x%%%%%<%r%%%%Z%%M%%%%%%=%V%%%_%w%%%% %S % % % % %!%)!%J!%P!%i!%v!%!%!%!%!%!%!%!%!% "%"% "%0"%F"%U"%b"%p"%|"%"%"%"%"%"%"% #%"#%#%$%!$%U$%$%,%%J%%"&%>&%'%(%(%*)%)%*%/*%Q*%[*%c*%m*%w*%*%*%*%*%*%*%*%+%F+%Z+%g+%s+%:$+%+%+%+%+%+%+%+%,%,%6,%Q,%p,%,%,%,%,%$,%jE$,%-% -%-%-%-%=-%D-%Q-%a-%z-%-%-%-%-%$-%-%-%.%#.%6.%C.%H.%Q.%W.%h.%4%q.%.%.%.%.%.%.%$.%.%.%/%/%&/%1/%>/%M/%\/%j/%y/%.0%S1%2%83%3%4%4%5%55%S5%e5%%$5%}"#5%5%5%5%5%5%5%6%<6%i6%6%6%6%6%7%7%=7%R7%{7%G8%_8%09%G8%A9%g9%9%9%8#:%?:%m:%}:%%$:%:%y{%:%:%:%;%3;%Z;%;%;%"8<%<%<%<%<%&=%w=%=%>%>%>%#3>%\>%c>%q>%~>%>%>%>%>%>%?%1l&9%=$1$$D@%?%?%@%@%1@%R@%"l@%}@%@%T$@%@%f%@%@%@%@%A%A%VD%qD%D%D%Q$JE$D%D%D%D%D%E%E%E%F%t#n$#F%%F%F%;$F%99$F%%F%o$F%F%F%G% G%LG%{G%G%G%G%G%G%H%vH%H%H%H%I%I%I%I%)I%7I%S%US%ZS%`S%iS%S%T%T%sU%U%'V%8%~"u%LV%dV%ea&V%V%V%V%5W%zW%W%X%X%};$X%X%X%Y%"Y%LY%Y%Y% Z%Z%AZ%aZ%~Z%Z%Z%Z%Z%Z%g&Z%Z%Z%Z%[%;[%K[%\[%y[%ێ"\%\%\%\%\%\%""\%\%\%]%,]%4]%<]%F]%Q]%c]%t]%]%]%]%]%JE$]%]%]%]%]%,% ^%^%#^%5^%H^%]^%h^%z^%^%^%^%^%^%^%^%^%^%^%^%_%"_%(_%;_%O_%c_%^%JE$]%r_%}_%_%_%_%_%_%_%_%_%"_%^%`%%`%3`%<`%Q`%c`%l`%m:%`%`%`%`%`%`%`%#`%`%a%!a%Bc%cc%c%c%c%c%e%e%e%f%"f%1f%Gf%yf%f%f%f%f%g%g%h%6h%h%h%xn T$@x%9&3JvW/~%!% & y%~%~%~%a&~%&_$~%~%$0~%~%~% ~%~%10~%&1|#'%( %)%*&+%.1/%@y%x$%+%%%%@u$ t$!%,%;%G%ï$ftp h%7?ܹ$@>8ARݻB%cC%cD %cE $[F %cG <"cH 6T$cI6%cJd#d#d#1f) vn q%%%%%%Œ%Ԓ%%%% %%^].^]gݥ%%dA.,R %d#d#d#d#d#d#d#d#d#C  -dd-ddTdd:dd:dd%y{%% % %%%%% #% %@,%@|%`6%;%F%%y{%w%&##K%#S%#[%#_%#e%$n%$v%$~%$%$%%%%%%~&%%%%&%&%&%'%'%'%(%(%(%)&) &)&* &**&*0&+;&+F&+M&,Y&,p&,c&,i&-t&-&-}&-&.&.&.&/&/&/&6&;&;&0&0&0&1&1&<&<#&=.&=9&>0&>C&?D%2K&2U&2[&3f&3p&3v&9&7&8&:&4&4&4&5&5& &! &" &# &$ &% && '&' 3&( ?&) K&* V&. b&+ n&, z&- &/ &0 &1 &2 &3 &4 &5 &6 &7 &8 &9 &:  &; &< $&= 0&> :&? D& @M&!@V&"@a&#@m&$@x&%@&&@&'@&)@&*@&+@&&`&'`&,@&-@&.@&/@&0@&(`!&1@-&2@:&3@G&)`T&4@`&5@m&6@z&7@&8@&9@&:@&*`&;@&<@&=@&>@&?@& ` &!`&+`$&,`1&"`>&#`K&-`X&$`e&.`r&/`&%`&C&C&D&D&E&E&F&F&c&c&d&d&e[%e&#&# &&&&'&06&D&H&L&P&T&X&]&b&h&n&u&|&&&&&&&&&&&&&& & #@&@ #& &&$&0# h$ #& +&@3&@$@E&@S&@Y&@c&`h&`t&x&~&#&& &@&@O d]&33333333d#d#/&/&/&/&/&3333B&UTC3333p2p2RLQALKxPUK(QK33|V33T3T3С3`39㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžx2 33UU33UU33UU$3!!!Д!3|3!!!Д!d3 Ԧ3!!!Д!Ĥ3$uU,3$3 j&j&j&k& k&a&uJ&J&J&"J&J&J&J&k&k&x   @ 0 33333333333333333333333333333333333333 333U4(4( 3333 0000000000000000 pV33330 33330!33`3h3p333 (root)`2C(((((((((((((('<2h2t2$2820(2(4(6(3P!`!p!!!!0!@!!0!p!!0!!!!0!!`!!!! !p!!@!P!Service unavailableq%s%4ԦIx= @ЉD,Bl,޿rt#j! 7ٰlT1b?eQgh[e&rreoДuuliY6]ؖ>3_2d|S38QI+cRWILJQ(/LIMQ2$g$1d0&1%213ge3RK] 'ramdiskbin.debuga.shstrtab.note.netbsd.ident.note.netbsd.pax.init.text.fini.rodata.tbss.init_array.ctors.dtors.jcr.data.rel.ro.got.got.plt.data.bss.SUNW_ctf.gnu_debuglink TTll/ 5;t" A"I2$O2$ [ 2 $b2$i2$n 2 ${2ĭ$02$ 3$3^%$"^%$_%_%MSGTXTS667 5352 5377 5394 5416 5419 5424 5432 5439 5447 5455 5458 5461 5464 5468 5480 5489 5502 5531 5546 6089 6123 6806 7094 7802 7858 7932 8028 8203 8226 8249 8255 8264 8286 8290 8294 8297 8300 8405 8608 8847 9288 9726 9761 9776 9788 9794 9806 9855 9875 9915 9932 9949 9964 10011 10049 10097 10179 10303 10439 10480 10518 10555 10590 10600 10649 10799 10805 10810 10814 10834 10944 10964 10970 10984 10996 11007 11044 11078 11102 11204 11241 11263 11362 11417 11475 11486 11502 11554 11722 11929 12100 12164 12216 12487 13036 13564 13995 14333 14666 14779 14794 14803 14963 15134 15284 15448 15471 15495 15510 15585 15725 15902 16057 16069 16149 16250 16296 16322 16392 16403 16412 16425 16451 16466 16482 16495 16550 16561 16576 16780 17013 17042 17057 17126 17200 17273 17303 17341 17964 18018 18437 18463 18492 18596 18702 18887 18999 19114 19218 19905 20164 20304 20340 20510 20551 20687 20710 20747 20792 21043 21139 21193 21292 21303 21340 21377 21404 21413 21447 21454 21479 21506 21541 21555 21569 21598 21612 21629 21638 21660 21678 21695 21706 21725 21751 21769 21792 21809 21824 21839 21857 21884 21911 21933 21972 21990 22022 22250 22324 22367 22413 22560 22716 22760 23039 23066 23425 23609 23761 23942 24089 24247 24268 24316 24326 24334 24345 24356 24366 24373 24388 24400 24437 24467 24506 24559 24617 24638 24645 24664 24685 24692 24714 24736 24756 24778 24809 24846 24868 24882 24928 24957 24991 25031 25066 25094 25142 25151 25160 25165 25174 25183 25200 25204 25209 25215 25219 25257 25266 25293 25313 25336 25355 25382 25404 25436 25452 25457 25467 25490 25512 25529 25546 25559 25568 25577 25583 25610 25617 25641 25662 25686 25699 25718 25743 25766 25782 25788 25800 25830 25838 25878 25889 25900 25911 25928 25945 25959 25976 26192 26496 26944 27160 27424 27696 27748 27784 27820 27871 27888 27926 27940 27947 27964 27967 27972 27981 27993 28004 28013 28034 28076 28114 28130 28161 28186 28221 28277 28317 28338 28358 28399 28428 28476 28709 28744 28951 28970 29007 29068 29106 29145 29301 29316 29362 29410 29433 29469 29479 29489 29500 29505 29568 29616 29660 29721 29754 29855 29873 30012 30034 30157 30171 30181 30204 30309 30365 30481 30512 30517 30543 30582 30592 30635 30645 30661 30676 30694 30717 30747 30768 30794 30991 31034 31038 31044 31050 31055 31066 31080 31109 31141 31153 31200 31250 31290 31317 31333 31342 31385 31391 31399 31403 31423 31440 31452 31483 31739 31788 32364 32391 32423 32451 32503 32509 32515 32520 32541 32557 32579 32608 32749 32883 32896 33032 33034 33036 33038 33055 33068 33086 33113 33117 33123 33128 33136 33142 33182 33184 33194 33209 33226 33260 33292 33330 33359 33388 33410 33453 33479 33523 33659 33692 33721 33766 33848 33853 33866 33877 33891 33905 33979 33981 33983 33998 34001 34050 34324 34337 34375 34387 34410 34423 34448 34473 34498 34523 34558 34589 34628 34683 34790 34819 34850 34880 34917 34973 35088 35124 35548 35571 35841 36147 36457 36673 36784 36883 36900 36923 36927 36934 36943 37065 37134 37422 37560 37701 37782 37829 37835 37844 37857 37880 37926 37929 37974 38017 38082 38144 38214 38282 38375 38594 38619 38623 38659 38677 38705 38747 38791 38855 38905 38981 39003 39055 39099 39138 39172 39202 39233 39258 39267 39279 39287 39298 39310 39329 39353 39402 39419 39443 39486 39808 39811 39825 39838 39850 39857 39868 39875 39882 39891 39901 39918 39934 39984 39992 40000 40010 40021 40039 40056 40077 40099 40108 40118 40145 40151 40161 40180 40196 40214 40234 40243 40254 40261 40278 40297 40318 40328 40345 40351 40367 40382 40397 40418 40440 40459 40469 40474 40479 40497 40516 40535 40541 40560 40580 40600 40618 40623 40629 40646 40662 40683 40696 40704 40724 40748 40765 40773 40784 40805 40811 40823 40845 40859 40868 40889 40907 40916 40950 40973 41000 41032 41055 41075 41086 41118 41134 41145 41158 41181 41203 41711 41741 41772 41800 41814 42015 42237 42404 42491 42508 42526 42543 42572 42619 42630 42649 42671 42750 42942 42970 43088 43110 43251 43270 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.6. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.6 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.6 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.6 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.6 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Das Paket "$0" ist optional und auf diesem Medium nicht vorhanden. Das ist kein Problem und die Installation wird forgesetzt. Das Paket kann nachtrglich installiert werden, z.B. durch download via https von der NetBSD CDN. Optionale Pakete sind: debug/debug32 mit debug Informationen base32 mit Untersttzung um 32bit Applikationen auf 64bit Architekturen zu verwenden test mit automatischen Testprogrammen manhtml mit Anleitung im html Format Fr einige Architekturen stehen unterschiedliche ISO Dateien fr CD und DVD Laufwerke zur verfgung, auf der DVD Version sind alle Installations-Pakete enthalten. Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.6 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.6 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Uhr scheint falsch zu gehen!Datum und Uhrzeit einstellenDatum und Uhrzeit wie eingestellt bernehmen$0 Bitte geben sie das aktuelle Datum und Uhrzeit ein. Eingestellte Zeit: $1 JahrMonat (1-12)Tag (1-31)Stunde (0-23)Minute (0-59)Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? TastaturschemadeInstalliere die Tabelle der defekten Blcke ... Mchten Sie normale oder serielle Bootblcke installieren? Normale Bootblcke benutzen die BIOS Konsolenschnittstelle als Konsole (meistens der Monitor und die Tastatur). Serielle Bootblcke benutzen den gewhlten seriellen Anschluss als Konsole. Selektierter Bootblock: BIOS KonsoleSerielle Konsole an com%d mit %d baudUnverndertAuswahl der BootblckeBIOS KonsoleSerielle Konsole an com0Serielle Konsole an com1Serielle Konsole an com2Serielle Konsole an com3Serielle Geschwindigkeit whlen...Vorhandene Bootblcke benutzenInstalliere die Bootblcke auf %s ... Diese Festplatte entspricht der folgenden BIOS Disk: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- --------------- ---- %#6x %8d %5d %8d %13u %3u Das ist die korrekte Geometriedie Geometrie von Hand setzenBenutzen Sie eine dieser FestplattenDiese Festplatte entspricht den folgenden BIOS Disks: BIOS # Zylinder Kpfe Sektoren Anzahl Sektoren GB ------ -------- ----- -------- ---------------- ---- %-1d: %#6x %8d %5d %8d %13u %3u Achtung: sysinst hat festgestellt, dass die von Ihnen ausgewhlte Festplatte einer anderen - dem BIOS bekannten - entspricht; damit sind obige Werte mit hchster Wahrscheinlichkeit korrekt, sollten also nicht verndert werden (die Werte fr Zylinder, Kpfe und Sektoren sind wahrscheinlich 1023, 255 und 63 - dies ist korrekt). Sie sollten nur die Geometrie abndern falls Sie wissen, dass das BIOS falsche Werte liefert. Festplatte auswhlen: Der NetBSD Teil der Festplatte liegt auerhalb der vom BIOS dieser Maschine adressierbaren Bereich. Eventuell knnen Sie von dieser Partition nicht booten. Sind Sie sicher, dass Sie fortfahren mchten? (Antworten Sie mit 'nein' um die Partitionen erneut zu editieren.)Sie haben mehr als ein Betriebssystem auf dieser Festplatte; allerdings ist kein 'bootmenu' (Eintrag fr den NetBSD Bootloader) fr die aktive Partition und/oder der Partition vorhanden, auf die NetBSD installiert werden soll. Wollen Sie die Partition zum Hinzufgen eines 'bootmenu' Eintrages editieren?Sie haben eine erweiterte Partition in das 'bootmenu' eingetragen. Doch scheint Ihr BIOS System den 'read' (Lese-) Befehl fr diese Version des 'bootmenu' Codes nicht zu untersttzen. Sind Sie sicher, dass Sie dennoch fortfahren mchten? (Antworten Sie 'nein' um zum Partitionierungsmen zurck zu gelangen.)Ihre Konfiguration bentigt den NetBSD Bootselect (Bootauswahl) Code, um das zu startende Betriebssystem beim Start des Computers zu whlen. Dieser ist gegenwrtig noch nicht installiert; wollen Sie dies jetzt tun?Der Bootcode im Master Boot Record scheint nicht gltig zu sein. Wollen Sie den NetBSD Bootcode installieren?Wollen Sie den Bootcode im Master Boot Record auf die letzte Version des NetBSD Bootcodes updaten?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypOrdnerBootmenSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivBootmenStandardbootPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition, (S)tandardauswahl$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.l networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chio chmod cp dd df ed ln ls mkdir mt mv pax pwd rcmd rm sh stty sync . ..MAKEDEVMSGTXTS667 5352 5390 5407 5422 5425 5428 5433 5441 5449 5457 5460 5463 5472 5484 5496 5505 5514 5540 5551 6086 6113 6679 6979 7620 7667 7780 7873 7907 7926 7944 7952 7961 7986 7990 7994 7997 8000 8122 8307 8535 9055 9406 9435 9448 9461 9466 9486 9505 9526 9585 9602 9616 9638 9683 9709 9750 9828 9946 10060 10114 10143 10175 10214 10220 10253 10376 10383 10387 10395 10419 10501 10507 10514 10526 10540 10549 10582 10601 10613 10723 10785 10804 10923 10974 11026 11038 11057 11109 11313 11521 11712 11772 11821 12087 12545 13210 13632 13954 14379 14511 14543 14555 14733 14930 15091 15225 15245 15278 15292 15361 15474 15646 15781 15801 15913 16005 16028 16051 16110 16125 16146 16161 16182 16202 16227 16241 16265 16277 16295 16505 16755 16776 16792 16845 16913 16986 17023 17049 17596 17672 18129 18155 18177 18284 18391 18592 18665 18749 18849 19344 19582 19733 19767 19902 19946 20085 20126 20171 20218 20462 20595 20657 20751 20756 20790 20824 20839 20867 20900 20907 20932 20950 20976 20983 20998 21013 21033 21073 21090 21110 21131 21153 21168 21188 21210 21225 21238 21252 21264 21276 21290 21313 21336 21354 21397 21448 21485 21670 21733 21769 21818 21909 22039 22092 22352 22399 22760 22910 23079 23219 23339 23471 23511 23558 23568 23576 23586 23594 23605 23616 23630 23655 23696 23729 23762 23797 23851 23876 23895 23917 23922 23928 23957 23974 24001 24019 24040 24062 24081 24091 24121 24147 24174 24223 24251 24278 24331 24341 24351 24357 24367 24376 24396 24400 24405 24411 24415 24450 24459 24490 24507 24534 24555 24575 24594 24620 24633 24641 24657 24688 24719 24740 24766 24779 24787 24798 24804 24828 24838 24850 24868 24879 24899 24915 24941 24963 24979 24991 25011 25037 25043 25073 25087 25101 25124 25143 25162 25180 25198 25421 25727 26145 26346 26586 26770 26848 26903 26970 27010 27033 27067 27078 27086 27109 27112 27115 27121 27132 27144 27157 27187 27231 27244 27257 27294 27308 27319 27330 27341 27358 27369 27416 27439 27488 27729 27762 28017 28038 28071 28124 28150 28177 28333 28339 28382 28402 28421 28450 28457 28464 28471 28476 28525 28563 28597 28654 28682 28727 28744 28845 28850 28927 28941 28951 28975 29098 29179 29289 29317 29322 29338 29367 29375 29416 29423 29437 29450 29458 29477 29510 29530 29550 29766 29797 29802 29809 29816 29820 29834 29846 29861 29894 29907 29962 30020 30056 30074 30092 30110 30147 30153 30161 30165 30186 30203 30214 30236 30414 30458 31160 31184 31218 31237 31282 31289 31296 31300 31324 31335 31340 31403 31524 31647 31660 31794 31796 31798 31800 31810 31819 31832 31859 31863 31869 31874 31883 31888 31915 31917 31930 31942 31957 31985 32029 32076 32092 32114 32125 32158 32178 32227 32327 32354 32372 32403 32465 32470 32483 32494 32506 32520 32574 32576 32578 32594 32597 32639 32908 32921 32954 32966 32990 33008 33031 33054 33077 33100 33121 33147 33189 33243 33346 33373 33403 33428 33453 33510 33619 33652 34025 34040 34280 34531 34844 34998 35116 35236 35253 35276 35281 35287 35296 35405 35464 35715 35856 35983 36051 36088 36095 36104 36112 36139 36185 36188 36235 36280 36331 36390 36459 36506 36611 36754 36779 36783 36817 36834 36858 36910 36961 37033 37099 37197 37214 37245 37281 37315 37339 37363 37396 37416 37426 37434 37442 37452 37463 37477 37503 37551 37574 37594 37635 37934 37937 37951 37963 37970 37989 38003 38010 38017 38026 38036 38053 38069 38117 38125 38133 38143 38154 38172 38189 38208 38228 38235 38252 38269 38276 38289 38324 38341 38360 38380 38390 38406 38419 38437 38457 38478 38488 38508 38528 38541 38560 38573 38597 38620 38633 38644 38649 38656 38674 38693 38712 38720 38739 38759 38784 38802 38809 38816 38829 38838 38859 38872 38880 38900 38928 38945 38951 38962 38993 39001 39014 39036 39058 39067 39088 39106 39113 39136 39155 39182 39200 39220 39233 39248 39269 39283 39290 39304 39319 39338 39883 39916 39944 39973 39981 40018 40330 40507 40584 40601 40619 40634 40656 40706 40716 40733 40755 40814 40972 40996 41126 41151 41277 41295 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.6. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.6 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.6 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.6 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.6. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.6Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.6Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Tipo de tecladoesInstalando la tabla de bloques malos ... Le gustaria instalar el set normal de bootblocks o bootblocks por serie? Bootblocks normal usa el dispositivo de consola de BIOS como consola (normalmente el monitor y teclado). Bootblocks por serie usa el primer puerto serie como consola. Bootblock seleccionado: Consola BIOSPuerto serie en com%D en %d baudSin cambiosSeleccion de bootblocksUsar consola BIOSUsar puerto serie com0Usar puerto serie com1Usar puerto serie com2Usar puerto serie com3Baudios puerto serieUsar bootblocks existenteInstalando bloques de arranque en %s.... Este disco coincide con el siguiente disco de BIOS: BIOS # cilindros cabez sectors sect. totales GB ------ --------- ----- ------- ------------- ---- %#6x %9d %5d %7d %13u %3u Esta es la geometra correctaAjustar geometra a manoUsar uno de estos discosEste disco coincide con los siguientes discos de BIOS: BIOS # cilindros cabez sectors sect totales GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Nota: como sysinst es capaz de concordar unicamente el disco que escoja con un disco conocido por BIOS, los valores anteriores son probablemente correctos, y no deberan ser cambiados (los valores para cilindros, cabezales y sectores son probablemente 1023, 255 y 63 - esto es correcto). Solo debera cambiar la geometra si sabe que su BIOS reporta valores incorrectos. Escoja disco: La parte NetBSD del disco est fuera del rango que la BIOS de su maquina puede acceder. Puede que no sea posible iniciar desde ahi. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicion de particiones.)Tiene mas de un sistema operativo en el disco, pero no ha especificado un 'menu de arranque' para la particin activa o la particin de NetBSD en la que lo va a instalar. Quiere re-editar la particin para aadir una entrada en el menu de arranque?Ha pedido que una particin extendida sea incluida en el men de arranque. Sin embargo la BIOS de su sistema no parece soportar el comando de lectura usado por esa versin del cdigo del menu de arranque. Est seguro de que quiere hacer eso? (Seleccionando 'no' le devolver al men de edicin de particiones.)Su configuracin requiere el cdigo de bootselect de NetBSD para seleccionar que sistema usar. Actualmente no est instalado, lo quiere instalar ahora?El cdigo de arranque del Master Boot Record no parece ser vlido. Quiere instalar el cdigo de arranque de NetBSD?Quiere actualizar el cdigo de arranque en el Master Boot Record a la ultima versin del cdigo de arranque de NetBSD?Ncleo (GENERIC)Kernel (GENERIC_KASLR)TipoMountBootmenuNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activabootmenupredef.Tipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctiva, bootselect (p)redefinidoConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy locaMSGTXTS667 5352 5388 5405 5420 5424 5428 5433 5444 5450 5456 5459 5462 5465 5469 5481 5493 5503 5533 5545 5974 6001 6577 6937 7622 7683 7761 7856 7896 7918 7936 7942 7951 7977 7981 7985 7988 7991 8113 8298 8526 9055 9473 9502 9515 9528 9535 9555 9574 9597 9640 9660 9679 9702 9746 9775 9816 9882 9994 10108 10162 10191 10223 10262 10268 10301 10379 10385 10389 10394 10435 10572 10582 10590 10609 10623 10632 10664 10705 10718 10843 10901 10920 11039 11095 11147 11158 11174 11213 11463 11635 11807 11862 11897 12146 12549 12847 13114 13475 13655 13974 13994 14007 14196 14340 14536 14670 14690 14723 14742 14843 14998 15186 15373 15393 15472 15570 15608 15631 15721 15742 15765 15784 15808 15838 15882 15915 15938 15950 15968 16236 16555 16586 16621 16685 16760 16830 16861 16891 17438 17530 18021 18051 18068 18208 18349 18546 18665 18812 18979 19537 19833 20014 20059 20222 20276 20411 20447 20507 20557 20848 20957 21014 21111 21116 21151 21186 21201 21225 21258 21263 21288 21304 21327 21334 21351 21366 21385 21417 21421 21441 21459 21471 21484 21502 21526 21544 21563 21590 21617 21629 21650 21680 21710 21735 21768 21803 21841 22094 22163 22218 22279 22397 22556 22610 22871 22922 23298 23453 23597 23737 23845 24030 24060 24103 24113 24121 24131 24143 24164 24173 24179 24211 24251 24287 24325 24362 24410 24434 24446 24460 24468 24476 24503 24520 24549 24570 24593 24602 24621 24633 24677 24715 24742 24786 24814 24841 24894 24905 24916 24923 24933 24942 24976 24980 24985 24991 24995 25030 25040 25070 25093 25122 25144 25166 25188 25215 25227 25239 25258 25292 25325 25346 25370 25383 25395 25408 25414 25440 25450 25461 25485 25495 25515 25535 25552 25578 25602 25615 25635 25669 25676 25705 25728 25751 25767 25782 25797 25812 25826 26014 26319 26750 26941 27176 27364 27406 27456 27510 27558 27580 27621 27632 27640 27664 27668 27672 27681 27692 27703 27718 27749 27795 27808 27821 27851 27865 27877 27889 27901 27919 27942 27987 28010 28070 28322 28349 28611 28629 28656 28705 28735 28766 28898 28905 28954 28977 29001 29030 29038 29048 29056 29061 29114 29163 29203 29269 29302 29346 29369 29470 29475 29552 29566 29576 29600 29723 29804 29914 29942 29947 29963 29992 30000 30041 30049 30063 30076 30084 30103 30136 30156 30176 30392 30423 30443 30449 30456 30460 30475 30494 30520 30529 30541 30595 30653 30688 30707 30724 30736 30771 30777 30785 30789 30810 30827 30838 30863 31041 31095 31786 31805 31840 31870 31916 31922 31929 31933 31957 31973 31979 32054 32204 32323 32336 32404 32406 32408 32410 32420 32433 32450 32477 32481 32487 32492 32501 32506 32533 32535 32548 32560 32575 32603 32647 32694 32710 32732 32743 32776 32796 32845 32945 32972 32990 33021 33083 33088 33101 33112 33124 33138 33192 33194 33196 33212 33215 33266 33588 33604 33635 33655 33691 33708 33724 33740 33756 33772 33794 33839 33887 33938 34057 34084 34109 34129 34158 34212 34337 34370 34596 34620 34902 35185 35459 35646 35770 35895 35912 35935 35940 35946 35951 36054 36106 36352 36513 36668 36739 36792 36799 36817 36824 36851 36901 36904 36947 36993 37048 37107 37176 37223 37328 37471 37496 37500 37534 37551 37589 37642 37682 37758 37823 37917 37938 37976 38016 38052 38076 38099 38138 38168 38175 38184 38192 38200 38214 38230 38258 38310 38327 38348 38392 38734 38738 38753 38764 38772 38791 38803 38810 38817 38826 38836 38853 38869 38923 38931 38939 38949 38960 38978 38995 39011 39029 39036 39054 39071 39078 39088 39119 39138 39157 39177 39187 39206 39219 39239 39259 39280 39290 39309 39328 39338 39355 39369 39392 39416 39429 39439 39444 39448 39466 39485 39504 39509 39528 39548 39573 39588 39592 39599 39609 39618 39639 39653 39661 39681 39707 39724 39732 39743 39774 39779 39792 39814 39829 39838 39859 39877 39886 39930 39954 39981 39996 40013 40027 40058 40082 40113 40120 40134 40149 40168 40713 40746 40774 40803 40811 40848 41160 41337 41414 41431 41449 41464 41486 41536 41546 41563 41585 41644 41802 41826 41956 41981 42107 42125 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.6. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.6 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.6 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.6 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.6 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.6 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.6Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Type de clavierfrInstallation de la table des blocs dfectueux ... Voulez-vous installer le programme de dmarrage standard ou sur port srie ? Le programme de dmarrage standard utilise les priphriques dfinis par le BIOS (en gnral le moniteur et le clavier). Le programme de dmarrage sur port srie utilise quant lui le premier port srie. Programme de dmarrage slectionn : Console du BIOSPort srie com%d, baud rate %dPas de modificationSlection du programme de dmarrageConsole du BIOS port srie com0port srie com1port srie com2port srie com3Vitesse du port srieConserver le programme de dmarrage existantInstallation programme de dmarrage sur %s ... Ce disque correspond au disque du BIOS suivant : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %#6x %9d %5d %8d %20u %3u C'est la bonne gomtrieEntrer la gomtrieUtiliser l'un de ces disquesCe disque correspond aux disques du BIOS suivants : BIOS # cylindres ttes secteurs nb total de secteurs GB ------ --------- ----- -------- -------------------- ---- %-1d: %#6x %9d %5d %8d %20u %3u Note: puisque sysinst a pu trouver une correspondance unique entre le disque choisi et un disque connu du BIOS, les valeurs ci-dessus sont probablement correctes. Modifiez-les uniquement si elles sont manifestement fausses. Choisissez un disque : La partition de votre disque rserve NetBSD se trouve en-dehors de l'espace que le BIOS de votre machine peut adresser. L'amorage depuis cette partition ne sera peut-tre pas possible. Voulez-vous rellement faire ceci ? ('Non' vous ramnera au menu d'dition des partitions.)Vous avez plus d'un systme d'exploitation sur ce disque, mais vous n'avez pas spcifi d'entre dans le menu de boot pour la partition active ou la partition NetBSD sur laquelle vous allez installer. Voulez-vous rediter la partition pour ajouter une entre dans le menu de boot ?Vous avez ajout une partition tendue au menu de boot, mais il semble que le BIOS de votre systme ne supporte pas la commande de lecture utilise par cette version du menu de boot. Voulez-vous vraiment faire ceci ? ('non' vous ramnera au menu d'dition des partitions.)Votre configuration ncessite le selecteur de boot de NetBSD pour choisir le systme d'exploitation dmarrer. Il n'est pour l'instant pas install, voulez-vous l'installer maintenant ?Le code d'amorage dans le secteur de boot ne semble pas tre valide. Voulez-vous installer le code d'amorage de NetBSD ?Voulez-vous mettre jour le code d'amorage dans le secteur de boot avec la dernire version du code d'amorage de NetBSD ?Kernel (GENERIC)Kernel (GENERIC_KASLR)TypeMountMenuVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activemenu de dmarragedfautType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (Ac)tive partition, bootselect (d)efaultConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.ndom characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. dhcpcd.confgroup master.passwd netconfig protocolsservices ...MSGTXTS667 5352 5393 5409 5427 5431 5435 5445 5454 5460 5466 5469 5472 5481 5491 5504 5512 5523 5548 5560 6068 6100 6592 6881 7426 7472 7576 7662 7698 7713 7731 7739 7747 7774 7778 7782 7785 7788 7899 8084 8312 8788 9122 9151 9166 9181 9189 9203 9221 9242 9293 9309 9319 9339 9385 9415 9468 9525 9636 9757 9801 9834 9873 9907 9914 9947 10024 10030 10037 10044 10073 10185 10191 10202 10219 10236 10245 10274 10286 10296 10397 10459 10479 10599 10636 10692 10706 10727 10764 10974 11149 11298 11333 11385 11601 11914 12437 12798 13088 13481 13616 13629 13640 13786 13965 14096 14230 14250 14283 14302 14385 14500 14641 14766 14780 14888 14981 15010 15030 15106 15123 15141 15157 15176 15196 15213 15225 15251 15263 15281 15482 15721 15748 15765 15821 15883 15943 15974 15998 16545 16604 16950 16980 16997 17105 17215 17355 17429 17505 17583 18075 18295 18406 18437 18564 18600 18728 18755 18795 18841 19057 19181 19249 19349 19354 19390 19426 19440 19463 19496 19500 19525 19544 19570 19575 19590 19605 19624 19649 19661 19683 19700 19713 19725 19743 19767 19782 19799 19812 19823 19834 19854 19883 19912 19936 19971 20006 20033 20220 20269 20301 20349 20446 20579 20625 20817 20847 21169 21298 21438 21578 21695 21830 21874 21917 21925 21935 21947 21959 21967 21978 22005 22039 22074 22105 22140 22176 22223 22243 22260 22278 22283 22290 22315 22331 22352 22369 22386 22404 22421 22434 22465 22490 22521 22552 22587 22614 22667 22677 22687 22693 22702 22710 22725 22729 22734 22740 22744 22779 22789 22818 22834 22860 22877 22896 22917 22933 22946 22951 22959 22974 23000 23019 23047 23065 23076 23082 23088 23109 23119 23130 23148 23170 23187 23200 23221 23241 23261 23272 23285 23307 23314 23339 23354 23374 23386 23403 23420 23440 23459 23636 23920 24230 24410 24621 24809 24875 24922 24977 25021 25041 25070 25082 25088 25104 25108 25112 25120 25130 25142 25157 25176 25212 25223 25234 25273 25285 25295 25305 25315 25331 25349 25398 25419 25464 25708 25734 25988 26003 26029 26086 26120 26155 26297 26314 26363 26384 26400 26429 26434 26439 26445 26450 26489 26524 26554 26609 26642 26688 26702 26781 26786 26840 26854 26864 26888 26974 27022 27128 27162 27169 27184 27211 27220 27259 27266 27288 27307 27323 27341 27373 27392 27409 27566 27597 27604 27613 27621 27628 27642 27660 27679 27689 27701 27742 27787 27816 27837 27860 27879 27917 27923 27931 27935 27956 27973 27982 28001 28147 28189 28699 28707 28731 28749 28793 28798 28803 28807 28838 28851 28860 28906 29032 29123 29135 29199 29201 29203 29205 29215 29229 29244 29271 29275 29281 29286 29295 29300 29327 29329 29344 29355 29370 29398 29442 29489 29505 29527 29538 29571 29591 29640 29740 29767 29785 29816 29878 29883 29896 29907 29919 29933 29987 29989 29991 30005 30008 30047 30147 30160 30191 30201 30218 30236 30264 30292 30320 30348 30361 30390 30425 30471 30576 30603 30632 30656 30683 30727 30838 30870 31138 31153 31386 31599 31859 32025 32115 32201 32218 32241 32248 32254 32264 32363 32419 32695 32819 32930 32992 33030 33038 33055 33064 33086 33135 33138 33181 33226 33281 33340 33409 33456 33561 33704 33729 33733 33767 33783 33808 33856 33892 33953 34007 34088 34110 34149 34186 34218 34242 34269 34295 34309 34317 34327 34335 34349 34362 34374 34398 34439 34465 34482 34511 34835 34838 34852 34864 34870 34886 34898 34905 34912 34921 34931 34948 34964 35007 35015 35023 35033 35044 35062 35079 35092 35118 35125 35133 35150 35158 35175 35199 35218 35237 35256 35266 35277 35291 35309 35329 35349 35358 35381 35401 35412 35427 35439 35458 35477 35488 35498 35503 35509 35527 35546 35565 35572 35591 35611 35636 35653 35659 35667 35677 35689 35710 35726 35734 35754 35774 35796 35804 35815 35838 35845 35859 35881 35898 35907 35928 35946 35955 35986 36002 36029 36048 36068 36086 36107 36121 36141 36148 36167 36182 36201 36746 36779 36807 36836 36844 36881 37193 37370 37447 37464 37482 37497 37519 37569 37579 37596 37618 37677 37835 37859 37989 38014 38140 38158 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.6. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.6 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.6 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.6 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.6 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.6Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.6Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Keyboard typeplInstalowanie tablicy zlych blokow ... Czy chcesz zainstalowac normalne bootbloki, czy te do uzycia z zewn. konsola? Selected bootblock: Konsola BIOSPort szeregowy com%d, %d bodowBez zmianWybor bootblokowUzyj konsoli BIOSUzyj portu szeregowego com0Uzyj portu szeregowego com1Uzyj portu szeregowego com2Uzyj portu szeregowego com3Liczba bodowUzyj istniejacych bootblokowInstalowanie bootblokow na %s.... Ten dysk odpowiada ponizszemu dyskowi BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %#6x %8d %7d %7d %13u %3u To jest prawidlowa geometriaUstaw geometrie recznieUzyj jednego z tych dyskowTen dysk odpowiada ponizszym dyskom BIOS: BIOS # cylindry glowice sektory razem sektory GB ------ -------- ------- ------- ------------- ---- %-1d: %6x %8d %7d %7d %13u %3u Notatka: od kiedy sysinst jest w stanie unikalnie rozpoznac dysk, ktory wybrales i powiazac go z dyskiem BIOS, wartosci wyswietlane powyzej sa bardzo prawdopodobnie prawidlowe i nie powinny byc zmieniane. Zmieniaj je tylko wtedy jesli sa naprawde _obrzydliwie_ zle. Wybierz dysk: Czesc NetBSD dysku lezy poza obszarem, ktory BIOS w twojej maszynie moze zaadresowac. Nie mozliwe bedzie bootowanie z tego dysku. Jestes pewien, ze chcesz to zrobic? (Odpowiedz 'nie' zabierze cie spowrotem do menu edycji partycji.)Masz wiecej niz jeden system operacyjny na tym dysku, ale nie zostalo wskazane menu ani dla aktywnej partycji ani dla partycji NetBSD, ktora bedzie zainstalowana. Chcesz zmienic partycje, aby dodac wpis do menu?Wskazane zostalo, ze w menu zostanie zawarta partycja rozszerzona. Nie wyglada na to, ze system BIOS wspiera polecenie odczytu uzywane przez te wersje kodu menu. Czy na pewno chcesz tak zrobic? (Odpowiedz 'nie' przeniesie z powrotem do menu zmiany partycji.)Twoje konfiguracja wymaga kodu rozruchowego NetBSD, aby wybierac, ktorego systemu operacyjnego uzywac. Nie jest on obecnie zainstalowany. Czy zainstalowac go teraz?Kod rozruchowy w MBR nie wyglada na poprawny. Chcesz zainstalowac kod rozruchowy NetBSD?Chcesz uaktualnic kod rozruchowy w MBR do najnowszej wersji kodu rozruchowego NetBSD?Kernel (GENERIC)Kernel (GENERIC_KASLR)RodzajMountWpis menuNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaw menu startowymdomyslnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partition, bootselect (d)efaultKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of ra#!/bin/sh - # # Generated from: # NetBSD: MAKEDEV.awk,v 1.29 2020/06/13 19:46:23 thorpej Exp # NetBSD: MAKEDEV.tmpl,v 1.239 2026/06/27 19:58:26 riastradh Exp # NetBSD: etc.i386/MAKEDEV.conf,v 1.37 2025/03/28 18:41:26 riastradh Exp # # Copyright (c) 2003,2007,2008 The NetBSD Foundation, Inc. # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE FOUNDATION OR CONTRIBUTORS # BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # ########################################################################### # # # Device "make" file. Valid special arguments: # all makes all known devices, including local devices. # Tries to make the 'standard' number of each type. # init A set of devices that is used for MFS /dev by init. # May be equal to "all". # floppy devices to be put on install floppies # ramdisk devices to be put into INSTALL kernel ramdisks. # std standard devices # local configuration specific devices # lua Lua device # wscons make wscons devices # usbs make USB devices # virtio virtio(4)-related devices # # # NOTE: # # * MAKEDEV is used both as a standalone script (via "sh ./MAKEDEV # all" or similar), and as a function library for MAKEDEV.local (via # "MAKEDEV_AS_LIBRARY=1 . MAKEDEV"). Because of this, the script # should consist almost entirely of function definitions, apart from a # few lines right at the end. # # * MAKEDEV may be executed in an environment that is missing some # common commands. For example, it may be executed from a minimal # system used during installation, or it may be executed early in the # boot sequence before most file systems have been mounted. It may # also be executed in a cross-build environment on a non-NetBSD host. # usage() { cat 1>&2 << _USAGE_ Usage: ${0##*/} [-fMsu] [-m mknod] [-p pax] [-t mtree] special [...] Create listed special devices. Options: -f Force permissions to be updated on existing devices. -M Create memory file system. -m mknod Name of mknod(8) program. [\$TOOL_MKNOD or mknod] -p pax Name of pax(1) program. [\$TOOL_PAX or pax] -s Generate mtree(8) specfile instead of creating devices. -t mtree Name of mtree(8) program. [\$TOOL_MTREE or mtree] -u Don't re-create devices that already exist. _USAGE_ exit 1 } # zeropad width number # display number with a zero (`0') padding of width digits. # zeropad() { case $(($1 - ${#2})) in 5) echo 00000$2;; 4) echo 0000$2;; 3) echo 000$2;; 2) echo 00$2;; 1) echo 0$2;; 0) echo $2;; *) die "bad padding" ;; esac } # hexprint number # display (base10) number as hexadecimal # hexprint() { val="$(($1 + 0))" hex= set -- 0 1 2 3 4 5 6 7 8 9 a b c d e f while [ "$val" -gt 0 ]; do eval hex=\${$(($val % 16 + 1))}\$hex val="$(($val / 16))" done echo "${hex:-0}" } # linecount multiline_string # count the number of lines in the string # linecount() { local IFS=' ' # just a newline, no other white space between the quotes set -- $1 echo $# } # nooutput -12 cmd [args...] # run a command with stdout and/or stderr ignored. # "nooutput -1 cmd" is like "cmd >/dev/null"; # "nooutput -2 cmd" is like "{ cmd ; } 2>/dev/null"; # "nooutput -12 cmd" is like "{ cmd ; } >/dev/null 2>&1"; # except they should work even if /dev/null doesn't [yet] exist. # # The "{...}" wrapper used in cases where stderr is redirected # serves to capture shell error messages such as "cmd: not found". # nooutput() { local flags="$1" ; shift local junk case "$flags" in "-1") junk="$( "$@" )" ;; "-2") ( exec 4>&1 ; junk="$( { "$@" ; } 2>&1 1>&4 )" ) ;; "-12") junk="$( { "$@" ; } 2>&1 )" ;; *) warn "Incorrect use of nooutput" ;; esac } # check_pax path_to_pax # Check whether pax exists and supports the command line options # and input format that we will want to use. # check_pax() { local pax="$1" echo ". type=dir optional" | nooutput -12 "${pax}" -r -w -M -pe . } # check_mtree path_to_mtree # Check whether mtree exists and supports the command line options # and input format that we will want to use. # check_mtree() { local mtree="$1" echo ". type=dir optional" | nooutput -12 "${mtree}" -e -U } # setup args... # Parse command line arguments, exit on error. # Callers should shift $((OPTIND - 1)) afterwards. # setup() { PATH=/sbin:/usr/sbin:/bin:/usr/bin:/rescue : ${HOST_SH:=sh} : ${TOOL_MKNOD:=mknod} : ${TOOL_MTREE:=mtree} : ${TOOL_PAX:=pax} status=0 do_create_mfs=false do_force=false do_mknod=false do_pax=false do_mtree=false do_redirect=false do_specfile=false do_update=false opts= while getopts Mfm:p:st:u ch; do # Note that $opts is only for options passed through to # MAKEDEV.local, not for all options. case ${ch} in M) # "-M" sets do_create_mfs; # "-M -M" is for use from init(8), and sets do_redirect do_redirect=$do_create_mfs do_create_mfs=true ;; f) do_force=true opts="${opts} -f" ;; m) TOOL_MKNOD=${OPTARG} do_mknod=true opts="${opts} -m ${OPTARG}" ;; p) TOOL_PAX="${OPTARG}" if check_pax "${TOOL_PAX}"; then do_pax=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -p option:" \ "${TOOL_PAX} is missing or broken" do_mknod=true fi ;; s) do_specfile=true opts="${opts} -s" ;; t) TOOL_MTREE="${OPTARG}" if check_mtree "${TOOL_MTREE}"; then do_mtree=true # do not add this to $opts; we will later # add "-s" instead. else warn "Ignored -t option:" \ "${TOOL_MTREE} is missing or broken" do_mknod=true fi ;; u) do_update=true opts="${opts} -u" ;; *) usage ;; esac done shift $((${OPTIND} - 1)) [ $# -gt 0 ] || usage u_root="0" u_uucp="66" g_gpio="29" g_kmem="2" g_ntpd="15" g_nvmm="34" g_operator="5" g_wheel="0" dialin=0 dialout=524288 callunit=262144 # only allow read&write for owner by default umask 077 # Set fdesc_mounted=true if the fdesc file system is mounted # on the current directory (typically "/dev"). # Later, this will be used to suppress creation of device nodes # that are supplied by the fdesc file system. # fdesc_mounted=false if [ -d fd ]; then # Parse the output from "mount -u -o nosuchoption .". # We don't parse the output from df(1) because that's # less likely to be available on install media. # # If the current directory is a mount point for the # fdesc file system, then the expected output (whether # or not the current user is root) is: # mount_fdesc: -o suchoption: option not supported. # # If the current directory is not a mount point, then # the expected output is: # mount: .: unknown special file or file system. # # If we are not running on NetBSD, or mount(8) is not # found, then we should get some other error message. # case "$({ LC_ALL=C mount -u -o nosuchoption . ; } 2>&1)" in *mount_fdesc*) fdesc_mounted=true ;; esac fi # do_force requires mknod if $do_force; then if $do_mtree || $do_pax || $do_specfile; then die "-f option works only with mknod" fi do_mknod=true fi # do_force and do_update do not work together if $do_force && $do_update; then die "-f and -u options do not work together" fi # If no explicit method was specified on the command line or # forced above, then use one of mtree, pax, or mknod, in that # order of preference. # # mtree is preferred because it's fast and designed for the # purpose. However, it's unlikely to be available early in the # boot sequence, when init(8) may invoke MAKEDEV(8). # # pax is usually acceptable, and it's likely to be available # early in the boot sequence. However, it's much slower than mtree. # # mknod is just very slow, because the shell has to fork for # each device node. # case ",${do_mtree},,${do_pax},,${do_mknod},,${do_specfile}," in ( ,false,,false,,false,,false, ) if check_mtree "${TOOL_MTREE}"; then do_mtree=true elif check_pax "${TOOL_PAX}"; then do_pax=true else do_mknod=true fi ;; ( *,true,*,true,* ) die "-m, -p, -s, and -t options are mutually exclusive" ;; esac # If we are using mknod, then decide what options to pass it. MKNOD="${TOOL_MKNOD:-mknod} -F netbsd" if $do_mknod; then if $do_force; then MKNOD="${MKNOD} -R" else MKNOD="${MKNOD} -r" fi fi # do_mtree or do_pax internally implies do_specfile. # This happens after checking for mutually-exclusive options. if $do_mtree || $do_pax && ! $do_specfile; then do_specfile=true opts="${opts} -s" fi } # specfile_before # This is called before the bulk of the makedev processing, # if do_specfile is set. # # It simply prints ". type=dir optional", which must be the # first line of the specfile. # specfile_before() { echo ". type=dir optional" } # mtree_after # Output in specfile format is piped into this function. # # It uses mtree to create the devices defined in the specfile. # mtree_after() { nooutput -1 "${TOOL_MTREE}" -e -U } # pax_after # Output in specfile format is piped into this function. # # It uses pax to create the devices defined in the specfile. # pax_after() { # Run pax in an empty directory, so it pays # attention only to the specfile, without being # confused by the existing contents of the target # directory. Without this, pax would complain "file # would overwrite itself" for already-existing # device nodes. tmpdir=./tmp.$$ mkdir "${tmpdir}" || die "can't create temporary directory" cd "${tmpdir}" || die "can't cd to temporary directory" "${TOOL_PAX}" -r -w -M -pe .. pax_status=$? cd .. # back to where we started rmdir "${tmpdir}" return $pax_status } # makedev_main makedev_name args... # Perform most of the work of the main program. makedev_name # is typically "makedev", but may be the name of some other # makedev-like function (if we are invoked from MAKEDEV.local or # some other script). The other args to this function are the # command line args with which the MAKEDEV (or MAKEDEV.local) # script was invoked. # makedev_main() { local makedev="$1" ; shift # Parse command line args setup ${1+"$@"} shift $((${OPTIND}-1)) if $do_create_mfs; then # Count inodes and create mfs file system. # The makedev call merely updates $count_nodes. count_nodes=0 $makedev ${1+"$@"} create_mfs_dev $count_nodes unset count_nodes fi # Set before, middle, and after variables, so we can do # something like "( $before && $middle ) | $after", # except it will have to be more complex so we can capture # the exit status from both sides of the pipe. # if $do_specfile; then before=specfile_before else before=: fi middle='$makedev ${1+"$@"} && (exit $status)' if $do_mtree; then after=mtree_after elif $do_pax ; then after=pax_after else after=cat fi # Actually perform the "{ $before && $middle } | $after" commands. # # We go to some trouble to ensure that, if any of # $before, $middle, or $after fails, then we also # exit with a non-zero status. # # In the block below, fd 3 is a copy of the original stdout, # and fd 4 goes to a subshell that analyses the exit status # status from the other commands. # { exec 3>&1; { { eval "$before" && eval "$middle"; echo $? >&4; } \ | { eval "$after"; echo $? >&4; } \ } 4>&1 1>&3 \ | ( read status1; read status2; case "$status1,$status2" in 0,0) exit 0;; 0,*) exit $status2;; *,*) exit $status1;; esac ) } } # # functions available to create nodes: # # mkdev name [b|c] major minor [mode{=600} [gid{=0} [uid{=0}]]] # create device node `name' with the appropriate permissions # # lndev src target # create a symlink from src to target # # makedir dir mode # create directory with appropriate mode # mkdev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then case $2 in b) type=block ;; c) type=char ;; esac echo "./$1 type=${type} device=netbsd,$3,$4 mode=${5:-600} gid=${6:-$g_wheel} uid=${7:-$u_root}" else ${MKNOD} -m ${5:-600} -g \#${6:-$g_wheel} -u \#${7:-$u_root} $1 $2 $3 $4 fi } lndev() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $2; then return fi if $do_specfile; then echo "./$2 type=link link=$1 mode=0700 gid=$g_wheel uid=$u_root" else ln -f -s $1 $2 fi } makedir() { if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + 1)) return fi if $do_update && test -e $1; then return fi if $do_specfile; then echo "./$1 type=dir mode=$2 gid=$g_wheel uid=$u_root" else nooutput -2 mkdir $1 chmod $2 $1 fi } warn() { echo 1>&2 "$0: $*" status=1 } die() { echo 1>&2 "$0: $*" exit 1 } # makedev special [...] # the main loop # makedev() { for i do case $i in # As of 2005-03-15, the "init" case must not create more than 1024 entries. all_md) makedev std wscons wt0 fd0 fd1 makedev wd0 wd1 wd2 wd3 wd4 wd5 wd6 wd7 makedev sd0 sd1 sd2 sd3 sd4 sd5 sd6 sd7 makedev flash0 flash1 flash2 flash3 flash4 flash5 flash6 flash7 makedev tty0 tty1 tty2 tty3 makedev st0 st1 ch0 cd0 cd1 mcd0 vnd0 makedev bpf makedev ccd0 md0 random makedev cgd0 cgd1 makedev amr0 iop0 mfi0 mlx0 mly0 dpti0 dpt0 twe0 icp0 makedev ed0 ed1 makedev nvme0 nvme0ns1 nvme0ns2 nvme0ns3 nvme0ns4 makedev nvme1 nvme1ns1 nvme1ns2 nvme1ns3 nvme1ns4 makedev nvme2 nvme2ns1 nvme2ns2 nvme2ns3 nvme2ns4 makedev nvme3 nvme3ns1 nvme3ns2 nvme3ns3 nvme3ns4 makedev raid0 raid1 raid2 raid3 makedev ld0 ld1 ld2 ld3 ld4 ld5 ld6 ld7 makedev xbd0 xbd1 xbd2 xbd3 xen makedev usbs makedev ipty makedev local makedev cfs makedev lpa0 lpa1 lpa2 makedev lpt0 lpt1 lpt2 makedev ss0 uk0 uk1 makedev speaker joy0 joy1 makedev apm makedev cmos makedev audio makedev radio makedev music rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 rmidi7 makedev scsibus0 scsibus1 scsibus2 scsibus3 makedev ses0 ses1 ses2 ses3 makedev sysmon makedev bktr makedev tprof makedev ttyCZ0 ttyCY0 makedev agp0 makedev pci0 pci1 pci2 pci3 pci4 pci5 pci6 pci7 makedev pci8 pci9 pci10 pci11 pci12 pci13 pci14 makedev pci15 pci16 pci17 pci18 pci19 makedev altq makedev cir0 cir1 irframe0 irframe1 makedev dmoverio makedev kttcp makedev io makedev bio makedev acpi smbios efi makedev virtio ;; xen) makedev xenevt xencons xsd_kva ;; floppy) makedev std bpf wt0 fd0 fd1 wd0 wd1 wd2 wd3 sd0 sd1 sd2 sd3 sd4 st0 st1 makedev tty0 tty1 tty2 cd0 cd1 mcd0 ttyv0 opty ld0 ld1 ld2 ld3 ed0 ed1 ;; ramdisk) makedev floppy md0 ;; all) makedev all_md makedev std fd ptm makedev dk0 dk1 dk2 dk3 dk4 dk5 dk6 dk7 makedev dk8 dk9 dk10 dk11 dk12 dk13 dk14 dk15 makedev dk16 dk17 dk18 dk19 dk20 dk21 dk22 dk23 makedev dk24 dk25 dk26 dk27 dk28 dk29 dk30 dk31 makedev ccd0 ccd1 ccd2 ccd3 makedev cgd0 cgd1 cgd2 cgd3 cgd4 cgd5 cgd6 cgd7 makedev fss0 fss1 fss2 fss3 makedev md0 md1 makedev raid0 raid1 raid2 raid3 raid4 raid5 raid6 raid7 makedev vnd0 vnd1 vnd2 vnd3 makedev iscsi0 makedev bpf npf makedev tun0 tun1 tun2 tun3 makedev ipl pf crypto random makedev lockstat clockctl cpuctl makedev atabus0 atabus1 atabus2 atabus3 atabus4 atabus5 atabus6 atabus7 makedev srt0 srt1 srt2 srt3 makedev tap tap0 tap1 tap2 tap3 makedev gpio gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 makedev gpioirq0 gpiopps0 makedev pad pad0 pad1 pad2 pad3 makedev bthub makedev putter makedev drvctl makedev video makedev dtv makedev drm0 drm1 drm2 drm3 makedev altmem makedev zfs makedev lua makedev hdmicec0 makedev dtrace makedev veriexec makedev autofs makedev fw0 fw1 fw2 fw3 makedev ipmi0 makedev qemufwcfg makedev sht3xtemp0 makedev scmd0 makedev local # do this last ;; init) # unless overridden by MD entry, this is equal to 'all' makedev all opty ;; audio) makedev audio0 audio1 audio2 audio3 makedev hdaudio0 hdaudio1 hdaudio2 hdaudio3 lndev sound0 sound lndev audio0 audio lndev mixer0 mixer lndev audioctl0 audioctl ;; emcfan[0-9]*) unit=${i#emcfan} mkdev emcfan$unit c 367 $unit 660 ;; gpio) makedev gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 lndev gpio0 gpio ;; gpioirq) makedev gpioirq0 ;; gpiopps) makedev gpiopps0 lndev gpiopps0 gpiopps ;; lua) makedev lua0 lndev lua0 lua ;; pad) makedev pad0 pad1 pad2 pad3 lndev pad0 pad ;; qemufwcfg) makedev qemufwcfg0 lndev qemufwcfg0 qemufwcfg ;; radio) makedev radio0 radio1 lndev radio0 radio ;; video) makedev video0 video1 video2 video3 ;; dtv) makedev dtv0 dtv1 dtv2 dtv3 ;; iic) makedev iic0 iic1 iic2 iic3 ;; altmem) makedev altmem0 altmem1 ;; ramdisk) makedev floppy md0 ;; sht3xtemp) makedev sht3xtemp0 ;; scmd) makedev scmd0 ;; usbs) makedev usb usb0 usb1 usb2 usb3 usb4 usb5 usb6 usb7 makedev usb8 usb9 usb10 usb11 usb12 usb13 usb14 usb15 makedev uhid0 uhid1 uhid2 uhid3 uhid4 uhid5 makedev uhid6 uhid7 uhid8 uhid9 uhid10 uhid11 makedev uhid12 uhid13 uhid14 uhid15 makedev ulpt0 ulpt1 makedev ttyU0 ttyU1 ttyU2 ttyU3 ttyU4 ttyU5 ttyU6 ttyU7 makedev ttyY0 ttyY1 makedev ttyHS0 makedev utoppy0 utoppy1 makedev ugen0 ugen1 ugen2 ugen3 ;; virtio) makedev ttyVI makedev vio9p0 vio9p1 vio9p2 vio9p3 makedev vio9p4 vio9p5 vio9p6 vio9p7 ;; std) mkdev console c 0 0 600 mkdev constty c 0 1 600 mkdev drum c 4 0 640 $g_kmem mkdev kmem c 2 1 640 $g_kmem mkdev mem c 2 0 640 $g_kmem mkdev null c 2 2 666 mkdev full c 2 11 666 mkdev zero c 2 12 666 mkdev klog c 7 0 600 mkdev ksyms c 101 0 440 $g_kmem mkdev random c 46 0 444 mkdev urandom c 46 1 644 if ! $fdesc_mounted; then mkdev tty c 1 0 666 mkdev stdin c 22 0 666 mkdev stdout c 22 1 666 mkdev stderr c 22 2 666 fi ;; usb) mkdev usb c 55 255 444 ;; usb[0-9]*) unit=${i#usb} usb=usb$unit mkdev usb$unit c 55 $unit ;; uhid[0-9]*) unit=${i#uhid} mkdev uhid$unit c 56 $unit 666 ;; ulpt[0-9]*) unit=${i#ulpt} mkdev ulpt$unit c 57 $unit mkdev ulpn$unit c 57 $(($unit + 64)) ;; utoppy[0-9]*) unit=${i#utoppy} mkdev utoppy$unit c 174 $unit ;; ttyHS[0-9]*) unit=${i#ttyHS} for j in 00 01 02 03 04 05 06 07 08 09 10 do base=$(($unit * 16 + ${j#0})) mkdev ttyHS$unit.$j c 196 $(($base + $dialin )) "" "" $u_uucp mkdev dtyHS$unit.$j c 196 $(($base + $dialout )) "" "" $u_uucp mkdev ctyHS$unit.$j c 196 $(($base + $callunit)) "" "" $u_uucp done ;; ttyY[0-9]*) unit=${i#ttyY} mkdev ttyY$unit c 172 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyY$unit c 172 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyY$unit c 172 $(($unit + $callunit)) "" "" $u_uucp ;; ucom[0-9]*) makedev ttyU${i#ucom} ;; ttyU[0-9]*) unit=${i#ttyU} mkdev ttyU$unit c 66 $(($unit + $dialin )) "" "" $u_uucp mkdev dtyU$unit c 66 $(($unit + $dialout )) "" "" $u_uucp mkdev ctyU$unit c 66 $(($unit + $callunit)) "" "" $u_uucp ;; ugen[0-9]*) unit=${i#ugen} for j in 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 do mkdev ugen$unit.$j c 64 $(($unit * 16 + ${j#0})) done ;; umcpmio[0-9]*) unit=${i#umcpmio} mkdev umcpmio${unit}ctl c 366 $unit 660 for j in 0 1 2 do mkdev umcpmio${unit}GP$(($j + 1)) c 366 $(($unit * 3 + 128 + ${j#})) 666 done mkdev umcpmio${unit}EEP c 366 $(($unit + 256)) 660 ;; wscons) makedev ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 makedev ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 makedev ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 makedev ttyH0 ttyH1 ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 makedev wsmouse0 wsmouse1 wsmouse2 wsmouse3 makedev wskbd0 wskbd1 wskbd2 wskbd3 makedev wsmux0 wsmux1 wsmux2 wsmux3 makedev wsmouse wskbd makedev ttyEcfg ttyEstat makedev ttyFcfg ttyFstat makedev ttyGcfg ttyGstat makedev ttyHcfg ttyHstat makedev wsfont ;; wsmouse) mkdev wsmouse c 65 0 ;; wskbd) mkdev wskbd c 65 1 ;; wsmux[0-9]*) unit=${i#wsmux} mkdev wsmux$unit c 65 $unit mkdev wsmuxctl$unit c 65 $(($unit + 128)) 200 ;; xenevt) mkdev xenevt c 141 0 ;; xsd_kva) mkdev xsd_kva c 141 1 ;; xencons) mkdev xencons c 143 0 ;; ttyEstat) mkdev ttyEstat c 47 254 ;; ttyEcfg) mkdev ttyEcfg c 47 255 ;; ttyE[0-9]*) unit=${i#ttyE} mkdev ttyE$unit c 47 $unit ;; ttyFstat) mkdev ttyFstat c 47 510 ;; ttyFcfg) mkdev ttyFcfg c 47 511 ;; ttyF[0-9]*) unit=${i#ttyF} mkdev ttyF$unit c 47 $(($unit + 256)) ;; ttyGstat) mkdev ttyGstat c 47 766 ;; ttyGcfg) mkdev ttyGcfg c 47 767 ;; ttyG[0-9]*) unit=${i#ttyG} mkdev ttyG$unit c 47 $(($unit + 512)) ;; ttyHstat) mkdev ttyHstat c 47 1022 ;; ttyHcfg) mkdev ttyHcfg c 47 1023 ;; ttyH[0-9]*) unit=${i#ttyH} mkdev ttyH$unit c 47 $(($unit + 768)) ;; wsmouse[0-9]*) unit=${i#wsmouse} mkdev wsmouse$unit c 49 $unit ;; wskbd[0-9]*) unit=${i#wskbd} mkdev wskbd$unit c 48 $unit ;; fd) if ! $fdesc_mounted; then # Create the "fd" subdirectory, and devices "fd/0" to "fd/63" makedir fd 755 n=0 while [ $n -lt 64 ] do mkdev fd/$n c 22 $n 666 n=$(($n + 1)) done fi ;; wt[0-9]*) name=wt; unit=${i#wt}; chr=10; blk=3 for sub in $unit $(($unit+8)) $(($unit+16)) do mkdev $name$sub b $blk $(($sub + 0)) 660 $g_operator mkdev n$name$sub b $blk $(($sub + 4)) 660 $g_operator mkdev r$name$sub c $chr $(($sub + 0)) 660 $g_operator mkdev nr$name$sub c $chr $(($sub + 4)) 660 $g_operator done ;; md[0-9]*) makedisk_minimal md ${i#md} 17 24 ;; fss[0-9]*) name=fss; unit=${i#fss}; blk=163; chr=163 mkdev $name$unit b $blk $unit 660 $g_operator mkdev r$name$unit c $chr $unit 660 $g_operator ;; ss[0-9]*) name=ss; unit=${i#ss}; chr=19 mkdev $name$unit c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev n$name$unit c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev en$name$unit c $chr $(($unit * 16 + 3)) 640 $g_operator ;; ccd[0-9]*|cgd[0-9]*|raid[0-9]*|vnd[0-9]*) case $i in ccd*) name=ccd; unit=${i#ccd}; blk=16; chr=18;; cgd*) name=cgd; unit=${i#cgd}; blk=21; chr=93;; raid*) name=raid; unit=${i#raid}; blk=18; chr=62;; vnd*) name=vnd; unit=${i#vnd}; blk=14; chr=41;; esac makedisk_p16high $name $unit $blk $chr ;; sd[0-9]*) name=sd; unit=${i#sd}; blk=4; chr=13 makedisk_p16high $name $unit $blk $chr ;; wd[0-9]*) name=wd; unit=${i#wd}; blk=0; chr=3 makedisk_p16high $name $unit $blk $chr ;; fd[0-9]*) name=fd; unit=${i#fd}; blk=2; chr=9 makedisk_p16high $name $unit $blk $chr ;; ld[0-9]*) name=ld; unit=${i#ld}; blk=19; chr=69 makedisk_p16high $name $unit $blk $chr ;; flash[0-9]*) unit=${i#flash} flash=flash$unit mkdev flash$unit b 199 $unit mkdev rflash$unit c 199 $unit ;; spiflash[0-9]*) unit=${i#spiflash} spiflash=spiflash$unit mkdev spiflash$unit b 208 $unit mkdev rspiflash$unit c 208 $unit ;; altmem[0-9]*) name=altmem; unit=${i#altmem}; blk=182; chr=182 makedisk_p16high $name $unit $blk $chr ;; bio) mkdev bio c 181 0 ;; ed[0-9]*) name=ed; unit=${i#ed}; blk=20; chr=79 makedisk_p16high $name $unit $blk $chr ;; xbd[0-9]*) name=xbd; unit=${i#xbd}; blk=142; chr=142 makedisk_p16high $name $unit $blk $chr ;; dk[0-9]*) name=dk; unit=${i#dk}; blk=168; chr=168 mkdev r$name$unit c $chr $unit 0640 $g_operator mkdev $name$unit b $blk $unit 0640 $g_operator ;; tprof) mkdev tprof c 191 0 ;; ttyCY[0-9]*) # Each unit number creates 32 pairs of {tty,dty} device nodes: # ttyCY0 => device nodes [td]tyCY000 to [td]tyCY031; # ttyCY1 => device nodes [td]tyCY032 to [td]tyCY063; name=tyCY; chr=38; off=32 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=000$minor nminor=${nminor#${nminor%???}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; ttyCZ[0-9]*) # Each unit number creates 64 pairs of {tty,dty} device nodes: # ttyCZ0 => device nodes [td]tyCZ0000 to [td]tyCZ0063; # ttyCZ1 => device nodes [td]tyCZ0064 to [td]tyCZ0127; name=tyCZ; chr=73; off=64 unit=${i#t${name}} minor=$(($unit * $off)) eminor=$(($minor + $off)) while [ $minor -lt $eminor ] do nminor=0000$minor nminor=${nminor#${nminor%????}} mkdev t$name$nminor c $chr $(($minor + $dialin )) "" "" $u_uucp mkdev d$name$nminor c $chr $(($minor + $dialout)) "" "" $u_uucp minor=$(($minor + 1)) done ;; tty[0-9]*) unit=${i#tty} ounit=00$unit ounit=${ounit#${ounit%??}} mkdev tty$ounit c 8 $(($unit + $dialin )) "" "" $u_uucp mkdev dty$ounit c 8 $(($unit + $dialout)) "" "" $u_uucp ;; ttyC[0-9]*) # some archs call com_chr ttyC traditionally unit=${i#ttyC}; name=ttyC; dname=dtyC; chr=8 mkdev $name$unit c $chr $(($unit + $dialin )) "" "" $u_uucp mkdev $dname$unit c $chr $(($unit + $dialout)) "" "" $u_uucp ;; opty) # Create 16 device nodes, [pt]typ0 to [pt]typf, # same as "MAKEDEV pty0". for j in 0 1 2 3 4 5 6 7 8 9 a b c d e f do case $j in [0-9]) jn=$j ;; a) jn=10 ;; b) jn=11 ;; c) jn=12 ;; d) jn=13 ;; e) jn=14 ;; f) jn=15 ;; esac mkdev ttyp$j c 5 $jn 666 mkdev ptyp$j c 6 $jn 666 done ;; pty[0-9]*) # Each unit number creates up to 16 pairs of {tty,pty} device nodes: # pty0 => 16 pairs, [tp]typ0 to [tp]typf # pty1 => 16 pairs, [tp]tyq0 to [tp]tyqf # pty16 => 16 pairs, [tp]typg to [tp]typv # pty17 => 16 pairs, [tp]typw to [tp]typL # pty18 => 14 pairs, [tp]typM to [tp]typZ warn "$i: creating BSD style tty nodes with ptyfs is a security issue" class=${i#pty} d1="p q r s t u v w x y z P Q R S T" if [ "$class" -ge 64 ] then warn "$i: pty unit must be between 0 and 63" continue elif [ "$class" -lt 16 ] then # pty[p-zP-T][0-9a-f] offset=0 mult=0 d2="0 1 2 3 4 5 6 7 8 9 a b c d e f" else # pty[p-zP-T][g-zA-Z] class=$(($class - 16)) offset=256 mult=2 d2="g h i j k l m n o p q r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X Y Z" fi start=$(($class * 16)) set -- $d2 nt=$# s1=$(($start / $nt)) set -- $d1 shift $s1 t1=$1 if [ "$t1" = v ]; then warn "$i: pty unit conflicts with console ttyv0 device" continue fi s2=$(($start % ($nt - $s1 * $mult))) set -- $d2 shift $s2 t2=$1 unit=$(($start + $offset - $s1 * $mult)) end=$(($unit + 16)) while [ "$unit" -lt "$end" ] do mkdev tty$t1$t2 c 5 $unit 666 mkdev pty$t1$t2 c 6 $unit 666 shift t2=$1 if [ -z "$t2" ] then break fi unit=$(($unit + 1)) done ;; st[0-9]*) name=st; unit=${i#st}; chr=14; blk=5 mkdev $name$unit b $blk $(($unit * 16 + 0)) 660 $g_operator mkdev n$name$unit b $blk $(($unit * 16 + 1)) 660 $g_operator mkdev e$name$unit b $blk $(($unit * 16 + 2)) 660 $g_operator mkdev en$name$unit b $blk $(($unit * 16 + 3)) 660 $g_operator mkdev r$name$unit c $chr $(($unit * 16 + 0)) 660 $g_operator mkdev nr$name$unit c $chr $(($unit * 16 + 1)) 660 $g_operator mkdev er$name$unit c $chr $(($unit * 16 + 2)) 660 $g_operator mkdev enr$name$unit c $chr $(($unit * 16 + 3)) 660 $g_operator ;; ses[0-9]*|ch[0-9]*|uk[0-9]*) case $i in ch*) name=ch; unit=${i#ch}; chr=17;; uk*) name=uk; unit=${i#uk}; chr=20;; ses*) name=ses; unit=${i#ses}; chr=74;; esac mkdev $name$unit c $chr $unit 640 $g_operator ;; cd[0-9]*) makedisk_minimal cd ${i#cd} 6 15 ;; mcd[0-9]*) makedisk_minimal mcd ${i#mcd} 7 39 ;; lpt[0-9]*|lpa[0-9]*) case $i in lpt*) name=lpt; unit=${i#lpt}; chr=16; flags=0;; lpa*) name=lpa; unit=${i#lpa}; chr=16; flags=128;; esac mkdev $name$unit c $chr $(($unit + $flags)) mkdev lpt${unit}ctl c $chr $(($unit + 256)) ;; bpf) mkdev bpf c 23 0 lndev bpf bpf0 ;; npf) mkdev npf c 198 0 ;; bthub) mkdev bthub c 175 0 ;; tun[0-9]*) unit=${i#tun} mkdev tun$unit c 40 $unit ;; joy[0-9]*) unit=${i#joy} mkdev joy$unit c 26 $unit ;; ipl) mkdev ipl c 44 0 mkdev ipnat c 44 1 mkdev ipstate c 44 2 mkdev ipauth c 44 3 mkdev ipsync c 44 4 mkdev ipscan c 44 5 mkdev iplookup c 44 6 ;; pf) mkdev pf c 161 0 ;; crypto) mkdev crypto c 160 0 666 ;; cmos) mkdev cmos c 88 0 644 ;; speaker) mkdev speaker c 240 0 ;; lockstat) mkdev lockstat c 177 0 ;; cpuctl) mkdev cpuctl c 188 0 666 ;; audio|audio[0-9]*) unit=${i#audio} audio=audio$unit sound=sound$unit mixer=mixer$unit audioctl=audioctl$unit : ${unit:-0} mkdev $sound c 42 $(($unit + 0)) 666 mkdev $audio c 42 $(($unit + 128)) 666 mkdev $mixer c 42 $(($unit + 16)) 666 mkdev $audioctl c 42 $(($unit + 192)) 666 ;; hdaudio[0-9]*) unit=${i#hdaudio} mkdev hdaudio$unit c 195 $unit 644 ;; hdmicec[0-9]*) uint=${i#hdmicec} mkdev hdmicec$unit c 340 $unit 644 ;; gpio[0-9]*) unit=${i#gpio} mkdev gpio$unit c 173 $unit 664 $g_gpio ;; gpioirq[0-9]*) unit=${i#gpioirq} mkdev gpioirq$unit c 365 $unit 444 $g_gpio ;; gpiopps[0-9]*) unit=${i#gpiopps} mkdev gpiopps$unit c 344 $unit 664 $g_gpio ;; lua[0-9]*) unit=${i#lua} mkdev lua$unit c 209 $unit 600 ;; rmidi[0-9]*) unit=${i#rmidi} mkdev rmidi$unit c 58 $unit 666 ;; music|music[0-9]*) unit=${i#music} : ${unit:-0} mkdev music$unit c 59 $(($unit + 0)) 666 mkdev sequencer$unit c 59 $(($unit + 128)) 666 ;; radio|radio[0-9]*) unit=${i#radio} : ${unit:-0} mkdev radio$unit c 87 $unit 666 ;; video|video[0-9]*) unit=${i#video} : ${unit:-0} mkdev video$unit c 193 $unit 666 ;; dtv[0-9]*) unit=${i#dtv} makedir dvb 755 makedir dvb/adapter$unit 755 mkdev dvb/adapter$unit/frontend0 c 200 $(($unit + 0)) 666 mkdev dvb/adapter$unit/demux0 c 200 $(($unit + 16)) 666 mkdev dvb/adapter$unit/dvr0 c 200 $(($unit + 32)) 666 ;; iic[0-9]*) unit=${i#iic} : ${unit:-0} mkdev iic$unit c 201 $unit 600 ;; spi[0-9]*) unit=${i#spi} : ${unit:-0} mkdev spi$unit c 347 $unit 600 ;; amr[0-9]*) unit=${i#amr} mkdev amr$unit c 176 $unit ;; apm) mkdev apm c 21 0 644 mkdev apmctl c 21 8 644 ;; random) mkdev random c 46 0 444 mkdev urandom c 46 1 644 ;; cfs) makedev cfs0 ;; cfs[0-9]*) unit=${i#cfs} mkdev cfs$unit c 60 $unit ;; sysmon) mkdev sysmon c 67 0 644 mkdev watchdog c 67 1 644 mkdev power c 67 2 640 ;; scsibus[0-9]*) unit=${i#scsibus} mkdev scsibus$unit c 61 $unit 644 ;; bktr) makedev bktr0 bktr1 lndev bktr0 bktr lndev tuner0 tuner lndev vbi0 vbi ;; bktr[0-9]*) unit=${i#bktr} mkdev bktr$unit c 71 $(($unit + 0)) 444 mkdev tuner$unit c 71 $(($unit + 16)) 444 mkdev vbi$unit c 71 $(($unit + 32)) 444 ;; io) mkdev io c 2 14 600 ;; iop[0-9]*) unit=${i#iop} mkdev iop$unit c 76 $unit ;; mfi[0-9]*) unit=${i#mfi} mkdev mfi$unit c 205 $unit ;; mlx[0-9]*) unit=${i#mlx} mkdev mlx$unit c 78 $unit ;; mly[0-9]*) unit=${i#mly} mkdev mly$unit c 80 $unit ;; twa[0-9]*) unit=${i#twa} mkdev twa$unit c 187 $unit ;; twe[0-9]*) unit=${i#twe} mkdev twe$unit c 97 $unit ;; icp[0-9]*) unit=${i#icp} mkdev icp$unit c 102 $unit ;; agp[0-9]*) unit=${i#agp} mkdev agp$unit c 82 $unit 644 if [ "$unit" = "0" ]; then lndev agp$unit agpgart fi ;; pci[0-9]*) unit=${i#pci} mkdev pci$unit c 83 $unit 640 ;; dpti[0-9]*) unit=${i#dpti} mkdev dpti$unit c 84 $unit ;; dpt[0-9]*) unit=${i#dpt} mkdev dpt$unit c 96 $unit ;; altq) makedir altq 755 unit=0 for dev in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq jobs do mkdev altq/$dev c 77 $unit 644 unit=$(($unit + 1)) done ;; wsfont) mkdev wsfont c 81 0 644 ;; cir[0-9]*) unit=${i#cir} mkdev cir$unit c 86 $unit 666 ;; irframe[0-9]*) unit=${i#irframe} mkdev irframe$unit c 85 $unit ;; pad[0-9]*) unit=${i#pad} mkdev pad$unit c 189 $unit 444 ;; qemufwcfg[0-9]*) unit=${i#qemufwcfg} mkdev qemufwcfg$unit c 342 $unit 660 ;; vio9p[0-9]*) unit=${i#vio9p} mkdev vio9p$unit c 356 $unit 660 ;; fault) mkdev fault c 357 0 ;; clockctl) mkdev clockctl c 89 0 660 $g_ntpd ;; kttcp) mkdev kttcp c 91 0 ;; dmoverio) mkdev dmoverio c 92 0 644 ;; veriexec) mkdev veriexec c 170 0 600 ;; vhci[0-7]*) unit=${i#vhci} mkdev vhci$unit c 355 $unit ;; ttyv[0-9]*) unit=${i#ttyv} mkdev ttyv$unit c 12 $unit ;; # arm, acorn32 mouse-pms[0-9]*|mouse-qms[0-9]*) case $i in mouse-pms*) name=pms ;; mouse-qms*) name=qms ;; esac unit=${i#mouse-${name}} lndev $name$unit mouse ;; ipty) mkdev ttyp0 c 5 0 666 mkdev ttyp1 c 5 1 666 mkdev ptyp0 c 6 0 666 mkdev ptyp1 c 6 1 666 ;; ptm) makedir pts 755 mkdev ptmx c 165 0 666 mkdev ptm c 165 1 666 ;; atabus[0-9]*) unit=${i#atabus} mkdev atabus$unit c 166 $unit 644 ;; drm[0-9]*) unit=${i#drm} unit2=$((unit + 128)) makedir dri 755 mkdev dri/card$unit c 180 $unit 660 mkdev dri/renderD${unit2} c 180 ${unit2} 660 ;; drvctl) mkdev drvctl c 167 0 644 ;; isv) mkdev isv c 192 0 644 ;; tap|tap[0-9]*) unit=${i#tap} case "$unit" in [0-9]*) mkdev tap${unit} c 169 ${unit} 600 ;; "") mkdev tap c 169 0xfffff 600 ;; esac ;; srt[0-9]*) unit=${i#srt} mkdev srt$unit c 179 $unit 600 ;; tpm) mkdev tpm c 204 0 600 ;; dtrace) makedir dtrace 755 mkdev dtrace/dtrace c 207 0 600 ;; fw[0-9]*) unit=${i#fw} for j in 0 1 2 3 do mkdev fw${unit}.${j} c 171 $((${unit} * 256 + ${j})) 660 ${g_operator} mkdev fwmem${unit}.${j} c 171 $((65536 + ${unit} * 256 + ${j})) 660 ${g_operator} done ;; # create putter device and symlinks for all subsystems using it putter) mkdev putter c 178 0 600 mkdev pud c 178 1 600 lndev putter puffs ;; zfs) mkdev zfs c 190 0 600 makedir zpool 755 ;; iscsi[0-9]*) unit=${i#iscsi} mkdev iscsi${unit} c 203 $unit 600 ;; nvme[0-9]*ns[0-9]*) unit=${i#nvme} unit=${unit%ns*} subunit=${i#nvme${unit}ns} if [ 0$subunit -le 0 ] || [ 0$subunit -ge 65536 ]; then warn "bad nsid for $i: $subunit" break fi mkdev nvme${unit}ns$subunit c 341 $(($unit * 65536 + $subunit)) ;; nvme[0-9]*) unit=${i#nvme} mkdev nvme$unit c 341 $(($unit * 65536)) ;; nvmm) mkdev nvmm c 345 0 660 $g_nvmm ;; autofs) mkdev autofs c 343 0 600 ;; kcov) mkdev kcov c 346 0 ;; ipmi[0-9]*) unit=${i#ipmi} mkdev ipmi${unit} c 354 $unit 600 ;; xmm[0-9]) unit=${i#xmm} makedir xmm${unit} 755 mkdev xmm${unit}/rpc c 358 $(($unit * 65536 + 1)) mkdev ttyXMM${unit}0 c 358 $(($unit * 65536 + 2)) mkdev ttyXMM${unit}1 c 358 $(($unit * 65536 + 4)) ;; acpi) mkdev acpi c 359 0 ;; smbios) mkdev smbios c 360 0 ;; efi) mkdev efi c 361 0 660 ;; sht3xtemp[0-9]*) unit=${i#sht3xtemp} mkdev sht3xtemp$unit c 362 $unit 664 ;; scmd[0-9]*) unit=${i#scmd} mkdev scmd$unit c 363 $unit 666 ;; ttyVI[0-9][0-9]) port=${i#ttyVI?} devunit=${i%$port} unit=${devunit#ttyVI} mkdev ttyVI$unit$port c 364 $((16*$unit + $port)) ;; ttyVI) makedev ttyVI00 ttyVI10 ttyVI20 ttyVI30 ;; local) if [ -f "$0.local" ]; then umask 0 if [ -n "$count_nodes" ]; then count_nodes=$((count_nodes + \ $(linecount "$("$HOST_SH" "$0.local" $opts -s all)") )) else "$HOST_SH" "$0.local" $opts all fi umask 077 fi ;; *) warn "$i: unknown device" ;; esac done } # three variants of disk partitions - max 8, max 16, max 16 with highpartoffset # hack; only the one used by port is retained in final MAKEDEV script # routine is called as: # makedisk name unit blk chr makedisk_p8() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator } makedisk_p12high() { ho=524280 # offset for partition 9 to 11 (same as ...p16high) name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator } makedisk_p16() { name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 16 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 16 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 16 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 16 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 16 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 16 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 16 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 16 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 16 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 16 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 16 + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 16 + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 16 + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 16 + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 16 + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 16 + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 16 + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 16 + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 16 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 16 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 16 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 16 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 16 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 16 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 16 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 16 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 16 + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 16 + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 16 + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 16 + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 16 + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 16 + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 16 + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 16 + 15)) 640 $g_operator } makedisk_p16high() { ho=524280 # offset for partition 9 to 16 name="$1"; unit="$2"; blk="$3"; chr="$4" ro=3 mkdev ${name}${unit} b $blk $(($unit * 8 + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * 8 + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * 8 + 0)) 640 $g_operator mkdev ${name}${unit}b b $blk $(($unit * 8 + 1)) 640 $g_operator mkdev ${name}${unit}c b $blk $(($unit * 8 + 2)) 640 $g_operator mkdev ${name}${unit}d b $blk $(($unit * 8 + 3)) 640 $g_operator mkdev ${name}${unit}e b $blk $(($unit * 8 + 4)) 640 $g_operator mkdev ${name}${unit}f b $blk $(($unit * 8 + 5)) 640 $g_operator mkdev ${name}${unit}g b $blk $(($unit * 8 + 6)) 640 $g_operator mkdev ${name}${unit}h b $blk $(($unit * 8 + 7)) 640 $g_operator mkdev ${name}${unit}i b $blk $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev ${name}${unit}j b $blk $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev ${name}${unit}k b $blk $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev ${name}${unit}l b $blk $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev ${name}${unit}m b $blk $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev ${name}${unit}n b $blk $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev ${name}${unit}o b $blk $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev ${name}${unit}p b $blk $(($unit * 8 + $ho + 15)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * 8 + 0)) 640 $g_operator mkdev r${name}${unit}b c $chr $(($unit * 8 + 1)) 640 $g_operator mkdev r${name}${unit}c c $chr $(($unit * 8 + 2)) 640 $g_operator mkdev r${name}${unit}d c $chr $(($unit * 8 + 3)) 640 $g_operator mkdev r${name}${unit}e c $chr $(($unit * 8 + 4)) 640 $g_operator mkdev r${name}${unit}f c $chr $(($unit * 8 + 5)) 640 $g_operator mkdev r${name}${unit}g c $chr $(($unit * 8 + 6)) 640 $g_operator mkdev r${name}${unit}h c $chr $(($unit * 8 + 7)) 640 $g_operator mkdev r${name}${unit}i c $chr $(($unit * 8 + $ho + 8)) 640 $g_operator mkdev r${name}${unit}j c $chr $(($unit * 8 + $ho + 9)) 640 $g_operator mkdev r${name}${unit}k c $chr $(($unit * 8 + $ho + 10)) 640 $g_operator mkdev r${name}${unit}l c $chr $(($unit * 8 + $ho + 11)) 640 $g_operator mkdev r${name}${unit}m c $chr $(($unit * 8 + $ho + 12)) 640 $g_operator mkdev r${name}${unit}n c $chr $(($unit * 8 + $ho + 13)) 640 $g_operator mkdev r${name}${unit}o c $chr $(($unit * 8 + $ho + 14)) 640 $g_operator mkdev r${name}${unit}p c $chr $(($unit * 8 + $ho + 15)) 640 $g_operator } # make only the very few basic disk device nodes - 'a' partition # and raw partition makedisk_minimal() { name=$1; unit=$2; blk=$3; chr=$4 doff=8 ro=3 rn=d mkdev ${name}${unit} b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit} c $chr $(($unit * $doff + $ro)) 640 $g_operator mkdev ${name}${unit}a b $blk $(($unit * $doff + 0)) 640 $g_operator mkdev ${name}${unit}$rn b $blk $(($unit * $doff + $ro)) 640 $g_operator mkdev r${name}${unit}a c $chr $(($unit * $doff + 0)) 640 $g_operator mkdev r${name}${unit}$rn c $chr $(($unit * $doff + $ro)) 640 $g_operator } # create_mfs_dev nodes # Create a memory file system for a given number of device nodes, # and mount it. Attempts to use mount_tmpfs, or falls back to # mount_mfs. # # If do_redirect, then also redirect output to the console. # create_mfs_dev() { ndevnodes=${1-1200} dev_mountpoint=${PWD:-/dev} # Number of inodes is the specified number of device nodes, plus # a margin to allow for extra device nodes created later. ninode=$((ndevnodes * 11 / 10)) # Add 2 reserved inodes (needed for both mfs and tmpfs), and round # up to a multiple of 32 (needed for mfs, not needed for tmpfs). ninode=$(( (ninode + 2 + 31) / 32 * 32 )) # Try tmpfs; if that fails try mfs. # # For tmpfs, allocate 16KB and 512 byte per node. # Actual requirements are much lower, but the size limit # is only intended to avoid accidental writing to /dev. fs_bytes=$((16384 + ninode * 512)) if mount_tmpfs -s $fs_bytes -n $ninode -m 0755 \ -o union tmpfs "$dev_mountpoint" then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"} # A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option static_routes, classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . .. dhcpcd-hooksdhcpcd-run-hooks  lfs_cleanerdwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp fi done #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook" . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi ... ...# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi . .. chown dhcpcd  disklabel dkctl dmesg fdisk fsck fsck_ffs gpt halt ifconfig init mbrlabel mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_lfs  mount_mfs  mount_msdos  mount_nfs  mount_ntfs  mount_tmpfs newfs  newfs_ext2fs  newfs_lfs ping ping6 raidctl reboot restore route rrestore scsictl shutdown slattach swapctl sysctl umount ... ... . .. bin!mdec"sbin#share . .. ftp gunzip gzcat gzip less more progress sed tar `tip! . ..$boot% bootxx_ffsv1& bootxx_ffsv2' bootxx_lfsv2( gptmbr.bin) mbr* mbr_bootsel+\mbr_ext1؎м|WRRAU10rUu s fXBZ?Q@RPf1f@|SNVFZPQ AfFNfVRS1_YXff Uf Uf U t E0t!u!u.Missing OS Multiple active partitions Wf1fffD fT$@fD(fT,f+D fT$9*ff^fD4fT8[*UuZ_f!GPTf!tfffff`fRfPSjjfvŒvAVdfarDisk error on boot ^>b< u~Ҷxx%Ȏff|Ѷxuf xvxfmfм6$f~$mc)1 u1USR  w$P,h^(hBoot2 failed: V$h`NRVD$5PcPcPPG5Pc^hPh@B))hPVL$PQ$b D$t^8tYt$PhThV$eD$@j/P3uIt$hPhV$0&7$7$u߁^ËD$pdP2pdWV t$>tBj:V3t$D$T$PhLchHcQRVBt3h`N{)@cҡDc HctHQPRhQO4$cj(VW# =DchMV $9u Dc@c LcaRQPhQ[^_SWVt$j,VN2tC1۸oR7PV1tGuh.Q Et?tSxۣ7W=ktVh8h8`^_[jt$h8f" =GftGfh8fhGQÃ=kINhXQnVt$huQV0tEho]V0t3h}QV0t*hQV0thQbb^Vt$V^PVxhQ^V5cPVhQ ^USWVP|$,l$(\$$L$ t$D$M@ct$PhMj(hcً\$4cDcHcLcEPcj:V20ʼn)'hMV!9tm<1cL@ʀŸrƀc$9}{ ʀпe w_$1ҍɍTQЊL@̀Ѐ rGCSVhc  1JыD$ cD$$D$(E|$,>t71^_[]19} ΀fw@Ɵ4$9؋ $tWVL$T$t$ |$PQRVWt$4MMuYt$ hMVW 9t&D$a4$Pt$VhMjPhTc4$VhMjPhTcTc^_SWV\$|$t$l5S*#R bt#]B5cc=ch@chLchHchDcSWVPcQ uhMJ kTkt P| =ktRh8h8Ml=k~hJhM1ۿ$4ݨ7V]PhNhky1jPU< wr, th_t:h1NO1F ݬ75[nhON1^_[O=kQWV׉sVWPhPR 1=chPWjV&xhQu(VQ5crPVhQK ^_WV։rWhiRhW^_MUSWVT$L$t$,|$$\$؃l$ x ER*V9~ ER EUL$T$Vt$,RQSd,^_[]SWV\$(|$$D$L$t$ SPQRVWt$ Fa=du"jP3hcM jXjhcXM hMt$ $9t^hRQ$9tS|$hRS*tPhRS*tAhUS}*u6=c FaPFaWV`0t$WV1. ^_[fWVt$ t8d1Dd@dHd^_ËL$1USWVPӉΊ< t< uF=dt8_uV7)tw Ve)G,$t7t3WVP?+ $2B Zdt@ uQ hS d^_[]ËL$1BAL$3L$%USWV \$4tu|$8jO3P Pd@[u5dj PG D$L$T$u>tF:^_USWV@׉΋1 (t/ t tE\$@hPSa w D,@j:S t"ŀx/u:ShThhdEO;/u+SWh.Thhd%/EىUUSShbWhThhdjhdtvduF$Ttf">$u߉T$<$1$<<$T$u;G @1Ʌt-@u'Hr1M9tIu111$^_[]T$`t$^D$bfD$D$L1ׅJD$L$ $HD$A L$ K{s L$KRSP> $@pSUL$ 1ffO&7%fPfRf1ȣ$f1Ҍ҉$f)ff$f $$$$$$f$f$fZfXfP.$ "U% ؎%$XPQjYYf0؎%( f"..$Ȏ؎$f+&$UFu]fXfþ%iCfF>Cprot_to_real can't return to X1f$D$f`TÈfÉD$a`t$,fL$(D$0T$$\$8D$4Sf[f%D$a`R[s Àu1Of ȉD$a`fUAfofU ȉD$a`ֈzff؎؃BÈf/ÉD$a`ֈFff؎شHfÉD$af`1ɺO11fa`fa1`f\$a1`1۴f\$a1`1۴fh\$aUSQRVWf1f tȉӝf5}1fȫfЫf_^ZY[]USQRVWEPAMS} (Wf_f fE1_^ZY[]USQRVWf$f_^ZY[]`ffЉD$afUSQRVW}Wf_OfZ%_^ZY[]USQRVWM} eWf_Of%_^ZY[]USQRVW]@'Of%_^ZY[]USQRVW]Of%_^ZY[]USQRVW]U }Wf_ Of%_^ZY[]USQRVW1ǸOfXOu_^ZY[]USQRVWU} NWf_Of%_^ZY[]USQRVWPf11r&G$u&o&Of cX_^ZY[]f1`r&&G$ufffЎشfwL$afUSVWffO_^[]fUSVWfT$fL$]Ĉf$1_^[]Ð`>f \$a`*ffD$a`ffD$afUSWV |$$\$,l$(t$0|$ ڃOu ʼno _$19$w"jt$8PSUW~4t 1xO11tiT$ $ËL$ A0jD$PjSUQ54tD$8tDL$ q4$&C$L$4t$t$Qo  D$8t0 ^_[]ÿjh4;t$  jt$ t$  USWVD$|$1 h 1UP  jUW  wWS1tʼnFu/hVACtt?uhVPhVPhVPhVCt`hWD$0L$,d$(ʉ9ǿVrVrRUW |$h]p{11PPP ݁P11,$xalE EtEuG${uuGL$L$4T$PS<L$ u h YٿEt8tPhV迿WPhV詿 EtphT蒿,$'E!,$4D;hTPh*^fhVYGz|$|$h]&1D$D$ :1L t $0$u ^_SWV˸ 腷t,1h VPy VW(t 1^_[USWV D$0T$,L$ tt 1ۉ1SSSF t:1K؃ ^_[]11NXt$4$|$ tk 3L$$ 3|$(t t4$|$t t$u $w($st4$T$ $E$u 4$ $l$0uu 1ɋD$tD$,|$ɋP8ej$PV( uUSWVL$HƋT$t$$t$$t$$ u~襵tkNjl$(0hPW X t#$lj$ P $uΉ}D$,1 e^_[]USWV L$4É1O{u}D$PVw&ukD$=r PuFn@1T$8‰$L$<10jSPQt$Vv'uhSt$H 11O ^_[]USWV $ $HÅ$H $8e=e1M-ee-f-f11PPP> 9cƅf<@04K$k 8<S,s(0|$h jW UE@L$u uP t C @S$z$L11ҋqy tAtAu-t uuB$u΍D<@ՍD48K C$@K C${,s(k K$S,s(-f f5f f$ ^1 ^_[]Ã=\ft"j(jhe| j \fr1D^hmZ=SWV|$WC ơ7t7PWtuh~Z_jVS^_[VP$hZ4jPV襉 u@tPpfUSWV=`fu`fl$t$tC9ʼnrS5`ft$ x&PV5`f )9s1D$)1H^_[]fSWV\Qƍ|$Wu%D$=<<9u D$9|ƉWSu0|$u#|$uL$  9|ƃ<$uD$uD$<9uL$"9|Ɖ\^_[fWV= cu"Wx PWjdZu j`.jd$uhjd_jduhj`Bjd u j` jd uV ^_f=dfSWVt$fNr'Fs>Fdflf5df lR fpx0\$FѣdfltfjSW D$f4 5f5f( f5fj: t,5fj- t5fj( F3]6|$jWP+ f+o5f5f f5fj:? td5fj-+ tP5fj( uF:6t$jVP ɉ ftfPQ f df =dfoRtZjPhpf^_[Vt$ u-dfHs5fj ku bdfHs5fV? u^8^VdfHs5f.et#Ph,t @tƉ^ádfHs5f|$t u USWV D$44|$8ÿgfffi= <uVRhZj U较~7w2UhTO<$tD$@8@uUhT+j*ur:Pijtjuu1ۃ|$8t hZȏ؃ ^_[]WVƹ׉ 9}9}^_iL$@BUSWV$c?_!BW !%DGӉW7EjUhu E9}G?x&o1GG_GoGG1A$oGGt*G$tf5t1N<1}u4$u/1PjjVV7!tGGO^_[]VPjVhu ^USWV8|$XaD$T$t$PD$`L$\L$T$L1K|$ t$uD=ffu8;fu.f9Ƌ $ f|-f9 $ f} )|$`|$ujǸ$1ҋL$LyT$LD$Ɖt$ $L$ |$|$BtvuB9D$D$ }]ZJ ˋl$֙D$$Й)Ӌl$9t$URQt$46ttlT$LkBt_fD$(D$fD$*D$fD$,t$'fD$.$D$4D$D$0T$(t  l$*y G|$`tL$ |$t$tf $ ft$5ff fff|$ 9)B fPQ|$W7T$X t$L$ Blj|$$)D$`1ۉ؃8^_[]fW|$ L$f1_VWt$|$L$f1_^VWt$|$L$f1_^ËD$t2@Ƀ t t @uH@t t uH@SWVL$YA11B~ v~σv%~$>e$>W$> D=6/(!@ @ Y t uY t uAA-u6!thZ!j軜1 1L$1@^_[VhZWV|$L$D$ 1҉1FtD-tPwt.-uWPuhZ蟉j91^_fUSWVf;fu9t$~nWEtV8U-u!f1ɃHf ff^_[]USWV|$=fuWx=fuWt-WY fQff| f_7\$? $ hQP D$ D$081^_[]Vp@tLN0t|tNw|F4j|^|1^USWV ͉ƋD$ 1ɅtfӋ~G4$;O}IT$D$P[u>t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$L$ AxD$p$ uՋ#$1鋐1 ʋu&|$4)T$P+$9wʉ1&D$\$4$L$D$L$ Pt ^_[]Ë\$tLDzD$ HL$ $t$Rt$QSjpD$0Pu\$Sjt$ # D$ $L$\$WVt$ xtt1HtG1)ΉwOOЉΉ^_SWV֋x1j|SR G FGFG$FG^\FX1^_[USWV T$PB$1D$BT$9BD$T$ L$PD$;$<$~Yl$ $D$Efut-]sfM}D$T$4(?VWk E;l$rT$B  $ B;JL$D$T$ OD$k h[iyD$l ^_[]ÐUSWVL׉Ÿ<xljFu cu-wC$D1QWhRRjsPÅt ؁L^_[]ËVgVL$ptt1Hɉt#I)ЉIIIЉ^USWVΉՉË|$$=fD$4$l$CIى\$ ;IŋIt$uq));$r$I+I9r|$VW\$S II\$)4$L$ l$|$$$1Ƌ|$$t$D$e^_[]USWV֋hj|jR2 Md1[< w |CBuWD$Ml1[< w |CBuW$Mt1[< w |CBuWL$N $NFIFXF\1^_[]øR[ XVƸtNtȺ0IdF1^USWV L$ )ЉD$(D$1T$L$ q $D$I|$4D$,IHuBPjt$ͬ |$D$$ |$dž,IHTct$ \$ KT$Rt$WPUjsQthZ[?dNu,L$9tWQh\[!d D$$t$)uD$@T$1ۉ؃ ^_[]USWVt$1~09 u Av z011,0|9~ D(C9u^_[]USWV,։ſbSbFL$QShjj@jvPD$l$ t$(\$C\$1۾|$(|$uojh[t$ L uND$HP1ʉT$$É\$ $ދT$Hf9t F9r\$ 4$FT$ۉ4$%ω|$D$$T$ 11F1|$\$t$uo,$l$$t$ ^_D$(HL$ t$ l$$l$UShVRjpD$(P<|$ًt$,$u%9t9buq $AT$u` $I ɉtN< |$AL$ <$O"!|߅tDWw$9׋T$u|$ OCA|$ ͋|$?tQŋ $9M$;t.u.$|;uӃD$ L$ ~IL$ G;tЀ r믋|$\$ $|$\$D$9j^1jPV D$(p1ɉNEFN 1ɋE FD$N؉\^Pl\H@Ⱥ7^1USWV͉$D$ pɋN.(~V9l$ n^ tr|$]L$ AT$RWhSUjqP|$D$9tI$N‰ЃNl$~9||$<$sj%l$ (9r~))9wω|$DWP|$Wͥ D$lj<$N)N1틔$$+FN҉Ǹt޾|1*1^_[]øWVt$ xtt1HtGw)ΉwOOЉΉ^_Ë@B$1ɉJJH@B\JX1ø\_OfUSWV8ӉD$[1hWP肤 s j[t$D$$F&[CsH $l$4}Uhd\$SP UҹtӅuٸ 1L$Q\$(S Q1QPjVT$Ņt$ |$ u}{uw;buo$ȈC=|$w:Cp1Ƀt 1AuCtZŅt8^_[]ËL$T$4T$(11ۉ $d\$ <$WD$T$L$P>9\$/T$jnH^Ltt  T$t1<$UT$BL$QWvSUjrPL$;Ndt\$9\9u t9$9$Ht/q9u|z 1H170jZtt  t1 ^_[]USWV ։L$i  L4n;u?OD$ED$ D$1B9։$| <[ $9)1B9}1ɉ14$|`+$l$tTMttT$l$U$mT$  t1L$ T$Rt$qPWjUϋD$PD$;Gu9L$t$9wVt$ Sl GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV$T$yGD$$tL$ OL$tt$ T$ ut$4 D$t$wZX D$Ht19|$D$t$s!!$tT$ ! $ɋT$L $1鋗1 ʉu2!Ƌ$)D$0T$8w)΋OL$19ރs!2D$ L$ PIt$^_[]Ët$ t}HQL$ttL$T$ JL$JL$ T$L$  t1Qt$PVjt$$D$$Pu4$Vj GD$D$t$WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jRw G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$P'D$=D$~]l$ D$D$}t=Eww*rm4?]SljT$VuWZB E;l$rL$AT$A;QAt$D$T$ J$B h[BP$B ^_[]fUSWV8ӉD$O1hWP s Nt$D$ FNCsH $l$4}Uhd\$SP UҹtӅuٸ 1L$ Q\$$S Q1QPjVT$Ņ|$|$ {u};buu$ȈX=t$w=Cp1Ƀt 1AuXMŅt8^_[]ËL$VT$4T$(11ۉ $7<$?L$ hQPG D$ D$0(1^_[]Vp@t1tNXt$9wVt$ S萐 GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$yWtL$|$t \$<$ u݋42t$ |$wR_\$ Ot1ۋ|$9߉|$s#\$ t4! $t1苏1 L$u2T$ !)L$L$41W)‹<$19s!D$L$Pt ^_[]ËD$tED$ED$H $D$RVQPjD$ pD$PuVjw O $L$(WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jR G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$PD$=D$~]l$ D$D$}t=Eww*rm4?]S~ljT$VuW6 E;l$rL$AT$A;QAt$D$T$ J$=7 h[D$[7 ^_[]USWV4։D$(CljD$ h(jP苌 4$~ pC|$$D$G,C $AiPT$1҉T$0T$0RhdQP L$0¸uȋ@@1QPSV與L$Qt$h RPjUT$ E|$ 4L$33 u\=8 t=Tt@A0==`It1҃t1Bσ ut$ HB$ŅL$pD$$|11t:L$ I1҃(‰)I;L$uFt$PW> t3F9rL$ AT$A;QA YH>$X2L$ A %=uTqt$ 0|$|$L40@Pt$ Q 9(~Vt$(pL$t$D$ D$$@h|@Od u1$J|$W\$S|$w0UPjrQu\VSD$8P: |$0/D$(tlj$Ou-t$FL$01D$ h(-Pl ŋ$B4^_[]ýUSWVT$ B$pL$1ӋF݉1vxN`1 t1ՊNd $t1>T$ BL$Q\$Sv0UWjrPDžuRD$;F0uD$K 1D$1vxD$hPQ 1H$ ^_[]USWV(\$t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV8T$ ϋQBrD$HPT$$T$ |$t$t؉1ҿ 9ڋT$8t$$D$|$ |HV$ƒ߃ N t1ҋ$9ЉD$|$ }!L$@#QL$ L$I0 $ 1$1 ʋT$u1!׋$)T$ :U~)ϋN L$19߃s#:1|$(GL$WSte^_[]Ë|$(L$, tVL$9L$AD$QL$IdD$ t1Qt$PWjRD$ Pu<$Wjۂ D$ $FD$T$|$ WVt$ xtt1HtGw )ΉwOOЉΉ^_WV֋xj|jRS G FGFGFGO N\FX1^_USWV T$ƋP1$BJ T$zD$T$ t$PkD$=D$~]l$ D$D$}t=Eww*rm48@]SljT$VuW9+ E;l$rL$AT$A;QA t$D$T$ J$+ h[!9$+ ^_[]fUSWV8ӉD$71hWP s 7t$D$ F7CsH $l$4}Uhd\$SP UҹtӅuٸ 1L$ Q\$$S Q1QPjVT$Ņ|$|$ \T,(CHKLЉ8<щ@DC0=t$>=`r7Kt1҃t 1Bu6Ņt 8^_[]ËL$TT$4T$(11ۉ $7\$? $ hQP{ D$ D$081^_[]Vp@t.t NQ01F 111^USWV ͉ƋD$ 1ɅtfӋ~G4$;OG}IT$D$P[u>t$9wVt$ SPz GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV T$L$ iuENPUT$$ u׋8 D$-EU_9؉ËD$}!@#^L\$N0L$11 ʋT$u2!Ћ|$)T$T$4:u)΋M $19s!2D$L$ Pt ^_[]ËD$tKD$/D$ H $NdT$щRt$ QVjpD$Put$Vjxx ME$T$D$WVt$ xtt1HtGw)ΉwOOЉΉ^_WV֋xj|jRw G FG|FFGON\FX1^_USWV T$ƋP1$BJT$zD$T$ t$PD$=D$~]l$ D$D$}t=Eww*rm4@]SzuljT$VuW E;l$rL$AT$A;QAt$D$T$ J$9! h[.$W! ^_[]WV|$ jW#x*t$t$Pj t^VhpxP%=cH\tPhTW.ctP]!PhQ7. h](.1N^_USWV@t$T1PPPV'!ƒDj@UV% @t;uxh\-cP PhQ-\$\|$XjhTUs uY|$uRjD$jSWUV{kh.\_-cPa PhQ;-wjhTUMs uc|$u\jD$jSWUVuB1tAG+Ph@\!S,h],h],cO5c@^_[]ÐUSWV$1hWhjt k =kWV!9Nj$$D$PWu\$`t$d1D$`}9t$d}W"@+Ƌl$`1ۍ9͉rQPW" ~)W"$D$<#t t< u FFF]}CG<=tCGC؊t t@jhzMUo jhz\Uo jh\Uo jh\Uo jhmMUmo jhuMUUo jh_U=o jh\U%o SU$W$K`kGt?<:tNGD$ )j@D$Ѓ rYk$`kG$<k;u<`k@$SH\kSkTkXkPh\)`)K5AtRDtAaSE1Ʌ kIkat)dt8Lt)Nt ,ltnu"kk k1hH\)W $kt!u:$ |7=k~.k,=k $ $ $ kƣk\k1ҹxx9| 9|N \kĄ^_[]WVjt*Ph\G(kurt$|$ h](h\(Wh\(Vh\'h\'h ]'h ]'h]'^_SWVt$hT'1kT~.:u@j ؕ~ۻkj*ŕC9rŃt tb u[u ~u4t/~wkF*#Njxj n1 PWSj Ek^_[h@lUSWVh|$|1@|uAudt`l$h!]Uf_kVlPVUu_ Ut$VWgjWVl tKu11@h^_[]fSVD$ 1ۀ-tP41 wB1F2B r-u^[fUSWVT\$pL$ld$tCfy5D$A8k8$V L$h|$WD$0Pv$ D$lfx85t$,(1H11AL$1҉D$(D$1D$D$ ~GFܨ<t L$tu uL$ttv CuF!D$CӃ|$x]t ]vPhr]0K L$hT$vvvvvC HF܃D$ڋ\$pt L$tuL$t C~Vu%D$CL$(9ωЉӋT$Љ؉|$ rӉL$ \$NVL$$ωÉ$ӋT$9L$ ؉\$؉rȉӉ\$D$ D$ D$(L$$$'EL$lI889͉yT$N^V9$sF\$tt=)Phz]IFVT$)QRN^V$9$s@\$tt4)$T$9D$L$ щщNj\$prL$ |$|$L$ ;T$\$p,fyD$[y< "V(L$h|$$WD$ Pv, _t$)1\$l{${ {,@K({6%QD$0PS% 1ɉl$l$$?C9eL$1҉T)T)c1D$T$$D$,T$d$(|$t$ t$l$ 1D$(1D$,T$D$t% @uljƋT$lD$tl$ L$,t$ D$j<V(L$hUD$Pv, XD$,l$4D$T$ F>|$G $TT$lt D$tD$$t'L$hT$Vt$$t$ Ut$ l$@ƋL$hT$l$0UPt$  D$)D$t$T$ T$ L$lI>$T0T$l$l$l0t$D$0ƃT$ l$D$@%|$$WP\$S ؉D$pL$,Hh$1@D$tD$$11D$0t$B<l$t$4$Dt$81F1t$l$ 9 $LI$@|$$D$j h]PAbT$x |$$tX|$x]t],$t Ph]C L$hT$t Wt$ ttT$l|$+D$ $DD$ DD L$lj|$D$\$p1-rHL$89u 9q$E@Hu$||\$pFB<9J>D$t@tދ $;D D$\r{;뼋L$hjD$@Pso @|$<u:|$@u3|$Du,jhAD$PP{b ujD$TPhjd {;\$pT$lL1@D$t$l$|$$|$4t1D$,%L$WQt$h |$u hX!B$\t T$0MT$l|$D$t l$u -1B$B B,@J(B6QWRT$x D$(!#BCC {s1T^_[]Ë$T$4t$$T$4T$0WVjt$RQ!ƒt0|$Wt$V t19tPchB]h,]ctP PhQ h]1H^_SWV׉jt$t$Q!!ƒt8D$\$ %SPVM t19tPche]hW]*ctP0 PhQ  h]1H^_[ÐUSWVHl$dL$`d$hEEfyD$y,VL$\|$WD$PT$`fz,\$1@D$1HD$ 11${[Qt L$hu upL$htg EuC!D$E|$x]t ]sPhr]8? L$\T$sssV 0D$t L$huuGL$ht; Esu%D$EL$ 9wȋk $9rʉ$D$ kC)v>L$ht5Rhz]>CKST$)QR腌kC)v?L$hl$dT$`t4$9Ɖr $GJ, 9ωVl$dT$`fyD$mA0<ËV L$\|$WD$PD$)1t$`~4V ~*RL$$QV̋ D$l$3F0fL$L$ YC‹34$9ν wKD$Dމt$!ƃt uX%D$4$P) L$\T$4$Vs, +D$CM,$#l$D$`@0l$Gȃ(9R|$fT$ $1ۍ,t$ TwJt$$AL$\T$VWD$t tiD$ D+L$D$`@0C9r$zu9t(IuL$`I29tL$ DcD$ T$D$T$1HD$ $D$T$ $D$h% t $4$t$D$hT$`PL$(ED$B04'ËW L$\VPD$(D$G2LL$|D$hD$ t"L$\T$Wt$ t$ ; L$\T$WD$P|$$\t$t$+$L$`I2DT$`GƉt$t$ϋD$4ȉ%t$|$WP\$S萈 ؉D$dL$ HhG؉n1@D$hD$ 1D$D$$B0t$s,t$,1Ft$9`lIt~5cPh]mc X5cPh]:jP$hQj c- h]OVĀ^_[]USWVˉƅtRSyl$D$ tPNjD$Go D$PSU9V D$D 1ۅt: PUkTx%uUSt$t$$h] ˉ>^_[]Vt!ƍF vPvh]w 6u h6Wb ^Vt01 u^Ph]< SWV|$1H w1RTlt-uT$`lQ1 c^_[ÐL$-^ctxAt 9JRuQh^j$hl lfVPD$ L$T$t$4$VRQP^ÐUSWV|$t$&{~ tatqt c %uM9vgKjzj z>u/j mz9v8EPZzE9u" u0 t+CQ3z)9ZC^_[]j zUSWV|$\$C1FCtCɉttGuc4A1ɉNN NNT$ RPVl Åtc1O^_[]Ëu~tOD$t@8t;=b~D$1CaUttN$;b}D$C݃1뇋$rFH dVуYn `USWVt$w4<@>Tlt!L$T$l$ u(>`lUVc 1JщЉ^_[]Ãtu.>ll>hl>hl>ll>hl>llciUSWVl$ waD@TltM1Ҩu`lɾtQ1҉Ƌ1uXlt WP u҉t5c1H^_[]1f=ltál_PoojeolÐSWVmt3m11N9rtO9r׉މNj@ut0cwQt5cs H ^_[QPh_ mmfVPt$ =mu m%D$$PVSh].fWV1Tl?t VFu^_ÐPD$L$ $QPXUSWV D$8$|$4GG<%t Pn1GrwUø$A1yluψ@ Ƌ $ $$0SR|$t$$1rj0ymjxom|$u\$($1[$0$FP5mFu|$W$0$1S$(HP$1һωމB\B9ˍ^ʼnrD4PlNH$0h$|$y޿j-l1jj UV@ يBL<G 9KƉrDP,lK$pP$1һljމ˃B\B9͹ٍ^rD4PkNj$0h$1jj UV*@ يBL<G 9KƉrDPfkK|$$ ^_[]USWV$L$8D$< mD mɽtD$D$\$@CC<%tPՃ\$1ËL$AD$rwb$\B1yluL$@ 뼋 $ $PՃrl$$(ҋ\$PRgl$l $ $1hj0ՃjxՃl$u] $ $1\$0$\$FPՃFul$X$0$1T $yQ$1ҽŃBL B9Ÿnȉr΋l$D4 PՃNK$(x$yݾj-T$ 1jj WU= ي BL4 F 9Kʼnrċl$D PՃK $yQ$1ҽŃBL B9Ÿnȉr΋l$D4 PՃNh$0x$1۹jj WV< يBL C 9MƉrċt$D, PփM\$ L$8ɡmt)ȃ$^_[]mám; msL$PmfVt$pucN1A FFFF,Q tV0A4?AA1JQAA$AL$t*vx),V@< w!1H#D$F<~@11F|$ FHL$D$@=??uD$@?@?~N L$nT$J?$1ҋD$x1PPP|$ *ڋ\$$|$ L$,$A0??|$dND$xt"l$р,$T$D$N? ,$wBOF,$Չ‰L$A,$QOMl$U #ڃ$EG?>р,$F$Br wWF$Rrl$|$׋ $ʃl$EdCEh l$(h` $|$@l@E?1ɋ\$l$|$D$X`Hl\$(9ىsrʉ|$كw#YM>Ft$ 4$l$t$ l$ˋ4$JMlHCf|Ut4$;L$(ʋt$ ŋ|$r\$w$ nCT$fDBtD$Au@lD$\\$CpCTCPCXt$Pt$\t$Djt$djD$l$$@f`t$ 4$D$hlD$HL9|$T$Љt$ >Fˉ<$9rcD$XL\$$FL$ADG|$K\$$AH?D$X t$ L$ AL$ $prD$@  Ћ$9$$D$HD@B?D$C?T$D$@DtQ9wŋt$$9t$$wVR\$SZ8 )|$)t$$\$D$)pDl$w L$$ӉŋxD0t$ 4$ClCF?1D$؋T$T$HdPhL$HʉT$49ՋL$<XPHX1HЉ|$0|$ $D$(!TD$9sA\$0|$ L$ AL$ у#L$($T9rΉߋ$|$ |$0\fw$)ЍMT$Jlf\jt͉D$L$<&ftVfJL$9s(uL$ 9AL$ ߃;D$r؉)ЃJL$9s()L$ 9AL$ ߃;D$r؉)Ѕ@L$TirIJL$9s(L$ 9AL$ ߃;D$r؉ )Ѓ1҉D$);D$4\$F<$9r+T$$@ aD$Q?l$ Љ1O׋,$!L$yH),$Չ‹|$D$L?L$$ |$T$D$8)ȋl$]H)‰|$v!;U0v-t$$@"a} t$ D$)؋UD-t$ L$$E4)v E,)E8)E8֋UD9։w4$9ωw)ʋ|$WDʋ|$@GJu|$)͉l$$D$xD4$D$H?T$L$I$tA0t! $i{=B $@_ GpGTG\GdDGtUt$dSwhPjD$$_$@`D$Q?t$ R @$$t  s/D$@ t%D$@ $fjPt$46 |$D$6?1$ F$RrD$@$t $HD$@t*@ t$D$@ $jPt$46? |$D$7?1$ F$RrD$@$t$ʉHH D$@t/@ t)D$@ $fjPt$46 D$|$@8?@$ rD$@$tt@kF$QrL$$QDI$tQ1 s1D$@ t'D$@ $fjPt$461Ƀ |$1ҋD$9? $L$A rt$ ID9w΅T$T$Z$ۉl$t4St-{[)ω)v9wQt$R/. D$@ D$s@ tVt$\$43o l$)t$ HD)HDT$D$ɋ|$t$ @D@:?D$@u@$t@D$}T$l$17H$t AtT$RD;Q s Jl$MDFۋD$t9t$w@t@ tVWl$4u ED${ l$)|$T$@D@;?D$@u@$@$|$T$l$17H$t A$tT$RD;Q(s Jl$MDFۋD$t9t$w@t@ tVWl$4u El$)T$|$D$?u܍C$C$>?u$1PPP UWPv ;KuUt$R?|C1nVt$uuNA tD$ A$@01^USWV t$ =t ^_[]ËFnu }@r}S?tVES?E\$1@9uL$ D$)v\$1@9u+L$|T$jڋ4$rAGAGwtuG AGT$ ‹L$ 볹??` 4$t  a4$L$XAQ?D$H)ƋD$X0L$$)x HL$ )H1H!L$A[։!ϋ],\$$!׍\!Ћ]0\$ !"k!L$XY4\$‰!q Ӊ!؋I8L$Ɖ!荴0Cy։ЋL$8L$@!ōL$XICʋ|$ 1ȍN֋\$$ 1э9~S 15: \$4 1ƍ>*ʉ 1΍ӆD$H|$TD$DGT$LWL$PO j@jD$`P'Ĥ^_[]USWVD$ |$1ұՃ<,ΉՃ ,uNjt$ N?17)ȃ8PhMV jPV LLLLLLLL@ujXjVa^_[]ÐS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐVWST$L$1t8uЄtZB͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐVT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fSWVL$t#T$t$1>:8u1tG9u1)É^_[fUSWVD$,t$$$tD$,"'CH tr<+t<-t D$ 1ɉL$CD$,t$u;<0u7 xu-KʀЀ rʀŸr ʀ¿w $1<0ƒ|$,u эL  $1H14$D$ 1K1н rrw';,$} 1;t$ wu94$KC1G1ND$(tt\$L$~ـ|$uȃ^_[]t$,hahlaxSWVL$tT$t$1>:8u G9u1)^_[ËD$t8t9@€tuuuuH+D$ÐVS\$ t$tCFtD8t>u(CV9u!€tފCFt8t)[^VSD$ L$t 8tft`@͉ ыލ1΁ €t8u.t(8u!t8ut 8uHu1[^fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ÐV|$t$ L$uD$^ÃrfftFGZM _M c`.aMTM}fM7qMYmM'uMzMSM MMNM M [ M QQQQQQ RRRR)R;RoRrRwR|RRRRRRR^e[ !###!#######{"5.12 (Sun Jul 12 00:14:45 UTC 2026)NetBSD/x86 BIOS Boot11.99.6IчHZIчHIчH2IчH-чH-чH(s*K>;AM3iǁ|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+\ M}-3Dh&ǪX~B4ϳ`1bOh3qJi=rGy=iG};Mt?mWC 3KOOyD<#*=(SFH0eCSFU0eCHah!IdontNeedEFI8]U9iU9tU$9U49UD9UT9Ud9Ut9U9U9U9U9U9U9U9V9*V:=V:HV$:SV4:^VD:hVT:rVd:|VnWuWzWWWWWWWWWWWMWnVWWWdUUWrVWWX XXUXX.X:XUdcd dccccc{d{d{dc{dc{d{dc{dc{dcW["[&[*[.[3[8[. !.. ![[USTAR.volsize.USTARFSW.[&["[*[[8[3[ \W.[&["[*[[8[3[ \W.[&["[*[[8[3[ \ W.[&["[*[[8[3[ \999qNetBSDEEE.NetBSDc-^d@^eV^fg^gu^h^^^^F^O^_'_:_K_i[_ o_,,,,,,,,7V,,,,j,)@________q__ ___ 0123456789abcdef?5  z Yd+5K   T`      inflate 1.3.2 Copyright 1995-2026 Mark Adler  #+3;CScsK !1Aa  0@`@@`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @help?quitpkbootconsdevrootmenuloadmultibootvesasplashrndseeduserconfufsNAME=%sNAME=%s:%s%s%d%c:%s(invalid)boot.cfgPress return to boot now, any other key for boot menu booting %s - starting in type "?" or "help" for help. Wrong password. commands are: boot [dev:][filename] [-12acdqsvxz] dev syntax is (hd|fd|cd|raid)[N[x]] or NAME=gpt_label (ex. "hd0a:netbsd.old -s") pkboot [dev:][filename] [-12acdqsvxz] ls [dev:][path] dev [dev:] consdev {pc|{com[0123]|com[0123]kbd|auto}[,{speed}]} root {spec} spec can be disk, e.g. wd0, sd0 or string like wedge:name vesa {modenum|on|off|enabled|disabled|list} menu (reenters boot menu, if defined in boot.cfg) modules {on|off|enabled|disabled} load {path_to_module} multiboot [dev:][filename] [] splash {path_to_image_file} userconf {command} rndseed {path_to_rndseed_file} help|? quit /Exiting... Could not reboot!%s/kerneldefault NAME=%s on %s%d default %s%d%c invalid console device. truncated to %s No menu defined in boot.cfg enableddisabledoffinvalid flag, must be 'enabled' or 'disabled'. multiboot: %s: %s boot returned onetbsdonetbsd.gznetbsd.oldnetbsd.old.gzonetbsd/kernelonetbsd/kernel.gznetbsd.old/kernelnetbsd.old/kernel.gzbooting %s (howto 0x%x) %s.gzpccom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdautodiskhdfdraidmodule name too long couldn't allocate command exec returned%s is not a multiboot kernel couldn't allocate module /prekernWARNING: couldn't stat %s WARNING: couldn't allocate module list Loading %s FAILED WARNING: %d module%s failed to load i386amd64generic/stand/%s/%d.%d.%d/modules/stand/%s/%d.%d/modulesWARNING: couldn't open %s (%s)%s%s/%s/%s.kmod%s%sWARNING: couldn't allocate userconf commands list Unexpected ELF class%s %sELFlseek failedread failedUnsupported multiboot address header Unsupported multiboot relocatable header multiboot2 info size mismatchStart @ 0x%lx [%ld=0x%lx-0x%lx]... %s, Revision %s (from NetBSD %s)_SM__SM3_NetBSD RAIDNetBSD FFSNetBSD LFSNetBSD SwapNetBSD ccdNetBSD cgdEFI SystemMBRFreeBSDFreeBSD SwapFreeBSD UFSFreeBSD VinumFreeBSD ZFSMicrosoft ReservedMicrosoft Basic dataMicrosoft LDM metadataMicrosoft LDM dataLinux dataLinux RAIDLinux SwapLinux LVMApple HFSApple UFSBIOS Boot (GRUB)Out of memory disk cd0 cd0a fd%d fd%da hd%d%llu GB%llu MB NAME=%s( hd%d%c(raidframe raid%d serial %d in NAME=%s size hd%d%c size raid%d%c(, bootme%s not found EFI PARTUnexpected raidframe label version unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660ADOSFILECORELinux Ext2NTFSjfsvinumUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedVBE2VESAmode 0x%x invalid mode 0x%x not supported mode 0x%x could not be set WARNING: failed to set VBE mode 0x%x DDC [DDC1] [DDC2]: no EDID information : EDID %dx%d Modes: [?] none foundlist0xmode %s not supported by firmware invalid flag, must be 'on', 'off', 'list', a display mode, or a VBE mode number VBE not available 0x%x=%dx%dx%d %c. %s %s%d. %s Option: [%c]: Option: [%d]: Choose an option; RETURN for default; SPACE to stop countdown. Option %c will be chosen in Option %d will be chosen in promptbootinfo too bigunknown command > com%d seconds. 0 seconds. -%c: unknown flag invalid arguments diskbufp %x diskbuf crosses 64k boundaryufs/ext2fsbad dir entry REGDIRCHRBLKFIFOSOCKLNKmsdosdosfsustar%8oustarfs@Warning, unexpected short transfer %d/%d ustarfs read512block Please remove disk %d, insert disk %d, and press return...Disk is not from the volume set?! CD001cd9660lfsWHTread header failedread header short=0x%lx Could not allocate memory for boot configuration bannertimeoutdefaultvalue:%c clear \\-__,------,___. \\ __,---` %s \\ `---,_. Revision %s \\-,_____,.---` \\ \\ Password: lseek section headersread section headerslseek sectionread section%s%lu++%lu.SUNW_ctf%s%ld [ls: %s stat: %s no ls support for this file system %d: %.*s (%s) %d: %s (%s) The ls command is not currently supported for %s Unknown error: code %dbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentNot a directoryinvalid file offsetPermission denied1.3.2|/-\heap full (%p+%zu)incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check%s: invalid base %dstrtoul    Rl+9ABԊяcȋ)$چ4p&7=̩.oس޳ XP39{ؑə 74iLqqsss t(u5|؀ހY/Ѷx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W++)1_WVRVRf+ ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & vUSWV|$$MU+ ++h+jh+'+t |^_[]jhy+ǃ$+@+jhy+ǃ=+5+D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh+1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh+11Ʌ*D$0j$QP 1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh+**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$=`r7Kt1҃t 1BuŅt]4^_[]ËL$m4T$$D$1D$ $t=L$I1҃(‰)I;L$uFt$Pt$ t9F;t$(rL$AT$A;QAt$ N $t$ 4G %=ucot$,$ (9|$.,$L,0@Pt$ Qt 9(~Ut$(D$8PZ OL$o򋷔B@4Kdl$ UVs0QPjrFut4$VD$8P  t$ |$0/tL$ $Pu0D$L$0$T$1o/-+fXNŋt$ CUSWVT$B$hL$1щӋE!UD$ T$ut$1uxM`1 t1|$|$ \$ӊMd t1$D$PVu0SWjD$,pÅuCD$;E0u5$x 1ۋD$1uxֹ 1H $؃^_[]USWV֋i  |4(;u? L$ D$ED$D$1B9։$| <[ $9)1B9}14$D`l$T$Jd|$Wt$r0QPjD$$pu|+$l$D$;h0u{D$t$9wVt$ S^ GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWVT$L$iuENPUT$D$  u׋8 D$,EU_9؉ËD$}!@#^L$N0 $11 ʋT$u2!Ћ<$)T$T$0:u)΋ML$ 19s!2D$L$Pt^_[]ËD$t4NdRt$QPjD$ p%u4$Vj MED$ T$D$0WV֋xj|jR G FG|FFGON\FX1^_WVPT$t$D$@+7W++71Ƀ ȃ^_fWV+1L$D$ >tG u Att+1O^_ÐT$D$@+k+1ÐSWV+t3+11N9rtG9r׉މNj@ut(+wT+ H ^_[Ë ++fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH NetBSD/x86 ffsv1 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PART+1м|ؿ|PWˀ~RRL.f1f1ҍ*Ff~<t<t:t'~uf>?tV4fX uftfufff:2BZR}s0״t 00);v堐,;:us ZPf1$ffu?HBbZ1ZRRf.:2BZR2r۠|t}=U3ufZ|Error Fn: diskn0: I`uaU" . .. chroot  installboot wiconfigѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f Wt- -)1_WVRVRfl- ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & kUSWV|$$MU- --h,jh-,t |^_[]jh, ǃ$-@-jh,ǃ=-5-D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh-1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh-11Ʌ*D$0j$QP  1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh-**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV8T$ ϋQBrD$HPT$$T$ |$t$t؉1ҿ 9ڋT$8t$$D$|$ |KVT$ƒ߃ N t1ҋD$9ЉD$|$ }!L$@#QLT$ L$I0L$ 1$1 ʋT$u2!׋\$)T$ :U~)ϋN L$19߃s#:1|$(GL$WSte^_[]Ë|$D$(T$, t<L$Id t1Qt$ RPjWu|$Wj D$ $FD$T$|$ WV֋xj|jR G FGFGFGO N\FX1^_fWVPT$t$D$@<-7Wl-+71Ƀ ȃ^_fWV<-1L$D$ >tG u ACttl-1O^_ÐT$D$@<-l-1ÐSWVp-t3p-11N9rtG9r׉މNj@ut(-wT- H ^_[Ë p-p-fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH  NetBSD/x86 ffsv2 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PARTt-1м|ؿ|PWˀ~RRJ*Ft ~u. uƋu-P^ Z1fluCZRDPBTЃ?Z?H9tGUAZRerUutf. BZRAr|t}=UQufZ ZtL||Error NetBSD MBR bootNo active partitionDisk read errorNo operating systemInvalid CHS read`uaUѶx}uff>}`}Ba}rû`fl4f|8f.}f>}fError readno magicno slice`uaU~Ѷxx% f W- -)1_WVRVRf|- ufZf[fYfgNP 00<0u ^Boot failed (errno xx): & u5USWV|$$MU$- -(-h,jh(-,t |^_[]jh -Gǃ$ -@$-jh -ǃ=$-5 -D$8D$4PARTD$0EFI 1AD$|QPL$0QWVh(-1Ʌ$z1=Us1ɀ$>^1C؉S$RSQPh(-11Ʌ*D$0j$QPI 1Ʌ1Ɂ$1Ɂ$$D$1 L$,9ѺT$wD$$D$rt$(|$qރ1D$D$D$ D$$1AQ$PQWVh(-**t$(|$1ɉ|$$t$ L$D$,\|1D$HD$DD$@D$t$9wVt$ S GG)4$u1D$ 1 1D$ t(ȃ ^_[]USWV$T$y_D$tL$<$OL$t T$ u43t$ D$\$ wU$p Ht19ًD$\$ s##t$D$<$t !L$ɋ\<$1鋗1 ʉu3T$!)D$T$8w)΋OL$19ރs!2D$ L$PXt$^_[]ËD$ tnL$L$ tt $L$IL$L$ $ T$ t1QSRPjt$uSj GD$D$WV֋xj|jR G FG|FFGON\FX1^_ÐWVPT$t$D$@L-7W`|-+71Ƀ ȃ^_fWVL-1L$D$ >tG u Att|-1O^_ÐT$D$@L-|-1ÐSWV-t3-11N9rtG9r׉މNj@ut(-wT- H ^_[Ë --fVW|$ t$L$1_^wHËL$1H@<uÐW|$D$ L$WX_ÐVW|$ t$L$Wt 9rNOX_^ZIчHIчH-чH-чH NetBSD/x86 lfsv2 Primary Bootstrap set_geometry Can't open /boot /boot load failed Invalid /boot file format bootEFI PARTlfs-1м|ؿ|PWˀ~RRdF*Ft%~u.?tn'4X u0״t 00);v堐,;:us ZPJƋu?`ZZ1ZRRfluBZRDPBTЃ?Z?H9tDUAZRLrUutf.RJBZR2r|t}=U3{fZZtL||Error Fn: diskn0: a`uaU# . ..,misc, .#.. . ..- db. log/ run0spool- .... .../ ...0 . ..1lock1 .0..