08PEj'&<  'EjQeDP''`'$. $.Ej'&P@@<@T 08PEj'&<  'EjQeDP''`'$. $.Ej'&P@@<@TU Ej`'$.yAEjEjEjQ$f EjEjEjRAEjEjEjfAEjEjEjgAEjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEjmKS%EjEjEjX`hpx$EjEjEj (08@HPX`U$EjEjEjhpxeQ$EjEjEjS$nEjEjEj (08@HP KAEjEjEjCEjEjEjAEjEjEjAEjEjEjmAEjEjEjX`hpx\$ EjEjEj$EjEjEj$>EjEjEj$EjEjEj$sEjEjEj$EjEjEjAEjEjEjm EjEjEj$EjEjEj $EjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEj$cEjEjEj (08@HPX$EjEjEj$EjEjEj$EjEjEj$EjEjEj$EjEjEj$EjEjEj$EjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEjAEjEjEj*u`hFF!E*"fy3 7t[268x~a2)O*U&5g>%g|;E> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4P%4 (p"p"XX}$22#TTT,,}$22PtdX(QtdNetBSDLwGPaXU,SR ffffUSWVP[O.t$DujPjjj謊j0Fɉ$uȮ& Q/tu|$Tu?;(s(U9rq\|$u ]t W0P0;sU9rHP0$06v? P+USWV [hN.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]USWV[ÛL.; s' ~*u.UE9r^_[]1SWV[LL.;s9r^_[f$SWL.5u1ƃ5$tЃ t$k_[SWöK.4uYƃ4$t|$<$kt(?t<$nktЃ_[WVD$0tP>tKj/Vt@Ƹ!q"Ѝ&PV@ t&uVhp"hp"hԆ33^_`SWVhp"hp"hԆ3u3 1۸!q"Ѝ&P CPrFhԆ3j 6@whw%hԆ3/3 uhԆ3j @j'D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5Ď3Y u$1^_[Vhs"Vhs"< 53hs"jwVhs"jܰUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S& tutD$D$$D$% D$t$@N D$l$hȎ3h׬$8(D$ @l$0tD$Ph$(j )'D$  |$\$4t$,s$L$)L >QPhu"' D$  L$s()@L$L bQPhu"'L$ D$  s D t 4H&hu"y'L$ D dtPh v"_'D$(@9XU¼\$D$T$T$9tt$N9BD$4H&53h*u"' 1h^_[]t$|ht"3%WS$h>u"h[u"j%U853hyu"j:t$|hs"53hnt"3$hu"jhc 5Ď3 u153h-v"jSWVPD$Hw#t$>(&WOt ub,&$h"s"W*t N1AQhc5Ď3q u 1^_[53hBv"jOUSWVP|$t$7Dh>s"WV fu U3u $3)u 3uhAs"Is"t 3hjQt Ď3u 53hRs"Ih !u3$(ܐ&SUt uUh{s"jAh[s"je$NPVS& PV Ԇ3PhVv"VE' Vjjhv"3&ܐ&hv"hԆ3' uj5Ď3uWVοVh&]tuVhs"j脥l&^_VPΉj PQ, x $9u^Vht"jKWVοV&tuVht"jt &^_USWV\$$13 |33 3sVrj=Px<$h٣jjh0&Ul 3H F H 3VP3u3t;#=t%{ 3##=uthRw"/3tttut!tcu3h ,3^_[] 3Vhv"W Whw"4$hv"4$h"w"j蕣hlw"hw"D$L$0161PjPjt$hy$\3|33 31PjPjt$hw",<383hw"j1hjPPt$hx"43031PjPPt$hx"ԍ,2tVj3u$1PjPjt$h)x"蜍3 3ËD$3h:x"jw1hjPPt$hPx"^$3 3h\x"jC3u$1PjPjt$hsx"$3|3ËD$3hx"j1hjPPt$hx"331hjPPt$hx"辌L3H3fSWV@3t/ 33 t53)փ>8F u3h33 3 p3l3;|3 3r*jUh33l3 p3 33^_[á3 3 t l3p3hB&h׬$jhB&h׬$j֠h@&h׬$jŠh@&h׬$j贠USWVt$|$61>dp#SjiSVWv u=$3P]3u,3^$3(3X&Ahx"j5(3X&1QQPqn 3y 533 3 =,2r3uhNy"롡3u#33y"3X&13H3X& hQPm 3yJ13H 3 hP53Q 3 3y 53d3d33utS1V 3<38393rZ 3t= 83 |3@ d3t# 3) 3I |3 3ujgd3 3h3 3 $3t 3 3t 3h`u;53 |3=3 353VP53W 31Vh3覯hjhj5T35X35\3P3h?-,2`3t%33 3 3;03 43ss$3 3tQj QjPh (35 35353P$ xd53- 31‰1 3 3=3 333=3 33 3xPh׬$耚,3u6(3j535 353P  t53h׬$<3 3 3 33=3 33=3 33C3s 33=3 33=3 33u@s)tЏ3ԏ3H 3PQQJ 33,3=l3 p3j133133hzy"jPh׬$jVWV,3=t=h=u <3p3 l3t;|39щ53s))Rj5h3 3 |3p3 l3 u\53=3 tJ5|3j5d3 3 |3p3 l3d3ʉh3)Ɖ=353 t jY=3u3jPu 8u*353Pt^_hn#j#hy"USWV|3|$,tl3d3(p‰D$l$|$,u 3 xT$ 33 t!3jQP53R !ƒ~t$VShd3 $~ D$ `18D$ Z 33 ʋ-33t>535|3QP؏3܏333133T$<$t$ 3-3l$13L$ 3ď3D$11 3t,`3u#`353h y"#T$3L$ AD$)ʋ$tЃ|1@|p9@|533*|31 3T$1 uK33I$T$ p3l3)ѣl3 p353-|393ď3$ t h3)PQ5d3F l31d3h3 L3H3 t(335ď353QPVRY tjh%jc$^_[]53h/y"53hx"53hx"jϖ53h׬$jUSWVt$(|$,\$$UhP3jc C4WVs(P( c8jUjc O8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"jUV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h׬$j跕VP9v V VPQ, t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVH3 L3t/jh<1#ja H3 L3tjh<1#j` 1t$PVĥFȺMb׋ 3-։+3D$H 3iى tL$ 1FD$|$ 5ď353535353535353hy"jdW,WGPWj ` ԏ3Џ3 t?ƒ ʺ'%t#RQPhy"jd|$4W@WPWj_ ̏3ȏ3 t?ƒ ʺ'%t#RQPhy"jd|$4WWPWjk_ t$ ܏3؏3 t?ƒ ʺ'%t#RQPhz"jd|$4WWSPWj_ 3D$=3jPt$ t$VÉiL$it$V)QPRPVSt$Whz"jdt$@V$VPVj^ e^_[]EVt$;VMj'fUSWV35 3= 311C(3W5353P$ Mtg3u53h׬$ (3W5353P$ ݅~3t )u= 3N{T,2rOH,2d5 3 3=(3 $353jVP53W !ƒt^_[]hQz"j~53h׬$j蜐WV3uD53 |3=3 353jVP53W !ƒuuJ3 3ti1135|35d353P$ ~J;533r,f 3H 3Phm53Q xw^_xof@ 3Phm53Q tD;533s5|35d3hd3 3|33 3 t53h׬$jGfUSWVX $p $l 7,hdp#j边j-hkz"WS轖 H-$&X3H3L3@H3L3P3T3`3l3H3L3ud3iH3L3Sp3Gx3;\3H3L3t3D3h3|3=3-UE=d3u =M=p3ui $=T3u=`3v$ =3u j Vh*#ot^_[]h~"h~"hJh)~"h~"hKh}"hL}"j}USWVt$ D$ɍ \3 ˍl$Sj hdp#PRWU0UVh @$^_[]fSWV|$13A3GO Đ31ʋ31 t$3 Đ3jP5Ȑ3  39}3W43 39|_SQ33 43u H35Ȑ3WjPfx!9u=3Đ353>X 0"Ph#hԆ3O h~"'0Ph#hԆ3& h~"N^_[0ĩPh#hԆ3 hH&hN 43uáH3u tjwGjFUSWVj Ƌ|$11K< @u=3t?jj5Ȑ3@  5Ȑ3j3Đ335Ȑ3UjW- A)߉n3 Đ3N F53q033-3F Đ3Z0sPh#hԆ3 hH&Mrh "]1HĐ3301Ph#hԆ3^ h"'0Ph#hԆ35 h~"LV1^_[]Vt$53q0F33^WVL$ 435̐39})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 ̐3u H3uu82^_É1jDjDVT$3t=31363t@9uхt3uh'%hK1^SWV13ē3j?h"衒/"tW]t|8/uWh5"WhA"hА3w( А3tLPEt$hh"PPȐ31ۅu@WLG5А3h׬$uk"juN"PJV,^_[VȐ3tAPSxGȐ3А3t!P5А3莋А313Đ33;5А3*0CPVh&hԆ3oh"I^Vt$Ȑ3t3PА3t!P5А3А3Vjh\3h$30 "x 3331Ԑ3@=ujuSVL$D$ T$t$ԑ3Ԑ35ԑ3Ԑ3~A2Ԑ3BI^[fV1ؑ3ܑ333P7tP^e!e3Fu^SWV5ܑ395ؑ3t$ؑ3Vjjh3ut=333jjPPMOth"h׬$[H303@u3=3V^tVPG~*h "53r0h"h׬$G1N1Nyh0"h׬$G5ܑ3~ؑ3H ؑ331H^_[Ë ؑ3u!T$7ܑ3ؑ31ܑ3xD$Qؑ331HSVփuU303@u3jjPP Nth"h׬$G3 3 33aˍ3)Qh3P] 3303@u3jjPPMth"h׬$FVjjh3^[Vt$ ؑ3uܑ3ؑ31ܑ3x 1H^USWVh"VƊtx<0uFD uh"h׬$$EGuȿ|w WjP\ 1T L ш @u3hjV* PO:1Fth"h׬$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$D& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhA"XC^_[]eC$t硨38u@353Nj-31;-3M1WtÃ=ē3tj jwSVVVSt$l1Ʌ;L$uWwZ?E;-3|1MV431535353535 3ƃ5 3 43u H3uu ^j:jq;V53953} 3I43P5 3}tC53 3 43u H3urufL$3r53 1^0Ph#hԆ3' hH&A 43u‹ H3u tj:j9USWV l$ D$fD$p 1P 3319 3@u 9u3Sk3 t$$PPh,  $ 3| t %03ڃuh<1#QUuhr"QjD$P 4Ë $39}=3]439|A‰T$R53{NjD$3=3 43uH32$@PSWh =3?5ƅt3VPP,+ 38uK=3뜣3Gh<1#53jt:jPDž["x Q:? ^_[]Í|$70PPh#hԆ3} hH&> 43uH3utj8u"j&7WV 35319}' 3FىDuw9@u1=3^_USWVD$L$9tV3r= 3~=39 t9|1C3Mu9|1C3= 3 9u^_[]fUSWVl$}!uEhx0#PUT1hx0#PÅt*t$Sǀ}!u?Su=0PUh&hԆ3h"=eSfx(=@3uWh(v"hԆ3 53+t$0b0{PUh&hԆ3h"=^_[]USWV |$$Wơ3$ē3D$31-3-ē39-,3t\$=3t$ gDž~w114353Y6ts3PPjJ Å 43uH3t$ Dž|$$\$9t$utt "<$u=3t!ʀ"9u ē3 uhԆ3P[9¡ē3Ƌ 3Ӏu1A9|$t $ 3 ē3,3t )) 43u H3ut j4 ^_[]j3USWV1|$=,3t WrGHOHt uG `- 39}3V439rFU53v- 33 43u H30u ē3F8W趾<1ۍF- 39~N43 39wUQut7- 33 43uH3uhtk30 F01Ph#hԆ3^ hH&9 43H3j2G @utL30 F380赔Ph#hԆ3 h܀"Y9-130=ē3=3  )Ɖ^_[]js1USWV|$?!uGh@$Pt$WI,VPÅt2l$t$ US NjD$8!u?Sf=0ؓPWh&hԆ3h"{8mSWx-=@3uWh(v"hԆ3 t D$ )@ʼn3N0gPt$h&hԆ3h "8^_[]USWVPl$Uƃ=,3t1ۅtf;l$ `1V$th~;-3u=ē3t =3u8 GWPt$ F x4EEs @6;l$ |=,3tt$$$^_[]USWV|$\$l$19t[=,33t UPrUPFy"0;Ph#hԆ3h h$"61^_[]USWVP\$53FEx @u}|~PVq6tj(39~l43$39SP!rgƉ(3$3 43u.H3_tO53;^_[]Ë5$3W53V脜 . ,1xщǃ|$uE3| /5(39$~Z439V5$3^qcÉ5(3$3 43uH3t $3W53Uћ ,$+HPS5$3D( |$tM1BDžh["40!Ph#hԆ3N hH&41 43H35(39} $3|$N43$39͋|$|MVP'pt05(3$3 43u H3umua(/ I0bPh#hԆ3 hH&4 43t1H3uj-j/,SWV11(3H (37h$3u803@%f039u$3H $3ÍF=`39~Y439wW53n=`33 43u H3t 30u ē3F 3C0 Ph6"hԆ3: hA"2%031t 3033^_[0豍Ph#hԆ3 hH&U2 43uH3u tj_+j*USWV\$ D$1tt$hS"D$ l$1uHD53J 3;3у  |3Q|3;=D2|h|3hX%7Q1GD5 | <\t<3H 3;3h|3j\|3H |3\\5tjj ShX"ٗ tVGX")Ȋa"3J 3;3Vу J |3Q|3\$ !03H 3;3h|3P|3H |3D50 3Q3ɋ\$ ; 3h|3P |3Q|3D50 3Q3; 3h|3P |3Q|3Dh|3Qd4 3Q3; 3~;ȃ t3 |3Q|3D$F9h|3Qh|3P똡3H 3~|3H |3 h|3j 1^_[]fWVD$L$L$$$0V| $ |r183hj"t$t$ d ot9EtzSD3ǃxtostypfUP3먡$3  $)D$|$ta$8-uW@3D$|<$3b<3S ,3D@35$L$jjAthjN1FhV=Vj2hj#hT3ƅux'L3|$t$8t$0|$t[hԆ3hr""M$8u h"_-j聜u$hԆ3hq"Lhu"--y =03thd3h#hԆ3 P3tPh׬$h|3 xt` 3| 3x51g3QPP M=3=@3hԆ3hr"Kh":,j\%033h[",%03΃t0hԆ3hr"sKj5153hԆ3hr"MKh"+V跚Q=03thd353h"hԆ3jrjkPh&hԆ3 j4=03j@unhd353h"hԆ3of$j0yjt$8!$h0hP3#h uhd3h#hԆ3 jL$ ɸ!H3Phht@jȟ x#$r@2D$ rD2ËL$=43t1@ H3Ql"L$=43t1@ H3Q#WV1F=83t9|$ ?!t!hA#WƮtj/W7th")1^_3333x>3 3 33 3;t,uQ39;u3빋 3| 33t9t31Ƀ USWVP33DJ@t t@3@DJ@t uHH 3~Ã=w$ &=3!h<"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=3t=@3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h("=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH-33=3=3 9=3 -339 9w hm" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sO薴j h353^M 3wg8"%3 3:o t!gc ptrP  A 3< b=3Ho13PP9 3-3 =3=3 9=33-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@3 3AQP2 3<谲j h353xK @2}8"h"N@2 3x w =33t30h3& 3x A =3u;.53O1@3 3AQP@ 3jPP>3x  1q1ۃ=@3Ƀ=3 ˃h'% 3x  =3u-5353 53g 3x ? =3uL-5353: 3@;3?73-3x =3u , 3IQ T3x =3u,3 39QPn3x QVP 3y F( 3y 1 3y P5353g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+0303uF%3x Uu<2=P3t1P33x =d3hd3h#hԆ3 3x }*x1Hptntlu  ˣ3@У3x ',3G1333@Hptnt lu  ˣ3У3x =P3P3uf%|$Wt@$5353QP';333x ==3uJ)=P3P3u53Q5;3)3hX"h"h"3h'%31< *5 3y qt3@P3@P&=@3h%+3x )53j 6'(Y$i*t> $w G8"tN؉^t-t!u*H 3@P ƅx#3('%"P^_[]9t'%x953}1NUSWV|$l$3t 1; 3}hA~I53tPVP[tMǃ=ē3tj jsW1PPPWt$$趓t#319uh"^_[]ËD$ 3DAuh͂"4d3SWVD$31=3t(3;C1 8 3<; u&3| u;.u { 43StXá3tPFPPjq ƅt-9u3 43;H3uC*@ 43u H3u!u#^_[1%03jj=3t 3 3L$D$3 3~9 1; 3h'%BUSWV\$|$43SWj t 931 43um[CPƍoU}ǃ=3t V7F7~\$3-331 43u H3u u ^_[]jjVP3 ui5̓343V5ȓ3J;5̓3ȓ3 43 H3b[ 3DQ@t/@3DQ@t@ u uh" 1jP318!@3$t3@P=53ȓ3$31ɀ: t$1ɍr53q4$3: $uP@ƅtj5ȓ3b<$h" F0/hPh#hԆ3\ hH& 1 43u H3u u^j jSWV5X3}Z43W5T39Hti=X3T3 43u H3} &T3NT$1\uZB0tFB9u^_["0;gPh#hԆ3h hH& 1 43uË H3u tjjUSWVPD$931@P0t$"4$91S肻ŋs 39~Y439V53F5533 43u H3t Y3sUPaq {;$\153G9~Z43 39VQ^F533 43u H3*t 3f8 t$t$VN534353ta3PPj tL31 430ePh#hԆ3L hH&  43tUH3uZtCj诜0dPh#hԆ3 hH&l  43t ȃ^_[]áH3tjD$ 3DAuh͂"' ËL$EEp $A8GMi 3913)@أ3=3t W6U31 43u H3u u^_[]jjSWV=L3uj貽L$ɸ!H33Pjh@$h"Hy|hI#NtkPx=Yà P7tGWP#|3/tf/V=ed.hDhup53jh@$Vj=L3ujL$ɸ!H3jhT3USWVPl$53'Ƌ=33-39ʼn) u)E1u1$43E@43V}tzP蘹t_3PPj DžtO343H43u H3u[uE6M3@Pi1,$l& 43u H3ut j1^_[]jUSWV$83 D3th"ckjP~3L$F$ ԓ39} Г3V43Г39|BVP@5ԓ3Г3 43u H3! 3 u1C1E҃!%=P3hP3P譇Ɖ$ ԓ39V439V5Г3?5ԓ3Г3 43" H37 09L$]9439|WP?=ԓ3Г3 43]9~[439V5Г33?/5ԓ3Г3 43u H3yt vГ3 3 (E 3Q39\u=Q3I ( Г3G (E,$s 3L$A 3 3y ؓ3)9~_439VPM>I5ԓ3Г3 43u H3 ؓ3Г3| 3A(EA3ؓ39r 3L$A 37 H33/ 3Q3 ( 3݀ (5ܓ39}3R4339|KVP]=t]5ܓ33 43u H3S5Г3Pg 3ؓ3D$1!PR0k\Ph#hԆ3蘯 hH& 43 H3u!u#^_[]h"qhu"gj'jVj1tL$Qq p PIH1豓0[Ph#hԆ3 hH&n1^VP3t.L$19 3u3HP3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hd3/XWV 3 td< uhA"1 Q3I t;8t7P1ǡ3t?=3u6PPp3953h"R53j03tV35<3WP] 3t.h'hd3QPD53C@33/0 ZPh#hԆ38 hH&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M4339|KUP9tYlj-33 43uH3uyS53W[d 53=ē3tsj jSWmeА0XPh#hԆ3 hH&1 43u*H3u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwRsj h353;( 1wE8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[439V537#533 43u H3\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t %03ى384339|NWP'6t8=33 43u H3uuuw5303M1IA0ZUPh#hԆ3臨 hH&1 43u H3uu^_[]H3,j'jUSWVPL$33193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP3431S̪á3tP芬EPPjM Ņtl9u 43l$ uH3ue$33+39}yF3@3P%Ut$ Pt$$hDž+9 43u1H3uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=ē3tj jvS肮vލD$jPjSuUzt1t$ED$$D$1E $A9T$ 439Ɖ $T$~c43t$ 9V532\533 43t$ T$uH3=ē3tjj RS藭T$=3RSWO] 4$D$D$ 3 $9~bt$ 43$9V53B2533 43t$ uH3=ē3tjj t$(S=3t$SW\ Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu^x&D$)D$39~V43 39SQ7133 43uH3|$~#D$$ D$ ud$th/"$=ē3\$tjj SV賫3SVPn[ 3f |$%C<0PPh#hԆ3- hH& 43t e^_[]Ë H3u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y439W53/=33 43T$uH3%$9C 31F9uEEπ;D$$,$L$l)39~Y439W53.>=33 43T$uH3ml9}C 31F9u,$y^=39}3_439|W53x.=33 43tT$ H3T$M 0E+3;3539}3J4339|KVP-t)533 43u H3u^u`I0(MPh#hԆ3U hH& 43u H3uu؃^_[]jjfWV3 39|ld 3j Qh3  tJPLPh#hԆ3ɟ hH&@532133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWW19u33H23L2^_[USWV=H2=L2=3t 33$3D$j荣433 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H23$H2L23D$L21 43u) H3u&tj\hJ"$^_[]jlUSWVL\$d3ƸhZ"Y5_"tNjt$`hj"SV" fttu=U߃u $3r|$L$ D$10&"D$PpƋO9rPSt$ q tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ ho"j;L$j QP $;Fl$|1ƋD$8u&1zPUny!Uh׬$jD$ th"jNjC=m@!sHQPWc xs{QPWB x4$Uh" =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W y?60PhЃ"ӍL$fqQhmW 3Uh5#D$ukD$Pho"h"C T$"h"T$"h/"3H 3~|3H |3 Phj"kh|3j 艜t$8t$8t$8t$8t$4h"踖t$Ht$Ht$Ht$Ht$8hDŽ"藖t$h"膖t$ h"uj蛍6|PhD"hԆ3 j|SWV֋|$t 8"?t>"VQP( JB83H 3;3h|3j<蕛|3H |3虚|3H |3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hk"0th}"Pmu3h"/th}"PVmu h"%jh}"h"O Y'Pu h"jN0D$ u h"j`t$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$&U$뼃4t6맃dtket/1@D$s&=UumWt$#lXh΅"5UKD$71@D$$+L$ $3 $3T$uA$3$T$uȋ$D$,jj@R El$L$ $tL$ $L$,1ۋD$PiCEu S)St$PʼnD$$# UHil$$T$DtIL$ىL$$U$E L$)QPR=# 4$hEuED$ush΅"h+%fu]h"bh҅"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh3t$ t$,QPRNt$ H&yj=3y h"|$$tQt$(jVjhSXy h*"jVjh53Xy h<"h΅"fǽt$(1CUVSwD$PyXUVSw53eXt$,9$1L$XAAA @D$HPQSu =3u'l$hD$h8jU&u ul$uDžy h0#1O~fVS53Y VSt$VY |$h53l$0fE<u1|vu@hWj uXv8Jv18tƉjjUx tD$68Ztv8tEVSt$ x )bu8#Th%|$l$8fE=3ul$0fE9EjD$LPj |$@f9fGfG3G$jVU tQf|$<tٺtf|$4t?3L$0u+fD$<=3ufD$4 t8t$>Nf|$Dt1BuNfD$Dh|$u%j t$khN"jt$j芄h#ysh"PhS"hԆ3֏j\PD$L$jQ53C XUSWVA1K8uSt<։,thU7G ~WUV ~)u1s1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSbƅu]jj&tqƉx jPSz  ǀ;t$8u1A8Љ4DAtt;L5rSh"j6 1<0h"USWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hˇ"j46NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxjQWP-\l1eUSWVl$(D$,8tщ$PQh" D$|$,x H&Phу xBWhH& 1yJt$t$,WSh'"j4#t$t$,VSh"j4^_[]USWVu ]̕3Е3,ܕ3?ؕ31=33=3=ȕ3hM"VS  I~Hw0$&3уCt DGU3봃JUȕ3333x5UЕ3`3UG3I5U315Uؕ35U~̕35Uf3 $3) =3x =3tD$)T)&1PP0D$qU Qh"j0 $N tut ttL$8L$t Ht D$\$$|$1¿ u׉|$L$pL$ |$x\$|څy11Pt$RQL$D$T$$D$4t$$$SWt$h" D$pźHt;T$v$uuD$,D$xT$|$$)ډ<$9|$\$߉ËD$lD$ @"9ؿUD$uD$Pt$L$(tT$Rh1"`83L$(D$TD$X<3tt<$11D$|$PD$PPh  T$ t$$t$t; D$XL8T$4 2L8L2 8L$L8L2L$L2 L2 L8L22Pt$S 4L01 L0T$T$B`$|$ tt$t;< zD$p$tF8DQh܋"jN- vcjPh"j7-t$(V583d0Vh" $4dK4ҍ4v֋T0|0T0|0u׋$8tthxUj4 POT$8H Ht1<D$@$L$D93tx8D$,D$ tD$tD$,4 L$p̕3ލQ։9w9681 ̕3D$pNt$u1G|$D$ 9ξ|L$T$ $8T$$T$tL$$t$Pt$ Qh"$¾tt $<1|$t$  $8:O_ d$1F$+4im۶D$D$uD$$SQWPh΍"~ dK<t@1ɍA;r^_[USWVhKtWjjP hK9u hK4t0jQ臼x!=3h#"jt$vhKxi8tPWh\"QVtPSh"Wj$ct8VhB"jp 1^_[]fWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21KIu顀2PQK 2~ t1@K@9uUSWVD$921A9|G2SƉ<$~ SjV N 2D$~Q1ɡKt<2*tBEB(B$B4!؉B8<:tWBuA;L$u5K5K$2^_[]V$tK xKD$D$ `&T$ t$ 25|Kt$T$L$D$\$ $ǐ"i$^Vt$FtN H N tNHNfr v V pK^VD$`sH) KK KHtP4BPQ@@1ҋKv9tKKrh "jWtp4F@K^USWVD$T$#25KtC=pK11-|K9| n-|K9t%9P4uH$3L$X(3\$ t Fu1^_[]h]"hV"hh"IUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>pK K 29|[5KtFNu K5Kt5FNHNFy F4VPVpK@pK1@j@PU1@PF ~4D$F(^$F0^,n#2^8K Kt q4K^G FtH 7~ F^_[]É K=hs"hl"hh"hl"hh"kGVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP KHKN^,H KKKH@KP K KHKH4IKH89t;tprpK40Kt4F KH^h"h"h4h"EUSWV}]uuu W@t tK1@xK1HCSuu WW KN0F,xNF4VPe^_[]vjv H fUSWVP|$gX&sT&G4$O,52w0VPww D$0^_[]USWVPt$ffX&sT&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p KHtƒQ K@ K^_WVt$ KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpddFShjvHF v6^_,USWVPT$|$:%4K\$ K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4K1ہ=K| t PtKK1t 98t@^_[]Ã^_[]`V15K5KhVhK)E 5K^ft$ t$ jXSWVt$frLN4F,=2~0WPvv 1X&t\fv4V1AN4F,=2~0WPvv 1T&1;NuN^_[h" 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRQ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"E>USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPy3T$3D$M u1^_[]USWV(t$FpaFaF 1bF F$9D$4toh4j!lj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthuW1$2L$1 QWPUSVh4jÍD$(Pu S \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu P $\ E1PU\$tE|$8t ho"袅,$S/tU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"(t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"RB$  $ V)19tQRhڕ"R 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȒ"UN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthْ"fQh|3Y D$(u KHKpStURQPt$DljT$t hږ"u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" KVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"Vt$Ht$wL$tI9ȋt$ tPQ$$h"1t$U\^_[]h"hv"h)h"vh"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ {,[D$ p D$D$D$,$D$ M,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWDZƋD$0 u$$$UW茱ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPERP$GW #RPERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWVNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP֫t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPKT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP蘪|$FV D$t RP{|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPf|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPݧ$ D$TBL$?ttXLT$BtJ J T$$T$ QPnL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPئي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 9 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h" USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ  ^_[]fUSWVL$T$ BKulF1G&Uh#',$3H 3~|3H |3 h|3j 9-u q1^_[]V/ Ԇ3PPhd"V)Vjjh""@Ԛ&Ph@#hԆ3)&uj3USWV׉΋*h"U&tCt[PUjhhĦKs 5KĪKt2KĦKWVS5ĪK8w^_[]Uh{s"jӧ5Kh׬$jUSWV$:$D$VuPϷ 9$j uP買 A 1ɉ\$QSu/ Ƌ8 8"u11F9Ή$<$ 1ɉQSu ʌ ËD$8Չ 8"u !t$$Vhyd5ĪK tbVhg"%^_[]jh"7jh".uh"$h"h"$p h5"hM"j#$05Kh5#j8USWV}E phJ%VFhȘ"Vh$VrSD$(P5ĪKZ#D$0= M$L$A1yyy D$Phwd5ĪKs D$tG\$ D$ L$|$j 謨ljL$ NjL$IuɉNjD$ D$|$uhj$D$v1111O w+Ow?u$L$A1AAA D$Phwd5ĪK  \$tmt$ NL$,D$(KD$FD$FD$ FD$$~D$(PPWt$,t$t$t$h"" KuD$1D$|$Ynhxd 5ĪKR5K1111VQRP5Kh""hxd 5ĪK KLQh8"!ww ww5KhQ"!w_G|$9w  jPQ5ĪK=!¡KtNSVPh"q!Wt$ 5ĪKp 5$9t#"Q"Sh|35SVPhk"cكT$;r ZƉ[|$?e^_[]jjs5Kh"lh"h"hΘ"hԆ3V# jQh"WV$u>$jvW s'Wh{dЀ5ĪK t^_jh"j衡65Kh5#j轡VPPhtd@5ĪK $t%t5Kh"$"uʙ"5KQK$$>">"sdp#QPh" K$$ >"sdp#QPhC" K$$>"sdp#QPhk"[ K$$>"sdp#QPh"6 K$$sdp#VPh"^5Kh"j菠WV$u^Vhzd@5ĪKj tH$D$PWVh"$PwwwwVh "^_%5Kh"jUSWV}D$Phd@5ĪK tzD$Phd@5ĪK u5Kh?"RK$|$\$ t$jVSW)VRPSWt$hQ"e^_[]f5Kh."jISWVP|$uX|$_ho#SƅthH"Su+1Qhwd5ĪK t ^_[75Kh5#j͞USWV|$0t$,1@U$3$1ۉ؉D$h|"WVV qt\$te+$95$31|$7wWh|d5ĪKK D$ ;D$t-i9l$sUt$qƉD$l$묅hhPVKL$ dp#ti#RQPhݛ"/|$ t\ư1P`VvvvvQPh" G;|$ ru5KhÛ"$t1^_[]W5Kh"j:5Kh"jjP|$u1Phd@5ĪK KtQh"]XD$ 0Qh5#jМSWVP|$t$^h#S4tDhx0#S"t@h@$SttT$da3 D$dD$ tTj/StF1;tٍT$d#3D$dD$,t>\$:t$1\$(X4&0&h"w u1\^_[]hG"h "z$3=ԪKuj=ܪKKتKЪK̪K ̪KYh"5UhӜ"Phd"j0ЪK=Ku th|"0"تK ̪Kt uh"t=2uh˝" )ǃ|u D2j=K|$\G1PPL$lQPjWt2t$dt"1PPD$lPVjW輿t52=Ku4$P52&uu#$=uKK ܪK K تK=K ɡ2=Kt&jQP%b 2u[52hO#jhh$KQP腣2y"t8h$Khܻ"2$K=Ku'L$dQP52h "h KhrdAP] 52hI"h KhedA52) 52h["h$Kh"讐$$t(hQP52h":$$ƒ \K>s1@![Vs ) ȣTKPKHKLK? \K xK|KTKKPKK5HK52=LK= K?wKK=KL[VK?K) K>r$r$K KKKu 22]u1hQP_ 2u25Kh׬$52a`2j52|VKu Vh"8 11hKt1A1A1ۉL$@1hK|K xKhK=ȪKu#KKKKKK t$\F|$LSSWSjV荻t$L賓Kn 1QQWPjV[y5KK52j/Vt@UUUU)ʹ3333!!сis K1Kt!ttKKcԋK KK1K‰ KKK1 K1AhQhKx i-K=K / KًKP+==w !r%1H$D$ ʀŸw1D$ $}ȹKytKt  uK1I $L$9 K11O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj \K1҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$K-K=KKD$Kt T$$T$تK=Kuu 2; K7=ЪKlȪK_h""EK81uhU"8KL8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRPSt$@t$,t$4t$K1K1Kޅ`1PPPPPP =28h"1K8LFu=ЪKuRhx"%tajh"1к"WjWWWP+h"t҉Ku K=KuتKu K1g=KKD$tD$|D$h_"4K1N=t 蹵@ 1<"WhVVWP+9tigfff։f5KKL$ȃjPD$ u hp"jÃh}" 41HL$ Ajhk"1۾KD$KtB?t=kWUh" "KL$ DD 3$ D$tD$D$ uK K1K|(.tq<(tk{PWh"_ KKKt (BD$,T(2D$ TL 3$3L$ щtT$ KT$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R֕K=ueK$@D$ $#D$u D$ 0&1$L$19;ta $ȢK=تKuܪKuKu K=ЪKt8K~ h" K~lh" ]h"T1=تKu1I(K Kt h")1hZ"tKoKe$jEt1 KKt Kt3$ D$ K u=K5KKK1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ K|$E9u KD KDKDKDL /K KWQD$lP蚸 D- K1ۉl$(-D$D$D̪K$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$K K5K KD$t$"c5Khe"PPhs"Ah+"K K525|K5xKRQP5Kh}" hK"K K5K5KRQP5Kh"5 K5Kh@" USWVPˁˀ K K K1KK~t=uKt 9r u֋ K~:K”>u~t:t  IuK щ $ Kt&=uKօ4$u KGЪKtiKȨuh "hؘ%Ktj̬K=uKЅ$tN K=ЪKu"PhB"I0h ":Phw"t K =KuQ8$$ty%ty%1KtiKх $t4$P5 Kh˴"=ЪKu5 Kh"1t"1K=u KK^_[]VPD$ L$ $QPsh"O(3H (3~$3H $30h$3}Ɖ t9tD(3H (3~$3H $3h$3=ƒ1Y^h"jeUSWV1=K˃y CS t |K5xK11 uY1ɉNVt11@5C Cg"t"Ph"Ub hT"1He^_[]SWVP$2;2u+Ku"QhmdPY y h#a11hK<=Ku;5K|- K1Puhe"V=K~e1K111 KKPt,K8C;K|hC"77PUSh"7PUSh"7?PUSh""'1PPPUt$(SRht"^_[]USWVˉ1u=Kh"dT$$8$43|$͉)uhdp#Wh" |$Z)uhdp#Wh" D$|$K:KK Kl$M?>KKKL$ u}tGE)9H9^_[]USWV,։L$D$DD$+"tD$F"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h" KKD$HL$LVSQP D$T$D$PVSUPD$|$ D$@VSPWѬljӸ1=2ƉT$ L$@PVt$QR蕬PSW|$LWVUl$lt$,t$,t$(t$@h"2,h$3jdhK |h0#hK4K\$ $t < uC{ - 3DAu<-j D$$PhK D$$\$ h&&SeK|$(@D$Ph"Si $ϋT$ t։t=t$hA&Sii t't$h "SSi ct$ |$@D$1=2ы5KjVWRD$ՋD$D$D$D$D$$t$t$D$$  T$ Ku1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th0#Sl< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh3"KVHƀKt$Vh " 5KD$,$t$P։ω,^_[]h"jTUSWV΃ twttu"^T$(|$$+ KуD$ ;K"L$ K|.|$,T$0 K|$9=K|=ЪKu|$4u 1^_[]Ë-K~} ʉ$9twK|(tk Kt( T( (t1+ K9\$ \$$}2;T$}#=ЪKu6|$4ttD(OG1nFݷ"t(n9Չػ}n9l$\$QAuƉKtt  $tt ^K K11 Kt$ -Kt$|$$|$}K] ʀ|(tP Kt( ;L$T$|L( (9Ή} =ЪK{|$(t ;KKC KK"1$t=t K KS_"=ЪK|$(5K5Ke1KKKKKKKƆKt$ |$(PK9Ku85Kve1KKKKKKKK1Ƀ|$(T$3\$1 5Kn K|+D$Nu K[\$j5 KK)؋ KP|$(t$ hhj]KVfǀUKL$ KD$KƋD$$ȉ5KKK11KuK=ЪKh""u׸"D"=ЪK1|$(9 Ku85Kc1KKKKKKKKJu UPQ0X K1|$(tD$KD$K5K=K^_[]hp"j:OWVKt^ tڋt֋|҉tΡK4 K QPVW Kƀ^_USWV T$L$K@hPhK:  KK~CKK$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRV K;UjP fDŽ;UtZF , M ;M;MU;; K KT$)ʉUL$  K1 EE=K KϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MK ^_[]h"jLWV1=KAut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$ȓ!1Kl$ 22uhUPzQ5KPB ;2u[jVW52f!1Kt?D$H5K#$SUP, 52V52 ;2tÉ؃ ^_[]h"jJUSWV$0$,1@D$l$D$D$ $1h"WV\R suM?j U5U áU8=L$908"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-$3)1<$L$jhQP4qYh,KhedAP褑 =K_9l$| _@fKUjDž\$ t|3H 3~|3H |3 h|3j Ojh,Kh|3 3H 3~|3H |3 h|3j <$ D$ttdp#t$"Ph" D$fK,KWafKgdWPVu xnu)D$PhwdVZ h"h"V[1^_[]Ph"25Uh"jG4 hW"hz"Vrj茽'Ph1"hԆ3 jmUSWV\T$TK< $S KD$9d$ՉjRPt$ V蠏11 Sl$UVE 9 1U\$tL$j@PQ; 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW48&h"0T$l$ K1ɺK1MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$Kt)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf KŅtMaQ48&h"T$ t tuf f111K|$ KKT$KKfKl$E<$g\$ttXaQ48&h" ;B Q48&h,"n <$\$t48&h]"N<$l$!F1D4  $D$D$1G$D$ȃ 1$,&N|w5UFt|$`N|Z5UFx|$Cj$hX&5U,P,5UUFp<$h"SUv= V$3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h5"j5Wh$jG42Ph("hԆ3 j@xWVPt$jWVV3 9u9t x^_Vt$he"jm4Vt$V0t@^h#V^Vt$V5t@^h'%V|^WVPt$jWV2 9t9u x^_Vhw"j3WVt$|$ VW臏t$?/tWh*"`VhC"R^_Wh"j3fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$ Q 5D$ T$M⿪t׋E4D$P9$E0D$@s h",1VWt$ t$4P:1@PPVVu4u0ufNË\h4h&Pk }D@u hh& hh&Sk }D@\E,CEhos%V׉$thos%Vh"+ E]u"Mr u%1ɺu; L$M υu"Mr $9\$~\$~tSh"0+\$9|1} t h"+hW5Kh "輼t$ }4xME0;E4ru0h^"*u8E,u.D$@ E4t h"eD$P 1u D$@E|@L$tɉ$~ș|$u D$x9~BQh"P*D$x,D$xt9th"+*D$x$5 t$ D$$$$ $$$E@$D$,D$(AD$|AD$tAD$0A $CD$ D$TFD$D$HD$DAhD$LL$$AlD$dD$XA D$8X$$AP$$p$$$$tD$hD$\$$A`$AtD$pD$lH$$x$$DŽ$\$|$$S (L$ L$,tL$(|$1F9tSh"'D$ D$L$ 1۾Ë$||$|tL3L$ 3tD D$ Wp'\$t4$1F9tWh%"P'D$ 1t4$ tЉ<$TB7D7R&tt htD$pt\$1t$$2:|$$xtIt$%Whd"Ԇ3Pέ |$)Wh"Ԇ3P语 D$ $L$t$}D@tBW&1@9tWhD"% $G$D$D$||$tD$tD$L$\$dT$,T$T$8tD$T$\$XT$(T$T$0\$`T$<ÉȺ$L$`D$L$<wD$ $L$t$L$}D@$t1ɉD$d|$$tD$X$D$8tD$08$t$1ۋd|$tTt˹)$E3|$x|$trE P|$t$ \$t$ lt $U<$uL$$|$t$$t$ \$1ҋ} P#$t$D$1P#L$hT$tL$\},D$dD$tD$X0#1T$(L$t$D$htD$\0Mt$  $t1D$uAAQ 1D$1L$HD$tL$D $L$h|$tL$\$tT$HD$< u M։ ut$< uƋ$ș)Љ$T$ uD$D$u$p $pL$ʼnnV PU%ʼnnVT$$`t,\u tȉFt SUF V$D$$u tȉFt SUF(V,D$$u t͉n tSU{ʼnӉn0^4l$$tD1t@$tHu tω~#u$4$Wlj|$t1@ltP p $tW| KK:H1эPK K $uFht Ȋ $1FVt RP9=KK$tL  t1 $u tω~htSWljӉ~^|$~8 | 1@11u D(LtLpB9u T$$u FX1pt11H~N1ۃtOu D\l$$ptlH1HC^_[]hh"h+"h"h""fPD$L$ $QPhԆ3 XÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fL$1r 11B@9rWVPt$D$$Ԇ35Kh"W< 4$VW/ Wj j{fUSWVu D$Tj/6LKu@K|Ph"j]1D$$D$ D$4D$8D$D$D$PD$Lh"VS&  aH&$԰&1HD$8ЍHw2$$&UM"WP1HPWh K떃bfUD0%WP1HPWh KVUn"WWjWjl D$$3Uu$D$TPP1HPWW?  KU{$WWjcWW 2U1^"WPVu WjK5Uij $PV D$i8$8D$!u QU1"WP1HPWWaK'UKUSy$WP1HPWj'H‰D$5Uh9"U"WP1HPWWKU"WP1HPWh@D$8oU&"WP1HPWWKE1@D$491@D$ -K"U9q%WP1HPWW2D$PT$LUy$WP1HPWhKVh"hU"&u=$3؃rKVh"h"jD$t t @@u|$$h"Ћ45Kj/V2umKVh"h"hS~$DPSRu"5Kh"hox%hhK{~KK Ph"Ku =KhjSR |$4tg$y\hh5K( D$xD= K~1hSPD$ F;5 K|1QQQPHD$ u D$y05K^f0w.PVu h5#E 1HD$j5KÅy'5Kf01.PVu h5# $DPSNBy'5Ke0-PVu h5# $L%=ta= uDKu DKL$t$QRPS5K~ul5Kh`&5Kh"NDŽ$$lfsD$tjV$$T$ $L$ Z$ $ u4h*"L$ u.$$lfst!$$Phos%4h<"L$|$u$=2|$Tt K1 Kɉ\$Hu0 KtL;$$ s5$$ %DŽ$$lfs Kt$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s hV" h"vL$8J#$L= j|$W$($(D$8T$ t$VN|$(O11VSh$Pt$XxHWVD$(+D$L$,L$ ʃ|*5Kh"讈1D$(+D$L$,L$QPVSQD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$D$\D$8L$\ h&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xx>WHFD$(+D$L$,L$ ʃ{1QPWV th"j$1F\$D1VPSh"wzD$XWVPSP%|$$u1Ʌ|$t1ɉAw1@|$Ph5"!zD$tt$5K5K5Kt$\t$dt$<5K5KQ5K5K52PWt$L@ƃ|$4tVpUSWVӉ $`|$j W\$ S譂 Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ `8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"jUSWVԆ31F/WVUh4"+WVjhd"+WVj!hz"+WVjh"+ WVSh"p+WVj+h"_+WVj;h"N+WVj$h,"=+WVUhQ"-+WVjh"+WVjh" +h"WyWVj h"*WVSh"*VcnfD$t1B9| 2I 21 K 8K 29|[5LKtFNu PK5DKt5FNHNFy F4VPV K@ K1@j@PU1@PF ~4D$F(^$F0^,n#2^8TK TKt q4TK^G FtH 7~ F^_[]É HK=hs"hl"hh"hl"hh"CSVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP HKHHKN^,H 0K4K8KH@@KP @K PKHPKH4ITKH89t;tprpTK40TKt4F TKH^h"h"h4h"QUSWV}]uuu W@t $K1@(K1HCSuu WW KN0F,xNF4VPe^_[]vjv S fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p XKHtƒQ XK@ XK^_WVt$ \KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd<F+hjv R v^_USWVPT$|$:%4`K\$ `K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4`K1ہ=\K| t PtdKXK1t 98t@^_[]Ã^_[]`V15\K5hKhVh`KQ 5XK^ft$ t$ jdSWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR)׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSW$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"JUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPQ3T$3D$M u1^_[]USWV(t$FUFUF YVF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"ʓ$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthiW1$2L$1 QWPUSVh4j]ÍD$(Pu Sc \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jqËl$hu Pz $\ E1PU\$tE|$8t ho"z,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"^B$  $ V19tQRhڕ"\^ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȒ"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthْ">]h|31D$(u KHKpStURQPt$DljT$t hږ"͎u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" lKVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$h"`1t$-\^_[]h"hv"h)h"N+h"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ S,[D$ p D$D$D$,$D$ %,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DlKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW軽ƋD$0T$UW蟽ƋD$0 u$$$UWdljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPERP$GW #RPҼERP¼$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW.Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP讷t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP#T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPp|$FV D$t RPS|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP۵ t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP>|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP赳$ D$TBL$?ttXLT$BtJ J T$$T$ QPFL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP谲ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV蘰D$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQx ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QPA81 ^Vt$ V(1y?1I+F$ыT$ptj42QP71 ^Vt$ V(1y?1I+F$ыT$ptj42QP71 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jL'Ɖ t,UFtf^81FF"PUSWV=hKtp\$1 ^uXGourEr?E!u$t.E( E,tWt$t$' Ut$t$ F(u1^_[]USWV(l$Dt$@|$<]N(;LrN,t 9ы|$H1|$<΋t$  KuN KNVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVhA"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"jT@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ KKuPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp F ^ hjS V^_[]h"h"hh")USWV l$4E}0I\$8u tȉFSt T$$xF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|ttՃ/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$"袵\$8u;l$L$4A(I,WhT$L$$D$ { l$u L$4A(I,T$L$$D$ D \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$-vF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$uF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWƅuWh]"j~$$<$4D$Phd@U| tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;<%t$1 Sh"U CPh "U C Ph"Um CPh"U[ CPh"UI CK,C,Qh"U1 C0Ph,"U $@D$t P41-Uhzd@$<W t1 VhedAW hjUc D$ P$4^D$, 9L$GL$9u0$S11:8tx$0ht"zb$11҉ $ƅ*ŰPLj PU蠌 ^_[]$0h"jm|USWV81ۍD$4ShPSu1NtAljSPSWuWBKuMU D$t$$$Q1e^_[]fUSWV $( $$ hojS hx0#U=t.P |$:"V(t!UhU"JUh;"1OUh"l$D$QUPh%W虹tPUh%W肹iD$$Ca2=ouVq \$B&V{VL $( ]hh"W̊ ƃaT$q"V1u\$ىjW$( h" VT$X"V$$ h"V ^_[]1ىj=ߊ< t< uGjhQ#W k2$( aj2WPlj EKu$( 8~y$( 1\$ىj(Sh$Pr u$PUhl" "j2PWF E2$( ;(|V\$}"V$( @V[T$d"Vg$$ hK"h"#uD$ $PUh_"SuUU<Shhg" $( aPWh"Uh&"$( x?$( Z1ىjPySh$Pp uSUh"U j2PW E2$( ;h||$jt\h"@PUW覰 $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"WuL$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR V)qI8uUh"Ih"Ph"4USWVՉt$hRk 1I t uFjhQ#V u<^Ft t u^F t tWPWV tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPh׬$^_V#1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh"+C< t< t< uhx0#S@ƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P轲 t$$$ىh"rC< t< t< uS=$<rLjSh,"ShH"qSh|"Gh"5t$<L$D$D$L$ oPvtXljo 1tX L@uH~vCtTjhhV" V$^_[]V )UjS D$ D$ CD$CD$C D$C$Cl$Uhfp#V聆 u D$CV:)1$<;obD$D$PSh" =USWV$0xjWƅ~F$0h$1jUX~4$hP C9uЋ$4hx0#S{Ǎ$ىh:"$0St| uƄ$ $0phi"QUD$$0qhs"QPwىD$PUPUS u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph%S'D$L$ T$ ыD$E L$ T$ D $A9L$D$uP h"h"%n}Sh"h" Sh"h"n $02t$t$h"$@t$Ph" |$W}~14G;}|V߃1^_[]USWVD$(}~;$ ~VE pS $PjVWjSHD$11D$D$D$D$$D$ D$h$"u Vuv H5$x&D$>j 5UP' CrK밋U$P+Crj ho#V{ ىVS:1PuE$ ~S4Vz $PhjSPt$V1|uVh\" kWh"jjÍD$LPS蒬u $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV^ 8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQ $PhV"Phr<rr h"jhr +rryt$$$PVW>ލ$P|$xh"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP $Phq"Phr}"t5"PSh"C .1$P;$hn"Shrt$V"9;$PVh"|$$Vh"h{"jhr t$Cj5'=K:$h"Whrt$"?c.\$j&h"WhrS$d|1$XAA$Pj2PQY $Ph>"Phr9rh"$`>ߋN8^&w&PVh@" `Ouet$$P\$ ZSh"h"$P\$;$PPh="n Vh-"Sh*rt$  09rh4"h@"$\>$Thjk% VhR"$X~:$\1j hD$V' "tQC`;$X|j ~-hw"k$`>V[`Ouj $X1~$1:t @`9u9u$\Ph["-1@\D$,\$H|$PS1$hjVm L$,9F Vh"VhrWN h^"F0Ph"F0Pv,v(v$h"j hk"W$Th"cPh"h"Fh%%V譋D$0L$4$PND$8Fh9"Vh(r W  FtsShX"$PtPh%hu"$Tt*Mbi)QRh" j $XqPSh"p ]h">$X~n$1Wȃw,#"$P&L$S7"!""^& }""PRhJ" F`;$X|ۋt$~G$`>G8tu #P^&w &QWhJ" `Kut$hn"VhrP >"t"PEt$1 E$`$d $jj h_$QPjVAyjhv`$Vn V$`t$Vh"$XMbi)QR$\Vh,"$|$|$|$|$|$|Vhi" $\uMi#1wh"AL$!r"$PPV=t$h"!11҉4hӀB9udp#ti#QPt$h"=K~S$h1hR#1PQh" C uߍ_ j  rt$h"Vh&r@t$<#;$Pt."}"t5"RPt$h"7t$ USWVdp׉L$$xph"S'tÃr t1C$|L$ PVQ^ Ou wu pu o$1hoVW owt1$4 j2tWk F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0Ghh"W0k Ƈ$L$h"Qh+r|$W9uh{"jhr Wdp^_[]ø"1@$" "$Pt$h"hԆ3WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhz%Sl tVjh"Sl tBjhP#Sl t.jh"Szl jho#Sbl u$D$D$h"PhrWh"PhrW=Kt?|$"t"PVh" |$u$4ص&Vh," ^_[$oWVjƿԆ3Ph!"W' Vhd"W Vh"W  Vh"W Vh"W Vh"W Vh"W Vh;"W Vh\"W Vhs"W Vh"W Vh"W Vh"Ws Vh"Wd Vh"WU Vh-"WF VhD"W7 Vhe"W( Vh"W Vh"W  Vh"W Vh"W Vh"W jcVRhQdP t^Vh׬$jnWWVPΉ1WPhPPj PQ@ u^_Vh"QjWUSWV։ωl$PU\$hjS' E9C Sh"ShrW Vh0"wssss hI"^ss3h"I{""t"t$(Ph"" t$4t$4t$4h" $t$Ht$Ht$Hh"D$8Ph6"$t"VhI"$4ص&h\"$hs"Ę^_[]t$ t$ t$  tt$h"jUUSWVӉύD$(jPCg1t$`FFF FFD$hdp#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPVD$HD$PD$P l&5`&|$D$ fD$ l$ \$Tl$+D$Ty1l&Ph׬$j($PT$D$ +T$(+D$0хyL$XD$\D$\5p&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$PT DŽ$ <\$D9r<s5=K ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S+t jh#SW t ;/u f. Gf./W0S%9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSYtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 DKH $s-t$$tHfHxt P2)1^USWV=Kth|3jjh"djj9#tvƃ=Kth|3jjh "dHK1GNIIˋ^s DK tVfV(HKޅuTK=PK1WS"ơHKKrk=KtV$Ph"h|3 ~uV7dV'%V`v v"KF$5Kvu;PKTKK^_[]USWVPl$DKM1t$"Džt.w w!ƅu h+"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=KtW"PhC"h|3迱 W_1l$$ttF9u t G9t$&Qt$hKh("hԆ3Y<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hԆ3ȰEuFufFFV!|$WP`WV&N=K1ۈKK|NILKhK KǀK|NAMǀKEFNDt$hKh"h|31N1@=K1ۈKK|NILKKW葄ǀKFNDǀK|INOWtKǀK|NAMǀKEFNDVdPt$hKhg"h|3uC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=K#~VPt$ht"hԆ31t$hKhE"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=K$ WbPt$hKhg"h|3Ut$$t$$|$$WƀH1@=KىV_bPWhKh" |$u V[v vYKF$5KUt$$t$$WDUt$$t$$W.PZN1@=Kt-ى,VaPWhKhg"h|3-؃^_[]S1KK|NILKt!hK踁ǀKAPEǀK|ONTt!hK蒁ǀKFNDǀK|INOt(hKlǀK|NAMǀKEFNDƀKt(hK?ǀK|MODǀKECHGƀK[SWV=Kth|3jjh`"@]TK=PK1VWftmxtg DKW sJX tCf{u7=KtSPhz"h|3 S\S [빃;=PKTKk5Ktc~ tWuLfth"W Z=KtWRPhz"h|3> Wy\W9 륋v$^_[SWV=Kth|3jj h"[KtSK1{ t$C$Su[SFuՅu5Kth"VKYv$^_[USWV=KRKutDh|3jj"h"o[,th|3jjh "S[5Kt$G!jj#^ơK;PKKTK,׋-KWV]Ɖ׋ KK9sAWV2ÅuWVh""p\ SPh2"hԆ3赩 c렉1‰1 u`WVÅu hj"%\Cuh"SXCt SZcSSPCcQPWVhI"hԆ3-:KK9tPt$ ZU-KK;PKKTK^_[]USWV=Kth|3jjh"YfKjY9T jj\ʼnT$TK PKPQ\D$5K5KJ\Ɖt$U9\ʼn$St$p\Él$9$\$K K9ˉs6fKj8DTk D$;KKrM\$ -K9sIK95Ks9-KtS KE9uK K9\$ K K9ΉsZWVÅu h+"YSCPh2"hԆ3/ cWV[ƉסK K911 uU9t$D$ rIWV<Åu h+"|YSPKAc9-Ku*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5K5KfZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=Kth|3jjh"WFtVPXfvu݃=Kth|3jj h"VTK=PK1ҹ$RL$QtMƋhtDEt9VP|$ W 1ۀ~UiCSPW+W em븋L$$; PKTKr^_[]SWV=Kth|3jjh" VTK=PKrc11CWS5t:FfN~u %fFfth"VYSvuȃ;PKTKr^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h)"VRWh"hԆ3 1^_[]fUSWV`=Kth|3jjhT"T5\K5XK5Khs"hh2謟K t=dLuFFF%)Fu9rV9=KtJh|3jjh"}OF Kt(t$h|3jjh"UOF K1V9vtRPh "h|3 Kth|3j $ 9̓>t9߁^_[]áKtPjt$t$Nuù2WVIAfF=K|CK)fK5KjQhKRNu5KF1KPVQ$ =KFK^_ù2Qht"蘁8u"h"h"5Kh"hԆ3ԜjZWVjh21t)h t 8@ W^_VK Kt7#K=@u%o>K KtK!=@t^USWV$$$ $jhWV a,KtE1M1 tmjWVS$8jWVS$8t$Shk|%hV謗Vcp$ KU Rh5KDžtGh%PqtShF"hԆ3R 5KDžtGhA#PqtShn"hԆ3 5K[Nj5K1jPP6a+^^$DOGrhPD$Ph"hԆ3覚:hPt$VQ* $(j7V@ Ku D5KNj5Kj1PP6Ta+^^X^_[]SWV׉1jPP1"a+FF9tX\$)yWh1"hԆ3 %؉jQP6`~tF hP6 F^_[USWV|$_ OtGhS7U GO9}vDty)9|n4 ȉG.uFhb%Po;-PKTKrv=KtUh"hԆ3 \GP1=Kt:Ph"hԆ3Ә %1=KthԆ3jjh"I1^_[]USWVD$$PD$x/@thb%Q1ƀ81Mbi)KH1ًP1 t KP RVl5KAt\G9uGSVPm t5KDžu*hb%D$P tƀ8MbE^_[]USWVt$!M1 tFjhRWL\,Kt(E1M1 tm`ƋU R^_[]ËD$0)USWVX=Kth|3jj&h"GK Ph#V 1^_[]þԆ35@K5K5Kh"V贑Lv0e>Ph":Ԇ35@K5K5Kh"Vxv0)>Ph#VZ jSWVt$|$jhVW3V K1tQ1Y1 t ȃ^_[V'=2#t12PPV V蝯=2#t12PPV Vy^USWV|$\$1 tI;PKTKs9- L LQPWSsUDtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;5PKTKrWVh "B  L LQPWVU t߉^_[]USWV|$u h;">W` Lu`Ɖˋ-KUDDžuhE"z>-K)ً L9w؉9vlj< L|$ LWS^_[]USWV։ϋ\$ t;=PKTKrVWh "= - L LQPVW6P{s LK$\=Kt%[$tC1K 1 uh:"S9^_[]SWVt$f~th"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh "V)99tt79uNH4~^ SW FtPh"V8.>W^ L L LF$5 L^_[ËAP 9ttЋR9uIHËIH hI"Qt8Vt$V~^ L L^SWV|$t$Åuh*"V,8;^ty^C Fs j/WROGS^ L LW W]FV86P_1ɅF fN^_[USWVd=Kth|3jjh`"9=Ktd|$xh@$W$ƅu0Fm0_5Phz"hԆ3茈 Wh{";t$ f TKPK1؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6 9vuݡTK$PK؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W@8[uTK$5PKL$T$9΋$D 1$T$| L~L1\$ L tAD$t$ jjS7G L9|͋ TK $5PKT$|L$<q$Q AiKKQA XK\KQAKA$t$ Vjj(Q[7F @t3j03Ph"hԆ33 t$xh"8VZh^_[]USWV$=Kth|3jjh"6e1PPU Džy0aj0z2Ph{"hԆ3觅 Uh"88D$,PWFy0j082Ph9"hԆ3e UhC"7$jSUƅu he"7SVW xD$j(PW y0i01Ph"hԆ3 Uh"{7WKRrD$l$K=K,$1Չ1 9$hԆ3jjh"jj5TK5PK LjPb Lu h"6PjPh%HĨ^_[]fKD$L$ KKD$L$ \KXK=Ku t$(6t$pPh"S6D$ L$$ TKPKL$T$  L<) L؅~ڋghԆ3jjh#)=Kuh"=K Wj5LG =LtjW#y'(jPW52-!ƒ=Kth|3jjh. #=LK@1ɉ K tLP AL  L>t=KtPWh#h|3$f =tL LLhQV LL^_[]tK PUh#k s-LhhLUN DJ0]Ph #hԆ3e jZUSWVE@KfKK KD$#hԆ3X jMUSWV$$=Kt$h#h|3NX Z$ $(މ4$9{CKQPh"hl$US=Kt CU342h #h|3WtUCKQB+{))σ5#WRL$ QP$(eCKQB3{))σ4$U#WRL$ QP$,BCKQB;k))΃D#Vt$RL$ QP$,t%=K$(tqUhf#h|3V \{$(u0jhv#D$ P  tFjh#D$ P tk=Kth|3jjh#e9(jtzwC@#P$-6C@#P$-C@#Pj$$,!C@#Pj$$, u_{C@#Pj$$9,!C@#Pj$$, =KJ=Kt&dp#;$ t#Ph#h|3T =Kth|3j a^_[]5SWV|$t$=KtLWVhLP =KuWV5L t^_[Ë5K=K@K90PSWVh#hԆ3DTjHSWVt$=KtLVt$hLP =KujjV5L !ƒt^_[Ë5K=K@Kw80PSWVh#hԆ3Sj@HVsDKtufKVVVC ^PD$L$ $QPhԆ3kW Xq rW/bGG(3NNyJV=dLt114Bu11Bu=Iu1@'5@K5K5KPh #hԆ3R1^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=KuhV$x=Kt.u Ft#L#j1H^USWVPΉ˃|0Gl$jU5$Ll u/D$< t,COh#Vh#jC^_[]fUSWVP|$\$C$LK $Ljhh$LjP(Lu?&8$Ljhh$LjP(Lu 5$L$L$Lh(LhQ@P &$x8&x|&x#5$L PVt(E u(#<$xy"VPh#j SWUj5Ph׬$jVW$Ԇ3PhS#VA Vjj(hy#,&(&h@#hԆ3@ uhԆ3jj'h#0&,&h@#hԆ3@ u1FhԆ3Vj0h#V 5|$ujhU 5(LT u*h7#j;SWV |$t$ >h#Wt9h7o%Wt'\$j SW能 $ 9uy6hD#U$~h#WTt@h7o%WBt.\$j SW. D$ 9uyvhW#jMD$PhU5(Lb u ^_[2hg#jCSWV |$t$ >h#Wt9h7o%Wt'\$j SW苼 $ 9uy6hD#U$~h#W\t@h7o%WJt.\$j SW6 D$ 9uyvhW#jUD$PhU5(Lj u ^_[:hs#jKUSWVh$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUhg" tjUh|# tG99ufD$u\$ tR$,4jVh'%P EjVh#8 4jVh#  5\$ D$7f@jh0uht$Vj P5(LD$^ރ9tD$j@h#P ߉tD$PDaryDpriml$t?tD$PvD andfD D$PZDgrowfDnt$V<D defDectsDuVjh#PD V5(L5(L5(L5$Lh#~9Et2tR}jh#V H}j1hx#V #}jIh/#V t6Wh"8Sh׬$8UփOut$3 h#j^_[]1h]#jUSWV}\$j S5(LO D$t"NuD$Hj@PjSPh#j}$j$Vjj5(LrF=tPh#7D$D$ D$$fD$t$j VE 0k> 9 1L$81qAQQ a A j QV5(L-D$t$ *jh#E p  D$ @L$jhtjPjQ5(Lh#7h|3D$t$H1D$`D$L'Ƅ$0VhQ`5(LI $j D$tPS/ |$'y9D$(ȋL$;4&|"@D$Ph#\6h|3Oj yD$$<JD$ D$ L$jhtjPjQ5(L~e^_[]ÄtH<t<u'5$Lh3# 5$LhN#hԆ3q8 P5$Lha#hԆ3V8h#5h&#j#E 0h#`USWV $ ~($ 1j4h#  ?C9u1CCJt$LUPV CJjh'UVjS5(L~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5(L5(L5(L5$Lh#4 vL$D$$jh'hVjS5(LFfȁw$VhU VhU ƅtL$D$jh'h$PjS5(L]$f1Ɂw$PUhWh#eWh#3vL$D$jh'h$PjS5(L$f1Ɂwh#et$ t$ 1؃;D$ D$4ƜF>|$Ń &hp\&hox%2 ~y)L$"dp#t>"RPh#. $LD$tdp#VPh#. $L|$ >"ydp#QPh #{.,^USWV t$4}ty|$8h#Slt:hx0#SZt,h@$SHth/"S6t '1̓uha$w tR1ۉjVjj5(L7 f ?F$ȈFfFF PVQ5(LY 0^_[]Ã|$ u(1AA5Ph'PPjQ5(L$V(|$0D$40wiб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P5(LD^SV|$$jVjj5(L^$LtB>">"@tdp#QPhY#J, $Lydp#VPh#-, Ph2#,$L|$ >"ydp#QPh#+$^[`USWVt$,}ty|$0h#St:hx0#St,h@$Sth/"St '1@̓uha$wt1ۉjVjj5(Lf ?F$?ȈFF PVQ5(L(^_[]USWVhƋD$(1|$|$ |$ D$D$~{ŋD$,Sh#tMSh#t?Sh7o%t1jD$PSE1 L$9=r1D$G9uD$@@ jh0uhVj P5(Lȉ$=r%ht$5$Lh'#*$<$r],$1D L Tl| D  PW5$LhE#)C9$uV^_[]ËD$,4h #jҪh#D$Ph#X)VD$P H PpRQh#%) tVh#)^h#Z^VD$P H PpRQh#( tVh#(^h#Z^USWV$Gh4&V Vh5#n( r[hG#[(O yj hW#C(O,@tPhl#((O, tPh|# (GȅtPh#'GȅtPPh#' O W hVbVh#'GtPh#'$hVjWƅtVh#n'j &t)$1@9}$݀KAL$A1#tdp#h-L5-LPh1#SY|@h,L PhE1#S zh0#Ph0#j<|/iĹdp#AL$D$"hk#V21۰D$t$h%Vrh.=#V\Nh\&VFgh-$V0h+q&V.hM$Vc |$$i \$ Ct$ɍQw1$h&>a΀-% plj\$ Cut$BT$ҋ $)|$4g1ɉQD$PS D$ D$ 938*68\$ L$ D$D$W|$hE #SDh &S;he&S7h|#S|3hi=#Sf'hn=#SPD$t$ |$@D1ɉQD$PS D$D$ 9؋t$88|$1ɉQD$PS L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh.L4t2hl@#v 1<==.L ڍt$81 D$ \$phjSh.LPVT$Rs$1BD$L4JD4`L$p$QRSRPVܧ.L .Lu1$Pv`$w &Qh.Lh?# .L1<=4 j=VR9=.L j=V2T$81 D$ t$ hjVh.LPRWP\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP谦$h.LhS@#D$49t 8Vh@#S1JD$ $$Qh@?#,=.LD$t$=.L$D$D$,D$\$(VGC@D$p9Vh@#W0pPt$h?#|$oQh\?#=.LD$WSt$hH=#VD$ 81ҸD$ |$\$ Cj"$Pc}ÍD$pWVPSt$ $P\$ E $.Ljt$tS7 $.LjWV# -B0[Ph.Lh6@# B.L .L$Ph.Lh&D$ $u1@t$2|$ Qh>#(11G|$1\$ tpupth#Q譐D$ t$D$t1@L$ ɉ%t.=#PQ^Q|$t &8t1j t$ J4$`St$h=#FQt$h=#7.l2m2L$ L$ ف$K{8P|$WD$ t@j QS D$ ;$|$8tQtUL$4 T$hjRh.LQWt$ l2T$ gL$4D$ .L1ɍAD$4tT8`T$ Q$QRQPWhc.L .LT$Jv`$w&Pt$h?#t$L$ $d$ r $3 $tu¸|#tn=#PQh?#|$D$u |$u |$TF1@]%t.=#Pt$h =#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qhu?#x0董Pt$h?#|$L$lj% L$St$h=#{D$$T& 1ɉQD$PS L$ 9t 9St$h=>#,D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$.LjVPM D$h|$tM811FD$&|$.LVVP  D$'$D$8|$.LjVP D$p.LjVP UD$1=.LD$44$Vt$h=# Ph5=#=.Lhe^_[]4$h>#ًt$D$t$$t$Sm@9s Vt$h|># SE@D$t$|1ɉQD$PSV T$tD$pD$ 9t8u8 St$h>#Qh>#1ɉQD$PS ƋD$ 9t8t}St$h^>#St$hu=#D$t$։D$TL$8`OGL$0d$ rxL$D$nT$ L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h<# jj-1Ph.Lh<# h<#h?#h@#h.Lh4#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS講1Ht$L$ltT$d;WuT$h;W(u Qs ŃtD$ppPUE D$DGXHr PoXd^_[]USWV$l2x0L8.Lt x0L/y0LSh.LtW.Lމ)ˉESQ|$ W¨ DWx0LVKVcfǀx0L/SU萠u.LUhx0LK,^_[]USWVhT$D$5#&1Chx0LD$ CL$;rjt$V蠟 ufD$jD$Pjhx0LV"t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP8Wt$hg5#|$$j@WVPWt$hw5#j7nWVPt$=h2Ph"WY .Lt5.LPh;#5h26D$$PV5h2 .L^_V΅tOHw;s1.L .Lte~0藛Ph.Lh<#M Atʡ.L .Lt"H0aPh.Lh& u =.Lt^jUSWV=.Lˋ}.L .L t u tth|3jVu!}ti=.L|}t j }MO؃thD$VuP迥 t$UtuRh"{5p2Rhox% bD$VuPi tMD$PVh&<# D$VuP6 t+t$ t$ Vh-<#z]D$ s*P? D$L$ r!QPhA$ rD$rIPhfp#QPhx$xt$h3L$}u h6<#j e^_[]Ph!K&USWVP=.Lu(ˋl$ D$$|$5.L .L t u^_[]Åtth|3jt$W4܅.L| t j $^_[]uCuWt$h"D K4$~DN1ۅtPh#"t#=.LuPhM<#9t.LC뿃u,h6<#'t+ORh"PWVh/&QPhά$ t$QPhl:#e^_]VhM9#jfUWVEMT$ 1VVRWQPKt+M|$ .L .Ltjjj1A`.Lu5p2Qhox%8 .L$h t$t$ t Pt$t$hy:# e^_]QhM9#j>eUSWVD|$huI=.Lt@D$$1ɍT$QQPRh:#HqD$pt$D$(1N\$$SahŋD$d\$ 1ҹt(t$ RRVQWPD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2Vh:#j\$DSg.L .Ltىjj(A=.LuSh"w$w wwwww ww7h:#g,D$tM(9ʼnd4$1A1AUvD^_[]VhM9#jvbUSWV$$|$$u1D$1ɉQQPRh:#@E4$$t$Vetfŋ$L$ 11RRQUSP<tO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=.LtM<$1\$t$Whl2Rh:#jSL$$jjV G;<$|u .L .LtщjPV=.LuRh"<$~/1t h#yttVh:#cF;4$|j st$tĄ^_[]RhM9#j`USWV$=.Lt  $D$\$ 1ɉD$QQSP$V胋jrWUnrt3j`rt$S1$UEr8W$h:#{ =.Lvjk11ۍL$l$ PSQU$Vڊtct =.L9$$D$.L .LtT1΋$PjU$h:#1Ʌ7_l$ 11΍L$AAQU"<D$L$PUh ;#jdQ$WPUV to.L .Lt$jjPDH1L$AAQ\$S;D$|$PSh ;#jdW$jPW Ā^_[]USWVP\$(|$$1PPUPSWa$P~a1PPUVSW*tu=.Lu5p2t$hox%I $ $ r/1۸dp#WwwPh1;#C #;$rj 1A1AyV\q^_[]Ph;#j[]UWV0EMT$1|$ VVRWQP[t0M|$.L .LtT$ jj1Ay=.LuQh"I1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$>;#e^_]QhM9#j0\USWV@$ @=.Lt Z$ Veƍ$ h jU h%V8 t}1ۍ|$1ESWV L$99=z  h%jx8ƅu$ 11L$RUPQ$8@$8@|tIt =.L$,@$@.L .Lt.1T$Ph X1Ʌ1ۅÍL$MP袰$@SPUB U$@ntW.L .Lt$ jh V0$ P8jPS S8n@^_[]8"tD$9t 8uVhl;#Vh[;#jYhN;#h׬$jZUSWV \$0|$,1PPUPSW)4$8]1PPUVSW=.Lut$ h">rt51t ttt ttth;# 9uЋkT ;$tl  1L$D$Sjh"} {t+1:LtPh;#W G,;{r܃TD$@TL$9uj OVl1A ^_[]h.Lh;#+USWV }=.Lt D$ toh;#Wtc1ɉt$QVW; T$$9t8u̽8,Wuh;# =.Lj11CL$ t$PSQVuutWt =.L1=.Lu?=.Lu6L$1J1ыT$1 u#MUPj h;#1ɅRaMUPjV tK=.Lu-=.Lu$1H3$3|$ uMUjj h;#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh;#SpUh#S_ t9V*j4$Euuhdp#_Ɖ$t^_[]h;#h;#jUh;#h;#USWV\։ύD$ jPj Pȷ 1u0D$F|fD$Y|Uh;<#j D$ P$L$D$ L$/Ph#j D$ P[ $fL 3/LA .sD$ L<u\$ SjPj S" E9[|$ t D$ PeVh@<#wd^_[]WVth΋u\~8tU~4~`N4F8 I9rPh1F0F4F8FXHr PhFX^_fUSWV\$3L3LhnA#sP\su 3L芸hq"Pϫu 3Lj3LJmx &蹶'?c.53L芓hq"Piu nL=nLyA#t$\#l$PKrt Pu|Qߋ<-t<+u{uNhf &StGSM16kh~A#q3Lt8u)hA#q3LPqt 3L#hA#}q3LPqt 3LA#1=3LtjhA#~FP7֛j觛N=3Lu0j_`ujjB=3Lt!= nLu=3LujhA# C1FVV7=mLuhE#503vu\~jhA#B jM5mLf:0BuK@3L3L!Ѓt4\nL3LBzu=(nLt0譚|(nLjS=hnLu T3L=\sL~jh B#u j j 6GWVt$ y53L53L3Lut[<|=nLt=3Lt|2'V1Wu=WSBVWV|$ W<@jP]tWP^_t$t$Y]tjh#B#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@93L<3LU5{L腑=4Lu 3L4LU*=v====,=XAf2 3Li4L 4L$4LF=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fTD$4LD$L$d$ 4L $4LD$D$fD$ D$5{LPj5{L2 3L,^_[]VPhht@j t1h?B#ktP.$t$uչ%~(4Lh:B#rkt(P# (4L (4L2 (4L (4Lu.hJB#!kt P#Tƅ~5,4LhEB#jtPk# ,4L ,4L ,4L ,4LP^V[tP(=X@Lt1H V¬^PL$$04L1Qw$&RB#M(uMf04L xUB#4XB#+[B#"^B#aB#dB#gB#=YÉjB#/uf04LmB#uf04L04LWV׉vu1=X@Lu WV^_SWVPhpB#iPi1Ʌ 2h%uiM&tX@LQhX4LtX@LB#tX@LVy n)#\@LB#`@LB#d@Lu=&h@LK#l@LB#|p@Lq"yt@Lx@L|@L@L@L@L@L@L~ nLXB#t @LB#!B#t @L=$nLt8=3Lu/B#@LR&@L=@Lu @L1@Ldp#u @Ldp#[$@Lt8u3L@Ldp#⹻Q&q@L=h@Ltt8u3L@Ldp##q#:@Lt8u3L@L8%B# @Lt 8t1@ @Ldp#1@Ldp#B#%VWWh@Lh@Lq)#u&V5@L5@Lh@Lh@LHP#N%V5@L5@Lh@Lh@LA&N%V5@L5@Lh@Lh@L#;tlj=@L #m@L0&}#dp#dp#tơ@L8t,<$1QQP蘪 PW<$Wœ@$hB#@L⹪%=2dp#udp#udp#@L8t2<$ (4LIQjP PW"<$WF@$3#S>@L # tÉ@L#dp#tƹ"=d@Ludp#t‰hdp#Ɖ5@L>u KL^_[É$@Lz8{lV t<0 1=X@Lu VA^USWV׋t$$\$l$;Et*+u(N%dp#t D$ L$M^_[]USWVր9tMτtC1AL U5(4LW脣 AL1ALU5(4LVg ;AL|ut$3L^_[]Ë @L(4LUSWVL $։ύl$ D$?hB#W踻)?SWUX} D hVUĢ $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$txt$4hVW2 L^_[]Ë @L(4LV=(nLt =3L=hnLuF @L(4L@L8t!@L8t=p@Lu @L1B3L=lnLu @L(4Lb=nLt @L(4LH@L=nLt!=(4L|1Fj 2F;5(4L|^Ë @L1B^ @L1B @L1B=@Lug=(nLt =3LuN=nLt @L(4L=lnLu @L(4L=hnLu @L(4L@LÃ=3L"@LË @L1BY @L(4LHt$j5@Le 1B)= nLtË @L9t(4L =nLjË @L(4L @L1BV=nL@Lt@L1B5ALt-F=h@L@Lt@L1BV^Ã=h@L@Lt@L1B^_%ALt @L1B>ALt @L1B'ALt @L1BALt @L1BALWVD$ #=$2 lj Ƌ @Lj" @Lj @Lj=nLttV$ @Lj5AL^_WV|$ 1Ʌ<+u OL$ GW芕-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%VhtrL$PQV t4uRL$xB# $x2P B#T$x B#$x C#w^1JB#^aD$# $2  AL9uVD$ T$5$2! щ щ! ‰ 19^Ã=2thB#Ë @L1BSWV@΃=2ttALtVstx1Cj S*VGV&SP_GVhy%P AL=AL!VhB#j@W"WZ@^_[ËD$ALWV92t#֍|$RQjW1B$52^_ÃwH&ÉfUSWVPt$ P!уtRPtt jhC#jh#C#l$$\$|$Q t^tY9uE}㽙 u yՃt(ˉ $19u tC ;$u~2KՃujhkC#t jh:C#jhQC#D ^_[]1ۅs IQRP踒fVt$t=2tjhC#52^á2xy= ALuE AL0@#4@u. ALjhC#?t {Lt2P= 253LM3LV1N=ALt9t/ AL,@wB$@(@1҉,@Ɖ^USWV=2AL@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhC#1@$qQ52 9D$}AL럃^_[]USWV-AL1|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5{L(AL@9@S AL1JЅt8=ALu/@u1u0@4@ '[WVAL1t[@t @4v AL4@0@{!уt RPF1G)t {Lt^_USWVALt>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHAL9t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë ALt$@(@ ,@1HUSWV5AL1H(@$@9t#H1ًP1 u,@;Hs DLoL%D$z9tG1؋O1 D$ ~9 $tG#G=HnLt @t2x9 @}lh j^BtH @1HGG7FGF8~FNOG Fx ~,@;GsN+HnL~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@j|!ƒ5AL@@2tOD2Q@u;G  )RQ@w u&AL0@4@&OD1@l$1tʼn$yjhC#1=3Lu 2x~OUQP  5AL@@o<$t0@D$4@=ALtU=LoLu#L$ Qh׬$ LoLj2=ALt=nLu q={L5AL9>tOOHOAL5ALwx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhC# KL1H^_[]USWVALti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áAL@u1I4@0@Ë9t1JQQ 9u@o AL4@0@1@@(@$@,@PPP@x!ƒtjhC#81PPjt$x!1WVAL0@4@!΃t@@9} 0@4@^_SV\$t$ 53L({ALh8@jAL@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVw!ƒtAL AL@P53LvzAL@u@^[SV5AL@  ˀuH9tPQP PCdž @vv Hu5AL@uE u@5ALdž@tVB1ALP53Ly^[áALt@1fWV|$t$ t=ALttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVU_tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hdp#j|XhH#lLhBLhBLhBLhBL\$ -uF :tjhI#]jNbt'.t5BLbt0:wtptcu+BLF&jShBL BLjSQ ,uFBL|BLBLBLBLtBLBLxBLBLlBLBLpBLBLdBLBLhBLhH#J1tPhH#J1F$2VhH#WhALP(hH#dJVhH#Wh ALP ^_[hH#>JPJj3DV1B thH#Jƅu&hH#IƅuhH#Iƅt]h@$Vsu6hC#Vau$hG#VOuh G#V=t1BC#w1 3TA ruƀ$ALƀ$ALƀ$AL@=u=ALD$$ALSVt$ dBLM1ۅuDtBL;1Cu12(u!=nLu2 1ۅÉ^[D$$ALËL$=r!=ALtP5ALj h$BLݦ'$ALu $BL%BLu$BLESC$BLÃw@$ALuQhH#VPt$ u DBLESCuw $ALu;Vt V5 ALB$DBLxPV@,@$ALuPhH#V5ALj hDBLDBL^WVD$L$ =AL=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=ALt'~3P19wKS>~-19s2C,9r9v)CK$SUuuF8AU1V1o ɋl$u9tSv vut1|$jjSOF ~.EFE0uE^_[]VJLt";T2t1FVhBLP/ JLp^USWV\$,=ALtVJLtgفuHJLJ JLJL19*QhJL~-JL5JL1E4JLJJLJL1EJL=JLu JL JL1҅; <2t҉օt1PS;H*$&=JL+"JLШu*%=tS JL1JL]^_[]Ét$JL5JL 2yJLBL)É 2n1|$ l9} SWhBLhr uԉndp#tJLBLVW=JL=BL5* JL8u!e0JLJLtP.JL%MD$Pp-JLE˨ -JLEJL JL? ǃJL^_[]JL] vJLeJLJL=BLv!x ux ;|JL=BLw%JLJL< t JL8 tJLJL JLJLB5JLaJLJL8r JLJL=BLwx u JL=BL\x tQ JL=BL.uD$ L$PjQ课 $T$e^_]Ë JL1; JL|BLáJLt @@@ 1141PPUSWV=3L׉΋$$L$ D$1AyōD$PU3#D$=xhx0#UɕU'(W$ShU0 0jhI#U ShU D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU S_h1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3Lo=82u=h2u =|hLP1TAP#h@PjVP۝Wh|8QZtQL8h@$W蕓É4$pu1ND$PVSx#D$ =uhVhtI#a0tPƅdո(2Ex uָX2Fx uhI#h#S T$Z6VUhI#S:Sf4$VWW%V%Ā^_[]SWVhI#/P/tt;^_[&hE#Veh1ۅt+h%f%VQhtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%I#+I#Qh#PO tWhI#v: Y=82t"hI#h#v V(2=h2t%hI#h#v VX2^_[^_[USWVPӋl$D$ $uSPpeSS1tD$ t}t8^_[]StV믉hBLjPN SPuSqWVJL8L$ ƋJL ,4L9}I9uJLxtWD$JL$JLVJL8t,t$<$PD$JL8uڃ^_SWV BLJL$ ,4L+ JL|51ۉ|$8tZO\$,4L+JL$9|Ӏ8t-t$|$D$|$D$$8u$BL)ȣJL5JL^V^_[V5JLBLtRJL)Ɗ 0@u 25JLA=JLBL"JL=BL 1@^À=BLt8JLJL 25JLJL1@áJL8t AUSWVPQb$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhI#O+hI#@+VhI#P@ Åt^_[]jhI#Wz@ t VhI#Pe@ U8 uhI#*VhI#P:@ ÅuVhI#W%@ WV9G t'փtPhI#V G?G uG^_ÐKLi ËD$u5Ã<3PhI#USWVD-3LÅE\$9uz$1ۀ|tisljDDs9u>rjjx KLKL$t,tV#hj:} ={LTeuYÃ={Le4΃eKL~o6/=KLu #=@KL t t =^=KL;@KLCt}.CЃ jS&ed~h(KL KLKL=KLt KL5=KLu!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=KLiKLih\%jjS\Fc`$8&=3L %t#-l25KL=ES[jUY  xSKLH݃t =nL-KL>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5KL hK#94L93L9 4L=KLSKLC1Ƀ HKLt5,KL,OL0KLnL4KLnLj)eD$t Pj{@eJr蘬 L$Qh׬$1;KLKL|KLKL)O=tnLKLu' KL|5$KL5 KLzMKLjjP1;KLKL|KLKL跷ݫjj蟷ūD$<3D$PhI#=3LjhJ#VR KLKLXnL KLKLXnLKL1ɉ KL|KLKL1@Pe(ejhJ#e1;KLKL|YKLKL 諶Ѫ=tnLu5$KL5 KLLjj- KLKLʃEݣxnLc KLKLxnL8KL  8KL1; KLKL KL|KLKLq j5<2?KL158KL"58KL1;KL KLKL|KLKL j5<2RCiKL1D58KL=tnLt5$KL5 KLJ1=W KLiKLme53LV?P/V$KL1ɉ KL|KLKL1@PuGjhJ#KL1ɉ KL|KLKL1@Pk 2V_e!ֹe5\nLRPyJ1A诳է KLKL1҉AQPcM,OLNn,OLKL>X`hJ#r1PP?ùe94Le93Le9 4Le e S賁+̲1PP5nLn豲צ1PP5nLjP#'KLKLؽy蟦=tnLt5$KL5 KLGjj5KLd:0ؔKLKL艽*Pjj5KL9; eS贔D$D$PhIK#{豱ӡKL1ɉ KL|KLKL1@P"etbt3tFu j11A; KLKLxJ#|dp#L$QhJ#11%KL1ɉ KL|KLKL1@P'"e11A; KLKLxJ#|dp#L$QhJ#je53L<hE#PI53L1=tjh@J#o5l2KLnvh%1SVUh蠻Ag53LrSPx]xnL ,4L݉KL KL,OL9‰}KL5KL)‰,OLKLexnL ,4LKL KL,OLKLi1KLKL15\nLQPHFjhJ#H3D$Ph1K#d ։u=(KLtKL KL(KLe,5(KL5KLtI~V8Jjh%J#bUSWVP趮ܢGVD$1Ƀɉlj щ 4OL0OLAL={LuH9ljD$u21xUUjn6 9-{Lu;=0OL4OLD$tAL {L2t8teue^_[]USWVPӉơKLuKL1 r4$0utV4$#KLKL1ESWPO áKL KL 8KLtu1Fx` sKu j]j%u0SW5KL áKL KL 8KLujhK#t 4$4$^_[]WV=2u=(nLt =3Lu袬׮t 3L3L!ʃt]53LQYKLu =2uP5nL=ALnLALu _BLE5nL=AL1jPPB ^_SWV!t LKLt PPV!LKL=3LMLKL.hsK#qF<+t< t 3Lt QV菛3L/7E=3LV蜭hyK#Pt% =3LV^XKL^(N5KLjF5KLjQP軯^5P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=nLÃB1ۃ=nLÃCɍH9 (4L~Pj#|kKLSWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=nLÃB61ۃ=nLÃC%|$mu9(4L~HPj#jKL؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P3V0ʼnP3D$X9vpG$11Ʌu2~>9sWt$V3 t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWh2V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ?t1=nLƃtEuG%t|QhN#hh.&AVh׬$6y Eu ?=u QhbN#$ u 覣!ƒtVHQh@N#^Ã=nLt$3LtPP&t53LËD$t53LPF$1PUSWVu1953LO3Lt_jP%=3LtJtWg%W"=3Lu"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =TnLuID$xAPt4D$8\$Ph4M#FًT$WVt$j 1@t=3LjWd$53Lt$V$t$53Lg$53L$h3L53L#3Lt$ t$ ۨnL=nL111{LD$4PD$,$jUuWPQW Uڃ,$C^_[]SVt$ hE#V11Ct'hA#VthL#V 1ۅÉ^[WV$ VtVWV tWt^_USWV 1=nL]=3LPj\hbJ#1Ƌ|$ 11@L|uM@-u)FhE#WK)1%tuQ%t s@AAۃ\$WV3W(؃D$jPtWVt$PCAW "S 1tXt^~u1O\$$D$jPWˑ uQD$P4D$(0E#^jhN#4|1 ^_[]ÉOVs;t;Vs1|$rɅuŋD$(L#1O;PrS> USWV=3Lt^_[]j荈h*O#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh4O#U{PljD$UVW}S\$n,8jUHrS\$SVUP?4$V SM \W; Vr V|V$#N@ |^WV|$=TnLtaPW襢1=TnL#D$=W*jP`qWP7MhP2LPWDx#D$=@{W3jPqWPLh@2V{ WoƉ|^_V|$PVx D$XT$\1jPPV |^UWV蒊lj53L# QP|t1GL$ T$3KL3 KL1@ u,L$3 KL$3KL u!tL$\9|$X}e^_]øgO#Vt$V"9vHx/uAΉ^fVn KL1ы5KL1 u^ãKLKL=nLt^6~^P~SWV1ۃ=ALt^_[!ƒtj}!Ѓt111 1Ctj}1Ã=KLtKLUSWV-nL~ON}=nL~Q111SWuljӉ:}qF;5nL|؃=nL' =nL1=nL|=(4L111;5nL| V|ljՉ!<$=nLFD$1;nLá,4LD$ \@LD$,OLD$$,4L1\@L,OLPPSUt$ ljՋD$ ,4LD$\@LD$,OL9pt$j pF1M(4LH91Z{1@^_[]Vh 2F;5nLuj{ t j2^USWV\$,=KLtKL&|$$t$ l$(4Lt  $9~ t'sujjh(4$jw!уtjt$WRPS#^_[]Åt(4LHPjytm=ALtPay1u11FUvUVRPVjv!уu {Ltw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V (4L~&111RP!уtF (4L9| 1 (4L19^fVt$tsVGF953Lu#1=2tu1Ɂ2tщ 3LAF=2tH KLv - v" ^ ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12táKLUSWV\$S@Nj522tv W6Wc |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@KLVEES ËnU 9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=,OLjjPWV^_USWV,T$Dl$@ظBӃ=nLt  |nLt0KL @1)ʉ|ЉjSUQP虊كQP4v=0nLtK uu|| t u+| t u{Ltt{L}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t{Lǃ݃ tkwRPW v=dnLt( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N ,OL CfN =,OL=dnLti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1(nLl$t$1E1!1M,^_[]Ã=|nLt׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhO#c^_[uƉס(4LHPLi11 u^_[8iWV!Ӌ (4LIt*QRP4 (4LHPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhQP#bKy1V[hVjRPUo=tnLjusj'hD$ jhD$T$l$ !Ѓtd9}\(4LH94$SW!уRPvlj9Љ $A(4LH $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$(4L1VVjt$t$PY95tnL^_[]1K16-KL-KL(4LH $)QUjSWP(1K[6=nLtf"g15KLSW=g(4LHVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9KLS#>$4,$tt=t|<9KL|wC^w \$D$ShS#jW $4,$jS#f9KLu+9KL}9KLt9KLhu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuT#dp#6$4t$ t t_GS#dp#$40tUPwtu!T#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVKL^_[]SWV׉Ή5KL5KLhS#hS=w )WVRQKLS^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl3 t^KLKLKLJtGtO GO KLKLl3 tKLuKL^_[]ÍZ w6$'tEGЃTZ$'btPeu>fKL랄tGOm><1#놃>3#w>p\&h>0&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]KLKLd   >KL KL KLKLKLRhS#jhKLS#KL_t>dp#vVh6T#MLP+t MLŐ"hGT#蹻NLPt NLXT#jVLNLjVLNL5KLhNLhNL1NLPҎ $uNL^1|$áNLNLS NL1NLNL NLNL NLNL@NL; NL|1ۉNLNLNLNLNLNLNLNLNLNLNLNLOL1HNLNLhNL#hNLNLP $uNL[USWV\$0l$,1=DnLuSUƉס|nL nLSU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| OL=|nLtU tOLNLZNLNL,NLnL NL9}QNLƁNL ,NLك=DnLWV^! tt$j VRP)NVB1 nL)~$NLr5NLƂNL ,NLIu܅~+1ɊT 5NL~=NLNL,NLA9uסNLH NLƀNL ,NLNLNL^_[]Ë |nLt nL=DnLt1nL@V5 NLNL9}9 NL<u"NL0PhNL NLNLF9|Ӌ5 NL5NLNLNL^SWVt$\$u$D$0j?oP/=ALt&v!Ss1҅ SVqt1҃Pn1҅t$StNL~- NLVt[uNL NLLV3Zt NLt> NLVtV[t'i=ALtVs1҅ƒK1JFVY# @L#@L#5@L#t@L‰^_[QY# @L#|@Lʉ# @L#x@LáNLOLNLOLáOLNLOLNLËL$1wQ5ML|1SVt$ 1ۃw)V5MLVuV5NLC1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJqT#9u!B1@uDA;1A+u%uVt1@^ÃwV5MLcu߸ع#L$1uj jE1ɉHH SWV=NL u|$t$\$t-1 |15OL5OLtm1@Z ugnLt nLuU=NL~+OL OL\@ OLNLNL5OL=OL1NL=AL NL%=ua OLP OL$OL19Rh$OLbmh$OLm$OL5OL5OLOL OLH OLNLu" OL$OLx,1WV=ALt OL1At^_[ÉШu-%=tS0lNL=OL5OL뢋OL OL OLNLUSWVӋl$,|$(NL=PnL8OLuBu>%j jzC1҉PP8OLNLNLNLtwQPl'UWS 8OLxtNLPhNL蔅18OLNLu+nLtnLA\$l$͉=AL1؋5NLNLNLRk5NLUWS% 658OLW 8OLNLPV軄NL@NLVP诅V荄 NLAVUUUЍ@@NLNL ,OL9}ohNL藅ơNL ,OLY$gQVlu&NLNLPjVPmNL$#5NLNL9|NLl$ EVjUek L$ )v %uhNL蚃58OL 8OL NL; NL 5NL|tq=NL0jf jNL9u"_l$\$u4Шx$_l$\$u$5NL _ ‰$ u*nLt =nLuKuG ڃ^_[]ALm_uiud1UWjNL+NL t3KL91J$;KL} qɉы4LL)t _NL\$ PjSi 1EL$NL) NLPjS`i ǡNL NLtW4V)NL~ZNLt\ [5x3)Й)֋$F UWh\% N1NLE1-NL$_PdtUW ]ALt6=PnLt-QdtQd UWl $UWS t1@1^_[]SWV= OL~4։1$OLPd VW u C; OL|1 OL)^_[Ã=NL~OL OLNL1WV=NL~OL OLmNL|$t$ =NLuu 15OL5OLitb=nLtYNL,4L9NL|NLNLNLNLA,4L NLH9NL}nL j nLnLjf=nLNLtLOLtBx NL ,4L9}; j,NLP NL ,4L9}OLы NL ,4L9|L=\@LtC`@L„u0=PnLt't4|$t- 1j1j 1j5NL95KL uNL0NL^_V=PnLuajm5MLtMȺj9B#Fu=NLu"Ⱥj~T#Fu^SWV։ˋ=NLGNL9=KL uNL8NL4D$ NL; NL~~ NLNLNL NL^_[SWV NL NL9}1T$5NLׁtu Ӊ NL@9|^_[ËD$L$ NL,NLVD$ L$=NLu=pnLttNI1҉ tK1GNL9~,NLNL+5 NL)΋ NL NL0 ~^NLNLUSWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8{Lu/KLH9| Qu@NL8GO1H^_[]cS NL9t NLMtۉ>?SUSWV-KL\-jS艖 jS| DžtVtRU5NLVO NLUPW: U 5NL 5NL=NLKL1t Wٜ 1Gt Vɜ ^_[]USWVL$D$ʃQPO1H…t$=KLNLD8OlV tn{Luc~NL>-KLu@NL (I=KL9rHŠIJNL9s=KL)\8OVà uQL$ t NLt=KL91H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= VA 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15,OL1K,OL|EtESSP t,OL@ԋ=NL9=KL uS1Hte1ɺ|3:tWAuN1|31I:t?@u21|31I:t%@u1|31I:t @u^ËL$H1Ʌx 3USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=PnLu1@$5NL+5NL~1; ,4L^USWV։L$|$0\$,ЃtNL!t6tC؃T$RjQPWSQ=nL=NL1ۀ=NLtw4$NL NLىȺVUUUЍ@)INL~4,IŠNL1E 8Vt$0j* G;}|Cu4$SG OLtf 4OL0OL!Ƴttt$,9} 50OL=4OLNL1ۃtQNL NLT$ 1ۅ~&L$ PjQ\ NL~NL\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1ENL;,OLuXNL#NLuD$,NL=NL=NL~01NL 8jG;=NL|hNLtNL;NL~<$~NL NL NL$NL~1 ;j_G9uNL1;,OLuD$PhNLtNL NL9~~51ɋNL4*1 NL444A; NL|١NL) $ NLNL NL; ,OL~(nL jNLHNL;,OL؉^_[]WV|$t$ =PnLu1WVP PV WVt1@1^_ÐDOLH ȁhLr1hLDhLDOLHhL$hLLhL PhL LhLThLXhL\hL`hLhhLdhLUSWVL$0D$,l$$LhL$LhLLhLt-9Br }$r1z3|$( HLhLu$$rDhLt :=DhLHhLHhL<$:rBJ jl$(jWLhLtC:LhLt9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?LhLt_ )ϋ,$]}LhLtLhLtV+BJ NF=HhLuW-LhLMEu$9ˉ|-HhL],$ϋ=LhLt sKӋ$JHJ^_[]USWV1=DnLtD|$(T$$!t3|0LhLLhL=LhLt'9PH }=LhLu11CŋE1ЋM 1 u ]u,thLphLxhLEP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}{L!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[{Lu`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStxhL 11؉^_[]Ã=xhLxÃ=DnLu KL1DnLPh~T#4VxhLxNH xhLd|@xhL* thL5phL9|jhT#z5xhL^USWV|$ l$1ɃLhLLhLtKC9LhLdhL1 hhL1 5PhLv vB1IʅI~nVv 4$9ʼn1I1PPt$R9{L ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R{LuF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=(4L~%GW8É!Ѓu O;=(4L|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhP#2@OL1111ۉu WVSU1PPWV+{Lu Ɖ!Ѓu@OL^_[]WVT$D$ =nLt 5nL1)|щƉ^_fUSWV t$ >-uF(s7h%+V+h<1#+艣D$1S6]+S)S\^SJSGjy WJh#À8t>tkV聪tmSʼnD$$U $ȃ$jP'袷t$PShҿ%t$Ut$͋  Sa'Ņu>tVhq"F'UWU蓋 jFWIWF1FVJ]V'D$$t*P*hT#y*/j ))3KLt$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhT#.1N\$h@$So!4h%Q)SH)h<1#;)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhT#1KtL tGf;t=ËFHN~ ;F~à tQu VS@Ve%1Vj 1GWZWg%e1=KLVZ^_[]fSWV1hL1K4t 5u'#ar'G__ _Gt Pj GF6u^_[ËL$ 1ɅV-$t:xmL'W.t7^uM3LmL1mLmLmL3L \nL|mL1mLmL mLmLt P| mLFu,~1S薺PW豺FvE ^F~ ^v;3Lt PNu VSWh ^_[ËL$t@;3LtjhT#x)1HËA QUSWVD$T$1ɾhL=3L9~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9mLu mLmLuUSWV\$SκƋmLt@PPVumLmL DžmLW u^_[]USWV=nL|$,t$0h#W l$mLmL!ʃtWj UQP"mLumL hE#V!tmLVUmLPh U#Wu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=(4L9Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft Pz  $FQF^_[]V=3Ltjh=U#&dt$D$tt/uKV3L;m?u7=2xCjhsU#뵃=2x%3LQhU#l&^jh_U#jhU#{Vơ3Lt P要 VޣP3LV脁 53L蛙 ^33LVD$$L$ t tC8.@L$$Vhe&Q 3>jhU#3xxPhU#j VV||P|0tB D$0PhU#;D$$Vhe&P >t.jhU#1\nLL$QhU#$^ã\nL3V3x$ (4L1Vh@BVPRQ_\nL^VD$$L$ t tC8.@L$$Vh#Q 3>jh!V#3xxPhU#j VV||P|0tB D$0PhkV#;D$$Vh#P >t.jh9V#1xnLL$QhOV##^ãxnL3V3x$ ,4L1Vh@BVPRQ&xnL^V|$u%t$jVt0PhV#N#^V|$u%t$jV؇t0PhV##^SWVD$L$tPmLp=3LtjhV#"VP>PR Zt V踘)X!ЃtV谕5\nLSW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t P} VӟP03Vy} 03QhV#!^V|$uJt$ =nLtV3L-mLhb%_V_h@^^WVD$t t0t$hsLl7=tDMtGhuXF 3PnLhsLQh׬$5!Emtwt su!FF3FpsLFlsLF$37j| V^_D$u5LnL6Ã|$"7VD$Hs^\jhV#7<3V)h$&PhW#hW#V蝽;3xu'hCW#h}W#hW#hW#hX#hGX#h|X#j^^WVD$t$ʃc"y$@'m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=nLutjhX#$FVPMy0PhX#^_ÉPhX#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;KL~KLA9s } uE9u9t},u E&| t3KL+KLx3 ^_[]WVD$Pt t*$TV轺PVLD$ps D$ stopD$Tab =t3|i1Gt$rVufD,Ve4KLhfp#PK G;=t3|V9D andD theDen t$V5x3hY#P 0Ph׬$D^_à D$t t+uyL$tJQtQytWjh/Y#Mà$2L$%2AAD$PhSY#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh_$QVP46hE#Vºt5>t nL $nL8nLtP9nLE#L$Qh]Y#O ^ËD$HsjhuY#/Åu 3LÃ|$u=nLD$u =nL~GTnLÃD$ u)=nL| PhY#nLÃD$ u)=nL| PhY#nLD$u"=nLt=3Lt*!ƒÃD$ t t%uCD$ 3^u2@t+$3"3P7QhY#V D$,L$(t tC1ɉ nL nL8,uT@L$,t$Vh3$Ql >tejhZ#Ot$5nL5nLh2$jV0Ph.Z##t$D$,Vh3$P >tjhY#9 ^ãnLnLD$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GnL1 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$QhfZ#1QZSnL^[ÍD$PhKZ#҃=`nL=nL=nLË XnL1 (4L+nLt$4Ph[#hmLt mLUSWVl$,H mLt&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph[#hmLd mLFVEŅ8D$EH$|'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=nLnAL$,9 ItIT$uWoD$,7mLj+o2Ph[#mLV" T$jV%D$,|$?+3Lt Po GP 3LCE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt Wo |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhmLP mLImL^_[]É|$|$ u D$PhZ# D$PhZ#͉-mLōD$8PhyZ#uA0h[#j*hmLËI1Ph[#j*hmLUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph\#=j UQ xt-u)%tt0Ph[#1H^_[]SWV9toӉQׯ@jP ljtG\$=nLt <\u ~t F <$t)\tPSˊt GFFuD$Qh[#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$mLPh[#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hRn#3rtP~31@USWV\$(|$$1E=nLuhoL?nL{L9<$l$D$l$ =LoLt=@OLt=nLu3=4oLubPjD$P  D$tD 39PaHD$=ALt=nLtft$,SWU  nL=ALu"t1nL@nL| j=y!8Է8#1Hpt9={Lt4oL[1nLD$ D$D$$PD$Pj 9={Lt {Lt, {LnL^_[]øjhoLUVVYOVe^]USWV\$0' SV,jUVSh5#UP-^_[]Vt$V~ uVhbn#h5oL 5oL^USWV D$0щL$l$ |$$t$4PWURƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV-RՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SQ׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP]QÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWPi)$l$D$ ׋ $D$ՋD$1PPU\$S}Pыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPXe^]fSWVP{Lt KLZ1PoLWP(t>1C4$$PoLu V WSCu ^_[S=XsLtXsL \$3=SsLr 3H 3TsL[V53ToLt(ToL3VP53 9t KL^Vt$53^Ã=XsLtXsLr Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRV3يln#O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRVĠيln#O u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$Fln#NuxF-VQ>^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuV腝^_9Hw @sÃtP=USWVPt$|$\sLV<$=nLuԇTh=t@L T#Vt$ P]Eu x@L48JMp;5,4L| KL^_[]VWj .^_[]ËL$T$dp#PPh}n# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuXsL^_[]WVt$|$ zt!3Phn#Phn#dp#PPh}n# ^_WV|$t$ t%WVra7ft=,4L KL j Qu jF^_fUSWV\$l$=@nLu<؉%t1U1GWP?[PW1WPPUVd[1 jj1=3L1Ƀ={LHPVW9u Åt!WX |$t8jhn#'D$ tPD$ 0MX D$ 89t V6X ^_[]Vt$tP袇6X ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} @nL@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø*_&fL$tt"u$ (4L(4LHI (4LI`sLʋTUSWVD$T$ (4L5`sL|1Gll\G9uTD^_[]SWVD$L$5(4L`sL|F|\\|N B^_[á(4L~Ph5`sL USWV (4L; dsL`sLth!t 1G31K;)1G1I4:tl!GtˉPT  (4LjQJƣ`sL(4LdsL~PhVV !t\l^_[]USWVPL$\$As (4L11H$(u(4L1@$1`sL<#|tZ`sL4ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$`sL1H; t$z|#=(4L|O1;Ll |C9u^_[]USWV (4L~.`sL11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5`sLA1G1֋l9߻rB9u^_[]ËT$(4L!х1A9Hhi'*hsL=nL't'P lsLh%'psLh'3h' 3hX'$3USWV \$4t{LtsL|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$T'=DnLEQ-s4C$ىË $Fw$'#Fw}$'X!уj WRPBBtDt L=DnL!153LhE#PD1sTu~-\$PuYQA tLу|=RP螽1 $1=t{LtsL7f1=,OLu ÊCCs|,v, l,uȡ3L!ƒtظ:,u53L资j W5,OLQTу (4L5nLn9|$ V53L53L蛅PtmƉVO +1+5Q ic+Ɖ!уRPUVt{L=tsLH8 t{LH=tsLwA53LkP豄 !уRPaٹ nL (4LVQRP蚎g 3L53L,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/153LMj WP j W1P9<"@|tsLdp#9 t{Lt tsLdp# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5\nLQ^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5nL1=nLtȉt 3hsL0A3L^5$3'SWVQNjt{Lعt{L9r Ѝt{LWVSh ;t{L;^_[VQ!уu$x (4LH9}FV!уtt^^Ð1x{L|{L{L{LWV|$ =KLt5{LtZ=@Lta=(4L|<1W!уtRP虆Ws@G(4LH9|vu{L覍5{L^_USWV 22D$L$!ȃ2D$2D$ 1H2222=@L=KLt4$=(4L|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$(4LH9|u $u^_[]Ã^_[]鍌^_[]Tx{LK|$th{Lm={Lt1={L{Lj jhn#"V΋At PH FVC^h{LSWVt$>t_w DH W;H ߅u1F FF1H{L{L{L{L^_[h{LSWVQ1u(\$|${LSt ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-{LVt;xH|p$x Hȅu^_SWV|$t$u;{LWt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=|nLuH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^{LU1tHt$ !t Q9y}1I(t(t$=nLtT$$1={Luȅt^_[]h{L{L=nLtUWVjW7!t"j]jRPWV je^_]Ã={Lu @nL{Lx{Ld {LVj5<2t2x{LjVx 1F=nLu={Lu@11N^USWV(U ]1Nt$ t$tr:tm1x{LPSi( nL1 |nLt)1V5{Lh{L nL|nLttxq @3{L nLt =|nLtj)nLu={Lt{L9{LJ\$tP1ػ&!Ѓ1ojhn#D$Pj@t$>SD$$PL$Qt$Tt$V>{L$u:{L {L!ƒt&9L$L$|D$;{LD${Lt$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d{LT$X/ t$; t$ u; \$(T$_CtN4$jjD$xP$Pt$4t$5|{L5x{L2$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$: V: T$1H#E t0E t L$PL$THD$$e^_[]Ã=nLu?h{LL$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ ,OLL$,OLL$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$,OL}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8,OLKLt$8 t$ 8 }tEL$L$H1USWV8={L{L5{L{LD$$8u={Lu\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}{L {LȉT$!Ѓtsu!9t$ƄuY{L5{L;t$T$$|@Ut$ 9D$ЉʋD$4$KL@Eh{Lh{L}!KL @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># {LL$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o={L{L!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$${L {L!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ {LD${LD$${LD$ {Le^_[]1JЋ4$|$9ωL$}@D$ KL I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd={L USWVt$h{LtH>tC\$1EjU1GGGUSxL{LG={L-5{Lt~'V3 u{LKL^_[]W3 USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5{LjjSt$DPV5|{L5x{Ls$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@tLPhD|LUSWV T$(\$$t$ 1`3PURSU)ˉ<à uVh׬$Wt$|$u u)u%u!1ɃtsQl3Phbq#t DhOr#ݰ^_[]SWV \$ hShp## uPthq#蘰 ^_[xEhSh.p#o# 4$-t t$j VRhjƉ׉UZ~*9u$h|3Q|EhjƉ׉Uz~*9u$h|3Q2zEht=LVIPVW 1FVh<1#5Lq |$VW5L ?nu53h1q#r ^_VPjPVhCq# t=Lu.5 3V yVhIq#qhQr#蜣P^Vt$j5LVtVh]q#qhTr#ZEjhWV5,3t)>t$=LVHPVWs j蹴j{VhVhkq# V3t$3jh_$5L 3u3$3%3t$3t$3f=3t53t$$53f=<3T#t~"Pn3t$33xL3t$3j3t$$3f=3T#t~"P^WV,|$8V5L3h~"WHt! $#(L $ (L(L1GVW5L( h(LWj (8^_WV,t$8W5L-3h~"VH1Ʌ#G OWj5L'8^_V1Vh{t 5L8 j蓲Vhzt 5L8 ^S\$1uTjP̾[ESWV|$\$1FtCWPt1^_[fUSWVl$$14L LL%PhP3hs#t$4U1I~1L$$D$=xL8O>HЃ sX 4HЉ5LjhP3hs#t$4U߃ufH1K$ 'U4L뷃EFUjh"SF jh"SE h#SFD$QPuVUh<%ScFh#SMFzh#S7F$_=|LUL1@D$<$XD$xL= LUj/S0 Lk<$$YxD$ P1PhPjPP5UT0 LL$ !P5Uh1t#Q΂LPLL=UWJC*Sh%h Lf 1@1H1HD$1@$D$~1HD$$$3)t5|$L$(4hY%VsDt5LLPLLg VjOVjOVjvOVjkOL5Lht#j ViV4$jh|34N#w\ 'P_ D$tu1=|L 1A111ɣ<3 333=xLt 3=Lt5L uW6uB=Lu5L u3^_[]xVhet#Hht#Aht#:ht#j(5Lht#!ht#hs#ht# hs#ht#jhԆ3jj@ht# j`hԆ3jhh-u#j`fUSWV,|$@h^ jMW^1ۅL=LhL%u.j 1=LȍPU舸LjLx3=Lu?jPL LteQILUh׬$LWŅ?1GVjL=Lt1O,^_[]ÉVQ+=LuL$ @Vj5L  1Vh t 5L1 VjaL1@LjhL6~fWVP=ȀLt 5ĀLt$uhw#;ƅhw#$t8/u33w# Py Vh3P !%1 '9uQPt$5 h 'uڃ=Lu%hLh8$t$ u L%hLLhN%t$j u LL=PLj:h:x#t$ 1Ʌuǡ Lu'>/5 LjVZ L4L5HLLPL=Lu L%LLY1ɉ PL Lt=4Lu4Lt =Llj:h\$t$ 1Ʌ xL=Lu64Lt=PLtP5 L>1L5HLj:hQ&t$p t 3j:h8v&t$O t 3j:h<#t$. t 3j:h#t$ t 3j:h%t$ t 3j:hC|#t$ t 3j:h#t$ t 3j:hXS#t$ t 3j:h%t$h t <3j:hf%t$G t <3j:h/"t$& t |3j:h\$t$ t 3j:h!#t$ tLj:hH#t$ t 3=dLu dL3=XLu XL3TLtPh",\LtPh"hLtPhv&`LtPhr%hlLhnx#t$ u lLhpLh#q#t$ u pLhtLh.#t$u u tL 5 L5ĀLȀLt%j,VbtA1ɉ5 L ĀL^_Vh=x# VhUx#hw#jttu$Vhw#goh x#hw#QojwYfSWV t$ |$6̀LЀLcԀLYZ؀LGhtx#P;܀LVW8=L1hLS{% (LL%4L%(L%,LfHL TL(LfFL@Lh(LjS hLUhLHhL;hN jEy#9܀Lty#Ph׬$`L x |AEjj5L xPj5L hx#j#u hzx#j1hx#VW vtHЃ rt+vhx#ImLō HЉL봡$3)ǃG<13DHu0WY7=r$hhx#`h&q#jdSGhWhL[ ?t GG?uLL5Lhx#j V'^g WjCWjCWjCWjCVtuht#ht#jh|3hx#3t L h#=Lt53u,u5=L53{53hx#jPhx# WVSDƿԆ3Phzy#Wa Vhy#Wa jU=LthLhtj' j#DSWV53t>u+t$`Lt P Vƣ`L3h#V 7ts܃Lh#V6tah#V6tShH%V6teh<%V6t1Ԇ3Vh_y#W` Wv܃L$11ɺ30 ߈`LBu^_[ñ1WV,|$8V5L WVfWV謹#NF=Lt L$f=3t D$#$d$d$ wfD$ f=<3t $Vj5L8^_h(Ljj SVPf=3tjt$R 30utztD$=܀L„u30u1f=33몈D$< t< u>jV5Lz f=3t|$ 3#tdp#P褍`u 2 <3tu 3tt A8u1f=3t 3DAt 3DAD$jV5L f=3D$P_Z/hLjj USWVt$D$ $1=Lh l je?D$1CSjS?hLSWR Vh׬$ZhLptWD$ h(Ljj t$j>Uj>=LuD$ 1;$ȃ^_[]Ët$$4$(3H (3~$3H $3h$32eȋL$ < U;t$ KD$ V1FVjY>5Lh3#趋VhL(pSWVP3\$ x3t%ԀL39u Gt+t' u9tpD$jP5L Yـƀ_r؃L^?t@آكLڃL ؃LكLh؃Lh׬$YPW1^_[P(3H (3~$3H $3$$311t1Ƀ=܃L!YXD$_r؃L^?<t@ كLڃL ؃LكL؃LSWVT$L$D$=܃Lut1<1L1F9uRQPe yi?8th%Z^_[hQy#USL$ \$1B1t 9tA8u[VL$؂LtSA .y#8t6u(^@\VPt؃L)ƃuf^?݈@؂L^VD$Ph9y#jW=x3x3ԀLFt3_r؃L^?<t@ كLڃL ؃LكLh؃Lh>y#V_r؃L^?<t@ كLڃL ؃LكLF t*vPh؃LhBy#VԀL~ v 7^ÐWV1FLVW5L蝤 VW5Lͥ ^_USWVt$jV5L諥  uD$41؍oD<jV5L肥 D$< t r֍,f=3tdLt P, u3D$y1D$hf%PXdLtD$y3D$nD$jP5L诣^_[]1f=33USWV1GWj9Wj9r VW9Vj9LfCLCfC 1l$jjS臤 ~}D$tvjhL5LG ~]LBt8StGWuG1GWLU5Lբ WUl$5L 1f=33D$hU5Lǣ j#XƉ,<=܃L  A9rWD$Pj@ f=3dLtyf=3~g|$_r5,3Pt. dLYSQ;Y~ڃ tZG9r QR2Yl$!y-:8u!PWjl$UVVEh@Wjf=3tdLt P)*j?JfSWV3t33^tPwtF tFFu҉5 3hy#hWOQhx0#WUtRVhW,` t4=LtWhy#qRj WtWV[)%%3^_[USWV|$h7o%WD+j Wj=Wt@C@uSh H%W*u S6ÉXj?WUt0tO@t8JSG?!tOYt@t tWhy#FQ~5=3t,3Ft = @t ^t~vuك=|L~h3#΂|L^_[]SWV΋|LC!w\C|L؋ 3Q3; 3h|3j IV|L |3Q|3 X|L#|>W'أ|LNI$ 'Who#8P|L@|LN Q1f~ @|L3H 3t;3lh|3j!Ul|Lv Why#O `Who#O|L@|LN tEPP&|LV|3H |3!6h׬$`O|L#||Lh3#^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!ny#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh H%Sb'uW 1@WljR1^_[SWV31t8ϻ3WP't!CtWP't Cuމ^_[USWV׉A tS^؃H$ 'n tWU&tjPu U WuF tQfB t thz#.*N 1?!9~ t~ N 9tF N^_[]hz#fSWV,1f=3t h{#L|$Wh)}#GP+t%thz}#*P|$ DL$ $ 4hW1 uW$ 4h5#9ō$UhPP tʼn-L=LLhPU= Lu%t#P5Lh}#hLPu5Lh}#LuG=LtyLD$#uhԆ3h<1#ϯ^_[]fL$t11f3QBuh #h#jThă#WVD$ tRt$tX|$t3fPh$#;fPhG#x;f1@^_hq#h#j` h #h#jahă#USWV @$ @F~  ߃| RQh#%19ս|*Ձ tRQhT#G 1 @^_[]û l$ WWSUPY9tmv h#謹$ =Ut%tv hÅ#F:hjU 1$ PPQÉ11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPtT$ L$D$19عPh#Fch Pv tOPSQh#E6$!u$!$!j?PQ t$h#EQ+PQhI#$ "u!$ "$ "hPQ葛 t|h%#$ QRPht#]hq#h#h8Bh#h#h91hԄ#h#h: h#h#h;h#h#h<hu#$$j@P$!Pm Pt$$"PS$$ Ѷxl$$ $8v+)t)+8uHJRQP萚 t h#Í$  tL$(SUP l$ 1rh$ US |4ōPUSn < ߁WjP4 N1\$ PPh; tB=NýjPU  98t 8uxw8u2N1 T$ PPS 9ǃu8E8u<\$Shmdvx t*hC##Wv hy#v hl#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSP9u!D$=жxt9wwF̓uv h#5 v h#AST$1uD1Gu<jUPSvQ9tu&v hl#hĈ#A1^_[]hPv h#lAhq#h#h h#h#hhԄ#h#hhu#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ Pj D$VUP{ s DD$st$s 8D$ s <D$tf4$l$4U ' t_uhS#^@ho%h֬$hԆ35 'h0#hԆ35 uhԆ3j B 'D$l$4$sf@8tD4$t$xVS@S0 PSVT \$$Vt$S\K1D$0D$,D$(D$$d$sD$4j@HP st$st$hƇ#K2t$h܇#:2t$h#)2t$ h#2t$th#2L$9 't uQh # 'h#1|$4tD$4Ph##1|$ gvVD$PUG 16D$8uT$Bg)QPR衔 thz#p>1@^_[]USWVӉ͋t$VC 1Htkt$t$VSUхtGUQt$t$VWUޅ9uVSW t'Wk * WU 1H^_[]WD USWV$$$|G8-t $3$D$ 1FD$h#WS边 it 1, '39t9At&9IuJuiu3$tHPhNJ$ AtPqh5# = 늡UA뀃Dtou&t$ mt$dU$W$uQ 1t$hWV1 jSV $FWPP  uh=(&VhiP u hɍ#jWT$, '3l$D$G_HrY7ShjD$*Pe ft$fD$CL$fA37S{yhjD$&P% ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$Pr \$ $ sh #-sh.#-s hQ#-shn#-sh#-sh#~-s hЎ#n-s$h#^-s(h#N-sHh-#>-s,hT#.-s0hr#-s4h#-s8h#,sXf|$rL$I#fw D 'L$T$ t$"VRQPh# +h#h#jSD$f=313hjD$$P@ fD$|$<3fD$ $T$3h׬$*H$ 'L$f|$#t#PE*D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPh#)~|$ujq jPP賴 jt$t$ VE VhiW u h#D$(|$ u,$PD$D$,$|$ 1hSW1  GG?t$>hSD$$P  G$0hSW  jl$UW wh#F(h|39Wh:it$V uO j.2'h|3j{k3Wh:iVq u Cw 8)|$Ò##PY$rkLPD$$PQ& $<1|$Vh#c't$kL4t44 'h`#='hw#0'48~1D=P5&G9uh#X4 D$4!4"4#4$4%PSWRQt$h#&4(h#&444,40k<SWPRQPhϑ#s&4`h2#_&hW#R&4\t hf#9&t hk#'&h#W4d6|$1A t$t&u/7t$t nu Qhp#%FL9Mt$ $t$qVPvP$t$RV1vhL#? Ph#hԆ3' jUSWV։1hUS jWS[ sUPP蘰 t'Sh9iP tVuĔ^_[]h=(&h؍#jfUSWV׉1hVU8 jSU }VPP tAUh:iP uGPh#謣1FSuĐ^_[]h=(&jԥVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph##^WVh##f>r1D~Ph[&#GH9|j]"^_WVh##f>r91D>Ph#o# 9} j:x"G9|h#>#^_WV$fGjRWG WhiV t Đ^_h#j{fUSWVu }6Ahdp#j hӒ#VW Hw$\ 'dLhLԃBu|1PP5U蘢 `L불lLpLtLxLdL|L너lLLsjh|3蟲_lLS3=$3=xLu.1L$A AAAQj j!r =hLpLdL|LLlL231O=tL^$3tchE#Vdt^=tLukjjVp ƅD$ PVD$(!=<\$yB  23u1PPVop Ɖx\$L3=tL5`LPL$Qo ƅ~E1LVPSn i)u5`L5Lt$o ƿy5Lh׬$JL231O=\$t$9ȉQpL$5`Lu ύD$ PSQ5`Lr*V脤 LVh2#q,L`LLLLVo3h׬$lL3Vo3h#+ˋ$B65`L9Phߒ#hԆ3Z! 1@L^$;$3t=hE#Wt1#=tLux0#PW~!;? \$$3\$=L 1$ӋFHN~ HVvƒ =|Lu u u1G1=dLup=hLu< u7 =pL>hdp#h#h|3?  3@t>$@$Ph#h|3 ڃ 3@ t_  =pL3H 3;3h|3j$"  =Lx3H 3;3h|3j^o":=lL,3H 3;3h|3jM"ڃ|3H |3$|3H |3^3H 3!;3h|3jI! |3H |3I |3H |3M3H 3%;3h|3j-T!ڃu!|3H |3-3DPuW3H 3;3~ƒ t|3H |3h|3R ڃ3H 3";3h|3j^ ڃuv|3H |3^?tЃ@Ӌ 3Q3; 3~ ȃ t |3Q|3Vh|3P2 =F @t5Lh׬$螙Lf 3@ui$3\$t VE($3%03Wh׬$WL1;`h|3uLe^_[]hy"jbh^$fUSWV$$08hdp#j 11E1D$D$D$D$$׉jh 3hK#$VQ~Hw@$ 'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jU$ىY1ɉPXuG $3$T:-u"j9uzuI $3 u $3)t u <$u|$uM1ۋD$Ã<$D$ 0tD$ $4u9>W&9uTWh#D$u5t뢍D$PW:zu!Wh#Mh\#j+$1 |$ $jSV\ u h6C&PDf1u8V1CHHf wy$ '|$uhUfÅu뼋ss PVh5#-$ |$u.jSU5r ss e PVh5## 1F $tCPpQ6|$t KP;AmPsT$Z|$Osh׬$ڕ1F7hKC&jNPPh#hԆ3 j fUSWV$$6151hdp#Ui -L-L-L-L1Ch*#VWW e'H wu$8 'L-L-LŃo'filL뙃prvLoaLLL%L-L-L7L-L-LL LLLLLLLu $3)ǃ=LLu-tX1Ƀ=L=LtL$H=L=L=L=LtʉT$4oLjċLPէt$lVUhH3艥 9rUh#\hH30H3 @3QT$/u>t$|9A@3A @3I3vy/th7#hl#jהt$ D3Dh j=Lu$PhH3u$PhH3uu@Z8uT\=Lu=Lt@L Lt3D$ P61u1#$=@txUhH3D$ P6~uu6h׬$j(#D$=@uL L1ۉ  t1ۀ|$/uhH3h”#.t9Ur|/u (IHr IH9/touɉt$P/ ȋLUSWVT$juQW Pu`D$1t$CHfw?$d 'ss PVt$ h5#v Pshؔ#d>|$(5D3C,H3)=|5TShH3h#( t$V_1Ga{DuO|$u C(D$?Cj/D$ Pqt L$)@L$D$hA#QT$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3h#t$PV L$@3@3=I3vx/u H@3=LtD$PhH3rD$PhH3SrT$KP3Qt$31 u@T$(3Qt$$3q u.shH3h8# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h^#R 1Gt$#KPqt$1BD$ $ '=LL$ QP T$ L LsHtbffM ̛LQ̛LT$ ̋Lt$/D$ !=@8fush#djSt$ Vti 1G)=LtRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=Lt$tjQ\̛LH ̛L<ȋLtICPphH3a4sh#kD$ PhH3o1u=LthH3shZ"#  V[Åc1G1?8uFVdZe^_[]h#h#h6h*#h##h?hޕ#}7h׬$hKC&j8hH3fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV5a#X$hSWf W苋t?$ VPhԃ%hW;D$PW`#t VQ}D$PW:aÅMWVi/PVt@\$L$/PWt@L$ Q\$Su)D$ )=|\$=؛Mu=ܛMh|3蟶Whԗ#hԆ3, (3H (3~$3H $3h$3É؃t9 t4(3H (3~$3H $3h$3zƒ߃Y=ЛMu#D$=@uWZWBu8=Mu WV[NԛM PWQVQOtW#1ۀ=M$MVPWh#zhԆ3jj h#9D$t$QVP޶ Ƅ fDŽ$.$$PQb^\$4$9|$ t#t$WP苶$ D$Ƅ fDŽ$.$PQ ^$3$$3$ $3$$3$  WVh#Z fD$L$TTPQ[ËD$L$TTPQBUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPz^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPH^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQPL^_[]USWV |$87hdp#j; jIt7D$Phht@jq uD$tL3MMMu Mt$41۽h#WVր HσG$ 'M1M1M,M0MM1MM MM M낃w@MDM^LMOTM@$M1M"dMhM@1M,M0MMM4M$M(M M=Mt M M@MDM1V8MG08u ^_[]jhKC&jCrWVD$ qH1ftYT$zHftIf t$f tf9t=4MuyDt,RQlM1f Duf u RQ^_fu1@fu1HUSWVL$d8MD$  Mu =`MD$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P貞 PSl$$h5#;t$X 1@F FMZ|$dt~T.u-=Mt"fu=4MuFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$= Mt-T$$L$(=HMt-sh!K&j $W$D$\l$t$0KjsjDžt=HMtsh!K&j $UjsŅtщ|$WO‹L$@D$9ʉT$@l$ U.ʼnD$<9L$<=PMt/hE#sl D$TPT$ 9щL$ 1|$Pdq  à t$P Ct$ Pl=PMt +Cl$TUPLU茁 ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=@MtD$|t$ |$ n 3J 3;3~у t |3Q|3Guh|3Q=dMtXD>3J 3;3~!у t |3Q|3Gu7h|3QL$D$ ρÃxMT$9|M}`;L$}XD>3J 3;3~!у t |3Q|3Guh|3Q衄3H 3;3h|3j |3H |3 1D>3J 3;3~!у t |3Q|3Guh|3Qu衄3H 3;3h|3j J|3H |3 e^_[]SWV΃=TMt vrhb%c1TVO^_[SWV΃=TMt vhb%1TV^_[Ã=TMtATPqhԃ% ÃTQh׬$Í` f w5$'3H 3;3h|3j@I/3H 3;3h|3j*3H 3;3h|3j=k3H 3;3h|3j%D3H 3w;3oh|3j|!3H 3g;3_h|3j/_1@á|3H |3@|3H |3=֡|3H |3%á|3H |3|밡|3H |3/1á|3H |3*USWVl$(}=8MtE G=`Mt=@Mt(DG M1 XMÍ4^69L3} ^_[]{E ;\3~*P5Mm tM \3MM4FMt%$Q  Qt $ B$Iu$ L3șƉșD$$t$D$ D$|$1ۋt$=@Mt( M U tt$ ;4$}Z;D$}El$)š3H 3;3h|3j K|3H |3 MuC;\$r3H 3~|3H |3 h|3j D$@D$;D$ ^_[]j_[LUSWVt$~=8MtF G=`Mt=@Mt(G M1 XMÍ,C L3-9} ^_[][Gșljș|$$.1E  E;|$|63H 3~|3H |3 h|3j 1V =@Mt(41;$}D$)á3H 3;3h|3j |3H |3 KuGm=3H 3~|3H |3 h|3j 6^_[]USWV|$=8Mt_ C1ۃ=`Mt=@Mt(C= M71F  F3H 3;3h|3j,|3H |3, +N,3P3; L3} 0;3(h|3j P;~&|3H |3 "|3H |3 h|3j 1W =@Mt(4_ŋv3H 3~|3H |3 h|3j ^_[]fSWV|$0MWAt pSP] t81PWV Vh׬$Vn ^_[h#Wh#jYUSWV$U趯4(F$$1 |$1 9$)덄$PSUD$P tXǃt-tat$> ?tL$T$d$.?T$O$E1 $ ;3r9vL$?T$$$^_[]SWV ΉRQS 1t4u t|uHth|3PjS͊t V聂 lj ^_[fUSWV$$31hdp#W Wj%$ D$D$ hY%SV` mu05UtChP9$Wk 뼃pu D$ 뭃u $3,uk5Uh#jW#D$=@u.$VtP_e 9r*thۙ#jU|WP ty/t AƄ/@L$M$D$S蹪|/uH9tx/@tj/S›ޅt@V耪L$rShۙ#1A $'@PVt$ -] ٍ$Ct1@$Mg4$苸PPh#hԆ3JjMUSWV։π=MujVEjt~VWw$t9蛹8uR\$@SV5t{SW 59Wh׬$1ۀ=MVWhZ"  VWh#8Q w=Mu=jWiuWh#H#D$H=@Vg=M/jVeiD$@PV3jW (3 tuÃ߉1ۃYM@Vh׬$N'$MST Mt$|$SPt$  Å11S5Mt$| 9x߉=Mt{\$(t$,l$( `&$$L$$D$ l$ |$T$ fT$l$\$l$T$MRQPVSt$(t$(hV#hԆ3Y$5M5Mt$  Å6|$W\$SLt$uVhQ#MS D$hL$l$JD$pBD$tB D$xBD$|BRWQ!tVh>#OMt$\t$\Wn! .8tVhL#M#D$HD$Ht$\$ \$D$t$Ph׬$LVtVh3#Lt$/S&1VL5Mt$t$ЋD$HPW tVh`#nL$W tR8-t$Vhm#;L WtV|$W;t Wh3#H1ۀ=MDVt$SWVP׉djWP t$t-h#h#ph#h#K1@^_[%tPh#hƚ#8 ^djWP} t$th#h#%tPh#1돸#=Mu##jWVhf &Phq"SSh׬$Jj蓱#jVhf &h#hq"WWUSWV8`3t P`31MMMMMM 3it$L$<'hjV `39VhB#0jG`3hhVu `3MhjVD `3迱Vhw#0jͳMu31`3Md31t~Mttja`3Ml31@5`3Ml31@D7Vh\#0jE`3tMtj`3 HNtQ`3hĜMP,xC̜M%= ts=`=@5Mh#j許 }5Mh#0j膲5`3`3M1HPhm8@5`3| 1ɅA M- M5MMˋ 3uHN HN3v$P'=HN= HN>1jSS5`3 !ƒu茯8fM- M5M a1H 3 3=,MGt =}r t~= HN HNq˃u#=HNtPWUV$ ~jWUV  tw߿(= HNu  HN~~=3|318^_[]111RSWV։ωS_H3D$t,t\$W3T^4$it$]ctjt$)^gO#1@jt$^ #1PW^4$t$ jSVVFx^_[h# h#h$#jGVP=`3x=pIN INt}=Mut=INtD@INHQP~'Q &M1MM$Pj i5INhڛ#5@IN@ 5@IN~=MuKhĜM5`3u4#̜M=u" M Mu5MM= 3w=dINt3~ jP5`33~jQPS pIN INt4=Mu+5@INh#8IN5@IN}`3=Mu MtP1MM8INt3 pIN INt'=INtG@INHQP~Q MPj IN8INtZ5INh #&uC5@IN #hVk$VSh#hWO}WPW}tf=`Mt]t$5M5Mh3#hV$Vh`Mh#hWW蚙PWj^ 3u_5M<$t$WjVC$h$RPWh>#hS$S]Vh#hPj8IND$=3OMD$ 3#D$5#hS輿$S]$QL$Qt$Wt$$h #hP舿$t$V4PVj "$PW5INh5#t$De^_[]V~=Mu(=|3~h~V5`3 |3~^V@M1=MuE1jVV5`3xRP5`3 yUh#0jd 1N^Ã=Muh<#jI&1=Mu5IN5 HNhn#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU  ~)t^_[]WV5|3=Mt$t$5`3 ƃu*~3M;5 HNtc5 HNtUML~ M?5|3x53h͜#j, 153h#0j^_USWVP5|3|$l$1ۡ`3$WUt$  ƅ~)tދD$9u@MM!|3MHs-Y8 uc1h#Vh5|3:~\%tS1jPP5`3胇x})RP5`3誒 yPb8tD8t:ؤ8t0Ty:Ȥ8t 辤8u |31訤8Eu |3xt @M1M=@Muh#j腥`tx>8INHt)t h#53h͜#jL 1%hp#j53hM#0j^_[]USWV1N=DM=|3  3uh؝#j٤M<uM-MsgM,M1jWW5`3xXͽuWURP)jWU5`3觅yQu t#M@M=|3:h#Ff@Phm5`36 x|3h7#j1^_[]USWV \$$|$ l$(1uu5|3M1jVV5`3̈́x\D$ljT$Ӄ=MD$ MM9L$ujRP5`3聄x+D$T$EU,=Mu#hk#0j |31N ^_[]USWV~=|3$(~$$~Mt)h#j蔢I1u)1ɍ|$h~W5`3{  0|$fGWhm5`3j fD$D$Whm5`3? \$h~S5`3 $h~S5`3 GfD$D$Whm5`3ӂ |3t1<$uzfD$D$Whm5`3蔂 f $ HN11F$$~jQUR,<ы$ʉD$ ʋ$$~) h=#b1F|?1jPP5`3.xg)y11=3|!h#11Fs1o臟hZ#RjRP5`31yKch#.Wh:#"Khʞ#?h# 3h#0jB 1N5|3~^_[]fD$D$ D$Shm5`3: yޞt$hm#Ξt$hգ#0j٠SWV VhINj y蓞h#0j袠 jVj ygh#0jv 1N=DM@M=LM=JNu5INhʟ#趟=Mhl3Wߏhd3Wɏo MaX#tE# 3 #tf#QWPA S8 3#t<1#P5INh#h۠#h#h+#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5M5Mh{#sWh\#T5INh#Ah۠#4h#'h+#<=JNth#j{53hڡ#5INh#ҝh#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@hl# h/#hK#Y5INh#Fh#9sWy\Wh#DM|35INhN#IN ^_[h#МHMt POI W>HMt M1DM|3h#j|5 3mtt$11HfhhXM)thXM訊XM1xhU#0j臜 1Ht$Ihr#0jX 1HVt$VJuVh#0j*^\SWV|$$W:ƃu[ۙ1~tHNtt 9 tu/貙PWt#D$=@t 芙1N|^_[USWV1F8INPH{8INP kji1Ɖ+ MHw> 8INSPh\MQ@ M$ ML$QPh\M\h\MCjuh\M[jh\M^uH=`M/u+-Bu"`MP聈PhaM`MPM; h|3WVh\MM<3@ubMM M MQP.t 8INP(jhINj4 xsZ1e^_[]Ɨh#0jՙ USWV (3x&,3kL39|׋yM1II1M1PQÅy19}WDu= 3h#j.hhMOÅy1ۉ9|(3x(,3kLShM3y݅u= 3teh#j迗M1E$sVhMMPl9 )؍M1Eh"#ji1IkFL38INShM#1ɉ^_[]USWV D$8INxGD$M$1F1MSQ291C8INhMh\MP$ 8INQu*D$PUhMQ8 Mtu= 3hϦ#j耖t$hMhMI8 $W1CttUtB:x9u= 3tFh#j,WhMQ19uh:#j1H ^_[]h`#th\MQ<t M1h#USWV1C8INPH8INP yj|,Ɖ׃=HNt/5 3At%h#0j4 e=XINt Rrx7t$t48INP(jhINj( lzbV1ۉ؍e^_[]Ít$\$D$ MHw5 8INVPh\MQ@ MD$ ML$ h\MkWeh\Mduy=\INtSh`Mt^lIN xINtSh`Mh\MUjh\MXt@h\MEmMM M MQP=`M/u+?<u"`MP蓂PhaM`MP_5 IN INtSh`M  pINtp@IN|NPWt$h\M)6Q=lINxIND$L;MD$PMPh`M8INxMt@t=INu Pl= 3t1 MHr@tZ tUh\Ml'9D$X;MD$\M?uD$Ph\M$Ã|$=INut$h\MÅ8INVSh\MP@ =INuSh\M/!؃=pIN\$C=IN6D$@INHQPQ IN=IND$L;MD$PMMM M MQPDy h\Mj=pIN\$^=INQ@INHQPQ D$L;MD$PMD$X;MD$\MOPj IND$uMD$ ML$ QPpxMx5 35@IN`MM M MQPh\Mji\$=D$L;MD$PMPj (INUSWVj/h`Mo1Uh`M?t>5XMhXMUw /tOGhXMWUh`Mhե#jjO1N,K|/t1Nuh`Mh#jj^_[]SWV=8IN01F 8INt9t71h#jێmQHb8INP R=lINt i<8INx t `m#pIN INt#5INhܤ#5@IN襨 INujh\M^t(MM M MQPu1=lINth\Mhxuth\Mly8INP(ljgSW, xapIN INt&=INt5@INh#2IN1G*ƃuejhINj ^_[USWV $8INxu d?*1F8INP,8IN@0D$ j $D$T$=XINjSh\M9]jh\MQ$=lINth\M~gh\M+th\M2d M w's1PP5lMz $jh\MPƀ=`M/u+4u"`MPzPhaM`MP- =INt4$h\MZ' pINt:@IN|Pt$t$h\Ms.Ph`M0INMh\MT$t8=pIN=IN@INHQP~dQ c8INL$Qt$\MSPD ƉPS?&=pINtc=INtZ@INHQP~3Q 2Pj INPh\M%dPj קIND$L$ʃ|QP  MMʃ|QPxnh\M*1C@TPh\MZ%ڈ5lMh#0jh\M8ch\M)t 8INP4 jhINj =hINtn)11Fe^_[]þ\MPV$Vb뙉Ph\M$뇃=lINt cxIx8INPHx11@USWV $$h 5INS-2 = u$ /,4ŏ4/t EƄ4/FED$P5IN#D$=@`1Gxv%xmlxd=XINt exRh\M!(ttjhINjY Gm'15INh #j 1GĐ ^_[]Ɇ5INh(#0j҈5INhO#뻸 )D$ )D$$h\M XlIN xINtV1=`M/`Mt$PU0 ;D$vh`Mhq#jN _D$PSE\MWT&W^jh\MKt'h\MK`h\M&'VSh\MNR xơIN INtD$Ph`MI=pINt5@INh`M+INM=`INtEh\MC=lINxIND$D;MD$HMh\M{ MHt 1PP5lM( $jh\M#Pt$h\M Wh\MD$P;MD$TM7wD$ Ph\M;INtk=INtbD$D;MD$HMNh\Mh\M^^D$D;MD$HMD$P;MD$TM范5lMh#0j蕅P\MWWWh\M!Ph\M=pINe=INX@INHQP~ Q Pj kIN D$D;MD$HMUfHNMHNu 8IN@HN=~| h~PhM#thPh~#j蜃1Hã HN35My x1,HN(HN HNHNʉ0HN 4HNHNM= 3u=HNt4=~| h~Ph#thPhݧ#j1H5M y xHN HN0HN4HN1/u/1N=PHNMWh0#js PHN.|$tjh W V/ $=THNTHN_Sh#VP覉$xƅE<$8$S x<Sh#P$Y$+ywq0=INt5@INC$h#Vjs15THN$ $qQh#0js1N^_[ÉmUSWV|$?/tGj/P<ƳUWu/Fj/Vt<ƅuhW=INt$$W jWW!y3UWIu%D$ PW)jUPWV/Fj/V;1ۅA4t*PWmt1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~oWh#0j r$tDPyo$h۪#0jq$ 1$THN^_USWVD$Et$$^߅tPyboWh#0jpq=INt<$8$W 1 INtt)$($u7=`HNuj\HNPv`HN\HN!UW 3  3t%1PPL$H$X$T$W$tJSWWy!{nSWh#0jpW肨$ 1$THN^_[]WVH1uA|$ t$t$W t(5@IN?nWh\#0jp1N^_Vt$#D$ PVgt%5@IN?mVhz#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U= 3t = 3D$PVt=mVh#0jKo_= 3u&D$DL$HL$$Mbl$L‰T$= 3u'D$PL$TL$D$ Mbl$X‰T$WVqt6l8Nu} u&WVulVh1#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh#jm 1HjW |^_[USWV׉L$]D$PS?t6St$thk0wwS tՃ} tL1@_1=\INuTG3D$ 3L$ uKG3D$O 3L$ u9t$h4#jUl 1St$hc#Vj6m1He^_[]ø#D$=@u%h%S\tS0S} DjShR#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=\INt1A$$3L$ $3$ u*0$3L$,$3T$ uVh2#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $d'5INhW#V[uu=INtlD$PUuZD$ !=uHhWUF ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUIUt$ 4$UhL$ t uu$UFD$y)Q8=INus<$8$U xZL$ A$)ht$Uha#0j3j1H=INt2<$8$U Uh#Wji1ɡINtt1Ƀ$ !($t($t$$5INh #SYjUxN1=IN= 3= 3Uh#Uh#j7h 1OD$PUx=1$ ?#D$ PU1@=INu;L$ ($/ft$h#0jh$ PU1@Pt$6UK 31  3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=\INt މ|^_[]ø#D$=@u5h%WW1EtXWyĉ#$t W˟y5@INY7۪#eWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5JNJN JN JNL$T$tI AQPb DUVP 9t_L$ xZjPUQGҋT$0y@oEP0 Džt<$\$MQVP D$8+$T$0)+|$$>h#jJe*dt$8h#dt$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS@FxjhXHNS y%#ͬ#\$cSV0je^_[Vt$ xFP=hINt.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(& ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$(>xLX$3D$8T$3L$4 uF1VVV$(DxE$($\h##bh#.h#j%c #a$(h#0jc1N|(^_[]V=INtdHN=|INtdHN=INt@dHN=hHNuh 4 lHNt01x&=hINtDyh}#jhb1N^WVHNtP\1HNHN1NhHNt xHNtqAxHNuj1(3H (3~$3H $3h$3QtN;43u1tB lHN9G= |+xHNxxlHN PW1t-lHN8j5dHNhlHN@ HN&1^_SWV|$tR?tMj tSƋ\$W/PH~ </u>ۉ^F=hHNt%tHNp!h#j`1Hhǭ#5hHN5tHN1^_[áxHNt@=dINt|HN=INu0=TINt'D$$uHNtjP5HN9 WV=hINtB5hHNt;11G~u)uh#jA`6h#hԆ3lz vu^_USWV =|HNu%|HN1NHNuHN}$ $ $L$PHNt#HHf w=$'phq##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p ] HNqh#0 ph9#p j_e=hINt\@PL$QL$ Qpp p09Bx8HNjjt$t$t$t$phU#p j[_ HN1N1 $'LJ$Ƅ  LJ$LJ$=hINtwL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G HN VqP  HNVqP 5INh #M1uxHN@e^_[]fUSWVT\$tl$h=pINP($2T$L$X$1V8$HV<$Idp#dp#t4$tVjQjRD$Ph#Sv $u2@$%  RPh#Uh#^|$x$h#SXvEPD$Ph%SAv$Hs Uhî#u# Uh\"S v Sb,X^_[]Sj USWV@L$E\$CD$PSV.{3j9#|#L$QPj@t$V ue^_[]SWVT|$dT$t$X$hS($TWVShˮ#t[d^_[SWVt$F=u1H|$P5t6t)G\$QjPS覮VS Gu܃^_[Ã^_[USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VtIN~1F1utINhԮ#j9W^ÐSWVL$D$t$|$UHNtHNtt\^_[3}\1KZHNteSP!ti:tdx:$39}j U@$3sPVW hVHN:-u/HNÈHNnHNHN`S6h%#$3=S6h<#hԆ3tp?^_[f1Ã=HNu1á8IN0h#jV HNt"H HNp0h#hԆ3p5INhW#Fu_sUSWVd|$|j/75INt@l$xINhW#PeINW#1CVn34IN IN@5U i@INLMTINM%|IN5U9i UE HNNIN4IN $! U }dININ5U =\IN@hIN 3%= 3@IN|3 0akG1A11|$<$tIND$tGNutNj]]hs#Sk<1t[h#SW<uEHNHNj5HNS^ 1AL$y#$]1HN<$D$hE#S;l$\$thx0#SeDžu $31 ðt5h#S;u3HNS I 1urL$tP؅uAJjh#S: uPHND$t t P CPىQg ؉D$1ES#jt$ S 1AL$"1ED$\$t t P hE#S:t W8=$IN<$l$S|$;HN, 31ɺ G1Fmفt#u41A 0 3<1A 0 3!5 31ɺ.1!# $ 4u 8IN3=rnFr0s9-$3DINPM$39}j4NxP$3@$33$39 1VV4b x$3@$39| Qhc#j?H 1FPh #V(H VV5UhM#hh#jHjV5Uh#hh#5Uhy#jG Ԇ3Vh#*w%53WVa 53WVa Vh8%5UhM#0h#jjG!j*Vmh,#jCGt$h-#jjP$t,(XN8@tUjP$yFD$8Uhs#W71D$h.D$1$hE#UV7thx0#U4aDžu J$3tkðtAh#S7tjh#S?6 tj1ujSðuhE#U6t W4=$INUh#l$}$l$h#Wm6]tjWB\$rt D$W3|$ td^_[]áMt8uhZ"~Mt8uM_"Uhv#j E USWV|$b%UWӊUVNJ00ht$跩tAtZ/UV蓊UW488ht$vumCt$hİ#0jxE1H1^_[]áHNt H HNhԆ3h#jSWVԆ31FWVhh#eWVhhc#QWVhh:#=WVhh4#)VRUSWVPˉjPQN% փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Qe$1>tj,V Åtj=V tmj  tdAE0H@HN=HNt INsINuhT#j6B1O^_[]hh#h#hh#j B4$ ɋD$L$012WV5INh#hԆ3 \ t(ο̲#Php$hԆ3[ !uء܆3H ܆3~Ԇ3H Ԇ3 hԆ3j ^^_SWVPωPQ}t4Ƌ$| tC$S t'ǍCPVWg DG $IN $IN1^_[USWV$t%t_݊M\tS8uEEh#j@Ej9 UEƃjSVA t3l$hUVP<WUh#j\@Sk $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=(INtZ,INHVV#4$ Wh#ji? 1H^_[]VV_ h# (IN ,IN1V4$1 Wh#USWV\$tK;tFj tLNjl$1pS-G woD$G950INt%4INx!h8#j>1NhM#=0IN=4IN^_[]WV50INt;11GFu)uhz#j^>6h#hԆ3X vu^_USWV0IN1 l$$=dINKt(=TINt!9t)@tB9uKKt8<0INCS Dž$h#j=z$uEP%t?NjCt /C;Wa,C |/uHC C$#h#j2=Ct/C1N^_[]USWV|$LJ$0INtOwCu kPUC |/uPV3, t2[u1=PINO=dIN=PIN 2$=PINtW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=TINtGtlD$@1G8D$@1D$\1GEt$ hI#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhc#j59tNjE|$tDD$@t:$t$PVh#hԆ3OVh#hԆ3O $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh/#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7#j@INԆ3WVVjuD$L$ L$$VjdVjuD$L$ L$$Vj;VjpuD$L$ L$$VjVjGuD$L$ L$$Vjh#IN1INININP INt$,NFF FFi~ |$WVjb0 y|$ujWjJ0 WVj60 y|$ujWj0 WVj 0 y|$ujWj/ WVj/ y|$ujWj/ TWVj/ y|$ujWj/ (D$,WVj ~/  WVjj/ 0= 3tfUSWVt$=INt38$/>3i=)‹1@?9 tR=INt3<$/>3i=)‹1@9 tR IN1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=INujh=0 IN#t\u#uGW* tjxGj jWK />3i=)Ë IN,t 98t#@u $j t!8h $1(Wh#j9- hԻ#h#j!-^_[]USWVP|$1N=INujh=3 IN#t\u#uGW tjxGj jWK C />3i=)Ë IN,t 98t#@u $j t!8h $1(Wh*#j<, hR#h#j$,^_[]USWVt$totij/V, 1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhv#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWh4#j*S h#C=INt$INX Vh#jW* 4Vh#ININ1Wh#j** S9 hW#}VQhۼ#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$eÅt>V,FN4A1R%113Wb1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=INu*jh INuh#j1(1N^USWV IN1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP $$$KCs{ D$C $C1^_[]Ët$ h 3PI  1$$CHC1FwCE3 S S h#j&1NwUSWVINt"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh#jY 1^_[]USWVINCD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u IN-INININ-INӉl$T$tQغ/>3i=)‹t01ڋh1 t@IN=INl$T$s}ډD$0! umщjt[IN=IN tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  hӿ#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=INu*jh= INuh #j1N^WVINt813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(p t^t$htAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h?#jj ^_[]USWV IN1Kt$/>3i=)‹/uPV3Džj$ tWWtN$$QVQ4y8~V Q(y,~VIlNF INF5IN3Wh#!Wh#j V Vhs#j ^_WV5INt~1FIN=INu~ t v6蚫 3  3tWWvvvv 6踫= 3t v6ά6z Vq 5INu^_jhÀ=JNu1WVL$T$t$ JN11H<>u5Guu%P=JNtJN11@^_V|$ |et$>t\jhU#P  t !3=!3t#h#j|j !31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#S{ u3h&#Wf u! 3u9JNDžu91FWSh#Voh&#h#hI#V WShw#jL1N^_[USWV\$hSb1N|$1h$UW, O$LJ4$<rD ShJNh JN   PhJNhJN  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ 7 1D$ereRPQ ^_[USWV $ $Hw.$' e| Rh'#{=JNx1ۃd|RhE#Q1l$ hVUI $ jdPU$,L $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h #$F1 $F2 jdPV螽 fF0 $j j0Pd HN HNtHNT$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0Uq $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R  t$ hc#$%$ $LJ$m9rD$ )yQj0U  1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U#  $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhU#W] t1H^_jh#WC u(=JNuJNuJNh#jjUSWVl$hUh1N\$1h$WS  K$ǃ4$Yt"Yh PQָ Ǎ A/G<rH )UhJNh JNo   PhJNhJNG  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP8yEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu+&-u~t6hx0#VDžu'0 PVhs#jH$31FUW0=t5Ë$rt$Vh#j$_Ft1N1$3t WD^_[]fVjhj"gxKh@$P(JNt)hx0#V,JN1u;5(JNVxh=XINthj"hB#j 1H1^WVPD$$|$t DINt$IN pINt"=INthԆ3j &INԆ35INh"W 4$VW Wj & ^_P(JNt$L$T$ $RQP 5(JNXSWV|$1N|5,JNt,\$OPWSh$ t;j SU1t^_[SWVPD$ $|$t DIN|$t$IN pINt"=INth|3j %INԆ35INh"S 4$WS ~V Ph$hԆ3 hԆ3j % ^_[fUSWV} u74hdp#j \$1h̩$WV LtPt߃95$3D$hm# ƀ8/h^#V:ush#V(ua$PVwtKD$Ph%lwt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02VFh|33@uj hy"j#^Phb#hԆ3 j USWV$$6E3hdp#j~ 11Chs#VU耝 e~%q~3كrtރvt_xDJNŃV.PtrكRtwftAi4JN8JN뒃Wt6duq0JNz@JNl4JN8JNWHJNItVG t|$u G?,KNw` wU WL  ,KNu=0KNt^_WVt$ ,KN1GJ#'uGP;KNWVP KN8^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5KN^_ÊVF|uܹո ѹ Ǹ É)B$:@BJ#'uVPQh# fUSWV|$,t$(Sh=JNjLV@t:xIuxNt@jLPj V1tE@j P )=JN5JN5KN&1,=KNuƉS^_[]ù#V=KN)u ^5JNQh#*WVdp#|$ |$wL!3 P!3 @SN>t'F @SNQ@SN6N@>vuڋ7 @SNQ@SNt  @뭅+L!3@P5WNVrƉRPhά$& 1 ^_USWV8׉ˋ KN KND$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhΊ"jVjVt$ [( USWV Ջ\$$St$$tƉ׃=KN%up1҉  ډD$$=KN&uU1ۉ D$KN KNME \$$L$SPy t D$$ ^_[]ù.#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹##w#wSWVP=WNKNWNQ+Ɖ=WN=!3ttxt>uw&m1ۉSPV ƉS9u$8t*B8u+$t@J#' t$@u^_[ù#)%USWVPՋ\$St$gƉ׃=KNuKl$KN KNMES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաKNHwSjP ljաKNuND$KN KNN1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THKN KNN&ىWP1Eكra$"ى=KN#ÉKN݅~hKN KN2É׃'1HKN KNNPىWP1 1KN KNNىWPÉKNLKN KNNىWPe$É׍EكwKN|$4t;~l-KNb1A1Ǎt$WShΊ"jVKjV5KN0't1I1@1l$QPhΊ"jUjU6s" ؉^_[]ùJ#T<#Je#@USWV֋] $t$ơKN KNL$ D$T$uPV֋=KNWw,\''8d''}uPW ֋=KNȃ}tً$VPt$ ֍Gwd'';E Qȉe^_[]fUSWVb!3$D$ h#d=etuD$ jHSN0hKNGVS?SAU6@P蔩áKN)QPST KN)١HSNpQVPSSS$jhI#2&ƅ<.u 1~.D0tKNWP5L!3P!3@SN?/=KN?GH @SNĨƊGF?@SNՋ KNtQx KN,KNKNKNjG ,KNu=0KNt=KN"V5KNhj# V5KNhm# /u@SNNKN{Ht/t@1@KNhA#SZtg;t^h%SCtL@SNH @SN袧/@;tS @SNQ@SN}O@?u+' L!39r9v@SNF~/uЋKNƅ/jhm#s(1;L!3u @SNQ@SN/@=@SNu @SN,KNKNt P褅 KNKN5L!3襣KNV5KNhj# V5KNhm# ,KNu=0KNt^_[áKNt HQt/tA1A KNUVutf>/ua$Ph%QtGPVQt6$3D$$3 $ u$$3L$3D$ 1e^]Sh̩$%t/h̩$uHSN8LtjHSN8j*5KNuj=KN5"3"3f`5KN"3HQPP"3Q 5"3{"3@u1[hq#[V0o Ph#Ah#7SWVW賡WPu2\$VQ8"u6W聡WP{tV0KNV^_[Åu0ٜ Ph#jKNtjPhm#V h#ÐUSWVD$ "3fa1Ƀ|$‰tpыLh$S$th5#Su 1t$.4NJ]taM\uNEU\rw$@'\0u!11ЃwxAunjt$>"3HQPP"3Q t$.PN    ȉš"3HQPP{"3Q<$t*"3HQPPG"3Q 5"3"3Hu 1^_[]ÁfHh#jf$KNuL$ (KNjPV=,KNt 0KNK150KN0ppp VPj9 95@QNt =!3ujVHVo^jpPT$=|KNu |KND$ $1APV0KN,KNt1It$a8VPL$T$ D$$PD$|KNjWVP|$t$D$$i4$ WWV׉ΡX"3t L"39ty u hL"3/=@KNpKNuPh"h`"3< =DKNt5DKNh"h`"3 t*t$ Wh`"3" x4h"w%h`"3xV Ph׬$h`"3 "3HQPP "3Q h`"3[ ^_SWV|$t$\$=SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhG&j h4KN4KN@^1HKNPKNTKNXKNWV|$ |t|$wL!3 P!3 @SN>t'F @SNQ@SN*N@>vuڋ7 @SNQ@SNt  @`KN15ޝ+L!3@Pơ\KNPV `KN^_USWV\$0t$,|$W谛5WNjVj j=8"3thƉ؃$1t7=!3u.D$0t g $uQVi=HKNu"W裛j获=8"3u11EjWGu `KND$0u^_[]jUSWVL$,|$(!306̓V踚$'Uw1ۀ=!3_=HKNMjw1ۀ=!31=HKN$=`KNjwH1ۀ=!3=HKN=`KNuQ=TNt~jw1ۀ=!3=HKN=`KNt  u8V1tu `KN1l=TNtUW_j\$0SWh a=TNtWD$,E=TNtt$,WK_=TNtt$,WE\$,SW=TNtjUW=TNtSUWyPh_# hL"31k=TNtwww. `KN@jw1=`KN`KN jwa=`KNt `KN1V蔘VYL$,= VNt =r!3t `KNtu u^_[]PjUSWV@|$T5$KND$$wG=*"3tttnVN5WNP$P]ho#PGtj P5"3c Kȅuh# 5"3l$jUth5$KN5(KNju<$t&4$h#5"3m|$`KN\$X,KN-$KNj wD$ ,KNu=0KNtSw,KN5$KNj ,KNu=0KNt]<$t&4$h#5"3@^_[]j5$KNUSWV\$;s=*"3{VN5WNPPho#stj V5"3 vh#`u h#N"3HQPPF"3Q 5"3l$,KNttu }tF1ۃjU ~Sl$SP tuQV}`KNJu ,KNu=0KNtjsUsV螂`KN ,KNu=0KNttJ=*"3tA{t;VN5WNPOPh#5"3^_[]SWV|$TKNjw1=!3t TKN5`KN^_[Ë\$1HKNu/? `KNut΅tSw5`KNHKNt"u8LKNH LKNKHKNjw=!3tru+LKNH LKNHKN1 1@65`KN+USWV1=!3t5`KN|$0D$Pm[thUS- =HKNtiD$TKN,$\$4>GWN=*"3 VNPQPShw"Fw ;"3HQPP3"3Q=u"3HQPP"3Q 5"3~juw 5 Sw5`KN=!3uZHKNt"u*LKNH LKN9HKNm"uLKNH LKN HKN TKN5`KND$P艑 ^_[]USWV|$0t$V6@O WNjPw, _1=HKN1{t'GWN$pWgXuuޡHKN[tZtT1=HKNuI=!3u@l$41; u{CWNUs t=HKNu =!3tʋ-`KN-`KNV葐 ^_[]USWV\$K1t@ ,KNPS>yƋk1Ou,D$}t]1{PuVz uR ,KNu=0KNt~ jW|$x4$+jt$jux Wu+<$t$f+mE{t V x1 V^}`KN ,KNu=0KNtA^_[]Åx W+0谉 Ph#USWV$$D$1t$ VND$$DVND$DHVND$Ht$05hKN$P袎5lKNEWNL$XIEtH1F\$XljtwuGWNhSWI) 1ɉȋOυuNjL$\u L$4IEt6t$4NjGWNw蚺tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P̌$D$XtH$r4$ ȅu$1ɉL$@=!3t=XKNu|$ ~ $@D$@D$ )$=*"3VN5WNPKPl$41dz=u)"3HQPP"3Q9}j=W̊Ɖt>u"3HQPP"3QFP\U 1Ո`1t$XtOË$t)"3HQPP;"3Qv É΅u$u t(PV5"3 مt ȋN΅uء"3HQPP"3Q 5"3C|$ +t$4~jh'W5 u|$$ƅuf|$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t D$$|$ u$|$<‹$t$t$$t$4V0fD$ fD$D$ f=TNt*fsD$= t=+ u ft$}u$D$@f%u D$,KNjU sD$,ED$D$tD$L$`2 =z!3u f|$t$Ut$4gt t@`KN|$D$D$`t$de%D$,F L$,KN=0KNtYD$t;=hKNu,KN=0KNt.t$`%jt$hL$D$Hs*|$ toD$ t$,v`KN.u D$@1@Ht$,Jq,KN=0KNH> $At:ʉ9-ЊQ-t u{yh8‰uD$_}t } ]1HL$|AAA WND$(WN\$l1GSQW! =hKNFkQNjhKN1-hKNUD$pPjx! D$ $KN D$(WN_UUW $1ɅȉD$PPVeTSN\$|fXSND$ HTSN$\SN1`SN,KN WNL$( DKNL$LWND$D$hP5 ,KNu=0KNt$jV17$KND$ 5$KN|$t&D$1f|$tH DVNHVN$DKNh t$8TXKNH XKN=t$L$QPD XKN,KNt$u D$(WND$DDVND$HHVND$LDKNhTSN轛TSNt$|D$ $KN|$Pt j ,KNu=0KNt=HKNu 1HKNLKND$G$jW$KND$ =$KNh!t$8.S5hKNt$ Ut$^_[]h#|5`KNt$1=hKNȍPu =hKNu"D$4thB pȅu]5hKNt$ t$,Pt$=(KNuSE'h#hTSN,TSNt$||$Pt jt$hD$(WND$DDVND$HHVND$LDKND$ $KNjPh01hKNPD$pPj ,KNu=0KNtVS{ Ph#%(KNuhKNj躱`KNt|KN1褱WVt$tr|$w$'j Wv 6 $@Fvu;Ftj WP $jpV ыF @v 빃^_V t$t8>u3Ft,p謩tF VNQjRp ^SWVQbt1OS jjP t6]>F1"jjP tv2^^_[USWV|$41GGG =!3l$0\$S~,KNAjUgjUPi uA,KN=0KNt4$1CSt$SU\$t$h$w ,KNu=0KNtgS~~^_[]h#VPdKNu1PPVPjh!3v tF$P|dKNt.1QQVPjh!3u tdKN@=PATH5dKN}^ dKN !3 !3^álKNSVhdp#HSN8uj1^[1ۈ!3!3蹏5tKNthB v65HSN VNSSQPVXKNáHKNËD$ HKNLKNPËD$@LKN HKN1HKNLKNVt$ |$|vPh#F1@ TKN9~1Ҁ8cBHKN LKN1^WV15`KNVHSN90t\Wh|HSN0PjPoI5pKN5PKNXKN@PKNj7y5PKNKWM|`KN^_USWV$VN$j/Wyt@D$PWl)D$ %=`t|=@t}Ā^_[]ÉjWS/ tFƍl$UV)uD$ %=`uV){jWS ƅuWh9%Wh)#Wh#L$PKNx PKNV|$|D$ p#`KNPKN5XKNuu~9} ~ HKNLKN^11@1USWV4hdp#|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h?#5"3(14^_[]UWV׉΋ xKNuj'<k< xKN11D$ T$l$ t&D$ $,$<$\$ D$\#D$?6u0uFjh$W{V %W0|80uHx.t x0@te^_]USWV|$7j/V0wu#$jVP uaK$$WV4臫 Pu& 1@Ɖ$m=KNud$$UVuG8t88t.8 uPV%t ҪVxju$P OfSƒrtt~ |KN7PSPVh5#jSWVt$|$t$VWu =t 1^_[Ã|$u08 jWD6_vPSNpKNV=j]USWVPD$tnt$ t%1;t <:t9tGt$ә,89-P!3}w,; L!3t,WSQL$ |L$ |9/u 1xAA/D$PL$QCKNE9u,;E-KNL$Et <:tEL$<:t1ED$(Q) $+ L!3AQ~u^_[]USWV$1C1D$ 1D$D$D$\$ha#芎Hw5$$'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ HSN9AHSN93t$$1CjWtV@wM$x'|$t&|$ t4t=0!3x'@ |$uHSNH HSN8uVNPVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿKN/tPEȃw?$'|$u/|$ u&u |$tf<u t$Um묃LNr5"3"3$@thk#1@$$$$^_[]SWVt$,KNKNt5Hftfu950!3| PT 9p}Ëu̓LNr ,KNt^_[Ã=0KNt^_[USWV$G$$'oVNEjWS PsM䃼$$twh#5Vh#fGPh׬$,KNwPQh` ,KNu=0KNth#D$Ph#/th#h#GPh׬$q t*"3HQPP"3Q*"3HQPP"3Q ^_[]ÃPWh#_SWV|$tWȊ Bu%iC)ʾ!)!KN3tFWPەtc6|$tT,KNWPoƉf@@ WP ,KNu=0KNt %1LN^_[,KNLNQQ  ,KNu =0KNUSWV$$$j/$nturfEE^VN9tth#V苴t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$K}8o8a$ u=0!3x $u  \u =0!3y& u $MƋ$1Mtfyu0!3YL$$j$P 1OD$VnGKNtAPh# }t$t-'5KNh#|t>/u19}-9j$$PM ƅvvD$ PV0x3D$(!D$ =u8=KN$Nu$8tנ8t ͠D$}o$E$\$|$$t$t'5"3jS P$h&VfEo$T$pƋ$$,KN|$ÍD$ uj$HfxT$ ufBuω7 ,KNu=0KNt sׅt"G GfEG EG fEGE fEEĜ^_[],KNT$ Éuj$fxE$ufBj ,KNtbiVdC+L!3PkVjj$t3fxu*SVn$=0KNV$h#SWVP#'1t8|$#'L$8u%tWP{L$ t us^_[SWVP$'1t3|$$'L$8uWP0L$ t us^_[V$'t%$'jPf@NHu^VKN 0!3trft fuxB =LNr^USWVP\$=VN1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#xt1<:CG럡0!3y x50!31Ʌx $y $Q50!3^_[]SWV,KNKN>t+fuwWK ߉?u׃LNr ,KNt^_[Ã=0KNt^_[2WV|$D$ ,KNjP+@ft*fu vDfFGF GF GF ,KNt^_Ã=0KNt^_WV t$D$L$ ,KNfO !3fOPGWVU ,KNt ^_Ã=0KNt ^_cjt$itfxup%1USWVt$4$1E11D$h#Xot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;HSN:6BHSN*1\$ D$}u<$uhr#߃<$u U't']'8uUP萌ujUƃ<$tvh# h#Tj vetih#6vh#HSN8tc"3HQPPt"3Q 7<$t"Uh#h#Rh#HSNH HSN(|$t PjD$PU1L$#jUHfL$@D$wS$'j/UdjUI~<$0)a Ph<#@<$ulh #]<$uh#D<$u h#7<$t,Uh#T)VN\$|$tIGh#t$HSNH HSN(nv<$uh3$O뒡VND$ CjUD$PO PveK<$u h3$ Vh#t$vt$1^_[]h,#d#ctdp#RPhO#Ph#f1PPt$  5L!3@PdUSWV |$$D$ \$(=!3tLNH LN L!3 LN P!3 @SN1ɉ LN LNH WN@\$$@SNtH @SN~ LN LNHfH LN LN+L!3$Vc(LN$LNu&4$$1cp (LN(LNq$LNl$4$(LN-(LN5$LNx=tA$LN0F$]5(LN΅ue LN@SN.4$(LN$LNt O(LNG ^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tPVNt D$"3 TVND$ LN+L!3D$?~uЃtRWOT$4$ D$1@D$ wy< @SNH @SN LN1=TSN LN; L!31y VT$0>u!y@u=D$D$LN$@SNH @SN LN=LNut LN+ L!3;L$~axu[@SNH LNk@SNH @SNA LN@@SNH @SN LN$ |$D$ЉD$$ @SNH @SN  LN LbT$,H LN$t)Ut$ 1^t LN+L!3jPHP T$,>~y=u|$ D$ _RV/ uWN@SNH @SN~# LN%aT$,H LN aT$,H LN$Ut$ a]T$4 LN+L!3jPHPT$8 %aT$,H LN>@SNH @SN~ LN `T$,H LN8 _WNT1>uO@t*u t  $! QVT$4`T$,H LNWNl`T$,H LN$J`T$,H LND$$ |$tu^_[]USWVt$0|$(= LNtPVNt$D$"3&j\xNFTVND$1@)D$ D$<$LN_w9gD$(Êxr>jWh&&b 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tj[ $HT$0JB^_[]WVt$ NȊ@>*u [t?uߋ=(LN,KN,LNu(Q;~9PZ,LNNQPc5,LN< ,LN ,KNu=0KNtQ(LN9t31Ʌt AuQP"u=(LN7v (LN6^_Vt$t"(LN0vX5(LN΅u^V5LNt1,KN6PW; 5LN ,KNuۃ=0KNt菺1 LNLN^USWVt$(PSZ LN+L!3PRYL!3Gtr}t  KvC#:t /tQ t7=!3tAL$,u8 @SNQ@SN[O@랃tPY^_[]Ã=@SNu [@SNL!38t!P' tx PYu$hI#2ljPYGËD$,tÊF!'$< t< s4< w*@SNH @SN~ LNZH LN@SNH @SN~ LNZH LNGw/u}/uEB7P' USWV,D$DD$l$@}E$u D$EJ#'D$D$D%D$ j=U1VD$pD$(|$$|$l$|$t;D$PU!tdá LN+L!3D$$1U$t>D$t;t0 LN+L!3D$1ue1C}@$uLN LN+L!3D$=!3t-E1<*t&<@t"1ۃ wйs\111O|$1CD$%t$RPUT$1 u= LNL!3D$)ǣ LN=@SND$%D$ u!L$ȃ@!"}@u =TSNt1E L$@11 $at$|$Wt$l$UV1 WgD$(D$8 u;1|;u|$ |$y|uCD$ F!'$< u*@SNH @SN~ LNWH LN@SNH @SN~ LNWH LNL$ CuqCD$ < w*@SNH @SN~ LNgWH LN@SNH @SN~ LN=WH LNL$ Cu1CK $Ix$'t @SNH @SN~Y LN\$$W1C:څu0L$ QV1ۀ>t5 LNW' LN$ukV$\$H LN= LN+=L!3t$ t$(SRWVu LN=L!3 LN)=@SNSL1C LN+L!3t$ Pt$ D$ t[1GFtuրut܋ LN LǸtuŠQ1ljOu,^_[]ÉUVh:#=Ȃ+D$5WNhR#t$#u+HL$IQt$P5WNhm#D$ƃHT$QRP5WNh#ƳUSWV LN+L!3D$,KNLND$ LND$$LND$(LND$,5 LN=LNl$0UR\$+L!3PQ\$ S$URD$,LND$(LND$ L$$ LNLN5 LN=LNk$$ L$1ҍ|$DT$rD$HL$[|$  ,KNu=0KNt8hWt$ y荄8t,KNHD$]Et uD$F끋D$H9 @SND$} QST$~ @SN @N1Ҁ|$tF!' tـ s ـ w @SN@ @SN@D$,KND$ x P8D$t P1 D$tP5?lKN$uD$+L!3jPt$$ D$ LN ,KNu=0KNt^_[]USWV D$4L$@- LN5L!3l$)hPD$@SNH @SN~ LNZRH LN=L!3UPW#D$ PDP LN+L!3PCO5WNW袛ljӍD$ PFPL!3 LN LN) @SN @SNjQ LNSWhΊ"jP  LNxt$GF9Iu|$"tjVU0 LNA LN@SN)@SND$ ^_[]SWVt$1ۃ|$|$á LNt#9xu 9X up2jM LNLN LN LNxpX ^_[WV= LNt$ 95LN~?=LN,KN?P/ =LN ,KNu׃=0KNtˮLN LNt?9p|,KN8PM/  LN8 ,KNu=0KNt脮 LNu9q~)q$95LN~  LN LNLN5LN^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) &@SNH @SN~ LNDH LNTSNڃt$$@8)΋=\SN$E1 Øt4t/*@SNH @SN~ LNDH LN@SNH @SN~$H $ LNQ LN C LN $Q$ P LN$j@SNH @SN~$D$ LNM ȨtD$BD$)@SNH @SN~ LND$ D$H LN@SNH @SN~$H $ LNQ LN > LN $Q$ P LN$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G@SNP@SN>GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r,LN9tH9u b%8/t F%QD$;5,LNtF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$ t8tG@u@/UPWV]5,LN=0KNtt$ tWE/Q ,LN߀xruX@8tB@9tD$P5,LNx5,LN,Ą^_[]ËD$1Ʌt AuQPFWV|$ W[@P78WP葑j!8p (LN(LN^_USWV\$D$|nOʼnmIWP)|$SUÉps ]x 7u߅u҉3D$^_[]SWVt$(\$$W^8C LNL!3 LNP!3@SN LNjs@SNH @SN~ LN9H LN LN+L!3P7jVP W 8^_[USWVt$FPhfp#ت"3HQPP艦"3|$Q1ۃ|11E4ZE9uSh#~"3HQPP/"3Q|=1C4蚥"3HQPP"3QC9u1^_[]Ðh#bh#XlLNH lLN~pLNH pLN#=~ulLNH lLNUSWVP8!3H lLNt+u ylLNH lLN~xhL"3该h`"3袥 tLN18!3~PXpLNhSp {eWh8t_8!3xL>h8#>WjW< !Pjj  hj#J8!3ptLN8!3@1ҋpLN  pLN@@P t 1+pLNlLN8!3{tXAˋ-tLNM tLN~ @لtpLNأlLN="3t$5pLND$脣5"3&D$pLNH pLN0~^_[]ølLNtLN1tLNlLNh#ДUSWV=8!3w ,KN^t)kUV~D(< t< u 8"3Hc FpLNFlLNF tLNG $9t V  ,KNt^_[]Ã=0KNt^_[]ѓV lLN1~^Ë8!3r t ~6u1@1zlLN pLNSWV\$t$|$,KN 8!3y tj1 8!3I  8!3A$A pLNH lLNH tLNH XtK =pLN5lLN ,KNt^_[Ã=0KNt^_[WV$,KNjWƍD$PVAuT#D$ =uD1PPPVG u2jPV- u <$ELF1PPPVMG uZV轌9t:$Ph ,KNu=0KNt3Ā^_Wh#菒Vh;#|VWh!#hVWh#TVt$,KNhI V賌jjVA |$ t8!3H~Q豌8!3pxuh 0 8!3A1lLNtLN4!3 ,KNt^Ã=0KNt^J8!3tL$T$9PuHuálLN 8!3A tLNApLNA4!3Aj8/ 8!3@1ɉH H$H8!3WVt$|$ ,KN|$t=pLNWBSlLNtLN54!3 ,KNt^_Ã=0KNt^_鄐V58!3,KNFx P{FtP ~ u8!3V 8!3H lLNH tLNH pLN@4!3 ,KNt^Ã=0KNt^8!3Vt$ 8!39t0LNtPu^hS#2=8!30LNt-Ã|$t=8!30LNu8LN~P藊8!3@fWV|$ 9=|PN=@QN@!3t PNjhj"@!3MPt@!3hM P5@!3PNB9t jj 1Vj:Vj/Vj$ kt!Zu忀ރlt puԉпɁuHSNtg8tbPh׬$臐m=!3u =!3u@HSNtA5"3jPvW:HSNH HSN@uj)W5"3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh3&W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thP#jD$Pԗ ] PN)i5rOC-D!3+9tti-;)t RPh#jl$ Uy\$D$PF$t+,D$0h'#jSDS\$FŋCt:tBuM ,%Ph,#jQD,ingD,Runn}=tQL l$ ,j SPF1 D$xxl$ ?SFl$ ō,@)QPh5# 1 h%jQf ݍ,PEWD$P葑݃FD$ ݋\$GHO WH EuݍCWPF$u/1M|t؁Ph5K$WT N1MM|FGHO WVH GHOl$  W2H|1GHO WH ~T$KW}D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =!3$tCt>5@!3f,9t%5@!3PV$=PN~y\$t$1=PNtEt*t t.<$u u/S0=PNu WE;-PN| $^_[]DS0] hkPh#*USWVD$4\$,tl$0|$WUS ƃuR8= VNt,KNPNPND$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1oPND$ PN$iD$ 9T$tcu tQ=@QNt 1=!3uL$,uP9tPtu "3P ,KNu=0KNtt~^_[]Vt$,KN9tP džƆ1z ,KNt^Ã=0KNt^~WV,KN5PN~%=PNFt WN ,KNt^_Ã=0KNt^_}WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#a5t$ntpupSND$D$D$t HSN8D$t(1PPS芒 EjS̟==PNu|$1PN-HSN~6@ PND$u}t!AH Et{1jP~ƅt9u ED$u :u G EuHSNt Dt111D$uD$PNL$L$t$D$\$l$|$ PN@1퀹ttt[uL$́Hͅ=u;1D$L$QPjX ul$t3u 'L$͊u/ <u UdD$PNC$jU9 L$tc|$tNuJD$1rȋi4hfp#jD$(Pdl$D$D$L$D$u UD$\$l$t0~Ot)D$PNy\$l$D$tUD$tMjPS ?jVDžtjuS =!3u V. Ń퀉0^_[]h#ySh#ySh#yUSWVP1$1C11h#1it"gu$ڃjt puЉ̉( HSNt yjP6ƅt,1tPN)i5rO@Ph.#‹H$t#tH~1i0 tPh3&11G^_[]Ã~1i4ht#G"3HQP~G ;| Z %PG ;| "3Z;|lh#Cxh#9xV1=PNujt$ t1+^V1=PNt. PN~$APN1F:uI}^V=!3tO=@QNtFD$t+ PNi5rOA1ɋ"3u0VQhq#R載^USWVl$=PNu~ PNPN~"5PNHI},KNtfiP)Ƌ-PN=PNiPUVR ~ ;uKuU l$hƋ=PN5PNi 1҉AJw)׉=PN ,KNu=0KNtu,KNfdž=!31Ɉ~1|PN1BtiP Ɔ ,KNu=0KNt]u^_[]USWV \$<|$41HL$AAA UQj bƅt#tFjUjͮ VSt$@Wl$\$<$D$ 5 ^_[]f@..@.^_WVt$ 6,KNNJujVj 瀾tW5@!30<u%+PNi5rO9D!3t jVt=tu  ρπtt=ttu jAu V ,KNu=0KNtq^_hC0 hPh#NqSVD$L$ =!3t1ۅ SPjD ^[Ët$1҅tހu1=PNu2PNu) PN~PN:tzt Iuh#PN1@SWVt$$1@=PN|$(1@$#$X'Wh#bjvu htT#h\%tjjvjv t1~ h#21@^tjs%;th#h$jvh.%1Wvh#1Wvh#Wvh#jvu htT#xhY#kjvm~ t+u htT#Gh#:jv <u htT#h##Rjvu htT#h#7hw"v h{p#jvh#jvu htT#h1h%;h#kFp]h{p#P~tF1SwJhN#.Sw 1> #t#P uh#hv`$vh#v#'1B#1###1#N9tQhfp#jWWSxuF x%Phfp#jVVjv S hE#51^_[h#h#jvUSWVfD$ PN PNl$$1D$Uލ}<$1!# x$']1,$]&~'t!=\tD"t $6\$ \|$ 'UӃ#\$ t #T$Ӊ$Ӄ;$#|$ t #,$ߺz&!}D$ ##(} u,$#$.%)|"qT$t=Ӄu?<'t u9$;u<'_.ֳ",$,D$1 <':'D$t#@ʼnʉ]|t GhJuJы,$ɉ/t t"@I PNPN^_[]WVt$ tG|$t jV~t'h\%h\%jVvu^_fUSWV$t PN =PND$P xVNt hVN|VN $=PN1jh'S eP >@Hx@u8/ZD$PV蟶x D$pL$t 1D$tD$p1ɋPN9PNKNtH1 8t:tGt89=P!3^ 9=P!3~KN5L!3WPVl >DS#A=@SN jn V+: fiDle cDhangD ged߉V w"3HQPPw"3Q D$pL$t PNPNE;-PN1-PND$PĔ^_[]6fUSWV<1Uj[7D$hhh UPj\ K9u { 9ÈPNj U PNjQNhdp#U ha#!3,$UhQNrgt$T|$P$KNQNhI#'t1Ph~#QPP[V$=!3u!3 PNt N=PNuEt$(Vh#蒀t8t$P1TPV$WN="3t =LSNtjD'kuD$PLSNu/jM=!3tFh<1#sh`"3s*1ɀ="3ˆQP;h="3u=LSNt4!3WN5`KNp$$#uSWVD$8t^,KNjP蜞ƅx jV ,KNu=0KNtcx"1=!3t=*"3t*"31G ^_[11="3t "31j V3V=!3tt*"3u"3^_[USWV|$(V11C= VNtn1=!3u4t0j5"3jh`"3%r!3P=8"3t.te=!3u\1Ƀ=PN PNjPlg1;tW1R=!3uIu=!3t7=!3t.h#pEVu$uV#^_[]Vt$,KNjV˜x1jP ,KNu=0KNtaj^/Vh#b t1Ã|$|D$pPJnZnft$ th#at$t$b th#aWV|$ W#@PN tWPxY^_h#vaSWV|$P!39~b9,KN؃P tr H!3 L!3P!3H!3 ,KNu=0KNt `P!3,KN5L!3>L!3)P!3 ,KNu=0KNt[`^_[h#`D$t L!3) P!3L!3j h#j聙 /D$ H!3 L!3H P!3H @SNH DSNHDSNËD$,KNH DSNP ,KNu =0KN_Vt$,KNH!3;t H!3P8 FL!3FP!3F @SN ,KNt^Ã=0KNt^Y_USWVP!3<k,KN-L!35H!3DQNt|F9uuH!3PV$  H!3H!3+ P!3 @SNL!3=P!3DSNtG90uC H!3 L!3H+HH x@WSUPm 5L!3=P!3 ,KNt^_[]Ã=0KNt^_[]o^h#^D$,KNL!3)P!3 ,KNu =0KN4^V5P!3P!3@SN5L!3^WV|$ 5P!3+5@SNP!3)@SN9|5L!3^_ËD$ L!3) P!3 P!3L!3+D$ȣ@SNUSWV(L$@D$D$@t-΍i11P wDGÉ,$Eu1ۋD$bV  ,KNu=0KNt:WӁS$1rD$r1@xDw@@uDx@D1 uD$r1@uDw@uDx@D1u$r1@uw@ux@L$T$PQRh&#i5"3e "31Ath#$e1@ ^_[]Wh<#VWh[#V(0 PWh{#VUSWV(f11CD$h#AR t!HuStau׉\$σʃŻP'C9t;[ uVh#V1NHSNɉL$|$xtD$ h;#Qte\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhjV9ىƉߋD$ \$ D$ |$D'C L$QP^CsP\$3h#ng\$ utt$|$ t$|$t$1N11 uh;##g+D$@ jPWt$ƉRPh#f 1 Phv%fgD$x @ #t$C\$SPv|$D$ tMt L$L$|$t D$D$|$FSP~unjQN]uT$tT$|$T$|$1I1Ѹ1 uh;#f FjPWRwRPhά$e 5"3>b "31AthF#sa1@e^_[]t$h#Shs"R$0 Ph #Rt$h#R$0 Ph"#RfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV t9t9u1u^_Vh#RVh#RL$A1@҃Ѓ wAu1SWV\$1tZStMPh%S 1Ft5Who#S t"uh~"S t Ѓ s^_[S1ɅfVt$ |$FHSN(!3Ɓ2"3u!3jHSN LSNu "3 ="3=!3u't#jtjt!3!3<u="3u !3=!3u!3PSN=!3ut 8-u!3(2"3u 3"32"33"3uހ="3LSNu:u6pKNHSNH HSNPSNjPǼPSNpKNLSN HSNt/t_9tZAHSNLSNQt HSNPSNȣ\SNYSN8t TSNAx@uHSN TSN^{hq#OUSWVt$LSNH HSN-t+C11C<-t1Eu{-1E1 [!3t$Y!3t(81"3uƆ2"3u Z!3@uă^_[V(D$ T$0"39tu#RPh#Jt#1"3t(81"3uƆ2"3u숁2"3^WVt$ ~t)~tP uv ^_USWV jA HSNt_y 8-uUD$$HSN1lSNP  HSNy8-@P1F PơTSN),KNTSN=\SN~-XSNFt7 XSN1N\SN1ɋu`SN ,KN=0KNH1F5TSNP)ƅTSN99S,KN TSN\SNlj4$މt$\$)1*C/5\SN9rL$ 9v!\$ۋ4$ P; \SNw4$ 9vQ9w`SN ,KNu=0KNtGW1 ^_[]h,#BHh#8Hh#.Hh#$HSWVT$ lSNtstm8u'1z:trrD8uAÀ~:u"9u HSNQHSN tf pSN1ɉ lSND5HSN>1t6?-u1t+O^HSN-uta5HSN1^_[Ph#JGPh#?G|$u1PjPPf,KNjwHSN8t PI ,KNu=0KNtzF1ËD$Ѓ w#j jP讱 u`SNYSNËL$~ND$tH  \SN=YSNu `SNdSNYSNhdSNh`SNQpphB#SFUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhdp#he#iZ J|$:uUD$8@?jPhe#BZ ^jUhe#Z 1|$D$0)@<Phl#h`"32W jhe#g1?\$D$01@11T$4*l$Phfp#j UiWhUh#Y D$EEjUt$0Y u0^_[]À|$:uD$8@:Ph#K1L$0L$4UjCfVD$ 8"31qqA1Ʌ xPN20PLR8"3p ]t u 1%8"38"3@j* 8"3 u^qqh#CPD$xPN/$QXUSWV'ơ8"3@tu'tƃ 8"3 x,$@D$t.$x"$18uWPtG'uD$tKjD$pH(t6NjpVWPVخ E$ht8"3@^_[]USWV8"3@|$u 8"3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8"3@@|$Fu6|$uD8"3@ 8"3Ap8 u\|$u8"3@^_[]jjX 8"3ASWVƻt u j pxʡ8"3@^_[USWV8"3kE1͋ 8"3x t*xPN,PN8"3@ C1Ƀ8Qs s j@8"3HOH O oKy K9t?U1CSp ʨShD 'P= 8"3HO@ G 8"3!^_[]WV@t$P 8"3A uyW wWh#4d'h#j"Q Wh#j"PMRWuL$Lx4d'h#Vh#jPRWUSWV8"3@1u 1=!3tMtݡ8"3@xuUj @jhÉGpjTaC+t8"3@tj (pƉ^_[]h#8"3t$p0h#_>USWV8"3@$ u8"3@$EŃCߡ8"3@$'$ 8"3APUj ^á8"31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjjljF j0G5jGt8"3xJjG B u08"3x,u%@J#'t@/@J#'uh#jÀ=!3tjjj 8"3H0+H8O U 8"3p0jR@ 8"3QPI H pGu58"3~ h%vRm|$F8"3xujD$ 8"3Hu 8"3H L$ qx0j@8"3HKH K {@;u.8"3x }8"3x|$ T@0GjG 8"3@t(HS u 8"3@8"3x\$\$j 8"3HK @0Cku8"3x ux,uh%pjD@<"31ɉH H 8"3Q0PCAHrAAtejC9t jW\G @:8"3@ u8"3@$EŃ!ߡ8"3@E<$t!t;tj dXÉ{؃^_[]/ uS\$|$8"3X0j&x@ 8"3QPI H X t\$|$D$C 8"3APsVL 8"3jj 5jj,jj#jj jjh%jjjjWV8"3x$G Hs8"3jpW$ uq8"3p(x,u~ 8"3At8 u @A8 @tHA~րxru\tuՀh'#8"3p0+p8j@ 8"3QPI H pG .Pr8"3@F 8"3t1^_jjVt$&9u^jVVL$1J#'tA1B1t AJ#'u^uVt$j@ 8"3QPI H p^USWV |$$tD$ D$$D$l$E1$8"3xc 8"3x0$t $jPƃF 8"3QVI N ~ut. 8"3IJ#'tAt=t AJ#'u1c8"3H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc4!3 8"3A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j8"3 $+H8N~L$NL$$N @0FEPdpj/vuG4!3 8"3+A8FF8"3@4 ^_[]jjjjh#L$1J#'tAt=t AJ#'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;QN}X;PN~PPNI;-u{tBuG8"3x0+x8j@ 8"3QPI H xF^_[F h#lUSWV|$4!3D$p=u ?vl$$5L!3P!3@SNG$|$ t u 3 t19uD $ tC9u?,$ u4!38"3HH }Mt9t u>u:<$ t=u$)jWP |$l$$uS\uN@SNH @SN'\Fg u%@SNH @SN F4!3#á@SNH @SNƈF t=v4!3=t h' u4!38"3HH @SNH @SNf=L!3)FV 8"3x4!3+D$^_[]USWV$$1҉T$ T$$D$(54!38"3r0=D 't1$|$ fw|$1/fFn D$j8fNL!3 P!3 @SN=H"'u ƒ=@SN$‹nD>  $l'=B'u f|> @SN4!3Bס8"3=B' f|> SD>fT$ NT!uhЃ`)0N,05,/L>=F!'fu @SNBn׍MN|$*@01fD T.fTT.fTT.fTDF!'fD1AL$1(ljƒ(M @SNFD @SNBvNO|$`@81ɃfD T7fTDH"'DfDfD> 蕖 = @SN\GęT$ t$>Hff @SNT$ Bf|>D>u6t$蘭 nMn @SN}f|>  @SNBFfL \ D$$D$f|>tD>t @SNBf|>u D> @SNB @SNB:Ã{t J#' @SN}E+=L!3 @SNE{|$ðD$ #{w#}cD$ 1@Xftf|>u f|>Iu6v $G nMnD.=B'( @SN ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDD 'fD @SNT$ B1AL$ Y) NjFfL @SNB)H 4!38"3@8xt xPN xPN$,9 Nf|C\:`1" $}f|  @SNT$ BFu6$荪 Ft$HFf5D$$D$UP`ſ1۹$'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDD 'fDu6t $z FHF @SNB^= t]譑\t 'u 虑 t =u 4!38"31Ƀxɉ xPN$ 7 @SNT$ 'uF|B' @SNF$oF!'$< u @SNT$ BT$ @SN c/et$1  4!38"3x5xPN0J#'ωD$Ѓ 谓}\$fF!'f|t @SN @SNB\F!' u @SNBNf|t @SNB1@D$v @SN @SNB݃"XŃ'K D$0$. nt$T$ Mn @SNB1@D$t$xPN$ 5U @` Ń< ?\u\ ? \$1跎HЃ w&Hw ÃHÃéOu \ @SNvNO|$@81BfD T7fTT7fTT7fTDF!'fD\$ I'L$ ur%=V =@SN D$  $ swF @SNP?ˀ @SN@F @SN x?ɀtw @SN@ @SNW?ˀg^ @SNGJT$ :,D$SNSND$D$$SN1zJ#'t.@SNH @SN!LjG J#'u\KЃ w4@SNH @SNLjG ÃЃ D$ u t @SN׃Zn @SNH @SN=Gt/ up}tk@SNJ @SNi#@ǽh#tE%t@Ń:b D$D$$7'm¸U1#, 9u茎1|$Nf|uf|t Ms@ L!39T$ vNK؃|$F@11fT T3fTT3|3|t3ft1BfTft|B'fq fq ƋT$ lLNH lLN~pLNH pLN 茊ËFD6\$D$$7'17')G @SNx ?ʀtw @SNE @SNO?ʀ @SNGZ @SNx?ʀtw @SNE @SNO ?ʀtw @SNG @SNA?ʀtw @SNA @SNH?ˀ; @SNx?ʀtw @SNE @SNO?ʀtw @SNG @SNA ?ʀtw @SNA @SNH?ʀtw @SN@ @SNA?ˀ[" @SNAD$ ??s@SNH @SN~2G:@SNH @SN~$_1:B ܿˆB1B'nD=H"'G=B'tf|cf|.3@SNH @SNk5L!3Gf|uNT$ ؃t 4$t$Kŀ>ts4$Ol襉T$ )B8"3L$H,L$H $貾8"3pM tΉ$螝 Nu8"3xĨ^_[]1HE;QN} ;PN~PN>uxkjy1$&tu>tyu6EBE9E0E"EEEA N}8"3h$ Ή$g Nu=tuS$D#$[#4!3 8"3A0$#^$h#K$#?$#3$g#'$~#V 8"3xt@@ ^Ãx t#xPN$)8"3@ @8 4!3H0lLNH lLN~pLNH pLN0ƃ~0:=F $'蓃 t=uԆ럃F~t\u^d 4!3@4!3 8"3A0ytxPN KxPN$(*;|u0d|8"3@=t*4$D$D$B'4uۡ8"3@1v u4!38"3HH @1@Q&8"3@-8"3@8"3@&tQ;ub8"3@ H8"3@-8"3@8"3@ 8"3@u菁\u?腁 u64!38"3@81Ƀxɉ xPNP&藄jjh_"薄 /Vȋ 8"3y8~0 @SNQ@SN轹@ 8"3Q8rq8^USWV\ӉΡ8"3@D$ 1,$$KND$資+L!3D$$UP,KN$~Sʼn$S5L!3P2 l$|$tD$$$KN ,KNu=0KNt8w4!3D$-L!3P!3@SN8"3x t*xPNP%8"3@ ǃ[~!\u9ǃ[C tJ$Q u"4!38"3HH s`un=ub\tX`tS4!3 8"3QQ NDt""u$@SNH @SN~E\E \@ŋ @SNA@SNٷ@@SNH @SN趷EL!3@|$t~PŴt$jP D$pŋȅut$ j蚴E8"3xtH@1D$4!3D$j7ǡ4!3D$4t5 8"3At$ D$AEx蠄8"3@t$ Ex P!39ًl$蕵 P!39~=L!3@SNt1SUW蛺 )@SN,KNU] $ ,KNt\$=0KN\$t 8"3T$ Q$KNNf|u%Du @SNQ@SN@Vt$+t$ @SNQ@SN@~.F@SNB@SNȅɵAJ։ȃՃ\^_[]á8"3L$H0h#WӃ<$t 4$^ /8"3@D$$KNjP>jj jjVtQ N^V 8"3dp#ytA5xPNt7t u(VNWN54!3P5xPN #^USWVt$,|$0l$Uز5P!3ݱ1BW;L!3u(VRGSN9w&SNWVSu U跲^_[]Áw: t9v$P5SNu tãSN$SN랾"#뤾0#USWVT$L$ -$KN'Ɗ*"3@KND$1|$08"3D$|$ljWMtJD$8"3*"3Vށ-$KND$@KN(KNdp#jUL\$t$l$=$KN1F5@KND$08"3$V\$S茀 vzVhD 'P 8"3A |$t|$t=!3u #@݅u:T$1rIJ$JB *"3VVRK -L!3=8"3D$*"3t$܀D$$KND$@KN؅tȁĤ^_[]j|L$1jRfL$1tT$9Qt uÉV SN1t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu SNtu(Mxju PQ.Ex PKU舐 uF^_[]USWVl$ t$\$|$t|h@VSD VSXDžt9u 9t SaK9u95D"3}5D"3^_[]Åy0 PVShe#WKWVSh#USWVt$ |$\$l$j蜭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jH@ SN$SNM|$];QN};PN~PNEu9] uSNtX9X5SNt-pt 9^t6SLF9t SJ SN1tF9Yt? SNtHt 9Y jjSeI PkD$($@t 9XjSI1x,KNSN  bSN PN9|AQjSH ǃt;=D"3~=D"3x jjWH j蹫$JBXxp ,KN|$u=0KNt uSNt$(WUN mCC1O ntuK5SNjS(H DžD8t 8ujjSG Dž0 PSh# \$t "3t"3|$t "3t"3^_[]j 賦 PSh# 0 SN1tT$9Qt uÉVt$5SNj VYG u SN|Qj V;G u8FPj V'G u$j j VG ujj VG t;D"3~D"3^h# WV|$ t;G;SN|.GPSƋG9tVPWwGw^_WV H"3 A H"31F |71FPWWoF y w;D"3~D"3PFgfff  SN^_USWV$$$~,KN 8k$@'n  SNt9i V SNtQt 9j b Y<(O8=!3tNnjUDƍD$PV聸#D$ =nhh]n$SUHDoƅtjVD!SjVD $/nhh nhh UC ƅV;5D"3~5D"3|'u" !39uu-jjWSD 9t1jPWV ,KNuQ=0KNtHA1jPWUy v 0 PWVPWBD ,KNt Ā^_[]Ã=0KNtĀ^_[]4hh j 订 PWUh#~y0蒢 PWh'#c1F5|KNPV0 PUhs#948VC$8|KNj0 PUhP#USWVP輊xa|$\$;D"3~D"3oU= VUSX 1jSSܑ t!t$C$^_[]h#z4$B1EUjUjUUUjtSj iVwt$  SVD$5SN,KNPV]SNV1  ,KNt^Ã=0KNt^l1=SNSWV5SNt4|$t^tCx PBjV6u^_[SWV|$ D"39|ȋt$|9}9| D"39tVAjjVW 9u^_[3WASB PVh#WVSN |;QN| pSNt$ Pj V@ y28t 8u>SN jjV@ ;D"3~=D"39t VA^_Vj 蛣tL$ T$5SN0SNPH^áSNtT$SN9Pt u@Pj @USWV$|$<\$81D$ $D$1F5U5$3h#WSx !1tbh$WRhE#W<uo1h$Wthv}"Wt D$1p@|MD$K}hf &Wjt8D$D$h8#\ j5"31CKD$D$u}h[#~ v11 t=t8t8t6w TNr1TNhKN ,KNt^Ã=0KNt^9USWVt$1u=TNTN1ۃýSNt6SN8t+,KNSP] ,KNu=0KNtSN=TNru t^_[]^_[]V1=TNu#SN1A:t2>u TNr^WV|$ 0=TNu =hKN1=hKNu0u+t =SNu"=,KNtW=VNuN0KN]tEQu95"3u V^_5"3t$WVt$ Nfu4VNFNtF t0fu^~,KN ?NQP膏F N)N,KNvIF FF ,KNu=0KNt V N^_Vt$F t-)t'VfxQPR yNFN F^5"3t$USWVP|$t$j'Vt~th#Vk<k>t!h'VT 1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9="3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Qj'Vt)19<>^_hL"3oh`"3bUSWVD$~@|$l$1SWU*' t ,8tF r)~1H^_[]ËD$)D$,KNX"3tPn 1X"3P"3 ,KNu =0KNRPD$L$ T$$RQP XVPt$t$V  tt$ P4$m ^h#ePD$L$ $QP5"3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+WN+DVNPqq h#jhWNWNSWVPLVNp'C PVw u,$$w0bCGσCGCuh WNVh#8 u*$ WNWNWNWN^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<WNt>7t9^ uSUvz9 t61^_[]ËD$t8SV ~ƋWN`uWN$k WN#t#$#t%`WN㟉WNt$D$$# ^[WV<5$KN1$|$PWt $D$PL$LT$H=$KNPQR 5$KN$<^_USWVL$T$tHtA|$9t91J#'Írjt/9t+1J#'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U#V Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#WV<5$KN@KN$|$jWiu"D$LL$H=$KN@KNPQ5$KN$@KN<^_USWVD$ èu|$=Z!3uÍD$PQW Ƌ@N4,KNNt%݁ uF @VSPу F`u vh NFtʁu F11ƒʎ! stځ ʉV~t&uفuN AVSQЃ tVNt`VNuxVNt j} ,KNuk=0KNtb[r2jXxL$H @ $  $#`uWg `u Wg fy^_[]vv h#z D$@!|$$~L$( t 9-uD$@-=TSNu0@=LSNtc@=pKNtf@=!3ti@=!3tl@=PNtp@="3ts@jPh#,WVt$|$ ,KNtwVP~? ,KNt^_Ã=0KNt^_(WVt$ t|$Wv 6u^_USWVP\$,KNjwƀ;-u {l$jPS5 tjNj@F GFGFG0 t uuO tGT$< =uFR,SP}j=S#SUPfu< ؉G@54"3蘃54"3hT!3Pʊ ~ F1gjt$VNuQG L$<=u5HVNHDVN2UjS $81F FFDVNVN~WN5WN ,KNu=0KNt\^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ tKNt8Q12<08uF=u =ut j=R蝁F^_[1VVP tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVWN1tr:1҃ЉuWNr׍PƻWNNj+t7Mȃu%EttUЃuEmŃWNr^_[]SWVWN>tLGu% uw*c Gu#Wc @tw"Gg;uWNr^_[SWV|$tfh#W]W訤9uWh׬$V't*tUj'Wt8)WPh# h #GhO#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhY$ctUhY$Q>=uD"3HQP~ j( P "3j)n~=uGuthZ#EU"3HQPP"3Q ^_[]USWVPWNuWN h WNT$ t$\$WN1<$?tIOt !T$ ttуt݋ WN9|QP~T$(WN%WNt=t @SN>:G @SN:pUSWVD$(01r$11h#1t7ptnuO1Gru=t*tHSN8t$jUt$VD$D$^_[]áHSN8H HSN(tϋ$ЉD$D$D$ P1PU L$ \ =u4)Ftt.L$!H=tFt=t Utvtt($t@u7=t $ H 4$VU HSNH HSN(e&UQh#\ 1@D${1 Uh4#9ru Qh#Qh#V tX1h\#膕Mt(IuNt xuփуVPHSNH HSNu1^hJ#TUSWVP\$jPS9 1NjT$@tуu1F,KNuaՋOW | uujh'S GuGOu' u w\  $W\ G ,KNu=0KNt^_[]SWV5WNWN~tFu7jwm54"3v hT!3藁 v e\ ENtuV _ BWPRу G u w+\ FGF GFGV\ M^_[ËD$ *ÃuD$jppk 1h`#USWVP1$1E1h#Qe~ft&vtxu teuԃe$뺋-HSNEt=$ ˃1$u P: ƄuWu ƋEu1^_[]fSWVt$|$h%6襞u"h#t萞DO1@$'N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h# h#WV|։π9!utNWNtfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP葇I1>?f u%PV&1u%#L$1PVN&1t1Ʌȃ|^_1@Ow$'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$C t$|19{USWVӉϋuWNfx@$l'$PW$1ۅD$PV$r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW$1ۅD$PV#$L$$t$<|$@11$;D$D9t$ aZ$PW#1ۅBD$PVu#,$3D$ $3L$ $$3L$3D$1 dVW1ۅTVW1ۅfVWٙVWř1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]誣Q9-u1tQyt8ytBÄth #Q͘'t1h jjh'Qh jjh'h jj hX'R觷ËD$L$  )VL$D$ 2)u AJ)^USWVPcj PV2 ljF8t"<ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#Vh#USWV׉ݶt 9Fup  ^^5x9uM1PPSx~ōPqPU,x~ LH;NuSS #~^_[]ÐUSWVt$(hdp#j%j D$,^H $x?-Ok-u)sstdluu~xwGWÅu"3DHt'1Ʌ S كhJ#h3DH\ƃ~ƀtVtVVh0#jރ $hw&S訕1Ʌt:Su+$891V5"3IV|-$K$8ʉT$hf &WA1Ʌ9ufمu$1D$\$ $,}%urUXDžl$UW u.&|u" $4Ph% 1@D$l$t jWl 询j D$PU< ljӋD$9t-ف8ur1u e8tQ#xdp#UPh# 1@D$\$ $4hk#1@D$F \$ t$lPh#jWpKNPPPPh#5"3j4WVPΉj WQU 9u=у|=}^_Vhz#jXQh#j5"3 jWV@$xLNLLNHLN5\V>t)j=WlthW}>uPhfp#j@VTjVh# Vh"3hE" G1$VWh# #t%VQh#a j,h#h#M VWh#>L^_<=(KNt 1lLNtLN>8"3tSN1SNSNtSN9SNtj=SNu"3L"3"3`"3"3tP.N "3Vj15`KN=CP0kAQW1^_[SWV|$t$<&'$\%'Vw vVw d_ t"Vst Vw?w萎N@F1Vw q#w iN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u<&'E$%'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tRJ Ã|$FJ USWVPu }WNWN"3f`|j%v0gm O1@ 0WND$,WN|$@t$(q%v>%L$ h#Va<*u C hs#S@1N .u{*u{ 1HD$Chs#S 1HD$  t$CD$'C`L$&~QF0 $&'. D$׋L$ jj D$tfL$tjWt$QPhXNTFu$t&'WNl$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhXN,WNL$ Q0|$WNH WNT$ l$=WNuM|$L$ jL D$tbL$l$tf|$ L$D$$XN>d\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$XNL$\$L$$X8GWN0WNE ƋL$ cjl |$D$VPt$wWNWNWNWN1  WN WNWt$*|$$XN \$$@XNWNt PLF V*P5 WN҉D$xF\$wZ$&'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V@XNWNT$t PE T$WNWNt PD T$15WN5WNЉ\$H\tF5WNX])P0tXM\$u/^t-u#F5WN벸^tic\$>T$ j5WNF5WN{ 31:DYt 7GuF5WN\$DF5WNȋ\$+1L$ jlD$t1L$t5WQg@XNL$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hXN PRQt$QP  WNFP2 WN VjxP 7sWNT$t t$L$ t PVRQhWNMT$L$ t1PRQhWN.VWhXN1PQ*t$P PQhWN tWNWNT$z \trB<]*<0tu$8'' ?$ ''."'#Eu uShi#WN 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h##\WN\),ҋ4$u|$ uWh>#,WN ^_[]WVPWN0tpWN蝏1ɉQPV Nj 3#DQt$c#r& WN+ WNVQP蠿 WN1^_SVˡWNH WN u:"3Prp~r0 PW"3Q 밅uWN)"3HQPP "3Q^[SWVPWN0t"WN<'t<"u1B^_[11fi1ɉQPVp lj+t:<-t6 3DAu)WN+WNVPh#z WN $ڃ^_[SWVӉQ~ǃArVh#1WNGPVhXN0 D$WNWNƇWN^_[USWVP׉1PPPV ,>U}@PUQ: x$tG9tCWN+WNVPh#蚽WN+WNVPh#< WN$^_[]WV9t"΀:t9WN+WN9t\VPh#ZWN+WNPh@#D輌8"uD=WN+=WNj"T PVWh#RPhd#ټ WN^_USWV\$$8l$}h" j jh''UFƅu!h" j jh('U)ƅH h]utu*C#EE CF|$-u#E EE1C؃^_[]USWV$$UJU9uVh#蝛PVh#茛 ƃrk$$$@PQh.#Z tUhD#DDžۋ$tShQ#)$t j ,] =DXNtj DXNHXN]#w %ud#Ywxl#=w %u r#w؃uz#D$w؃t#D$u#؃L$u #D$u#@D$u#a D$u#B D$u #"D$u#D$u#D$u#D$u#D$u# D$u #i]=DXNtj ۗDXNHXN# D$u# w %u#@D$u#D$u #w %u # D$u #w %u !#`w % u (#?؃L$u 1#&w؃u9#D$uA#D$uH#D$uP#]=DXNtj DXN؃HXNX#wu _#jw؃uf#LD$um#-w؃ut#D$u|##u=DXNtj XDXNHXN#w %u # ,' #u D$u #Uw %@u#4fD$u# D$u #D$u#D$u#D$u#DXNtj DXNHXN#''tX''|$FTPSh#jdW;,^ u΃=DXNtj 藓DXNHXNtj pDXNHXN''1'' tN$L :Ntl P#PSQ蔒 5 3ދ$391D$D$,h#UOD$ Uri9D$ urh#WVM wU$,'$j5Ul$D$y1E$39zD$1 $3l$|$HL$Oȍ$WQ9Uy ht&jt$VhBt @vZ y h#D$tPhht@pZ y h#]D$4Pht@pZ y h#7Ert&u+;?UVt$<$PW W19D$@D$<\$SUYu{SU[umSUu_3 $1DHu$jh#Vh VWVPW|VWD$<$H $xd|$<tWjt$qH y hY4&s|$@t'D$tPhgtt$VY y h"#jۆ5Uh׬$.1D$@D$#uFj PV蟑 r8u$8u؃^_[Vh׬$jB WVh#j USWV fT~NdXNB L~Nƒ L~NhXN L~N€ш L~NlXN P~NpXNtXNhG|#%t h#%t8ƿ1'#PV ctG uVh#j+  $$1ɉh4#SU P6$4-'xXNkj j5U0 ƃup8"5dXNXNv UflXNWj j5Uӏ ƃ _%XNj j5U蓏 ƃup8"G5hXNXNXNXN1A5U# 5Uh<#V_atch`#VMaKXN|XNBXN|XN/lXN#"o8"tD5pXN  9upXNrCjh#5Uh##VhR#5Uh|# 5Uhc#ju h# tXNt 1ҁ‰XNL~Nփ95lXNu<9hXNu2T~N9dXNu#P~N9 "3t "3|XNXN=XNu\1ɅQ}h# $3=XNt)ͅt=XNut 1jhhXNP4} $yhXNh׬$j=XNu1D$(Pt$Iu#D$0=u |XNXN1N1$.' $$h"H!/"t$h#Qhԃ%hV-Vth@$PY$Ph׬$xXN4^N $=4^N=XNp\NB=hx0#tt1@$$Phmdt$ hh#h|tWeWhJ# $=,]Nu ,]N =0]Nu 0]N 4$h\N TXN $$1 uWhPh\Nt> 1\N\N\N\NtjVh\N6 h\N\ $RhS\NhXNVW0 5XNVWF5 W[Zl$t$D$ 1ɉHHD$UD$ Pj %Džy#Jj8#Bjzx߉DžV辙x9ujUjY 1|$nhx0#$P貅<hjh\Nf ^ WYt $h#Qh|3D;(3H (3~$3H $38h$3rZljt9 t4(3H (3~$3H $3h$32Zƒ߃NyjUjE h0#1\N|3hXNVW4. 5XNVWj3 h\Ndtd($Ph׬$$P虢1@P]xjUj {P]P7hA##tǍ$PWh%VxD$uh"Z$P%jPhgO#QQjƃu Wz, VwWVθm#.'PVYt uVhT#jG lXNhXNGdXNGpXNO1<~Nt^_^_WV΃=<~N @~Nt>tXNt49t0`#`#9t<#9t<#QPh#軌 5tXN<~N@~N^_SWV#\e3'3'VSh#hԆ3 J9#ujvVPjj"P th*#41Q1\.'$ =uhY jj"t$ c)1$4ӰF"u4$[ 1@^WVκ_ u1H3 r1P^_V΀=|XNu6=lXNtS^ t41t)Ph\N0h\NhedAV xk^Ã=lXNuS^ Jt=XNt7XNt.h\NhedAVp th\NhrdAVY t=4^Nuj uhV#j^hg#j"USWVPύAPjh$#h|3FGw483'hH$PhO#h|3 |3w(h[#V w,hb#V w0hi#V w8hp#V w4hw#V W4O<W8#9tQh#h~#h|3dp#OHtQPh#h|3rdp#OJtQPh#h|3Pdp#OLtQPh#h|3/dp#ONtQPh#h|3dp#OPtQPh#h|3~dp#OTtQPh#h|3~<$f$1۽a|3Pjjh#/wVh#|3Pp~wVh#|3PY~GtmÈJ9|6{u;[tVPWhE#nD$(ffL$(D$ 1ۉa)D$u!)tPt$h#L$4 <)ǘ΋I<9vt$h#$N<.”T$9vt$h#輅$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h #_ D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ,]N0]Nt$(L$QhV菅  D$ 1h#V/tG<$h0#V4(1>tYj:W6*D$AL$\$h0#S螥,1tD$h\&WnPtkhM$W\Phv#WFP\D$Ph#W6 D$q;pXNef*]NujhM&l$!Ug l$83'1tUP# QF3'r܉1hD$ Pj <$Wh"#gD$ D$t$ <$}trÉD$h"U" t:h"U" t/h"Un" t$UWh`# F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh#{D$ D$\NFʼnD$uf5\Nl$u D$l$l$hk$WDNhu%W.Nh#WNh#WNh#WM h#WMh"WMTh#WMh"#WMh/#W~MUh"WhMkh3#WRMh=#Wt.WGLt t uPUW7 Á.'r D$3MDHu D$"91hD$ Pj t4$h"#|D$ \$"r)Ut$h#| h #|D$1ۋD$@]NND$@]NWF4(t$|t%h0#Vp L$1Ҁ<tʉT$D$< w'<$$0.'L$ L$<]N<$tL$$L$ L$<]N|$H~NcL$$t D$|$H~NL$<]N16FL$<$C fF|$H~NL$! L$<]N|$H~Nt8L$$ D$|$H~NtL$<]N11A<$D$ h\N1D$ ȁ(^_[]4$h#zD$ WVPθWEV\N$]Nf(]Nh\N f(]N=|XNu=XNu#$}h\NhgdV 1h\NhfdV ysT8t iT8uv$=XNu(PhmdVn xX5"3h-Z h1=XNu$h\NhgdV2 y <#1G^_ù+#h# 뙃="3tt$ t$ t$ 6 S1HVD$ t$=\NthPh\N& ^D$L$01OEVcSt,uVh#-t"uVh#Vh׬$-VhM#Vh#x^hD~Nhmd5"3& USWV8 $RPh h8^NQc8~N XNv|Pt$h#ix lj D$T$1D$ XƉ 11 ‹l$_N 8~N8^N98^NhWD$P}% $;D$dp#=4^Nt =}t=}uЉD$$#=XNtȋ XN=WEVuT$tf9pXNrD$Pftt=XN%4$t$Uh#7w D$t=VEW=XN$t=VEW4$t$UVh#v=XN|4$t$UVhF#v=4^N$D$PSt$Ut$Vhq#i=XNu $hXNS|3V 5XNSVI SGSt$VhVW# 4^ND$ L$D$11t4$h#48^_[]USWV T$ $11F1Ń=XN|Uh#u QPWD$Pt$c9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=XNtUPhI#t Ɖ ^_[]Ã=XNtUh#=XNtUh&#tċL$T$tPh\N11@Ph# t"j QP*n uN8"t1HhXN1Yh#jPh#t"j QPm uTN8"t1HdXN1Yh#jSWV։ϋ\$+XNtItEuXN1tGtB8^N_N8~N9w18^N 1tth\NQA1@^_[Vhi#jL$1=lXNT$ PG1ɅɉWV8~N~( WRPh8^NQ誺 8~N9u ^_h#uQVh#jpPQVh#j1USWVPӉ΋l$|$uj WVql EuL"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h0#V<t#ƍFh0#PK1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh;#Wh#q1۹H~N؃^_[]ËL$9/up\ND$\$A/jPU u$D$ \ND$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh"#pH~N!Wh#pH~N1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#(D$$Th#Sut]"L4'Wi:PWS^; '> uۀ$U-$T1405'D$XP tpC"uD$TPhQ#a$T$끹5#05'j" $eFMu SQЃ {Sh#ah$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$hR#/$PQhk#R~$ Z뾋$G4w$u ~ˍ|$@WV19t"b&J~PH k$3'1OJH w@$4' x&B(D$ D$$l$ CtGtngtbcB8D$D$l$cx&ɋB(D$(D$,l$(Bx&ɋB(D$8D$<l$8x&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=\~NuHr8jVSW)D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph?#iShN#\S~USWV|$t$t$h"VU Gw45'h "Ph"VU GPSh"VUGPSh"VUVjjhQ&vGXtVjj h"]GXtVjjh"DGXtVjjh"+Vj bw(h"VU w,h"VT w0h*"VT w8h?"VT w4hU"VT wu 1<1A71Au01<  $jj@PD$PȆD$ Ph׬$VJC9u<$u43H 3~|3H |3 h|3j O1^_[]h#jfUSWV $ $ D$-@1`~Nd~N`~Nh~Nl~Nh~N$p~Nt~Np~Nt$ h #US c~!P$6' x~N˃PtdT]=U?1AJ5U|~N뒹 .Up~Nhdp#n x~Nb x~ND$~NT$:@=`~NlUD$ Tnt uBxou D$ 1Ɉ ~Nh%VNt`~Nhdp#`ءU$j:WC-h~NtWuS!tmh~NS c$ \Wx~Ntx~Nt |~N$39$ 1ɉL$tVh$P tj/U u Uh"hox%h$ U FVSDžuVtDž7h$Ps Ƌoh#W5 t(h/"W# th#W pV 1QQ$ 4PU7L$9C9$ $ 9tU赵lj?,$u1QhD$PQV h~Nhzd@P tq$ PhedAW Wі|$ WtD8$9",7'uW8N,$ho h 5|~NP Ġ ^_[]h#j$Ph׬$jVh!#jh{"hz"ʍD$ Ph# D$ Ph#jD$ Ph#롍D$ Ph#땍L$ Q4@7'hC#USWV։ϋl$j@ V U CCCOK G^_[]*hX8'Phs#hԆ3PGj;USWVP׉΋tASW4$4(VSC Whk$Vt$ PB W É^_[]USWV|$1_h#S?t$h/"S-th#Su\`~NtoU3t[u=~Nt .=~Nt%p~NtoU3t [u^_[]USWV$D$|$h~Ndp#tW3t CÅushC$t$ ]uD$7r%D$ ~Nt L$ mt L$ ^$D$ D$h+ $$ t$hMn%hVjA$0|$D$4$L$h%QH1G@΍K9|,SPB Ŋt><-u(GD$tj=Vt>FD$ GD#th%D$P8Hu|$1F1B,$֋$$$,$Dx~NtPdp#tH"P$hL#A xF1Ë$4hw%AC9uj @t2ƅ|$t t$ 4$ tA710h\#v|$t t$ 4$ ^_[]ÍD$jPVXq x!L$ȃtuuh#묁tlP& PUh5#M 끉 x~NutD$P$fFuW$P${u4$Vv'8t#tUVh# Vhp)&ȅu&8u*uVhp)&¾jf%SVh#誾 jP%D$L$ XN\NáXNá`NVPD$ L$ $Ԇ3QPVE Vj NjA6USWVt$D&8\Nut5XNh">\Nl$\$=dNt!u5XNh#>dNUSyW Ph$>\Nttj =\Ntu^_[]Ë5XN$PVh#:> j`5PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j4USWVu`N$Phb%$|hWVČ t Ƅ|D$PV觟1ۋD$ !=`= بtLV0h$P9 Džu6hhNh׬$1 Vh$PW DžD$PWVh#Wh#ue^_[]Ë$3D$($3L$$ u`NVhhhN t9Ǎ$PW{x#$= uVh(#{Vh#pWh #eUEM JRtHPQhE# t$t$hT#hhhN>:hN]áNtjЃj k!WV"01Gj0h8'W蒉 =Njj"0^_SWV{"01GW~WSjSN"0^_[USWV1NNNNNN1@D$ $1虤4DžW$ t7h$Pʹ Ɖl$Pŋ$ tUt$h#W:$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU t,ƍD$Phzd@V t$VS 3‰D$H9rHDQtD$=Nt*wt$SV u D$<tQ?1GjA S趹 GL$G 1ɉO GONG8=NN\$w tUvtt6jܹ UQ Ft$B F t$3 FD$FGF0wVh#hԆ3: rUhL$(E_$ }L$ AL$ 15NtyvhC$7~ twhw%7?j 66Í$Ph׬$؁^_[]hx#hZ#~D܋NЋ$ t9‹-N҉T$։鋔$ t$ t $9|ȉ$mNu\$Nt 9Ct,Ph#C$PMu$ȃt1{ $ t#Qw wwh#6$ȃt*t&t!Pw wwh#hԆ39 OtHOKtNG8=N t$w w W CNH N{ t t N NI N;D$\$9NMŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$PL\$tqNc8dp#tK$h$Ph#hԆ3y75N.><1#t#Pv vvh5$hԆ3@76T$SWV։ϋY Wss ss҃ Nt~j wWss ssԅuA N^_[ÐWV1t$|$ ɉ @4uyȉXȉX\ȉ\ȉ! PQ40譪40<8荪<8D@mD@LHMLHTP-TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40蓩40<8s<8D@SD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7٨Vw wƨV Fww貨VFww螨VF^_USWV\$l$EffEffCEffCEffCu uLS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu聧SCuumSCu$u YS$C EDȉCDu,u(=S,C(E@ȉC@u4u0!S4C0EHȉCHudh$VŋFNHNtbSQP HNx N~,=ЅNtffOfGG@ Չn,~$N()ǃ~$N(=N9<$D$hP-N>N,ș)N,)n$F(teh$V$FNHNtbSQP HNHT$<L=ЅNtAf=ЅNt4f.<$ ^_[]`NNF,)F$N($fOt@ `N븋D$L$t$ QPQPUSWV$$$ $$$(hY$SV\1j "D$SVWUhPD؃r_N95NrPSV Pt7=ЅNtf%"=@ttl#WQh{%d Wh$T^_[]USWVP|$\$s s@=ЅNtf9uRȅNt=Nt=Ntj:D$1PPPs sQs s6O N3C N3K u "3&=ЅNtf%"=@ttl#Qh$胣s s/)SUh$" Nu =Nt:yj !h$NthE$S=Nuh$u=NЅNt7t;f5`ND$ȅNjh$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=ЅNtf=ЅNtGf"@ttl#Ph$/SVz.=Nt)1=NL L h\$wRh$$p$l tRQf@ NN 1VW "3L$@D$DD$ t$|$ Npt95ЅNtʋ N5ЅNT$Htt tɉL$LL$QPh$=Nuh$515"3PPPj NN  5"3RPjjt:tN=NhQ$ QD$L$ NN5 N=N tYjj=NHЅNtt,fI=ЅNtftfI=ЅNtfIfHVW51 NN9Nt-j  NN djjQP NN AQP=ЅNtf%=@5 N5N8,$t$R=NN t# Fjj WS.9ݹÉrFND$P9|$P$d닔$hjj RS )ˀ0^N9whE$訞hc$Ntf5 NN15"3WWWj NN CRP5"3jj_h$hn$1`N1P^_[]Ë$d#N N$tҍt$PtV$lSUQP4$SUfH1G@u5 N5NhA#SUu.$l#$pthA#5 N5NSUq5 N5NH=NЅNfA=ЅNfh$`Nh$h<1#Mjj5 N5ND$DD$( t$\$ VS@@PD$PQVSf@5 N5NtfA=ЅNtfA$l$p!fHG5 N5Nqf@5 N5NSU5SUh$ t$p$ph$ =Nj USWV @ D$0Pt$0t$0+ 1Ѓ{T$ՉޡPN@4 1WjPQWWRS 9=ЅNf"3 Nff"3=ЅNtwf"3 Nff#3=ЅNtjf"3"3f#3=Nt"3ȃ=ЅNt]D$ Yf"3 Nf"3f"3 Nf#3f"3"3f#3=Nt"37D$ G UV=Nl$$tApQt=ЅNtRPkA(=ЅNt1ҋ PNI4-HNteQRP HNxtt$V/11jWp֢ =N=ЅNtf=Nf"3PN;x4})}jh"3W蔢 =NE PNA49rE =ЅNt<$fGj \$l$u6_=ЅNtf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=ЅNtfUVfXW|$$Wf@t$$W=NHЅNtt,fA=ЅNtftfA=ЅNtfAfH ^_[]UUSWV$$1Q NN9;$$߃9։$PU$T$L1 B(B앹 $BjZr1B$J$=Npt$ =ЅNt ɋ=NЅNL$xtt tɋ=N5ЅN1L$|1ɅDT t$t RP5NUVRP tE{[|$t}SW趌ljUVSW)SW莌lj_{[ |$t]SWqljUVSW)SWIlj?UVSWY)Ӌ$xX#UVSW4)Ӌ$xX D$4PS $$W$VWVhPWV N1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =ЅNt SWe PNL$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =N<$\$T$|$(t$,DpLtL|Dx=ЅNRSzTtDpPND$0X0vvSRPEVFvv1 RS VFt|tx|$8D$T$Rl$$D(D,=ЅNtFB\pTtPNB0FN FNDxD$L|׉L$L$؉D(MU =ЅNt]RQ肉 PNI0VPfU EMhɡPN@0 ȃ=ЅNt3ȃ=ЅNEhD,t($PN@0MU EhEhD,=NL$ tL$D$D$=PN,$\$ 1QOP\$  t19}#8@#pLp0l$$ HNɋD$taVt$P= HNx4ƍ$5NpS PN@0fPt$t$ HNx5NSpE N=ЅNtf؋Nf"3PNB09}+^jh"3S蠚 NPNB0N9rF =NtL$L$ L$ 1YJP|$ uL$ 19}#8@#rL HNtaPt$t$$ HNx=Nt$,|$(DxL|DpLt1҉TxT|FN=PN<$09ЅNQP)RP҆VF^vv軆 )RP誆L$(D,D(D,EM =ЅN\$QPp PNI0)RPTU EEhhȋ5PNN0 )ȃ=ЅNt^ȋ5PNT)FN^FV )S\$L$4$*5PNV0)EM Ehh )ЋL$Ev8QS `N1Ą^_[]Éjh"3pb $Ph*$k=Nthk$?h>$߻F & PN@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F3 ^nFD$hF$D$pFD$lFNpt =ЅNtɡN=ЅNL$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=ЅNtf)9F=ЅN\$tAf)=ЅNt4f=ЅNt'fL$=ЅNfVT$Rt)f~T$JR>>fD>=Ntq1@1$CD$ƈCCEUL$ q/G9<$u1A=N=N\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=Nt Vt$t$Ut$h$& 1Ƀȃ^_[]1A=Nt1=N<$\$ HfUSWV $8$4}tE1ɉM4M019 N‹DT 9 ЅNtRPM$U(E$f M$E$U( u ^_[]%=uLIPN(9‰|ǃ=lNt<|u=NtFNFh1 tNtD$hVP |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =ЅNt RP PNI0VQRPڊ։D$D$ ЉT$t PN=NQ8k=NL$$tL$D$ =ЅNt QP~ PN#8t@DQL!!IT u‹$8U t#DT tE=ЅNt!RP.~D t(=ЅNt1҉EU}@U=}@|$`NEM QPQPh$3WWhw$聇h$'uQ{u u PNy0ƃ=NЅNt:tMPW]}?UUlCD$T$NQt PW#}~V ~V ho$j7ąNLN@ 뛋5PNF8E -NT$$tT$D$ =ЅNt RP|v0 I)؉$ʉT$t*DT tZ=ЅNt RPa|$8D t6=ЅNtȋ$81҉AQSt$t$tv<$8}@ud<$D$|W`NE$8I QPQPh$3UUhw$薅h$<$<t7PNHt)$|$-NCq qƃ=Nt0FV=ЅN|$$tJRP9{)RP+{4FV =ЅN|$$t&RP {)RPz)FV )FV ho$F5ąNLN@ USWV|$ \$tN9NaN N ‹-PNt9ˉrux9ˉ\$؉jL$QWPց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סLNt`v0WUL LNPNpxjV|$(WS)Љ NN=NjVPSt LNA^_[]WShG$LN@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$PNp0vv_ $G PNy0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP19rÃ=ԅN$t$ \$ti=Nt,ۉ~A1_t4wT\$F9uۉ~1O ɋW @9uG W5N萲t$ D$x PN;Xt|$#=Nt JًL B tmt$v vhN$hWkWVt=Nt$$B1ɉL `Nt$ $$Bt$ B CPN;Xt`R5N踱T$\$1ۃ=Nt%JًT tN=ЅNt#RPvBt/=ЅNt1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb`NL$AI QPQPh$7W]Whw$h$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=Nt+FV=ЅNtGRPvu+D$RPfu1FV =ЅNt*RPKu+D$RP;u+D$ډFV +D$ډFV ho$/ąNLN@ 1@$5USWV\$41F~3|$0l$,|!N N9|)S9у} ȃ^_[]ÉދPNK89}=NtOI.A!1‰9)=Nl$,|$0t!t$4PWUh$PNPVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=N!$l$|$ T|$0tN# $ND$T$RPWUh$ PN<$\Ttq!qIVPt$ Sh$e$@l$19=Ntk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh $PNt$Sh"$1Al$,|$0USWVD$,\$( $N Nփσ5 N=$N11 J ,N9(N6 4N0NN98N@D$ 8N=PN\$jD$ PL$QT$Ro}ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ = P0p4^_[USWV|$_8+t]Cw=NRMT$=ЅNHRPX9L$0ơPN@0 T$D$=ND$0T$T$4=ЅNt$$t RPWMt$t$$=ЅNtȋMD(PN@0T$,‹t$(΃=NЅNt+tMVRLWuVFt$t$ 3W7KVRWMQ AD$:MQqD$T$AQ!EL$DT=ЅNt1ҋ PNq0RP耐 ƋL$ jWSQwӃ=ND$ t7~SPt$t$$SNjT=ЅNt RPoV|$)~SPt$t$$=ЅNtȋ|$1҉\$$ t/f PNq0RPݏ xËD$L$ L$0|áPN@0 T$ʋL$ȃ=NL$0T$D$t!D$4=ЅNt)PQUD$ T$8=ЅNt@ɉL$ D$ %j 5UfpNPh$\N=Uh$WQh$W;c$j W|N|NPh$N\N~md-$j5U"3=mPh#$ANN/N$NUD$ NNNNhNtNxND$ L$uD$t/=Nt=ND$thC$D$1$3)hD$=Nt XNjj߽thI j˽=NthI j賽h~ j褽 |$D$ D$4CD$=dNu PZPcDžu6hb$%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$>)(L$9|ȉD$6hr$WWm K;D$=HND$te^_[] Ph$juYPh $hԆ3 j&USWVP׉΋\$t$USW M9t 9u^_[]WVh$jYUSWV Ӊ5NQW=Nt=Nt h$X1SW[u=Nh$XȅN=Nu<PNPh${XCWt h$eXh$XXV=`Nt>=Nt h$X=Nt h5$XhX$X/=Nu h|$WX=Nu h$W3=Nu h$W6=Nu h$W<=Nt=Nu h$WT PN|$Y8֋T$  SP5N5N5 N5Nh$Wd,$kdыPN@DWSQPD$T$iщډWSUR腫jj RPRPt$t$t$t$t$VD$Ph<$$=N PN+N NN NN N tQPhr$ =N-PNKC)s, N-NՋs4HS8\$ ډD$$+N$T$N $ $ډ Љ NNtRQh$ =`Nt8h$5`Ntvvh$ 6j =hNt8h$5hNtvvh$ 6j 15hN5`N5dN95NtmjR PN405ԄNh QVm] 5\NVʍ=ЅNtԄNPPҞ5ԄNz؄N=ąNt `Nj PNy,t+N1TtR)h N PNF;q,rNPh N=ȅNt =ąNth$SHN1=N=Nu h- $S=ąNt hT $SGRtgD$Phb%u1D$t)L$ jQPhb%h7r%gt-=Nu ht $S ^_[]1USWVXND$45PN~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B Nl$9؉|5PN|$0G;~,$LHN4H~KT$މ)1@ N9׋T$9|5PN1҉t$L1F NN NN9S,SދD$4HxL$HD$81ۋjV PNׁ\Tډ\$tQ!QЃQ SPhNEPN5N|$D$Xt1NPSWUKʼnFظ|߃\$ <$w4FN<$t LX FuWFsT$ N N$@=ЅNtfL$fAf|$l$$j _J hX hNhNT$ =Nt| $=ЅNt RP<RPh $l=Ngq$ʋT=ЅNt RP?<WURPVh $($DX=ЅNtPh $`Nh $Eh $frT$ '|$@@u' T$t$SUt$A Nt$D$, F=N=N$@=ЅNtffu$@=ЅNtfft}SU{$@=ЅNt?f=ЅNt/ȃ=ЅN $ApfAAt$f=ЅNt $ApfAA $AtfA1ɉ N N N Nl$T\$XNpt4$9 ЅNt ʡN ЅN$tt4$tʡN ЅN1ɉ$dtX$t $D$LPt$衹=N=Nt=xNu,$$@\=ЅNtȅSUh" $C hA $,p~SUؾ19 ЅNt1ɉH\H`HdHhHl$f!B=N,$(E\=ЅNtȅƄ$E\=ЅNtȋ PNI0H111҉,$L$ D$t ߋ PNY8Om\=ЅNt͋ PN#8߉@DYL!!ÊIT u,$\$lD`Td t<=ЅNt RPw8D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9PNH4 D$|$׉D$|$=Nt݋AQ=ЅNt-RP7!Eh=ЅNtȋt$|$1҉11 ˉl$$WVRPSUhi $uA=Nth $hW$m|$t;SU蕼ƃ=ND$|t1$=ЅNt RP'7FV`N=ЅNtȉFhܽ$|$jj$$$$SU z $A`Id=ЅNtEQP6 $plph61$D=ЅNtWUPVh $  $AhQl D\$C5PN;^,T$$L$ NN׃ƃ=N5N PN9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-Nt$| ؋T$(tu3D$1 Kl$@؃,Ut$HM ƋD$9\$(s+l$ UhV $>j胴SWUt$@hz $hO $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wN NʃǃN=N|$ |:w wh $= =Nh $qjG $D$|$tjVU¾ N<)1CVUh$D$,p p*N NʃǃN=N j @ hp dNtHdN `N9tDy1Y1 t 9u,NN$|$ ,dN`NQ1I1 ы|$ tdN$G0W4L$Aڃ]D$ p ph $J< =Nt)h $1C+`Nh $;h $h1Ct ؃ ^_[]`Njpj讱fUSWVP$T$1B@B `NNPNx,11=Nt>Q:PNx,$kd1PWSQh $hԆ3袼NPN1ۃVU聶tzljl$ t$Npt=ЅNtʡN ЅN1ɉT$HtttȉD$LVUz8tD$PWbu(CPN;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$NŅtTM1ًU1 u3VSh$w wNHPUMpXN dN9tmu1 dNͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $H9'h@ $F9hc$eh $ejj聴=NЅNf@=ЅNfh $8he$eeU1hPVPVҜ1Bh) $8hc$'et21VWhVWVW莜1 tah $+7`Nh $du<tf@=ЅNtf @f=Ntjjxfh j5N5pN`T$1B@B+ -pNN  $N$Wt>E6+5pN=NkdPWVQhu $hԆ3葸NuF$h $vv 躑 NA1ڍF$h $cvv 6ǃ=NF$ ЅN&jP,1 NI F NQPQPhSt=NF$ Nt%QjPSh,"$h $>6#`NQjPSh,"$h $36=NthE$=N1F$N I1)щN$uh$b-vv *ǃ=NF$ ЅN$Wt jP+1҉GW1҉GW }hjD$\P蚗 =NЅND$tt7fD$T@jv$_+-fD$T@jv$A+fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=N$tD$\=ЅNtL$Lu$D$PD$PD$XPyN;,$/`N$W=؅Nv؅N5pN;4$]|$T{$AhjWz -N=ЅNtt0fD$T@js$B)&tPfD$T@js$()FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=N$|$TtD$\=ЅNtD$L$|$TtD$\D$PD$PW٧;4$=pN;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h $ss QPTh $(^t~s sqf@fNCKK CQPhA#ss oOCK =Nth $ss QPCKhA#QPss fN `N;<$=pNN4~^1ۋ/uu q]]8u9rۋ=pN/CK tS  StQP HKX9rjj轄`^_[]`Nj&ej#PhY $/L$D$@, +A,USWV $0 n8$=Nui=Nt`E=ЅNtȅtNE=ЅNt$;NNs&E=ЅNtjPo@E$F0N4 utEh%PC)$0 F=ЅNtȍL$A=NAAhh%Qx? N ЅNtD$D$L$L$D$h6$v v薉 E=ЅNtfM9v%}EPhP$.w$hB$4[4/E=ЅNf)=ЅNf=ЅNfEtf=ЅNt΋$0 AI 1 h$QP辈 h $Z$0 F=ЅNtȉE$B$PpZEL$fAWQU6 $)fEPUVx6 =ЅNtfD$fXWPUX6 $0 G0W4w wmfH$X`N$0 =Nt>}t8h$v v贇 h $Yu EB`NF0N411G9 v vGD$@=ЅNtȍL$A=NAAhhA#Q< ЅN N tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=ЅNt2f)=ЅNt%ffD$=ЅNffЅN )fD$1fM$0 A0Q4MT$ tjQkfHD$=ЅNtfPjU認 D$fEutEhA#P)l$L$Aq $0 JR ωtljh$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=Nh$ڃD$=ЅNt΋D$p@ =NX}$0 ~h$v vڄ Eh $VJ`NB$$0 1GPVtXD$T$ F0V4=Nh$DڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV32 D$fXSPU 2 E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQU1 $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh $ U4$F0V4=ЅNtȋ N9Ns5h$juv v݂h%$T4$=NE=ЅNtȃu}uE=ЅNtȃtb}u\FN U=ЅNtʋ4$h,$jRQPX=ЅNt}Eh $T1 ЅNEtjPgC$0 A4y0?$$0 t=NG$=NJR u=ЅNtPjVRQ菁h%$cSƋE=ЅNtjP1Ƀ=ЅNt fЅN1ہ@€@t f ЅNfG`N4$Crv $0 A4y0AI U=ЅNtʋ4$h $jRQP褀h%$xR`NzE=ЅNtjP)Ë@ C$0 A4y0AI $QPQPhRcE=ЅNl$\$tȋM=ЅNt1퍜$UQUPhScShg$$"Ph]$ %9-Nth$zl$\$ h%$zQƃl$\$$0 A4y0| AI KC=NtaEO9tU$0 AI U=ЅNth$jRQP%GEh $Pu $ `NfO4$E  ^_[]ËM PSh$"ȃ=ЅNtUSWVT NpN,=Nt>)"=NkdPWVQh$hԆ3ߤN}ww cO W $T$ WGO ƀÄ:1=Nt4=ȅNt+=Nt"uGO 1F9ƺw1 tbQPc8uS=NxJ1v6KNj@ $GD$wOG tQPb8u E;-N|E;-N=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$DNpt =ЅNt ɡN-ЅNL$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t NN1JQPFafppN9)T^_[]fUSWVT1ۍT$1B( PNx,@=Nt;PNp,kd1PVSQhE$hԆ3ԡNPN N<\$11ۃVU衛VUm`$t$l$ Npt<=ЅNtϋ NЅN1҉|$Ltt<8tϋ NЅN1҉|$PdtX 8Džtɋ$L$HQ$`9'xtCVU誓tV=NVUhm$^1=NL L tOjh$shNtuQ1y1 t6 u_VUYdtl=NtHVUh$蠝7jh$$PxyQ hNP2 jh$D$P CNL$;JWD$ P$~ E$L$|t$$J N`JуRҍ;F0vt$hK$$B=Nt$teVhw$\$D$O4$~?K`O &hc$D=Ny1ɋD$@Bȋ@4ư#sLV5XN& 5D$ XNNh 5PN5ԄN  5\N5ԄNQ=ЅNtԄNPP$b5ԄN.>؄NNtDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5ԄN؄NPNh$h*$ udPNǀh P5ԄN 5\N5ԄN,=ЅNtԄNPP>5ԄN؄NPN@ PNHHщ8<=Nth)$葝=Nuh $u_h 5PN5ԄN 5\N5ԄN&=ЅNtԄNPP75ԄN'؄NNPND@RL҉111C QPhd$[ PNHLщ@D=Nth)$讜=Nuh $h 5PN5ԄN 5\N5ԄN.%=ЅNtԄNPP665ԄN@؄NN*HHPLщ8<҉@D1ۉN N|NPN1Ƀ,=Nh$1L$ PNL9| 9Ph$PN=Nth)$H=Nuh*$Ih 5PN5ԄNp 5\N5ԄN#=ЅNtԄNPP45ԄN؄NN@h$L$>NPNǀ,04ǀ(<HHPLщ8<҉@Dh P5ԄN 5\N5ԄN"=ЅNtԄNPP45ԄN؄NN N|NG?PNL-=Nth$:h$7NPNǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5ԄNK 5\N5ԄN!=ЅNtԄNPP25ԄN؄NN=Nt}=pNuth 5PN5ԄN 5\N5ԄN2!=ЅNtԄNPP:2PNph5ԄN5N h܄N5N=PNVh LVjPI G011D$)9|ËLG8 $HLOd t1SRPV5N6t0|$u)h;$h $s1AL$=̅NtLSVV36 PNA8$HLId t1SRPV5NU=ЅNt SVV5 =PNG0ŋ $A9N NʃƃVh NVjP H jw,1Ny9 NNtN9؃stNÉxNNC |NUPƣpNUSlN VhO XNFPN $N=dN N1Ƹ1ҽhWV5@N5N|5,N=0N4N5@N=LBALtl=lNHhi$Xh $11IPPQQPV7@Nf@5@N+6 @NfADNFȃtvFjPh$ =Nth $m=NuhW$nt1F@Nf@5@N5 @NfADNFf=rmh$=Nth2$=Nuh$t0fF@Nf@5@N,5 @NfADNFffuzh$=Nth)$s=Nuh $tt=11IPPQQPV6@Nf@5@N4 @NfADN1Ff9D> <:  FdGdPPHH8<<8@DD@HH0440vhWV{ ^_Ë\1HuT~!TtC 8tVÁTTt*8 t"Tt5݁Tt+ 8t#TušhN= ȉ11Ɂ=hN ЅN؅NԅN̅N1Åt.Vփ=NtPh"RVh$^fVD$=ЅNtfs r.1=Nt&=ЅNtfPh?$R1F^WV|$ =Nt hR$4h $W+j Pt=N,=N=Nu u=NtWhz$Q1@ Wh#~Qh|3q (3H (3~$3H $30h$3) t (3I (3~$3P$3h$3_) (3 t 03 t^mNt"YAyt n+j O yWhq$PȅN1^_USWV 1HNLNPN$X0Sh lN N1N5 N5NNhh -@NDN50N5,NPVQ& D>/|)Ot$L$6TN2TN$!D$h8JTN$ D$tB?JL$h)PRQSWVD$t$ N95Nr==N PNjSPV)޹#394v t^_[PVh $CWV|$ wu$9'1XD$@uPw w Ph׬$*=Nth $oh$t ^_Ph$趽NUSWV$\TM@$ 5uh` h`VPQ =Nt h $n=̅N1ۃL뀃=ЅNt\,L$UPQZ DPPz$\, ЅNL$L$UPQ( |$u $PP@1LDffLD@9u=ЅNt8PP\ЅNL$UQP t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h> $(USWV\$t$=N!ߋ,t9Xt6@u|$t&j貿t1ɉH HHXh1^_[]he $VD$ L$5N#p9tыR9u @^USWVt$|$VW/PN!t7^Fu+11 33 1u{ Ntqt$0|$,\$(l$$T$XNt9PtjRQ XN(Xxp L$ \Nt9HtjQ5N \N(Xxp ^_[]WV PN1!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$<'$1Aȋ$sY9Ud:'<@:'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$:'4  <QhP!$h4!$脹D$P`wZL$ D$$:'1B(ɀ!1Rh\!$h4!$SD$H`wPD$T$ $ :'1C%   [Qhl!$h4!$衸SD$H`wND$T$ $0:'1C%  [Qhy!$h4!$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWEƅuWh]"j蟵$$<$4D$Phd@U4 tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;<%t$E1 1 Sh"U CPh "U7 C Ph"U% CPh"U CPh"U CK,C,Qh"U C0Ph,"U $@D$t P_k 1-Uhzd@$<W_ t1 VhedAWD hjU D$ P$4הD$, 9L$ L$9u0$S11:r8tx$0ht"\b$11҉ $ƅ*ŰP j PUX ^_[]$0h"j%USWV81ۍD$4ShPSu 1NtAljSPSWuW uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSÓ$1NHD$ D$(%=@= j/S;xr)ك$0PSQh!$hR/D$jPǻ\$$0PSb : Ou\$ |E tÉ\$D$D$ D$|$$D$ PSA1@$D$hh Sx ƅ%D$ PVPD$3D$ 3|$$  D$uH$0PSp5$8$P$TRPVA V D$4@D$1$Vh!$jS-VjS~ ƅxc1GD$ PhFVv  8u;V{ Wh!$jSZ-jjS]~ Gy D$t P<$t t$O1Ox V e^_[]D$(%= tn=@u$0Sh!$hP,SOƉ\$1@$D$:\$ D$ PS8B$D$jSs} }tS许tN$PhF|@V" x4D$t PU$$JhF V$USWVP1hUU= ƉRP)9-ЅNt1@fCM+PUUSF PN;A0u $ytWVC^_[]Ë\$-N5ЅNSUqRPX$@ `PNؔؐh P5ԄN賶 5\N5ԄN =ЅNtԄNPP5ԄN؄N[USWVt$(~OholЅNtUQuՉ 1=NL$$t| tWV?Ɖt$$H$áPN@05ЅNQPWVsUC cMhml=ЅNtUQܢՋt$( }PN@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=ЅNtȋ|$PN1ɉSh"$=NthQ$dYh$lt$" PNQP#T$1RQQD$P1AáPN;X0t$~~1Ƀ=NT$DT =ЅN|$t RPJL$ pL$QSRPǍP螫`N$|$1D$D$t1)ÉعF@jP D`r9w<$r$l$T1C @<$9uG<$;|$}PNX0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡPN@0)ȃ`T$1ۡ`Nـ#h"$b=Nth)$Vh $ ع`֋,$L$t1ɉȉD$ օt$ tH PNi0T$,RQUt$> PN;A0l$,} $L$l$l$,PN@0D$Mt$ |1TT1PD$T$ ʃ=ЅNt RP聛L$(ωQM D$H 9tet$C9\$t$$h#$ `N4$F4$;t$SD$`1`N0^_[]ËL$ ʋ PNf9u Sh"$褤D$`,t$$h"$ljN PNPhV"$CUSWVT$L$D$0(D$ X=ЅNtSU>ʼnӉ OD$$PN@09ʼn} t$t$5D$PSUt$< PN;A0 t$~QPSU&~t$4SUWt$T$LtL$A L$ Q5ЅNt9RPt$ƉT$ wt$1ӋT$1 t<$G RQTD11 u5\$$9t ;D$t`GPD$ GPWTt RP$<$G L$;L$t9ta щʼn$;D$t`1h#$辢^_[]USWV N$PNx0UWt$0t$0}Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR) `NT$4$1B srl$,$ ȈU1wX=ЅNt N!9GX=ЅNtȋL$,1Ph#$蚡 `NL$ $  h#$y=Nth)$Qh $t$D$OPWTP1GTGP^_[]`N1USWV|$,$t$N1@$PNsll$NtN L$  ƍD$1PQQVK9 PN;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh.#$џ=Nth;$$=Phc#$Et3s ss3st$Vn[E;,$u`N'%t#Ph"$0jUSWV0\$T|$HOX=ЅNt1D$,D$(D$$D$ D$D$PL$Qs tPst$OGЅN҉L$D$td$PQДÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ蒧C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h&$oC'h%$hH&$h h$$1Ph'&$fO4$V0Vh%$h%$h h%$h%$hWVt$ F,t@eNth&$BF,Pk1~,>d9~8uv0M^_h%$h&$h h$$uD$x,u@Pt Ph'%$h%$h h$$=WV΋I01t*N8~2IN8tPQP PĥN0G;~4vɃ~8u^_h%$h%$h, h$$h%$h%$h2 USWVEH1Bx,T$1hϔM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vSݤe^_[]h(%$h@%$hF h$$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hm&$h&$hK h$$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h(%$hS%$h` hi%$hS%$ha h$$UUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h(%$h%$hq hi%$h%$hs h$${USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hm&$hZ&$h~ h$$fUSWV\$$|$ l$t$eNt5NSWUh&$ USWV5N 1^_[]USWV\$$|$ l$t$eNt5NSWUh('$ USWV5N1^_[]V=NthX'$Œ2j5hNHtah'$腌h $+tShNxL~61 dN s"@Pt4h'$  dNhNF;pL|^5hNvjhNt'x,tPhNPhNáhNt x,tt$t$t$t$P1WVt$|$ VW=NdtX=ЅNts,PN`uau33 u1@1^_WV Nt1 dN PN1!`u/aʀs2hlpx1Ph'$ԊPh($h $gJh'$蹊PN ǀdƀah P5ԄNg 5\N5ԄN=ЅNtԄNPP5ԄNѰ؄NPN!1111QWRPjhhNhh,($h $艶lh'$ۉPN ǀdh P5ԄN萒 5\N5ԄN=ЅNtԄNPP5ԄN؄N PNdPs+aʀu Ph($Phf($h $蟵hN($PNǀdƀah P5ԄN詑 5\N5ԄN=ЅNtԄNPP 5ԄN؄N^_jDUSWV1L$ AL$HAL$@AL$<L$ M'L$A L'AL'AL']u }h($SV ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uh<'jBƉe^_[]Ãu95$3ujhL'D$Pi u1PPD$Pju95$3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQ誇RPt$8t$@t$8t$@WT4u2h>)$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Phfp#hVnD$@w ww7VPh)$S  1h*)$+h|)$W fUSWV1L$(AL$$t$@L$ D$ }] h*$WSƋ aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9$3u~]#D1غ$Phzd@Y tN|$$tOh<'jt$ t$@1Oe^_[]h<'j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SsjPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q U H @AQ@A$Q @QHALh0$Swh0$h0$USWVP\$|$tus$g" $"$jptQ1@PVSjPt$8t$8W E1u>4$hU3$W V=wSh3$W4$h63$W 1H^_[]UWV} uOʃU|RQPh1$VUJPR3ox& $T$W1ٹ|$5Uh91$ 5Uh"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhL'VC 1OujV5UqMuW?,VQ>~IhI1$Qp1$VQ7 t1Ph[1$Q= 1O^_SWVP|$1N?u\aj S5U 8u1u/|$.8u $5Uh"W ^_[WV|$1N?t5Uj1t^_h3$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5Uh у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5UlxL$T$$$jST$ RL$Qk tXS?$$ىډWT$$jD$ PST$R% t)t$h4$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,PjhL't$5@$ tjVt$@$ jQV$Ѓ $V I iTh j$U$  V tZs0wht1$V1t^_[]1;BB ,FjhL'PQ? 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0h1$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1Ph1$Q= 1HUSWVt$|$ t)l$\$$jWUS tWUSh1$1h1$VD*l$(\$$jWUS tWUSh2$V1H^_[]Ã|jWUS^11USWV\$1s3h%5U9 t^1WtA'茳tuWh82$t$ 1N|A'xA' Ch%j8 Džu^_[]WV|$ A'tA'WhT2$u^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQ趺L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZhq=$P%1D$Bhq=$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh=$u51fUSWVPM(,|$8O] D$1h=$uS> sujsWVVuutqD$9$31t$$uӽ1Ne^_[]ÉD$H@ D$ juVTjV;H A D$ $Y$jV  jV tuhJ>$u1D$3D$3L$ u41D$Bha>$u-hD/$h(>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhL'Vv tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$th>$S菿 0+T$x|$yRt$h>$udh>$D$t$th?$S511A $1A;L$0D$4D$,L$ |L$Vt$VjS@L$)΋T$׋jp jRQWVS 6 $p q k  yq @N F$FV0~4j\V϶FSܹ H @AQ@Q A$Pƃ׃q0y4QLAHS%?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu01ha?$h"?$SJhC?$SfUSWV0u1L$ L$AL$AD$] }D$h?$VSI8 a~bt1iugD$ PW*u5D$PWD$PWut3NT$T${lhp\&Q1D$|$|HW_t;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9$3uD$L$ t!T$ T$thtI'je^_[]t$t$ QPt$WߐUSWV}u 1ۍD$D$XND$h?$WV6 V~Hw'$I'؃AtH`Łˠ뽃W hNuyh J'j4돍D$Puqx pD$PuWJ?71L$ L$ {=NhJB# Ht#L$<1QWh WWj WP} L$<99t33=u1H$Qhht@Pu u$Nu@L$w J'Ns t95$3juVuu hA$D$|$|But3L$L$T$xupt83|$H1 @uًt$uWt9wWuVhA$ue 1Hh J'j(e^_[]V  @$h9q% P֪ h-$  @$P轪 h,B$D$ @$tD$ @$u |$  L$ L$ك@L$0فL$(|$w7Pt$VCw wE V+3H 3;3h|3j 貯|3H |3 3H 3|$;3h|3j r|3H |3 GtOPh@$蚩O1w7w & 3H 3|3H |3 hO#LD$O1w7w IƋWMhD$@Pt$0w t t$D$PPw 0T$уL$, N1҉L$$9L$,h|3j Tt$<|$ Wh׬$PV|$Whfp#P$WWVzuhhM&V9 Vhdp#|$Wh$@$+D$xu2hNhfp#h$VVhdp#Wh3@$3$Vhdp#Wh3@$ԧD$Phfp#hVIVdp#VWhD@$褧VWhS@$蕧 D$4E$ȋ|$gw t$0j dp#QRPjt$LVy xVhY$GE$gw |$4dp#dp#t$t.%VRPQh_@$ Mt+WhD$@PSw M tPhg@$Ц3H 3t$~|3H |3 h|3j H|$G8jm$CQj$PJ$?Pdp#PVhm@$`dp#PVh}@$L G0O4 tQPh$P:Ph'B$|$t$ ދD$$ʍ RAt$Qhdp#Ph@$3H 3~|3H |3 h|3j ]GHt$sG 8-uXG $1҉QQ$$Phfp#hD$HPD$r> E+u(ljށD$D$Mj@$PVw tP{L$9wȉD$WMj@$PVw tPw{L$9wȉD$u|$D$ ?L$>G CVhA$ģE$A$PSw71P E$J5$PSw w1P \$ v vh@$+ tvh@$~$Ffp#$PQUWq WhI@$ӞVh׬$USQ Vfp#PUW@ Wh8@$袞WSwtSh)@$膞Vh@$hS WSwtSh@$VF0N4 t%$QPhRDPh@$%Phr@$Vv3h@$N1v6v w 3H 3~|3H |3 h|3j RFw*F 8Phfp#hV VhI@$m^_[]USWVw!Ӌ$ $$I'hA$QhA$$n $h A$$1 Gth A$ݜhSA$Μ$G oω13$ @uh]A$荜hA$h(A$t8t$W:h7A$hEA$Hh~A$3tff8t_r8$jmUj$WѢh+$ŀ/"htA$˛l$Wh@$tA$tdp#PQhup%z ,$$h}+$\,$ $1$A AAt$Qhfp#hVVhA$GWhfp#hUvUhA$ؚƍD$9t$9t U10^_[]ÉŅu1USWVDt$XL$ $ΉT$ʉT$ ы\$\ك D$VD$dL$`DD$Ւ"tD$A$HD$D$t$|$ j@u%$jhWV}a$A$tډ 4$ut$tƋ$SVt$j D$4P8Ɖ|$,$D$`l$|$9\$\)ǍD$$PW腦$A$>|$tD> 1@D$,$t$|$@u  jhWVkƉE ك@T$dt$`wQj hdp#|$Wt$PV x'D$`D$t$ \$\,$A$t$ tnՒ"tA$Vt$ P|$pWl$pU l$9~?r1D$@$t@$Vt$ L$( P,D$D$D^_[]WVtfy8tH8|$jmWj$QÞh@$jDƉjWP t VjC$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj hdp#UPjS] yD$4$T$dWRVhA$;tSh$j P^_[]fUSWVDt$`l$\\$XT$1 M'A L'AL'AL'B0B$` hB$VU k)Hw]r$uStJPSTu7HsutPD$PSH uh,J'jXD^_[]1Hu߅tjhL'D$P2 t9-$3uPh+0D$PS觷벃luhp\&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhB$SW a~bt)iuRt7D$PV""uUt$D$PV螺tD$PV蟳uh@J'j<e^_[]Ãluhp\&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=$3d1t$t$PPt$VqUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H NH N@N NhN1 NFNFNFNF^Vt$|$uD$ hN0NFDNF@NF<NF8^fUSWV$$$E#h"WV( ou-U95$3螅 1O$QhF$D$Pu0 $~ƋFHt$ $M'4 ^ hShm&PD$T8 xþ1${ WhB$P/ Ph"V{3 CPhF$V`3 CPhF$VE3 uCPhF$V*3 ZCPh\&V3 ?CPhG$V2 $CPhG$V2  CPhG$V2 CPh)G$V2 C Ph7G$V2 C PhFG$Vm2 CPhSG$VR2 <$u, $lVt$9 WGU $ɿt$ D$tQhF$P_) D$Ph}+$t$A) rp~ whqG$P1 fG8Phfp#h\$SfShzG$V4 4GPZPh")$V/ VhF$* $j D$$$Fo~ 1C: OƉShB$V- )Whfp#hD$PD$Ph\&V3 Whfp#hD$PaD$PhzG$V~3 wwh9q%V2 wwh1$V2 w$w h#Vz2 l(jm$Pj$W$t$Ph$V2 ,Vt$ C$$L$ AA H94$hG$t$ & t$hF$t$& t$ v8t$Ў t$ hE#U`h@$UfPV|3tkSA^`h8M'j<V haG$$@1ORt$Z 1O4$L 6h|3VV?1*Uh*$$衔 Vt$ ^_[]ÅtV hF$h6H$h hF$hG$hhG$hG$hhhF$ffUSWV]} E#D$D$ hG$SWX iu5UtFumD$ D$9=$3uUj]$,([ǃD$T$ЃD$,jS腺t%D$t6hG$hLM'j葞jSQ D$ tjS9tD$t h+;$w@hE#VC^G$tQo "hF$P观 )j$P~f hF$Vx hqG$D$ P^ jhPf D$0Ph")$t$(& D$0$L$ 11t$ L$ D$PhzG$t$. bD$\Pt$ tpt$hXH$SF 1O1PlVZ 0hG$hH$SV4 h=H$St$ ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhFG$S-! $PhSG$S ! t$( Åt$( $fǀU1PPPEG!ƒ[u$t$* ;$4t$8r D$t$Z fËt$01 |$lD$Ph\&S ( D$lPt$SD$PhzG$S' D$|Pt$$Ph9q%S1 `$Ph1$S B$Ph#S $D$Ph$SJ' tj$$Pt$ 菄 D$DPhB$S] D$D9M$ $ȃhL$pQP7 t$ Åt$ U$61QQPE!ƒ~t$ M$$VP5 9U]$|$$D$jRPE!ƒ=M$$VP 9E$1SP|$W _ GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uohL$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ 3$ E0t!t+M4S9rQSP $ 0t,hM$ MHtU4uL9rRQP# t$|$t%u@uhV2 tIYP81tSul|$tDEM9rQWP# u@u`Vo2 u@yu@u`VY2 teEptUt$8ЃtEu8uXV/2 t, ^_[]hL$hK$AhL$hI$5hL$hL$)u\u\h.M$udShL$j wlh׬$j fUSWVt$b 1tvt$wd t[S蘤 tCPn Vt$f tPUWg uW> S蕤 1S舤 Wb ^_[]USWVu]PhL$S t$f1j?1Nt}ǍD$ Ph"$S td\$ t\hjD$PJ jS\$S9 ShiW0 t$E L$Uf jQhL$P je^_[]PPh"$t$2 u1$YVPt$ t$t$V tPh"$V u1$^USWVt$t$d t Nj\$ P 9vM? xM1N*Ƌl$W VPU  )SjUI ^_[]USWVt$t$c t?Nj\$ P~ 9s9Ƌl$W~ VPUZ  )SjU*I L L?1N^_[]UPh&&u t$L1H]USWV@uPh5M$VO ] hM$Vb tP} |$ P\$$ShiV\@ |$ jS/| PhM$u d V! ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP{ t!PhM$SQd VƜ 1He^_[]hr%hM$hh>M$DWV|$$hM$Wa t;P| u1V| jPV VhiWQ? t^_hM$hM$jVh>M$xDhM$j< V8Nh$3V V @NhbV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhM$hV}>tVh+N$bVQ:FߋD$t$j7QPhM$hV8>tVh@N$bV :F߁^UVuPhHU$V t3$L$ AQhiV= u hOU$1e^]hr%hCU$hhO$BUVuPhU$V- t3$L$ AQhiVe= u hU$1e^]hr%hU$hhO$zBUWV}W#ƉPh~$W tZt4$P<tW@PVx tGPhU$u ;a t>V1e^_]hr%hU$hhO$AhT$hU$hU$ hU$hU$j h.U$t$^ tPhU$t$` HhC&h U$hhO$pAWVPt$|$D$PVW tKD$tUhL$W/^ tPhL$V\` H^_hC&hU$hhO$AhU$hL$j hL$j SWV$hQ$S] t]Px GAsdWt^WPhQ$StNpxPhiS3; u?V*1F1HĐ^_[hV$hV$h1V$j hnQ$j USWV 1CCj7Shxi P( uhT$?,$PuhT$#Ɖl$D$Shxi W( u hT$j| $L$9~D$~*1t j ]Sh׬$^G;|$|j ]VjUUSWVHdZ'D$@`Z'D$<\Z'D$85ДNu#D$1D$11D$=ԔND$(Pj 7u hS$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=ԔNu11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$P u h}\$j t$ D$D$t$$1|$\$F =)3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ u Wh{Q$j^ PND$L$AËD$L$AËD$L$AËD$L$AËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$H@)3 )31SV\$ Sh)3 uCЃ r"CrCr >01H^[h)3.H?r = ؈)31ыL$t N1ÍAЃ r)Aw AwÉ=1HUSWV1t$ D$hVP9 )3xNt8u^NǁNNNNNNNNNNNNN@wh)3R&uhS$0h)39&uh T$ht)3 &u h8T$j $5)3tvh$3%61ƔNǔNȔN(3tt)3$h)3$U5 ƃV B~>CNȔNF v/FwD$ Q'͔NAu"h]O$a$P'ɔNxu>Wu4D$P1VhVVj V5UU ԔN9t$:*ƀNl `C Lvms)3(3u$&3˔N̔NrʔNϔND$P1VhVVj V5U ДN9t$taYƔN>ǔNOΔNCatTl5$&3+wtz(39t)3 &3$ÿ%3؉$(3$3 ̔N$u =ϔNuB=N=ǔN=ƔNu|t =ϔNu =Nuftu^ϔNuS$ttH)ŋ$L$ T$ RQL$QWPU%u K u&h2"hnO$,5Uh4%jR t$PD$P & u hO$D$t,DtVPyDžuh2"hO$JW WtS)uh2"hK$Wuh2"hI$)3t H9t@h2"hO$$@ t%VWЃ$Wj!HhP$h2"h*hO$1USWV6I uhHV$hnO$jC Ƹ)3jmPDdp#dp#tV$jL)3P!tV$USWhNV$hԆ3S)3t VSm#V$udp#WWWWWQWhW$hԆ3R$V脈 j:GV )31tT$q9t Iu^WVΉhjWK3 D$PheU$Vx tZh%%VVM tQPyh L$PyRPQ  WhiV* u hpU$Ĕ^_hC&h]U$hhO$/WV hzR$QL t;Pg  u1Wg j PW  Whui V^* t ^_h^T$hQT$hihO$/hT$jF h*Q$茀1ÃD$ 1ɉJJJ JJ BRhiP) t1haQ$j $1ɉJJRhiP) u 1ĐhnQ$j Qh)3USWV΅t RH F F 0($D$P膈!\$D$1t$$tsV&sD$tVP&Vh"$W trC=ɔND$uCt\=ʔNuCuM=ΔNuCt>=͔NuLhj$V0 VhiWn( t!$uۋt$$4u=̔Nt ~ j Kh|3syWt& )3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhQ$h$VVUhBR$K jl$U$V Vhit$Y t$,$t!Ph`R$KVhOR$,$jt$V Vh~it$ t$tPhkR$VKj lJꍄ$P$$ j:QPhR$h$Pi$t'$UhS$JU1"E}uj:$$hR$h$P$t'$UhS$JU!E}u-)34$tVWUmuj|$W$VX $$ DŽ$@Vhit$V u$ h&S$I1@Pl$U%jWl$0U 1@D$81D$ƉPV5ܔNt ǣؔNV}1u ܔN$h(#Z1H^_hT%hNZ$hhvY$WVPt$T$hX$VX: tbPyU V>U PWtIƉPV5ܔṈ ǣNV1u! ܔN$h(#z#1H^_USWVt$T$1h]Z$V9 thƋ-ܔNPT VT PWSt6ƉPWKt>V4 ݉-ܔN11H^_[]hT%hZZ$h2hvY$Ehd-$fSWV|$ t"1H>t$|$\$j7] PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V3R tE$$PwCt/$F ~G F1! ! 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r A!8"t$8t/!1H^_[];sC| C 9s} !"WV t/t$ L$Ps(,tD$$F ^C F1  USWVuD$ tV} ]CtP76 tEC tP76 u/D$ Ph&&72 u$D$1$: 1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$h%W>D$w&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$scD$4D$4D$ PD$8Pt$ t$ _ÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WPö t9t1ۉD$=r"11HD$$P|$1OL$L$D$L$T$PQRhZ$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P~NjD$fVSP sD$ t P4$WL W<4$uM S]s {te|$t^t$Vt$t_@PW6L WDtNVsE04 ߉Vum ۉt3EF ^C F1Vt$hZ$hZ$hZ$hU$ hZ$hU$j WVt$tV r|1H^_VJ t3t$L$|$ Pwt΋D$F ~G F1+ USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t Pj 1GG GG1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7y/ t+{0t>-uUs t>Vs t)u 1H^_[]Ís s(CtP7/ uCtP7. t1@뿋C$1$\'4v6+ !6B PR  v6 tMtk $t$ 4$UQ$t^hb$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhz`$ja 1Hx^_[]hb$ha$j WV0t$<|$jWh]$V萴t8W. t7HfJBRhiV t!10^_hia$hVa$Whta$j蓛 h]$j跛 SWV Nh+3VS(Nh+3W@VgW^0NhlV38Nh°W@NhðSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!h{b$$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=ǔNt PnfD$(WhiU t$b$f|$*ub$=ǔNt P/|$fG WhiU t2D$*=) Phb$=ǔNt hb$fD$(IWhiU> t2D$*=) Phb$=ǔNt hb$1Shi8U |$Dhb$W1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh b$ uVhb$11t j,DLxPtT h b$v<u h $pj $PhiU tDhb$>$t$hb$  hT#j 'PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR Phb$$=tPhc$j $=tPhb$Y^_[]PhQb$j螖 hԆ3jhh c$ÃD$1ɉJJ JJ fBRhiPm t1h]$jn 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hz`$j USWV,$@$PhiV tr$A jjj"Ɵ xgljj2 xi$-hSWc xB$/uE$0uf$Ciu.h]$#1H h^$h"^$Wid 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$h%h^$h^$h>`$h]$h^$QL$4QhW^$(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q HNt HNEINtIAtcAtCAtPA tSA@tBAyAAT$hHNUWt$PVt$D$VPRRh^${,l$ }"E!Ê<)\<$^'=ǔN`Cs|$[VPWl$Ph^$h_$#<*<0<2=ǔN<$^$<t^$sQh׬$B#1L;dp#y_$QRPh:#G%9u<]K%C=Ph^$h׬$@=ǔNS<$CPh'_$KPh,_$K s k t?L$D$F3_$PWhox% N%܋L$D$(Mu} L$D$D$F8_$PtPtPuv_$I_$ i_$"QPhox%? N%D$ŋL$D$(ȉ</=ǔN%<C<$4^' `$=ǔNCPh^$=ǔNCKSRQPh^$h _$C~@sFNuQPh _$] IRQPh_$EMuj>U l$ L=ǔN?CPh^$ (sh^$h׬$ =ǔN<$CPh'_$ KPh,_$ Ck tAt$D$x3_$\PVhox%  O%܋D$t$)E}twt$D$p8_$ttuv_$I_$ i_$"QPhox%  N%D$<t$)ƃl$ rPh=_$ j> <$€_$$ ^'_$rQ=PuJC<u;h^$h׬$f =ǔNyCKQPh_$B  ]=ǔNPȹ^$6<"<o`$_$ `$`$!`$)`$1`$9`$C`$H`$Q`$Z`$a`$h^$h׬$} =ǔN<$CPh_$[ 1D3 dp#t_$T3 ׃l3 URWPQa'h_$ uj>' l$ {^_[]ø wb'ø"øSwb'ø"VPt$ D$Ph`$Vs tD$P^hr%h`$hh`$VPt$ D$Phb$V& tD$P^hr%h`$hh`$?WVt$(|$WhiV tgD$Pha$V辥 t7D$D$WhiV 1uha$\1H^_hr%h a$hh`$h`$j{ fUSWV8, y hc$hz%Am y hc$jhd$q t\襈L$jQP6 D$tPhe$蘅jhd$  D-31 VPh  VPUSWQRPh`$1EVRQUh#BVWh.. 1H\$(C CCVWPPUPP P P PPPPS8VSjS |$www wwVWjg VWj[ VU SU WU D$ @ )T$VVQRWP蔱1I9u 8tމ5hN D-3tщ1@8^_[]hf$׃j }jj he$' u8e$jV3 te$jhs$he$Vhq"h%j !j USWV`~ZD$=hNtIt@ƍD$H@ L$1jQRRjP薰ut$Vh[e$< 1t$HFFF FF1G>\$SVj l$ UVW 蒅ƅZD-31OjUj3 t:9uB$=hd$jV S  O8uh D-39tttn1VSj+ VD$$Pj D-3vhd$@jjj3 1VSj VU6hd$1=D-3u$=|$ u'1VSj VWj `^_[]Ét҃t̓ u1Ht$8F FFVP Phe$u1c$WVי td$D$8x xx8WPVhP q"{jhd$h&#i %SWJ Whid$jEVySWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[álNH lNt$Vt$VzPhc$ijfDVD-3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPj2 XWV1N=hNtED$@ L$1҉RRQWjPt4$ h6e$^_VQQ jhb'O jVO tPqt^Vhe$>jVhe$)jPD$L$ $QPjP !XPD$L$ $QPj1 jBXÐUSWV$$D$D$D$,1H$11D$hf$WSZ f~/P w`1A$b'5U D$u[FtR=5UD$,D$낃gU8#u(@j L$ QP~ $D$8LUP |@$)U8#u)@j L$ QPI~ D$D$8UL$QP j D$ P5U~ D$D$8c1Fj D$ P5U} $D$85Uh9f$8$3<=pNu-tN~q5pN1ۋtVP_uJVh׬$-FtPhg$FtPhh$j -tNC 9|?,u)É\$(k <D$j| D$Po Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0.1ɉQD$ P4 D4D$8u 8tz`Xt$7pNu pN-tNCPVt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP| j萎 |$tt$ VUWz  UWL 8C|$$8D$@PW?]tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUW #|$$tS9u$UWDL RWN $D$utSPWM uWhf$x1ļ^_[]Ë 3DQu UwF N" UxF0N=NucNgu\5$3)uOht|$0Wrb t$,tWD$(0t$(^_[]h5"j&R Bhm$jQ SWVP׉Ήj SQP 9u ~^_[WVhn$jQ h p$ho$ho$ho$hSo$Ph9o$hԆ3 jGfWVt$|$ VW t$?/tWh*"VhC"^_Wh"j[Q fD$Htu L$fHQhp$jQ SWVP\$$CxP4 CjjpZ 1Ox\ƉC@HtuMKfHjPjjV胗ppV ujt$ t$ VZlj^_[Qhp$jPP WVt$F1GyiD$ PWQZ 9ujt$ t$ v~ 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAAؖNBؖNʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RShPQh`Wt5v%NɅuNɅt(QhKp$h;p$ H1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w2k0|PhTp$h5# IH1HD$pȁ^USWVt$\$l$ |$$WUSVt$$1N|I; ؖNu=OɃu3_˅t( γ8dz0Shp$h`p$uƉ^_[]VD$L$ T$r؉1Jf^USWV D$jKlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$D8j>K|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3jJ)9}hW݃D$,|%L$,9QPhp$hp$C<1H ^_[]fUSWVd$xj[Vh0Nr\ j@Vg}t4$Fj:V@A $$|1D$hhhhh hh(K H|$WPhϟ$V1tP脤PVhp$E #CD$D$ @4$D$ UhD$PX D$,$Uj$lSL V#9rȉ$`WVSB jD$PW$lPjt$hD$(P t.2,$AuU=NuLD$D$ 1@D$p $t)ɋ,$t;|$ hp$1N$N,$ ND$ @tL$L$fQP$|BD0ND$ HJ@BBNuNȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5U5$3\$ \$(`&\$$} ]D$,D$D$D$D$ D$hp$WSQ H$p'P5U|U 3$L$T$,JjuhTp'5U?P?뇉=Ujh&q$W螟 t5jh+q$W芟 tZPWT $T$D$0PW%D$0t 8D$ D$(JD$0PW$D$0t 8D$ vD$$c5`&$T$$MA QD$5UD$o5UD$1@D$Q5UtD$ 1@D$35$3)h4uuW }WtD$0PW(|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5Uh q$h5" 5Uh0q$jF Wh r$PWhq$Whr$ PWh_r$jhF WhJq$˪Phr$hԆ3 jSWV$t$$$$\$VPWS$H$HTj S7Vhq"MZ D$@t$hgq$xt$t$htq$c t$ t$ hq$N t$Gt0hq$/jt$hq$ t$=Bt0hq$jt$ hq$ t$ hq$1$^_[Vh[q$jIE WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRh9r$'uUD$ L$$L$D$l$&\$ D$L$ |$D$ fD$l$|$l$D$T$]hFr$jD WVPt$jWVC 9u9t x^_Vt$he"j%D Vt$Vk@t@^h#V^Vt$VgEt@^h'%V|^WVPt$jWVB 9t9u x^_Vhw"jC WVt$|$ VW? t$?/tWh*"VhC" ^_Wh"jC fWV1t$|$ ɉ @4u99ȉXȉX\ȉ\ȉ888 PQ40m840<8M8<8D@-8D@LH 8LHTP7TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40S740<837<8D@7D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w76Vw w6V Fwwr6VFww^6VF^_USWV\$l$EffEffCEffCEffCu u 6S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuA5SCuu-5SCu$u 5S$C EDȉCDu,u(4S,C(E@ȉC@u4u04S4C0EHȉCHuhs$g=ėN<$=Uh0%Wu̗NG=U1L#PPjPPgd/31@D$ U1"PPjPP4NpU1Sy$PPhPhЗNP<U1t$PPhPj ܗN =U=Nj:WeEj/We2?}NU1Ht$,u$Vt$S1KS\$W|$P< NNr3DH,W.D$h"$WwhX&WaNW NN1xz$PPhPj l/3,N 3DHWD$<$Nhrt$$3=d/3_=NtVht${5Uhdt$k5Uhs$[ht$Qh5"j2 WhNt$:WhH|$/D$=Nu1=N@N$1󫍄$BNA+L$Nt1ۃ$ 1D$9|Pt$t$t )̓}4$At$ \$ NNɋ|$ N=N N5Nσ|,@σ|1ҿ9  ЗN9|щ Nt$ |$7ƍD$0jP .hNhu$N=NtNNt&hQhv$ NNt=|hPh2w$ʷ =Nu1=N1@N=ؗNu NؗN=h/3,=Nt#jhw$hw$hvw$gN=ԗNu=d/3NԗNt$t$ t$0SWt$t 9t W t S =NO$PD$tE+tƃh*s$Uj 5Phw$jd$ P7= j8 j. j$ hb%A N$ЗNNApQtN@jxQP$Ph*s$> yV0?Vhw$jd$ P蚧$\ $|$8j4U$P轮 $PSԁu/jZ$P$dP u$<mfsjWV 9uD$8(%PWP$Phw$!hv$|$t$/dev3N N/ ѹNtNL$4~t$0 @$jWh"1 u ƃrt$Wt$8V΀\GWV軀It$ Ɖ\$0Ë$H$|$Nt$ L$u DN$dT$dž,<tx(=Ndž dž,dž(Ɔ l/3p/3u(jh|$脡=ėN-5Nu"jh|$X=ėN,5N NN0NF4Qt$Qh}$=ėNw,5NF4Ht$PhF}$=ėNS,5NF4 ЗN9}"QPhr}$Š =ėN+,5NF0=)hPh}$蕠 =ėN+5NF0=|)hPh}$e =ėN+5NF0N49}QPh}$9 =ėN+NN;N|QUUUU)ʹ3333!!сis{09\~\{0\\5NsXș9}%CX=N~Qh1~$腟NsX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hI~$蚞=ėN**N{4$=ЗN11F9tA uPh$j $Kd=N5N u։<8=d/3[ WVh~$ =ėN)N<$C4$8=ЗN`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPrNjs8ƒPVRW*)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh~$詛=ėN'ܗNtm NyxH1҉$q1ҋ8$$)$<$$1C$I8$ ؗN=N_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$Wp1C1 t׉Ë$$QPV$$V9s($$$VSpÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ $9wȃr$9‹$֋$r‰$$$$$B1WRQPmË$Ë$ʃQPRS͛)ÍC4$$W$$P$Q?@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ&lj$P$$.@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh~$ =ėN NB$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d/3$_|HL!ʉG41SSjhjPSNN NI4QSPuv NH N N NP44Q5Nщ N`@#HL 9| Hh h/3H< NHX ԗNH\ NPTXH fǀ$蜷%=NO4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d/35O _(HLJ$N$$$t!LJ^F=N$$߬$$ڌ$d&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$$襏 N$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$B$B=NO0 9| IУNN=Nu\Tu))УN1VVjhjPV NuN9NN5NjP)r =ȗNGN N1ظ|(RQh|$r =ėNN N5 N5ЗN~ ș)dہ|4$t'GuȹC=NtL1$PP$$5NV1=ЗNVhZN ЗN1u;1$VhjVu&  = N5Nh`VWG =NtWV35Nx\ NhhPzp 1@$=Nhր$趾=N|o5NN,I\Tt~!NȃN׊Nd1 t1WPhA$RR$39u1H$Whht@PU PPftu!ѡNt $ Q$=ȗNu$|&NH,$$DŽ$%$ NI,$1$ DŽ$1h|3yDN$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h $"=ėNY Nj5Nm 5NFU $F +$^N$~J`^p=d/3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=NuFh$ NlK`ڍOȃ$ډFd;v&h$_=ėNN5NF $11ہ~U uv`щSAN$~!ـ1@ NIl N5NF=d/3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5NN uҋNB8H!tk)D4NB8)Nj5N$9sE)ȉـ1B~U uv`5NF$CHu͋NB8$؋N9ȉ$J`~U uv`щSN$~!ـ1@ NIl N5NF=d/3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45N;Vs2р1@~U uv`5NF$BɋN$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$ NH NV$P V PV~x; Nup=NtNs4PP NN@NKd15Ns4N N Nq4jP8f N5N{0 9 NPVQ"= =Nt N5NP5N Ny0 N$ryxtG$\訧%TuCl$AP$ NOu$ց\TtQ!QЃyId t15 N5N3 5N\TG~8^xN`1?9'N+$~0lj$Ɖ$)ى$= N$蕦%Gl NN9wߋ$9w$N$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=N} $H$$$~A=ȗN2$=|j.~扄$dp#t\% Nׁ\TtQ!QЃYId t1RP$Vh$=$$;$$|W=N9NH,t =ȗN $$ DŽ$j }DŽ$CN;X,/$~ j }=ȗN $hjPa d/3 N+ɋMt@U@f$$hM$lCɋuM@EfDŽ$Adv$h7$ld/3fDŽ$13tt/3$_ lj$DŽ$NH4$ $ H5ND@VL!! $`Nd8u+7fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t/3@ lj$DŽ$ NH4$ $l$h  5ND@~L!! $߉$Nd t1$Sv4$j2N@0p9w Au1H$$DŽ$1$$tsh5ǡNN@05NV$SQP$h$l Nɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=NCX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$Pf] N\T$$i$$ $$$$DŽ$H0$$_$ N@$D$@L!! $`oq$h2$l$  NId$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h N@$D$ @L!! $$Op$1$$h$lNHd t1$S6j$$V N$ȔȐG$11F$t =N$$=N40=d/30w4w+_1 N$`SWPZ1 $PjS!Z =Nt$W蔴=̗Nt Nǀ\8 N= Nx\hhPY ЗNQPZLWV=NtN Nq4PP 5NHLNd t15Nv4t5N95 NvG=NtNp4VV谸 5NN@N=NOd1Vw45N5 NN@4P5Ne^_[]ÿWjVX 1=ЗNVW\hA#tBh$ʦj&lj% lj(lNj kjkj'kjkh$Lh$Bjkjkjkjkjkjkjkjkjkjkj {kUSWV=ȗNua΋\$=NtЗNNSt$PV 4׋ ЗNUPSt$$5N 9u^_[][0,#PWVhv$sj$jUSWV"=ȗN΅ $NuNH4H N $N =ЗN;NNN;}FWh 4t'1I!;HtG#P;Pt;H uV9R_1ڍ_5 NP=ЗNWh De^_[]USWV΋L$l$=Nt=ȗNteUjQUp׋ ЗNSPUt$$5N 9t?`Y0y!PWVhP$ rj"/iЗNNUPQ) ^_[]SI`wD$$s'1C:Qh$hԆ3Nt .  [SWV1ۃ=N։ SjQT =d/3@fF F)f ^_[USWV Ӊϋ5NF Nd t15NG=NtN5NPP NyU +y/\$|$y1U =N1=U L$D$uq`|$ G`Ӊ $u щw*l$$t'р4l$skPh$hԆ3r =NND$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ ho$h$411҉ ^_[]ÉՁ|$U u L$I` L$w$t'ʉـ1@BPh$hԆ3q 8ʍ 6ʍ   1$5N$~3%)1@ NIl 5NNK=NOd$sC=d/3CNdЋT$ t1҉t$VQPR0D{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPR rL$|$ щT$ՉD$ȋL$D$VW|$RPqыt$ʋL$Vt$QRP*C$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45N;F8|$}X1Bσ) NyU uI`1@5N;F8|$|=NtNVPPV 5NF Nd t15NUSWV$΋=NG Od t15N=NtN5NPP軮 NxU t)h$:=ėN(NxU ‹l$(H $t@\$=NtN5NPP9 =NG Od t15NwNNHC, $9r%UQh&$j =ėNVN $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5 NWN\Tud Njpxt$0t$ 0$<=NWVV1L(ɉL(@ u1LXɉLX@ul$ Njpxt$0t$ 0$,;=NtrUV軪1tttp0TtDpC u1 Cu) % $D l$hVU" % $D9Pl$NT$5 Np0^_[]jK_j D_WV։σ=d/3ȃ@PQR" =Nt'ȉGffF=d/3u GffF^_fUSWV$8tW ƅuWh]"j $$<$4D$Phd@Ux tj1OLVhedAU0 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;<%t$d 1 Sh"U CPh "U{ C Ph"Ui CPh"UW CPh"UE CK,C,Qh"U- C0Ph,"U $@D$t P裞 1-Uhzd@$<W/ t1 VhedAW/ hjU_I D$ P$4D$, 9L$CL$9u0$S11:L8tx$0ht"b$11҉ $ƅ*ŰPHj PU ^_[]$0h"ji USWV81ۍD$4ShPSu1NtAljSPSWuW> uMU D$t$$$Q1e^_[]fWVt$|$ VW[A t$?/tWh*"4qVhC"&q^_Wh"j fUSWV|$$\$(SWt$(t$(+)jj`SWA~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVF 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$PU2a st$hlv$8 _ƍD$ jP] uhPNhu$t$/dev3PN TN/ ѹUNtPNL$$t$ @$jWh"2 u ƅrt$(Wt$(Vp3GPV[3|$t$( Ɖl$ ŋ$HD$D$t$ $xL$,QPjVhPNuhPNht'=9|Pt$t$< )σ}4$^ ,N-(NuU-,NuY5LN=HN|$j W\$ S` Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ y=8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"j WVq;Ԇ3PhD$V0X 1GVWjhd" Vhu'>WLUSWVu} D$8jPS=PN5TN5,N%UUUU)3333!!щ%i(NB9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣDN5\NXN33t$ƺQ=tND$xND$ N`ND$xN|N1 N5ND$8NNNSNNNN5NNNN[NIfNo fNN 33fN\$H$SW 93rWhNZ 50N|$t"V(YjVhШN 1NXN$N NND$N \N+ lN 1҃r1I15xN~σRVPW5\NH19w+5xN|$OL$)9r΅u Nf5&N5,N5xNVKNYVjP3 GD$AD$ 11L$\$xNlNtnNtHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& xN@Nt &N xN@ N1HNL2 ND1\$;|$txN)áNf\0 ND1 Nu\$fT1 NT1fD1L$ G;|$tD$ N|$11t$dNhN=4N~i ,N i{5(NQ5LN5HNPRuh7$N xN ,N5NPQWht$gNxN@\NN1QQjhjPQNI 5NjP1 =8NukLN HN1! V5h$m=4N|(L$ xN lN1PQhA$PPLD$$39u1H|$LWhht@P PPftu!ыt$4NtL$QT$=8NuL$L$D$ 1D$L$ 11T$h|3=Nt$tXNtOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5NxN1lN 5ND$ hhXNP 5\NtNP5NVt$ =xN=lN pN151A xVWhOh^$\3 hW$荥hԆ3@P1B 0PP@PpPPtPPxPPP P uCءxP@PtP+ PP$$߬$xP+PD$`D$`5|&D$Dw\$8O$fDŽ$jhLPjn D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$P\o SD$lD$lPD$,Pj5O5O5On <hpPjV OD$8<BC97)؉D$D$8 T$x'\$A9PI؉L$A PIff9uPxPPtPPpPPP PuxPPtPPpPPPO 1D$18 8l1A h4$dhԆ3AO<1A t$, PVhX$ ΍T$(jt$>Ph<$D$ Ot$؉T$΍T$(jt$F$ y'hӍ$΍T$(jt$Jh$ ΍T$(jt$bF$x'h$΍T$(jt$$Fft$NfQPh&$~ ΍T$(jt$؉t$hA$΍T$(jt$^؉t$hY$v΍T$(jt$z0FT_hr$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h$΍T$(jt$؉t$h$΍T$(jt$d؉t$h$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h$)΍T$(jt$-؉t$h)$h$Ph$wL$lL$AQ D$iPh$@h$ h$h؏$#NhDPh$ t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظy$L$dT$C;ԸPu#PhظPQD$Xy|L$$ D$LԸPPQhظP T$Ҹy$u1Gz$T$P L$r |$ rI3H 3~|3H |3 h|3j n(  }T$A{^N2D$ˀ) h$QuPt$,L L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$hc$9 |$ sS3H 3~|3H |3 h|3j )  }KF߉Ήs(T$hk$/L$T$؅t%3H 3~|3H |3 1I h|3j h|3ءP;O*؅tءO!^L$AQ T$Q=P P t+)|$L$p|$tl$pP)ЉD$PD$P5|& P P(P(P93v93PvP\$CfK%0Pf!t0P PT$ .KfKf0PD$ HP@1ۺ9T$t$,l L$IfɋT$8RD$4\$T$T$$T$ $L$JHP@)t2(uK 4POt1 4Ph}$ 4P O PVhӋ$ Pha$h$h $h-$AfPhJ$ho$h$h$h$hΎ$h$h$h $h$wh5$mhO$c 4Ph$1BD$D$pf93@)f~\OtSωL$!ȹT$V!RPt$ h$|T$ D$,Ot1RT$D$fxf593OruTt$,9 L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BOC9D$=O ؉T$5 O|$7\O)RQPu GD$9L$~D$8:\OuG9u߅uQt$,g L$IfɋT$8RD$4\$T$T$$T$ $L$E5 O)\Ot$>RQPh-$ O;O}0u h$Ph$Cы\$1B\$D$\$D$T$jh=$j 1AhN"WV8P~bPP 3Q3; 3h|3j.P |3Q|3.H Pby`)PP 3Q3; 3h|3jkP |3Q|3H P|tN=Pt43H 3~|3H |3 h|3j PPh|33hԆ3&pPȸPtP̸PxPиP@8^_jjb1A1=PPUSWV׉E\$1AMO]E uWVh$t h$Sh$qOt5@D$ &\$D$$Ō$5OfyuhԆ3je^_[]UVh1AtD$O$ӌ$PD$$$PD$$ $0PtD$$$Pt9+ P} $0$!L$LD$L `&D$Ht$H\$$S$\$ p  PO 0PL$DD$D= P@|-(P& 93 P\$,D$(\$ D$\$D$\$D$$f$ OP P t5+ PPL$XD$\l$XP+PD$@D$@5|&P P t7+ 8PL> QPha$lOtkD>L> QPh$F|>uGD>OufPh$H "L> ffPQh$$  ^_[WVOu8jjV> t'86 PWhɑ$hhDP}"6 Ph׬$hhDPY^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h$2;$t$t$ t$SPhё$1  UPh$  t$t$t$ h$t$ Ph $t$ PhY$r0G9s'GPh#| KG9r߃$^_[]fUSWVLƀ8-uFh1#Vu lPh1#Vk1u pPT$,11CD$D$h$Rt$0Y Hw؉$Ly'\$̃duE뻁뱀=lPt\랉\$떁댁낃u1 $31;L$(ujm1L$ 1ɉT$Љ $PL$Au $APD$t2ڋL$ PWd W[f uމ$D$uY|$ujhw&Sg =Puh$h$h%K  1CPFLCSS H3 VT$W$y' \$@1ɍP$z'P1A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12P#PL$L$# 1AD$ PD$@PD$ D$<+PR D$ Pj$P;3P;3P;3 PP׋t$#D$ PjPd$zT$ ED$ L$TL$@JL$CP";3-L$#d$d$d$L$׋t$P:P@.P"PP P\$ PPP t Pt P1SSP L$Y\=Pj$)/jD$D$ D$dp#D$dp#PL$9a|$u qP Pta|$  ‰4 D$=PT$tD$1@D$ 01ۉD$0 hxSh(PN atgcuL$+P 0P*PP@PPSVh$h|3^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV肑+D$  Pi1PPWSjVJ|$dt$ \$h$ID$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9;3tE;3P{y$L$t h$h=$QQhJ%PPh$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPE#PPh$ 3H 3~|3H |3 h|3j tT$h9t$ x h${L^_[]h$ jh$j d D$t'T$tt h$h=$QQhJ%PPh$, ËD$t%u7$%tu'$PhA$$1$Ph#USWV|$<\$8D$4t$0~u/jUz~ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR~"<Ph׬$,PWh# ^_[]USWV|$4t$0=PuMPhhPmt P'j.hPft@hPhPNr t"^tCt0Wv`rhhe%hPr ^_[]1w)ȉPjQ SVUК fEu jU| WUu&VhPSh_$hhPP^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhPSh$hhPP[SWV$L$4D$1GH~'t$"tZ@:t9rD$PhW$+,^_[SWV|$t^D$uFD$jjP t1Nj0j.V葑t@hPPu7ut$ e%hVhPGp P^_[VD$L$ 1Ҁ0QRRhhPVP| thh}%hP聑 P^Au yuyt$Qtu ȃP; Q3 APh$hhPPSWVD$PQ4$RP4$RPƄRP.r|I1AFL$ tWWVWh'G5 u;D$ D$ PUWWVD$Ph'5 tt$fĨ ^_[]h\%t$ . tԉ1|$l$Vh$PVSaHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$_t!ʼnD$t$Wh|dt$n ul$$WhedAPS f$a$>ukSt$h"hm%h$WƄ$tP5O$ {$t$QPW0 $Kà9Éu|$$P 1h\%jt- Å~A1ۉh"PujVh"hox%h$WAƄ$|$tP\O$ {$t6$QPWW C;\$ mUc|$l$|$$PUSWV n7 uj3D$$D$<$sh$Vthj%V3hUG Ƅ$hj%s详ut s hj%VJtt s h$V*t P Y PD$ h$VtHáPth$P$(j,StZ SW,PD$PU/xD$!=`ÉUh׬$K SWDž?tG<$tSWUhß$hҿ%h$VV. tEUhӟ$6Zh$$?Uh$h%h$P15PtD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hf$h$S\$ =PuD$m$D$ P$Pd l8\$t$Php$Q;PPUM uUh׬$*;1@$~#QhL$1@$\$$$Ĕ ^_[]$Ph׬$j= SPh{$hԆ3 j虲USWV L$P$T$t-P*jhP PšP$T$1i E$48t!u6$t$PT$ uF$t$PޓT$ tEM<ǃ hu$91 ^_[]ËD$ t 0P$4$݋D$ t 0P$$ؾPPhhP4 uhPh׬$j; fVD$t.})zhBQh$54P蠼 zQT%\%%'PQhox%54Pk#u54PhL$z-zQ^ËD$ H^WVθ%'PV蜒t)uVhE$54P zQSGt8tPwhڣ$j wh$Xuj whBQJ GdQhQ^_WVD$ t;5hQD$=P DPu P';pt8@uVh$j9 @u=؂Qth؂QPhڣ$赀 Ph$襀u5hQ=P^_Ã|$t $yzQÃ|$t %XzQÃ|$t $r7zQÃ|$uhQh$54Pw zQÃ|$uhQh$54PF ձzQÃ|$uhlQh>$54P 褱zQSWV$$DŽ$HH$pyƋ$ ƒtS!=zQ$t${$atσ=zQ =zQ PSj $;rtr1Auu($$hd$PQ te$P$$ho$PQm t8$(1;BQPVW7VK>zQ^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hh2zQtrʄt<$1ۊ zQt8tCu 9s1zQB+$=FFu4$D$|$ 1 BzQ$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ B~Q<$؉D$B~Q$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$54PhX$b%<$?uhVWC x^_[]USWV0$Du%$H$Dh$PQT y1E-0Qhj(UhP0 t$H4$=dPI1VV$P Í|$0;=P=0Q$H5zQ5zQ5zQs =zQ$t$9ƒ=PRPSQGy=0QuE=0Pt<PP$Hct0QP 0QVV$P Å 4$j0QzQ0^_[]Ã$D|Ã=Pt=P;1 T$󫋄$HRjh4< |$D$=Pʉǃ=0Q$H[L$05zQ5zQj =zQ$t$9Ã=PVPRQw=0Qu9=0Pt05PP$H1t0Q5PG=P-=0Q$H$HL$05zQ5zQj ƃ=zQ$t$$H9=PPVRQv=0Qu_=0PtV=PP$H1t0Q=P$$H4h$VD$P E;$Dnj=0Pt#4P@=u1Hjh<1#P0 jhPq WV=0Qt@=0Pt75P=9QP9Q15P=9Qu 0Q^_USWV1@=PS=9QFϻt$ͅtUSh$54P54PAet$PhVh$3xd3L$DH?uĀ^_[]Wh#'1؋D$L$yQ yQ@$t$RjQPUSWV$Xu%$$h$PQg .$0Q1ɉ yQ yQ $h$0*u=Q $hjjhP t$t$j5dP$r 1;=P=0Qh(QS$tY$5zQ5zQ5zQ8 ʼnǃ<$t{D$PWa tVWh#?&Y0Qj5dP$ Å9Sh$54PY ċD$`L$d yQyQyQ yQ@$t$995PjQPSWh$V5yQ5yQ950Q\=0PO=PP$t0Q=P>zQt$j0QĄ^_[]54Pjj/h$bYUSWV $ u{$$hx0#w襨trƉj h%S7 yQ yQ@$t$l$ jhUVx!|$ toSjWj@b!V1| wh#$54P詧 zQ ^_[]Ã|$T#t~"Ã|$t!hY$hN$h>$54P^11HzQWVt$D$ tu51>#t5PRPh|$Q蟣P#54Pjj6hE$TP1zQ^_h$hPt$t$ zQh$hPt$t$zQWVD$ tZ}UuZt$~h~"WLtOhT#WLtBWy7vhĦ$54Pˢ Z1H_1=DP1@1DP @P1ҾT#t~" щ @PPVhަ$54Pl1=DPzQ^_ËD$uD$L$h$PQ tvD$ph4$gu<=zQu0=Pt54Ph $D$ph3$fgu+Q(Q(Q>zQVD$ L$zQt u]H tPHQ"tsPj6 t8[=(Q4Pt5h(QhL$P/ zQ(^鳘Vh;$Pjj$he$QV3^ËD$tIDuD$L$ho$PQK t$D$ph$GfuQ0zQSWVD$-uD$L$h$PQ  1G=0Qhj輴WhPIJ t D$1VVt$@ ǀ?tx=0QtyD$thWh$teu Q=0QuB=0Pt9=PPD$bt0Q=P 0QVVt$ DžaSj׳0QzQ^_[ËD$uD$L$h$PQ tmD$_D$L$h$PQx tI|$BD$ph$mdu8D$ph$TduQÃt8zQUSWVt$ |$.E1ۈ$54Pjj,h$8N% u v1.贔zQ^_[]zQUSWV D$ #D$$L$ h$PQS L$ ȃ#D$$L$ hd$PQ) D$ L$$|<$DhE#t$rt3$8|t+4$$H$$ 3D$$h $0rD$1E-0Qhj臰UhP菮 t D$$\t$=0Q1D$ H9=P@$tf%$9t$t#$T$$VVP4t$Q܀0Qu?=0Pt6PPD$$" 0QtA 0QPE_t$j覯0Q$9t4$-衒zQ ^_[]SWV$tKjjQ?tK~S 9uWj(1uh$$<+1HzQ^_[þV Fujjۮh#F3 %tj/V0` t@hQW&) =DPt854PV> 4PHQP~ Q Pj |j5yQhgO#WV艖  jWV{ Vh$MzQj)SWVPD$D$t&D$t$hK$PV rzQ^_[ËD$phT$^u|$h\$ tD$x|$Whg$^WmPjWy uP|$ho$& t D$x |$Why$;^WXmPjWly 1ۃuM|$ Àu*D$p Vhy$]VmPjV,y P54Ph$U D$zQ=(Qt =(Qu&=(Qt#h(Qh$54Pї zQ54Pjj%h$HËD$zQ-=(Qu=(Qt#h(Qh̨$54Ph zQ54Pjj$he$FHËD$uD$L$h$PQ蘺 teD$ph$\u<=zQu0=Pt54Ph$D$ph$S\uQ<zQËD$uD$L$h$PQ teD$phM$[u<=zQu0=Pt54Ph"$UD$phL$[uQ蒍zQËD$t8uD$L$hT$PQQ tD$L$QPhdp# BzQUSWVh$V$ $|F$$h1Gh4V% 9}hh\%V$ G9$uVh׬$Zu jLTQ^_[]ËD$t8uD$L$hi$PQ\ tD$L$QPh$ MzQËD$thuD$L$hd-$PQ tHD$:D$L$ho$PQ t$|$D$pph$Y Ãt͋zQVD$t$5PPu h$Y%萋zQD$ ph$rY5P^VD$HrVzQ>5PPuh$*YD$ ph$Y5P^VD$t$5PPu hʩ$X%؊zQD$ phϩ$X5P^Ã|$u|$t蝊zQÃ=Pt 1PP)jg=Pt 1PP jN|$u|$tDzQÃ=Pthש$%X釽V1VVcVVPD$ D$t}uD$p*zQƃ=dPt~ vt5yQj V>h5yQhBzQz ~ vthVhB~Q^ zzQ^VD$t.uf1=PPP~"tT#D$ ph~"V7t.hT#V7th$W-t+hK%W,t h$W,u7 1CvݻttXPu\Phz1H!\PP5XPh'$54P讂1zQ^_[VD$ L$zQʃuCuD t\ÉGW¥D$C/GPj5D$<L$AQj褾8zQ1ۃcVhذ$1CVN D$t P= ؃$^_[]USWVωT$L1$\1J$$$$$D$D$@$D$$$D$P$D$`1C\$TD$lD$hD$dT$pfD$t$h$d$`$lf$pM $M$t$$$|$xD$HShP $t$j跋$t$j 蚋$t$j}$t$j`|$t$6$D$dj$uV1KPy* F|$Dt$dw$`t$hd$dt$lQ$hD$d|$p$lL$tf$pOG8>h$P(t$Dh($$t$ $t|$@t$t$@ЃD$;Pt|$tt$D$L$dC.$`7.$s.$tg.|$Htt$HAD$H|$Ptt$P&D$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=Pt;P襡D$HL$H+PtD$Ej/t$L: t@Pt$DhO$t$HYD$t$IPL$D|$D$81yQyQyQyQ$$9Pt1$Pt$u$\$` yQyQ|$pyyQ$hx0#t$L蒸D$|$t$A$QP4u5$8$<$$$\$` yQyQyQ yQt+t$޷j5yQ5yQP9:Y=PtPt$Hhֱ$54Ps yQyQ tQPh$54Pr54Ph<1# 1O$=\PY\P1O$8|$pu5 D$TQhu$|Pht$hWI =Q|$Lu:|$LD$puuh$t$Hh*$[uh$}D$LyQ$|$LD$L8|$dD$t$h$}8P莞$$WPF$<h%Vt1A$<$ǀ?tvj:W@7 t=@j $QPQu ~޻t?$9u3;$u*WE9$<r$)PWRi t/h%VWtDžm1Ft$Hh$1$t Py$$u |$p$$yQ yQt$Lt Vh$t$dKt|$dj%W; t Wh.$1$GGG fGd$P$xPW# $u2$t'8t"$tJ?t1hb%W1FtVhn$y$7(2W^DŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB PJBB D$$PRW$8F t ]YS0rRtD$$Z$$Pf-j j WhSvv5 t%h"PSP j "PW? =Pt+D$$xt!~$t$WSP54P nv jv Åx`=Pu~PvvS-x)$P$P$Phdp# ykS誻 1KW$Phƴ$ Nȉޅɍ$PD PW$4h$wh1N=PtJ$t$uP$$t$uPљ$P~R4QWhs$GCtNu1h@h$hP t$P059Qދ$tPMDŽ$$t4WAPjW)M $tPDŽ$$t4W@PjWL $tPDŽ$D$$t PC |$D$$hj($LP<tQh$$芰D$$\t$ BjLPtV=PtWh;$54P(k t$$tI=P D$tPt$hh$h$54Pj1@t$ht$hh"$t |$dwh6$Vĭ #hH$V譭hV$V蟭8Pxt'1ɉϋ4hLy#V} G8PЉ;zrۡyQ yQ54Ph$q 5yQ5yQhj$V/5yQ5yQh$54Pj1F&1t$lh$$V $`#=HPt"D$$$t$QP躬|$hӵ$ tPh$W薬 hY$hN$h$W|D$$0$|$Pt1$t$t#tD=P$tPh$54Pi FWh;$$8W $$0t-=PtPh$54Ph FSh5$Wʫ t=Pt54Ph$ $ h#t$ 虫t$21V|\$D$Lt$P5B3DƉ$$ىD$ډ׋$$|$|P‹$4$8$ PˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5|P5P" h#5Px0M|$`=$@$Dt$hl#UKhE#t$"0D$8|jjj m$D$@h@$Pw D$@|$@DŽ$%yQ yQ m!ڃt9}M#$H5yQyQ$$!;$$=Pt54Pjj h_$ D$TLD$@|3x=zQ=PP PƒP9}%4PHQP ;HQ#4PHQP<Q 8tB$ڋ$!t yQ5yQ1ϋ$H1 D$hf%P h@$t$%XD$@|$@tDŽ$ t$oD$@Ph$h$Vh$O <"P)PSh˲$hݲ$%Pt$Hhm$jykh$h$$|abhr$paL$D$ D$8t$4D$ D$0D$D$,T$1@މPj Yt$nthD$XWjbt$@ $= $#$1V$W$$$$$$t$@Ѓt$@Wt$- u.54P$Pr P艊PhQ$VU P=P| jjyQx& yQ PyQP; yQD1PP1\$  yQ yQPL$T$ T$8t$4\$0r\$ P1tt$h$54PU L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Wh$_D$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#~W7tt$hз$54PNT T$d|$?D$TD$L$ L$8t$4\$0ËD$D$,T$1@hM$b^D$L$ L$8t$4\$0h$:^D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hn$$n]$D$8$D$4$D$0t$,$$1@މt$$h$%]D$L$ L$8\$4q$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$t3USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q t}D$V~ƉD$j@Pt%L$L$4l$,|$ $tc?tTj/WS L$9uut$@jhb%VB @L$ǃuC=PtaD$t$uI$t>th$V1Ʌ $t}th$Uw1ɉL$<=D$Pj3D$T$"tQPh$Y "D$Pj觓<$l$,|$u'j/VptG1|$t>tFhhQ&l$LU8 l$t$1l$ -QD$Pj9-Q*x1l$,1Kd}Z<$t3$DSVW Shb%Wx SUWm <$hh%t$LV t$l$D$ D$<4uT5PP=P$t$hP|$LW= |$D$Pj5PPuj/U t@ʼnD$ D$$=PtAD$Pj?>uP=zQuDhԆ3jhh$)1D$PjT8zQ1ۃcÍL$%L$0d؁D^_[]1Ehf$VPh$h$j USWV օ\$ |$$jh$Qr l$t=jh$UZ t;jh$UF t9T$(.C fCPC fC C 1}Gt$j/Ud$t9lj)CS:yS\$$UP< { uG<$WxC Uxj@V|$$tZ{ u  5xQh#B 5xQd`Phש$Wl1ɅQǃ=Pt @w3t.Vj1Nh$ DzQ1^_jփUSWVu} 1D$(D$ PT$L$yQ"D$PP1KyQyQ PL$,9Pt7}t1?-tWhº$54P9 tVh=$54P8 =dPtVu u ~dQ9hQt jP }D$ \$\$jh@P'K hjLhǛjLD$hE#} W ?|jj LD$_hx0#S:b D$|$4PD$ j3=`PuzQD$tt$jHLD$tt$j 1LPxP跅 P|$ t|$t D$ t$Ѓ|$t t$ D$,P1yQyQPPe^_[]D$$3P} 5jh@PI Ct$jyKD$=`PPxP P|$tt$- D$jzQP=PjTKhx0#W6D$|$D$  D$fxtD$XD$0PS7}x.#D$8=u$$ yQyQu hͺ$54P5 Sh$Wh*$qyQ yQ@$ t^L$$h$W# th{$W @$u3hQH D$fxL$$D$@щ˅tVWh% Wh׬$@QSvD$|$ 8PXPt9tP tbE 8|ujj *D$ E @h@$P? $<$J1PPD$ (u h*$$|31PP$fxt$xD$`PW&t#D$h=t 1PP xP\Pt9tP |PtQ踧\P9|ʉ׺9օt xPQB|Pj =zQtP=Pt yQ!1ǡhQHs:|$ yQyQ r$fzL$RC|$0|$yQ yQ1PPPt$ TyQ=yQ|N1ÉD$,D$Pt$U t uR\$,;=yQyQ|1jPPt$ T\$(|$0St$T  ttiP P;L$D$|T4PHQP;H~0Q#54PQPL$D$L$Pj#̓PPSt$Tƃ u|$<t?D$Pt$j tT tV$@ @uM @ t" D$ D$Pt$Q1T tPP]4P P;L$D$4PHQP ;HQ#1JjQPRL$1HfytL$I$fzt$PW5P5xP5|P8 t h$$1HPPu h$ލE @Ph$Pj#/4PHQP~ Q Pj D$@ @t2t$(0y8 t h$$j1HPP]$@ @tt$E0]u hl#3j|$ tD$ 4$Ѓ$t$1t$V9t$t*t$h9$54P7 54Phm$T P P|$| j$=PD$ = jS6BT$DD$@!у։1\$HPSs{ 1CSu 蝠 b54P} D$@PPCPWh$VU.USWV\$j/S- t"b%9tjPN /b%t%jP. DžxxPhShP ƀP.uePG1dMt[G09tÉ؉jhPң x.0uO.u1GOtSh$1^_[]54Ph$ SWVd|$t1F5Pj"jdh$S( 4PIu1IPSQY W9Vh@P SWVxQ f$D$@=u1H$jjSP讖t hʿ$<hh$5xQ  5xQ tQj Dž,y hʿ$=Pt zQj9t+t&1ONthSPY j2u=zQ(u jj 'h$(=Pt zQjy8^_[V;0Pj P0^USWVPPhj |$ dPte$P$P1@K$$PP1dPPEP QCthQP EQ <PP<PPtQ<<tQxQ@@xQdQDDdQhQHHhQ`PLL`PzQPPzQ zQTT zQzQXXzQzQ\\zQ`; zQVQP赙 VW zQP裙 q;1zQVQP苙 VW1zQPy zQzQ;BzQVQPF VWBzQP4 B~QVPS VUB~QP 4$Vju=PtPjփ^_[]Pj=0Pt#4P@=u1Hjh<1#P)U P10QPjhPX WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPRhJ ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t54Ph$y zQQ tQ11j1xt5V tQ1Vhf$ zQj:4^54Ph$y fUSWV,1hdp#S̱$D0s$ PP V%PV%Ph$ $t P1@PPPPPPPPPPPPPP5PP5PP5P PPPPP P!Ph $( tVPh!P# 9 I$Ph" /"t (Ph"$֟ h$P蚰tFh8%V舰tJhB$Vvt54PhPl K=PthPhY$54P 54Pjh@hPh$3'tEt W=9Qk$P0t&ƅu'$D$54PPUk /$~ t&$=Pt9Qj 6W $P8$P059QV =9Qt'~t!4PHQP;H~Q~  Pjh"j hnj ^_Ã=0Pt4PHQP~Q fPj @fV5Pu<FA\t"uAt""tFAQt FAAtF5yQ 9Q;$yQ 9Q1tu yQyQyQ^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4('RSt$DhA$QP_ yQyQȃPPD$u݄$|9s0;T$ D$r$|$\$|?؍<)hc$؍<)hV$QP N+yQ yQT$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh|P VD$ B J1rrJVRV} $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0V0j0^USWVh=Pu=Pu }t$XjVg{+Q~=QN+ Qy@BD$HT$Ll$HL$$D$$5p&P PЃ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иdp#ti#|$d5yQPRQh~$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQdp#ri#+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ QHQP~ Q PʍHr̃t"1QHQP~ Q P衵\t"u5QHQP~ QPbQGduQ1G QHQP~ Q P[~#\uEQHQP~%Q'H wr? t:,u3Pʴt%QGdzh$H 1NQ=Qie%\'hQP2tu :v2USWVՉhQQItDj.Vn1ۅt6UP(u&)WhQVo u1ۀQ1C^_[]SWVD$=Pt5Qh.$54P nD$t$h[$PV` uA PPtPt$~Vt. ,P9PQ zQ^_[Pv蔘t=Pt"=Pt5,Phv$54PA 1G=P Sh%hBQ l =dQ=hQSh$hQl =QShq&hQk =ԂQSh<"hlQk =QSh:&h؂Qk Q=P1PPv hY$j<[ WVPhP/ơ4P?snt$h$PN ƆP P?)PRQh$35 x?t$|$ 9Q1; $P ^_Phz$M ^h$t$h\$54P =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=h$hxQd r1ɀwQ.)hxQPh$54Pjh$hxQ\h tfjh7h$hxQDh tN=dP Qt$Qj h$htQ 7 uh54Ph$G S=dP Qt$QdQj h$hBQ;e thBQh$54P 1HQQQ QQQPhƭ$1Ƀu 1AQu ǀQu QP5P^Vt$t3DH@tNFuh$VDtQjh$Vf tDh$Vt9h%V t.h$V~u'QQ Q QQ^áxQt P_1xQP Q$Q=hxQh_$54P fyQ20hyQh$54P yQt$1 UNVh$Uc D$(V荍!у $ P54Pjj(h*$#}u=zQu=Qu Qtj=DPua54PhtQ = 4PHQP~ Q 0Pj # DPtUh$54P 4$|$5P=zQ1Hƒ4^_[]t$h$j2hQstQh$jJ USWV\$l$jWth#WtUh$S*b Džu&Uh5$Sb DžuUhO$Sb Vjkt^_[]SWV(Q5P=DPu P=zQhm#+(Qu_j htQzztL8tGx"uAHt.1Ҁ"ux"u"@(QZHt@r1Ӎ(Q5P=zQ^_[SWV$h$VX VT h%PY1Fta\$SW4 t?|$/uH$ViPVS\ 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhw&P ƅu 4$r 1$^USWVHu\$ $Cj j ShWuu ؈ t "hVWPP j VSDP pP]t/M I9Nt vuvvS} jjS ƃPjS \$fD$=LP~%|$@jW&QLPO$Cuu S VjP* 1D$ PWhpq" D$ PWha$h9$<ۤ81\$@jPPhSvv莇 thh"SO 蟤8Sh&$<-D$ PWhf$u8$\$=LP~N1PD$PPT$@L$H+T$+L$x@BѺMbiy1fD$ PjSL u,8t8#tj}udϣ8AuZku<FD$ t:D$L$ PQhhuĄ t\$ ۋEu Y rD$ PWh"$`; 1He^_[] t$u SWV|$GHO~H0^_[Ë\$1NW+u4G `f@u8t 8#ug GHO~막뭅t¢USWV|$\$GHO~H^_[]1M;G~ uWSu4G `f@u8u}*8#}1D$11BtfT$ <$=LP~M1PD$$PIT$D$+T$ +D$(хy@BMbiy1虝VjD$P4 uy8wk8#iMtuL$E54PΛ5LPPh$V茸$<< MA(1e^_[]ËE@,$G(ޜ8<$tϜ19#u‹F9~sWPYEtF~WuPp ~ FUSWVP|$ Guh-:GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUwDtGo1F u$ԛ G(1@1(u8,t<_tGO T$t$)9|JSPVn _ ^_[]USWVPt$$\$ l$|$WSU tUj| u2HDeO,1t$t$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV<hr"Pt+hr"Vmthr"V[uLQHQu }h$VWb< Hσ s УB3߃c u1LQσdt ltntHHQ뵈PQHQ맃t Vu'$39u=HQq1z4$9-u yt$$PQ1ۅtw<$uaHQtX肙8uNW藉ƃP7VWPl 3.gz$PSL߉ޅu4$hN$\1$tE=@Vh]$t$$=HQ15XQ=HQjV DžD$PWt$$P Vh$D$V=HQ$=LQ0Ɂ==11BWjVf $=LQ$uXh$Vhox%PW9r DŽ$.gz=LQuhh W |<$D$D$P_D$ T$W =LQD$ #D$H=`t= ujV xLVVhx$;Vh"*$Vh"Vho$t$ u h$VD$ !=t D$D$pD$5XQhVW@ Wm|<ǍWh$tI=LQuCPQu:Vh$$Wh$-h$3超jD$P|$W t $Vh$1PPPW x=LQ$uL=PQuLhh W ƒu 1@P D$ 1@P T$1=PQuW4$T$WjVhd$$Pm t$t S%CN| $T$ V1PPPD$T$4$! t h$D$ tP t h$L$#L$LQtKfjjW tT$PQL$ptDWh5$b4$u W3Vh$Wh"KWh$*$l$pT$ 3T$ϋD$1 u V4$, $Qt$Pt$hZ$s4$ $W|h"$1B1PW 5TQ?h'h#hԆ3蛮 j!VԆ3h'h#V{ 裑Ph$Vg jUSWV΍D$PQAox#L$D$xt$h"1L$h $tSF0ǀ=PQu$h$jى\$9r<$SWVr t*t)u1ۋD$)؃tǃwh$ h$@<$D$1Bh$PW|$ WW@e^_[]h"+PD$L$ $QP30=TQu TQXPD$L$ $QP0jnUSWV׉ˀ=\Qu h$ t$\QjjjSs!ƒt7jPSa tuh $Tl$h $11PUVWh%$豩؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph4$jV輧L0L0D0.Vh;$h|3蜫 Wh*#^_[]PD$L$ $QP =TQu TQXUSWVpT$hL$lh-}h-D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0R2T$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$'1@ɽ9jD$0P1Ń|$<T$1D$ D$,8@D$,O|$01PPD$(P  T$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0C<\  Cj$jbGٍ$'j  1$'t$'1T$JAjD$ $$ _EQED$$hD$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$hQ$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PVAǍ$$ D$ VVD$PVA94$=31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$hQL$ QhPN hQ11 |$ 1 $R@t1BuڋD$8L$ Qj PY@  Ǎ$Pj t$8@ ŃuuD$ L$ }D$HPMQ4xWt$ PQ $(4$hUt$PQ L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$bE o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[a}j $( PS˜ A}8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =xQ hh V8 EKpCDH@uٺ>$&G=xQ GK4CDH@uٺH$KfCDH@uٺU$GQC t _DH@uu%ƋD$pW$k@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,hQt!9}uEpVkmj hQxt$p@ hQ>GWVt$F1EjhhdQ Å%|$څ,h$|$th$z`Q `Q11s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ V= uF9$Qs$Q^_[]VP Ph$' USWVP׉΋$1m~ w]$@' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j ; @x B3B3[>u)j H1҉P5B3 B35ojH@B38 B3>u+ j5`Qh|3e^u QPq~hy"j mPPhl$hԆ3迉jE~USWV\$|$t$ Q1EtB5QWV肔 QQ5Q]1QQHt8hx0#p蒉Q QI QKph1T#jhQrfQ"Q ...QQQ@Q Q =QuQ8#uxnu Q  QW1 t,E-Q@J}QQR)ʉ1ɉQ9‹\$kQ1m1 QQQu>#u~nu QtQ1B C1ɾ8f Q@Q1ɋ\$uQ\$t1A ^_[]ÉhQh׬$jA USWV|̷QuN зQ19u:=pQu̷Q$3$3Q^$ԷQ|3طQy"ȷQ1NHQPP\̷Q=$3P[=ܷQtCܷQSHS5Qi thܷQ5Q oܷQ=ܻQtMԷQt=|3tPZVԷQ5QhܻQ| ܻQطQ=ȷQtȷQзQ зQ@зQQ=pQQPrf|$pQ8t0W5QܷQVr W5pQV" =<W5Q$V@ W5Q$U) VP  U~ PWVh`$WhܻQ9hܻQ螣ԷQ޻t=|3t P.Yh@$hܻQԷQrH9tt$t$PR ԷQH9tȋL$!QPL طQܻQ=tQuQQԷQ|3طQy"hx0#P聄̷Q5Qh׬$Q̷Q$@1Q5̷QP£ 5̷QhķQhQ: ƅttbQ|0 uNt$@ $@ $QV5QPQ1@|^_[]5Qh׬$j 5Qh#hH$h2$5Qh($j h$h$~ =ܻQuh$f hܻQyj?wh$벡̷Q@ u:HQP~ QP>Xt5̷QPz 1=pQt tQt SWVзQX1t^hx0#3蔂t&Nj@HOWWuWjV[뾋HWP WHV1F^_[V$ $ $t$QPhVs}V5Q5Qh$jG V$ $ $t$QPhV.}V5Q5Qh$褋 ^SWVP\$|$ܿQt PD$jPSW PܿQVPSW ܿQ^_[ÐUSWVQjhQn91FD$Q`QQJBtOz T$R uW|$+;A QQ,QыR L$y th|$ Q)щ;HT$7D$t{T$A QQ+,Q. Q;H@ QQ|$to,Qu1ۉQ1;AQ1;AT$t1jT$ ,Q=(Q1ۉ__ WjWSQPR|$t4JT$B8 Q;H`QT$,Q5(Q1~>~ VjVWQPoR1FT$1,Q=(Q1ۉ__ WjWSQP RT$t tCsBtt$u Q;HrQxt$tQ1BtȉÅQJA7$'=Q5Q$=QFPj W5 @) QQPW `QҾ5= Q  QR҉Y = 5Qh(v"5ԷQ| u 1Pjh<1#QS1P5 Q5Q)1Pjh<1#QS1P5Q5QS!1Pjh<1#QS1PS =Q T$Q=QGPj S=4 ƅ QD$4)أQQ 5QQ9aQj5 Q5QhQj5Q5QhQ 4 5ԷQr  T$QQD$<=ԷQ|3=B311 |$@L$ɿ1D$@PL$ QSD$,PP tǃrT$ 1 |$@1GT$ uGF;5B3r5ԷQjjhX%+5ԷQj$苇 5ԷQj { 1-R1"L$ tKQ+#D$ ;B3r5ԷQjjhX%E+15ԷQWjS1+t$ tsQtejPh؆'F2 tQF;B3r5ԷQjjhX%*1؆'):$Ph6$5ԷQy Z;B3r5ԷQjjhX%*1t$ D$13PhB$5ԷQdy F9ut$ t$L$)4B3F9r5ԷQjjhX%"*5ԷQj$ 5ԷQj ԷQ@ @9  ֡Q Qu55ԷQ5Qj5Q)=Qt5ԷQj 蚅 j jhQE Q5 =Q( 5ԷQ5Qj5QR)=Qt5ԷQj ) 볋5QQ9Q+QT$JQ,QT$ut Q;P QT$I,QD=QyBu%hh r F 5Q5QP ;Q} jh<1#r  [ T$=Qujjhdp#hQ QD$0QD$,QD$(QQQQQQL$(t$, Q5 QL$0 QQQQ=Q_ QQZ=39Q @ Q Q9r Q֍Q@PQmQ5Q F@+6vFt P誹 uF6^_ËFp vh׬$j^ USWV ՉL$4Q0QщT$Љ$ 3(QE]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B DQ9r7 DQP5@Q@Q0Q4Q$(Q0D$SPt$V* it}ŋ4$L$]\4$L$t&uE\DQ9r+DQP5@Qeƣ@Q0Q54QF1C4$4Q4Q\$D$ DQ9ȋ$r+ DQQ5@Q@Q0Q4Q ^_[]USWV`}$111D$hH$u W: uu5U>ut0GtgU;uU$8u $3ȉL$91t*VLt@T$?D$D$t Vlj|$\$ |$t?1h%SEl t+8ttDGhO$jZ 1E L$3 th% u3h׬$jJ tD$PW uhv$ۃ|$ tt$\ uh$뼅tt$ uh$렋Cu/h# %tjh$VV VeSPQd QVh$ JPh$hԆ3g j\UVQt@t $e^]Vh$j WVP։K1ɉQPW# V?t$8tK1H^_K8"u #Ft1fUSWV\$t:{u4PD4ƋD$pVtD$0pV Cf{~a11C404t?L$qPMt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPIF tvP6v ۑF vyv辑F^USWVP1k<jP3~4jP3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùy yUSWVPk<jP3jP3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùzGz8{){hԆ3jjCh$jXV1=`Qp#bhYt*jjj$ V!V5TdQ5ThQj5TX@lQjPvpQt#1ɺXP3A<.u`Q1 1@^USWV D$0f 9lQZ pQ,I fEE!f ufE(Mt!U1f~ t @9ufE,$ltE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPPy/tCÀ8t? 3DAhԆ3jk Wh@$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$,'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEu[Lnfi=m$ 5T~5T莲1QQPSt$V5T5Tt1U#*19}1ۋ$p$ *ŊEt9}1< ˊEE5Thi$1VV5T UVj5TVj5T( 5T 5TC= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hԆ3jh bxu+=dQ dQσqt$V(sVV5TXIhԆ3jh ,$,$fUuE 9|)BfUhԆ3jg ,$T$4xut EfEuGza|1x(| E9}ED ufMhԆ3j\g !}Eu)urE t uP_uf;}]D; jtKcD; tt$4UЃF4; ~ttt$4WZuE tuPu gE uuJEpQ,Et)uuE t uPbuEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃu蘄EE tP聄E ^_[]at$5hQt$t$h$hԆ3yXZa$@ t$St$t$ t$UPh$'a $A It$U5dQt$SQPhr$hԆ3X$jLUSWVT$qЉD$ qGud$ T$T$ $P%%ǽ)j P)1Ƀ QWl$ U|$ WD$p軐tS;tNt$Cj S^)؃ QSVWD$p{t G}uo $ $l$Atl$|$qmKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W !L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SC G΋<$9Ƌt$ufthJ$VSwE|$Gu1PPw|$ GL$G)VQw;! w0 ^_[]D$L$pQ fAËL$1x9 lQ~pQUSWVl$0.lQ9}=pQDP5pQ&Ǎ PjQ5 =pQۉlQt @tFj-|QE3\Jك@to@uwt uDZ@t< ty< =Qu =QtI5tQЅtj 5tQ)=Quj 5tQ)QQQQ?=Qu"5tQhtj 5tQ(j 5tQ(1QQQQQ Qf)Q1ۈD$uQC5tQt$L$4 5tQH9Ƌt$|25tQ2VUUU9}j 5tQ'|$uCj 5tQ'KVW5tQk E߃ @ ȢQQ=QuW5tQt7j 5tQj'%5|Q5tQDgQQQQ5tQ藢 ^_[]t$Ph׬$VPt$D$ L$ $PVP;1A4$^hdp#t$t$t$t$USWVP|$ \$$l$(t$5tQ@QQD$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWj5tQb1ɉV,$E|$@t[D$@8tRD$u:h]Y%5tQet$@5tQeh#5tQeWt$Dt$ h"w%5tQYe4$5tQ΁D$ 5tQ܁5tQL‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5tQFe5tQȁth%US5tQe/)PS5tQ 5tQ蜟5tQ^Ã~0L$ZD$  4蹨 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQPc QtRD$(υ~] $9I\$)RPQ KOuLuH|$@tAt$t$D|$W? WhԆ3j7 D$z19Dzf tN;L$$} 3DXuhԆ3j6  $9A)RPQ] $8GED$t+)j Pt$5tQ"L$QQD$t8ʋL$ u|$@t$;D$@u  $L$t$t$P: 4$0^_[]hdp#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5tQk~5tQ;~$tKۋ|$,;SW|$0L$Dȃ19AD$LD$Ut$HP#1t$PQQ$Źt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PtC@j PuL$$)݃} 9WUQS5tQƅ|$ yVQƅtV5T<4$5tQ+PW/5tQ[PWW1PPW: W豚D$E|$ GWUPS5tQOPŋ=tQVPW=tQV<[PWbW5tQQQ#WUt$ Sh.Y%5tQ躼1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWVVQW>UP|QWsQ^_[]hdp#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hdp#t$t$t$t$USWVP|$ \$$l$(t$5tQQQD$,$VAUP14$SWt$(^_[]hdp#t$VPt$D$ L$ $PVPA1ɉ4$ ^V5tQIy5tQyy^fUSWV $$$ (R15p"R5#RRi%5x"RWKRWVP 0'Ft(=RtvvPò vhRA>vuɸ)RRl"R"R"Rh%_ ^$|$ hY%SU e~o~1pMrt"CIDR붃fi5Uhx0#Ve#PhW- \$h0#WRN D jPh# t \$Sh|$W- u4 Z%0'W.PWV t }u몋}tED$th0#SM <=u̍4@h0#PM Fh]%Vį 0t$VW F,Rh"Rh"RhY%5U `S#$$$ DmU$.sf6jhG1$h$s Qe5Tvǃ5Tv1FVVPWR*t5"R5"R+5Rh$VjVjhjz5Tl8Thh`RuD$D$@V轢ljD$ V订D$1ÅjP荨 $t|$ o u*t$ %n ut$ [%n jz|rjU۫tc1L$ <:B ޭ@9u1PPPPPjPPj jUVPv4t(jvt$WAWU11V/|$ t$~144 C9uWVjtPjjVhH# D`(RjE|"Rj"6R1V舛 HCj9| hu譸=,Rt jӦ jjDԡ4Q1 ^_[]Ét$ h1GQWP蠄 Ph#hԆ3 VW=hԆ3jj,h`Y%jy¹hԆ3VjhY%VYV1FhԆ3VhEh#\%V7UWVVd hI#w P莲  }[&=Rt>VNPhi]%WH 5R5RR=Rt>VPh{]%W 5RR5RTR=QuhԆ3jjh]%e^_]Ã=Rtát"Rtt$P jjhI#h tP{ t hb%j ZjAhw htjjUSWVB L$Q(~  Pŧ Ń j h\%UH| ~ uF t$|$ W2& WYfD/UWv W!jŋ>7Ptn,$n ;nu:FUW}t^FPvetFljFn ~D$Pe4$WUV Sæ ŅS0u ^_[]ËD$L$I4P1@fUSWV1t$,RjV t$t$ t$t$4$jVP!<=,RP芢#t$Vj >hj]jYj蘅jVsh$Yw * vV? 蘊Vjj^4?15,RwR)RVPX~Bjh-y)RjPWyjhy=RVVu%)Rǀ$jhxup襌)RPh׬$jX jȒtO)R)tTPCu2P.Ku#POuTjh0xPo^_[]Ë$l$ D$jP[tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UG9u1PG9uU~U$tG10L$9 t.T94t&zt T98t4t9t9y`$El9rۉt14UtG9uVfVSWV1t$t$t$ t$t$4$5,RjVՐj/r4PV~8 )R$*tKuKt!Pуt)R$P)RL$$Q tXD$t$VTVx)V2Ou]%u]%t*V^_[À)ujhcu VCt5T葉1WW5T 5T豽5TcSj I9;xhj_jZj]jV'Jh$r ]%]%}USWVο$WQS Wh]%S螤 WSUѣ Wh%U肤 S1tGUt0VVVVVVVVVVVh"h41PP:t US:^_[]SWV$SQV? Sh]%V SVW# Sh%Wԣ Wt VW^_[WV1t$t$t$ t$t$4$5,ROjV蹍tkjo4PVf5xG)R*tD$$tL$PQt$VqLtVO^_ÉWj ?t1hj`PP~u{fUSWV$$$$1EQt < tEBT$BL$ QjD$l$1@$4V;9D$pPt$V# Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04, Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW艌 5Rt@W蝌Phi]%V 5R5RRshf%h]%Rt*W@Ph]%V: 5R.5R0ջtPhU#hox%j[K1e^_]Ph^%hԆ3 jfUWVV蓋 =Rt>V訋1Ph{]%V腅 5R5R5Rwh@$h^%Rt81h^%W6V?Ph^%W 5R$0ںPh^%hox%j[T1e^_]V1hhPh,PjjPj jjhe3h赸4xjP荪V衹^hԆ3jjh]%虾RtPjjh]%~jSWVD$x1|$RtR P1; PPVh5#W裣^_[USWV$$$L$$QPhV$hx0#V6 $D$W1K4$> 1G9r6|$  WU虙ŋ$(\5F4$ ÃugD$ PVkuH|$dhx0#Vw $t:|$G=RtVhK^%h4^%P 1KS1D5$$t 4$: 4$uRtVhK^%hS^%Pu 1ۉ؁Ĉ^_[]U6$$$1Kej USWVu ED$l|$$PVW9  ED$8D$1ۉΊ<'t  j Fj'VӺu Vljt$ t$PS4 D$ t$ )VPh"L$Q|9 h^%V t+9s'T%u@u @Qj*P ;'uC|${*1\$ |$D$8j/W tW0l É@/ Wl É|$PD$S襕 ND$+D$D$ .t Vt$WW tSj Džu]D$T$L$;ȉD$Pt$ 蓖D$L$Wt$t$ h^%P'8 뒋D$L$T$;t RSbc |$\$ h\%S|4 G|$\$1\$L$9}OD$hKP:,PwXv|$u9Mx{;5TtVWjP|$ۋ|$t h<1#1:hP:v(3H (3~$3#h$39Nj|$tujB ;5Tt V-|$ t E%u15T5Tj5TVg~ut$$莔twP|uWjD$td$8u-e^_[]D$t$ h^%jJ Vhf^%P 1STO 1FVHO Sjh%f%8N VS V t$O $ D$pL$|PSt$0ö t$(pRt*t$h,_%P 5RRRt*t$h#P 5RRhQ&D$ 0u.h;_%D$ put$v t$e s hRyEt8tPIQ u%t$V6v 6hP_%w| jZL$1Ph>_%W| USWV։5T迧1@P5Te5TO7sh1PSUK8 #LhP7LhPS1CS8 KWh׬$譔eLh8%6FPUMr5TS@)VUPRQ5T^ntcjP%t05T趽PV輼5T>3PVd/1PPVG V>r^_[]hԆ3Sj+h^%BS USWV-1@=Q$hd%Pj hFD$1D$ $ $?$V9$<%VWi PWt$ + VWN G|$e%'3D$W+PWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$蘏$艏8 }? jS褈 ƃ $NfF((Ju1ҹhvRRRRQRRQjSD$DPju$4D$D$D$ D$ jtD$ Pt$֘D$ p Q )) hPhQÊ 14'jVhQh t1GuD$(Vhe%j@$Sr 1PPD$0PD$XPS+] t|$Lub4'hQhox%h.jsk"D$L1QD$PPQQS\ Shf%u1=Qsu=Qlu3 QDH$D$$Phb% u5$nfsu( $D$1@D$ |$$tD$$D$$i jv&h1Wt$TV j!W|$0W iW*]hhf%uRChQPPj%=Q hQPPhhhf%hwg% Phf%jKp hf%W=phtf%W/phf%W!phf%WphQhf%Wp =Qt!hQhg%Wo $9hg%Woh"g%Woh0g%WoW.hkb%johQh3g%hc DŽ$hQVVj~j ha%VX Qdefa1ȋ Qult1 j hg%hQX Qmanu1ȋ Qual1 Q1 Qnone1 Q tlf=Q tb=Qt`hQhQhg%j`tChQhg%Sj`~$d$3QQhhg%Oh#ighQhg%hg%h [ 8 Qh_%D$ Pj ~ht$ hQ譅 t$zj hQ蒦th`%D$ Pj[ ~ht$ h*R] t$*j h*RBt=*Rt Qh`%D$ Pj ~ht$ hQ t$ʈ=Qu:ha%D$ Pj ~ht$ hQ躄 t$臈j hQ蟥t=Qt QhhQu=Qt QD$1@$" hQS$W4 VQPPjxVQPPjws SW|t%Q|$$|$ t |$ujQPPjy!|$t jQPPjz^hQ< =Qu=a%=r!ƒa%t๧a%=ujQhQR jQPPj{hQPPj}Qu4D$D$Pjܐ|$uh*RPPj|T=*RD]$D]$t*R=Qa%tQ=QtQ|$ti=QD]$D]$tQ=QD]$tQ=QtQSVWQRhQPhQhQh"h,$L=QD]$D]$tQ=QtQWVQRhQPhQhQh"hX(jjj{ xP@ Qa%Ph׬$h hb}<hQhHg%hS S;"jrj!R$H1WWV$Ph:e%T t( ;$P$TshLe%jPt^DŽ$ 1WWV$Phke%S ? ;$0$4&he%jPhauq5|"Ry1H t$et$B1t$Ft$#ha%j<$t$j苧Q1@$F=*Rh@$ha%b ha%jgt$(Vm VmPh4b%hb%Wg=QthQhQb%Wxg =*Rth*Rh\b%W\g 1hkb%VLgV辦W=Q5|$tk1hQhQhQhpb%VQjhb%W  hWWVjFj jh ZotNjjSP; |$ =QQhQhQhQhb%jkDŽ$ch DŽ$attaDŽ$n/slDŽ$/sbihQSJ |$$h\%W D$Lt$t$L8th\%W ut$LD$LPV =QtQVPV |$ u/=Qt&hb%VhQhc%V |$ t1A&hh0c%h\1Ʌ QjڤQe^_[]hQhQhb%jtRtPjj"hd%71FhԆ3Vjhe%V 5RthpVP(_ hYhԆ3P _ jc USWVL$,!ij u!D$@tP jPhQ| L$,%ij u!D$@tP jPhQ\| jPP+v ƍ\$1 jhQS!| Sh8i(V V; ulD$P\hPhQ{ W]t;Ƹ=Y$QSPUv| SVUk| W]Ƹ%uցļ^_[]VPhQh f%PjW<1#Vt$9H Vj.H tfjh/f%V u;h7f%Vc u&hAf%VQ ujhLf%V u"h<1#jG ƅu4$~^Ét t t@hVhQz SWVt$hVuuT|$tMƄ$j.Vqt#GSVhQSz SWhQ hVhQ7z ^_[SWVQSܿhQͿhShQy =QtO)~!Q.uQPhQ蘔t(QVh%Woz VhQW`z ^_[ËD$w'ødp#USWV$Vh V%u $1퍌$UhPc%W :HUUW f@$|$$jhWc%P 9tx/uG/$N~/vt$jhWc%Pa dp#w'1҅‰)ˍL$$QSRPh_c%hU_ ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<#R401ɀ=R/RQPhԃ%hhRv 1^ËL$1Bjh$RWVt$=Qu jG7Wj u1@l#R5l"R蕷1ɀ=R/Rԃ%QPVWh"R c1ɀ=R/RQPVWhR 1^_Vt$V'eЉjhPR$^WV D$PhR u:$nfsu-VhRh"RBv VhRhR/v tWj 1F?t[hRh#Rhlc%ju>#Rc%hRVWh"R hRVWhR 1 ^_SWV=QhVQu(h%m]u5hQhc%V=*Rt ha%=Qt hwg%ٷ|$hQhc%hW h@$W ƅzWPhc%j\h$V\=QthQhc%V\ hkb%j\QuG"WPhc%jg\=QtDhQhQhQhc%VA\=QtChDd%UhQhPd%hQhQhc%V\hkb%j[hf%hc% |Ph d%j[ f%SW[htf%W[SW[=QthQhf%W[ hQhf%Wl[ =QtLhQhY$WK[ hQh#W8[ W躸hkb%j [h$d%0[uhQh1d%T=Qthgd%tThQh{d%bTt VSj9^_[USWV։ϸjPPl tCËl$hjW{ ojhQWr WVSm S1 1H^_[]USWV T$ˋ$ Ph V%軹u dp#$$t8ha%jP3x t&D$ha%蟴$D$D$$S^\$ PWS. R|$u#RPVSUh]f%t$Uƀ<$tha%~P,1 ^_[]ýYf%+T$L$t$q"u/Átu*s$Ãt6u8h6h/u uh}%!w'hh5V D$L$FFhV~ ȃ ^SWVP1ۉSSWSjh'蔋t{4$c1ۅtjSSWPjh'itEh\%V= t&|$\$PS׃th\%j< uVs Vs1ۉ؃^_[USWV8h%'\$|$jSPO ƅt Eu$wS7o whf%7[p G^_[]WV'|$u't%|$ jWQN t u1^_ËL$e34USWV1td։σSڴPSW͵ t u6P1PhPPj D$PU_G D$t΀8uɃ<$uð1^_[]ËL$f3w4USWVl$\$1}$hnW6StOD$SWPHDWWRt.ljFt(V$'EDh%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ $V1VPؾ 95,RD$40$X@hSP@tt$45TrQh$3p 5T*39r ,Rɉt$ =1MD$Ni8D$$11t=i8,4x"RtǍXUS褳N݉|$|$l$$R)RƀyH1ۉLPTXVUQk )R" .hQPk VUh0Rk ,)RL$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP)R$()1HD,048Ƃ(1 ,R<5R\x"R|$c[ RP$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً ,RɋD$L$ӾV Wdp#QSPSl$GU )R$H@ VWdp#RPQSD$BP Rt% )RQUHDRhh%P% =)R$0xơ)R$p^L$*QUPVWjj:XD$ D$D$ PjvD$ t.-,RL$QP5)R u<5)Rh`tS$Pdž$l$)R()8 R x"RVU[RVjPι L$ D$@D$9 ,RyuƇy$u4P4 44S$똋D$)R$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$((D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4((El$L$),$|4xfDŽ4DŽ4((T4E,$DB8t$ 9zt$D$tj$Dx[fDŽDŽ((D4B=ND$?P1D$ +D$D$$|$y+DxYfDŽDŽ((D4B1hPPPPjPPjjR$PjS4$1K|$$8h׬$j菤 D$Wt$rD$tvl4u^u3h1PPPPQPPQjt$,$PjҀ4ÃtCD$WSrD$lxS螁1H$^_[]1M4$老$<t4u/hhPhZf3ad )R8f31@멃=,Ryu,R,Rs19dL$w BsÁt1USWVD$$)R*t1G.$ )$Phh%hV 7r%jt(hgkNVhh%h j$ b%W\)R$Ph%hV WVhi%@ ]hb%Vjj\ R1PP3Ahjl1q|{$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$Sڡt$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$Ċ'hi%D$P i%D$i%X3|$0tPhh%hWU Whi%D$PB 7r%D$i%zhzi%D$P i%D$i%i3|$0tPh i%hW D3t#Ph'i%j\$S S\$W, D3t#Ph.i%j\$S S\$W, L3B"tG1$0%tWRh5i%D$ PK D3@i%tNi%D$7r%D3|$0tL3tQh[i%hW Whai%D$P os%D$ti%Q|3i%ti%PD$P i%D$i%!hi%D$P i%D$i%D3 $t!t$PQh%h+t)$j4$ctQbd3U$ ޳=,Rt$ $QD3$t<|$t4øSS$PW$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhGn%UT EtjPrd t4$ b؁ ^_[]Ê$ h7r%W葥$D$jV ù D$jQQPS! S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uhan%SGVUhun%S7$ Pu1Vt$hUn%P4$a$ l$Shfp#U hrUWVjP5L1PG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ^_[9rwًz89y8rw19HUSWV )R1G*ZƄ$hi%ch@$hx#3謜Phj%jC 5Rt荜 )RQPhj%V 5hSj%SC)R)\$J$WP[x$L$@PQ $d$ PV D$@Phj%SBC D$0PV["D$0L$8L$D$h"P蜢w\$D$H$194$h"WiFuށǐW$WW S^;t$$ *h薙RtPjjh7j%|1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#tdp#$j%\$t7ȉL$7 T$wXi%D$ 7r%D$$'dp#$uht$$PnY j%Pt$hj%t=uD7L7qQPhk%uv`$$#dD#t $D$ os% $T$hb%RvT$ D$L$ 1@D$hBk%T$i%D$L$ hb%R&uD7#t$$D7dp#@tqk%dp#yvk%dp#t~k%T$(dp#tk%T$ |$$dp#tk%L$,dp#tk%dp#tk% dp#tk%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hIk%t$D?@غRPhj%t$?ClE;F{Pp\$CPW S\[t$0|$4hiܕL$0QjP. P8W[tVhj%t$? SZ=Ru#D$@R@@hPihk%\$ S>hk%S>hk%S>=RthRhk%S> $ 1|$@VVPWh:n%[) ;wdp#r#t#Qhl%SB> hLl%}hRl%phXl%c=Rt hal%Mhhl%@1hkb%W=SjWQ}e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ ̋'hql%Ua Ueuhi%hql%U: U>FjVpR1Ktljt$"hl%NG$G7r%G #w"Ghl%jNG ${$7r%C(s4C8̋'hl%@NC<{@7r%CDsP$sT̋'Shql%Uo UstlShl%US "UMF$F^ #FShl%U F̋'UMF $F$^(#F48ihi%hql%U Utli%Whl%U "UJMF$F~ :^Whl%U F̋'UMF $F$~(^48+4$iƷm۶|$9`R1Khi%Wtzhx#+tiD$hx#PjL Wl$UVt$t$V6VOu4$V)RPh׬$h 1PP}#)R)t5Ph%hU葿 鋔$ 1$ 91AP蒒uDFl9Ɖr:)RPh׬$hn 1PP"ݖ69ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhch1m%h%m%hhl%蝠L$T$jt$oËL$T$jt$XWV׉κ7r%jujWhdp#Vhw0#< ^_VQ1ɾ 9r^^VD$QtU@8xtlIuAH1FVVjjhhQ0QRx tjhQjR tQ^À=QtjhQjR QUSWV 1WWjR &iPCSPj wR t$ ѕá3D$x1/dev4$D$iƋ1N/ u1FSt$$PA!/dev uDL$DAt|tE`R|$$t.jVjQ t 3L$Nj4$D$/devG4$D$M[1O4$1O1VS ^_[]USWVPD$tPpP11OFtFhb%Pmt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|TWm%wdm%Ph#"hԃ%Vy ^_[]Vt$D$QPNt(D$t%t!h hPQfD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5x"R.@ujPJD$1҅D$t 9tL$BuT$ЋT$P]1hPPhh{jjAPjQQhf3w h4WPZw PM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hSPuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPHD$1҅ӅtwU@t\P,40Ut5L${|$P]>$tL$ST$Dځ8Nut/$E t$ OЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W"GŅjW G{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ RD$$@$;E tL$ A;L$tI1۸hSShsShj D$/devf@/VuP> Q\낋E\tu xt@@AED$5x"R$ttt$PуuN)R덬$WPU[= t$/devfF/)RWPV8= [S,\as)a9aO$CQPU< {PWV)R$t(tt$Pуt Nj5)R,$1D$0$h@hSP5tt$G)RPU#tTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVSc; $WD$pV: l$ Uh%Vq ǰD$h/"WՁh#W迁tyh#W譁tgh$W蛁tUhj%W艁tCh"Wwt1%D$tn%tD$VPS: VWS: Uh%j2q DžED$4$v PS~ t"vh׬$jx jt$t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=(RSWt$t$`}$1PWt$t$G}|$u1@G#R1#@uRԃ%VPWSh"R葡 uVPWShR{ 1^_[USWV |$ faa@D$$1Cdp#=#Rthq%j#RVsPWhox%hrvD$PUAD$hR5Rh2t%j蜙x#RCtW5"Ru#RQWhRVt$D$PWhPt%SF$'D$D$ =mdt2VhRh"R2 VhRhR2 1$hVSŃ t$t$t$D$ PQjVVդ ~;Ƹ PV.D$i jQP誤 e9]D$|$h~MWwB5o ~#u4hPQhR۬ 21ji0pRލ$`QHf@((tJu1SSSSSjSSjjUVjlL4jmoPV>VMktPQPhR3 u`~*=#Rt!hq%jI1#RPjn)D$Wj,>\$tt21ۅ1C؁ļ^_[]ht%h{t%h2hs%1USWV|1ۀ=Rt}hRht%j蹕 ue#RJt%ԃ%"RhRVWSU軜 hRVWShR覜 VUJ#N@1 É؃|^_[]ËD$L$I1@Ã=#Rthq%j#RVt$ D$t P+nVj<m5R^USWVPWj<1F?tih0Rh#Rh|o%j袔uL#RRJt%o%hRVWSUh"R蟛 hRVWSUhR艛 1^_[]SWVPVj9<>u1@;Ro%hRVWSh"R8 hRVWShR# 1^_[ù1@t QIt1ùtAQt 1ùD$QAuQËD$QSWVhlhy1$hWV^ 㹼g3WSChWWh+Wj65DQWjWPVW1I4SP;V"Jİ^_[USWV|$1i/t\1tWQtI1r rr2xP0u&1q1ur1ۃ0݃Pr @뜃|$tB VQBBQ^_[]USWV|$D$L$BJ 0uQ=@Q1۾M&-8QB0t#1urFQtu@Q9u'Cϸ8Q9t0Q4Qt0Q0 5tV\$S裢 Vl$|$);\$u ^_[]ht%hs%hG hs%uSV5g31/t.T$ g39u9t Qt q/u^[V1ɍt$QQPVh0p%> y1t1^USWV|$(1$PPWVh0p% $D$(1PPWVh0p% Z$LF1d$Pj%3$>$ԋ'hd8%Udhght%dhgUdW45R6D$hךjU5R b :'PPqhVjU5Rc7Vjt PVW ÚWD$ P8St$5Ra 5R;5R Sjhu% j D$ PU Uh%_c D$(SSWVh0p% $j h%dfMuQ1AtCjV%* u4Vh u%"1ɉtjV* uVhu%j舉 D$(SSWVh0p%t u$~hDp%jTLȁĐ^_[]1USWVhhJt%=RtPjjh_p%2E14+R0+R,+R(+R$+R +RQg3/u D$8g3ڃ9tQu@ +RQ/uD$/u.0+R +R19hajr g31@|$>ZQM $+RL$ ,+RL$j5T5T5T=#Rthq%jه#R4+R0+R6P5 +Rhsp%ja0a#RWj /D$ttRN1ҋ0t1t /u oBrgQuƃQ4+R1QuAuVwD$u,D$ $+RD$,+R1@Q4+R^/ ,+RF +R0+RQR5$+R54+R5(+RPhzp%h!` jj.~_5R]1 Qtvhp%hVu>h-t_t$FVj0.~thp%jhp%jh#q%j1GQyQtfh?q%j辅hb%`L$QPu{hXq%`$QPfuYD$3$L$3$ t?h]q%h|q%Ugt!hq%j6h|q%hq%'b9裩1=#Rthq%j#R]$1L$VVPQh0p% }t|$ thDp%jT蟄jSe^_[]1F]VD$FVjl,F^SWVPD$$hf%hr%bt@Ƌ|$^1Phr%S9 4$WV Vchkb%S^_[USWV-j3ta1Fj3t&U7Re1tUh׬$h8] 111Fo u1tjh|1@1^_[]VhWr%^t$hPV hhQV) x(QƀQhjr%Q蛄 j/PP>@fr%<+R^SWVhsr%.^QhPV VbQK5<+RPQQPVhox%hWщ jWhk2#F hr<Vyoj< 1hhr%WWh<jHj j j jVWWa84ƣj3WP1*j3V;9W jjot$5Qhr%WV hWr%]$WPS S谫SVj jjn1@^_[UWVj| WW D W |$ hPW~ j Ws<t$Z<+R QtV("RWQPh%hge^_]1PPj<[ USWV=Quj5o3 ǣQ5Quo3P*ƣQ^V=Q~GtOQQW W=`;Qt1QhX QA LVQ$Q$V y))L$H 9Jx .@ SPt$ D$PhQ~=Q-o39|uP5QQQjPak P5QQ QjP(k -o3D$%=@t=ut-QD U1QD8 vVt$hb%t$ =Q-QQQP* QD G=QV V $$QB QfJhVjQP'1Ą^_[]VPt$D$ L$ $tt$VP9 Rt 4$VP# ^PD$L$ T$$RQP XUSWV$01D$$hr%XL$Ph׬$QǷ hr%XL$Ph׬$Q蟷 hr%XPh׬$Qy 4$FPeh$t$ 贈 D$ t$ h@$PYD$\$t$ hS tt1h0#Si 4$0P\P$4Vp] u <.=tSh׬$t$t t$ hS{ ut$ [t$[4$t$ t3h10Ut$FVj#~t$t$ot$t$R3jPD$t PD$t P~Wh׬$h4T jjY#>T5RS1N^_[]t$ Zt$ ZVS11N4$t$t$t$4$VD$FVj"F^SWVPD$$hf%hs%Xt@Ƌ|$>U1Ph#s%S 4$WV8 VYhkb%S_^_[hCs%hr%.Sjs%)1ۅtHq"t]q" 1ۅÉ[USWVh&# Pb D$1Ʌ$l$h"#U_ ti\$WPS 9s?hhb%Sp =w%hVSZ =wjS t@h"#U u4$@1jV 1Ʌȁ^_[]4$1AVt$VX1|TsrLc1f ^Vt$h)%VmZtVRt RR^WVt$ D$wǃr9t\?tSPQjhD V5TAV5RAV5TFV5R75T 5R5T5R^_WVt$ V8 u.>vg0/PVWhss%hԆ3Ђ s%^_WVt$ 0!PpPGt$>FFVjSF^_SWV=g3/t/t$g3GtPVXt /u?É^_[USWVj$t$ 21ۅtKƉ|$\$FUShSSj WVw $Vtu;D$ rj$V1ƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jU tMƅtPt$Vl9 SNVUP tP׃SV^_[]VPT$ D$t$4$VPv ^À=QuaQgq"+Rt%D/R(t%+R6D$@/RG$8+R&q"H/RSWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW $L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPl $LL $UT4L$ L8L$T$T@Lƽ$$hVWUnP uD5<w |5L Ku1PPD$P )ƍD$Phd@VGA |$D$|PhedAVA V4f$1 GaD$P$,ht%t$Vx 1PPV $C]su PUhhQt$t.QCD001 Q1 u=QtZF9|4$Eja$,h1~%$0u~ EPP膃 jOhQD$4Pm) D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h1~%uB~ EVPhɑ$P,~ EtE @E w-G$9@  VL؁^_[]1D$L$I@PQwʀuQAuQ Q1USWV$$1$hWVX E jSohWWh+Wh5DQWj jPVWY"4SP6VJ#1Ĭ^_[]ËD$1ɋ0t1urQA1ËD$1ɋ0t1urQA1USWV ։D$ $6D1$  D$$ ,$D$u%[| $D3u%uOu%D$$(u%Bu%uwu%D\$$@+R \$\$$&HD$\$$)|$=0R=#R=@+R$ <$D$D$u%-<$ q|$4$D$ @+RD$ԃ%H{ |$D$ 0RD$#RD$u%=Qu$wD$1Ƀ o3\$j3C|$D$$$8%@C\$$({|$!<$D$@+RD$j3S=o3dp#|$l$ D$D$u%$niljl$4$% K=Qu $>vD$|$D$$$$8%B\$$' |$u1=#R=R=@+R$ <$D$D$u%+<$ t|$4$D$ @+RD$ԃ%~y |$D$ RD$#RD$u%$ahuLl$ t$<$D$?x%@h$ \$<$D$zx%%h$" l$4$} > ^_[]Á=m3ftp]Yf%=m3PFSWV|$tyQGO4VSiItRV< t{S5QQVhQ5Qh^%hSn jShk2#+ fGj3~"PEptV6V=1^_[ËD$ QƁQ QfH QfH1SWVt$QQV~)S4:Q FQFQF1^_[ËD$L$01JHfSWV1ۉShPS$ CtD$$Pu8 t V臿 V8VsU81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6Ju61^_ðt$hzd@t$  SWV$1ۉShPSWVt/S$SPWH6V衾y #U81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=(R1SWt$ t$L$ T$BD$T$SWt$ t$BD$ ׋Rt$ t$(莌v%L$\PSWt$t$,t$RPPQj $(R1WSt$t$0BD$T$WSVt$BÉ֋=Rt$Ht$H$PWVSt$t$v%PPPQ=j $VD$`Pjhg1@USWV u C(D$|$8hjWN wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@ǾP'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$<L$ tEH/uj#EH@EH`L1^_[]/EHjSPz EHHLSWV t$ vDh!K&WSNa 1WSSPPjjh< S]FDNHA`1 ^_[ËL$Ahh1USWVL$AybRb+~V|$jPWRUvPQd@( m4)WP5Rhv%sT1hhV)P5R5Rhv%sKh^_[]Ës=Rh)PWUhv%VҋFHP5RUUSWVP $1jlv D$~ 1ɋT$RL$ QVPL $@L$T$t$(t$t$4t$ 4$vP|$,|$~1ϋ^1 u)~3|$u|$ t|$ ;>t~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$vjD$F@ F5|"Rbpe^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|lr94$ukGllPw?GX FPvt~C $i)ىQRPI 1D7D77rfD7 D7 lr4$~Efn'  V)RQP fNfF V ^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A ZOu\$ QfA |$tArfAAlr 1AA tAfAAs A sAvfAAQy) 91jEVVh7|h]yhrjJVjVQPhQ4C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Chb%P.uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0$ƋEp$PVjWGU:ƃu4UtUƃuEtDjUуƃu:C(C,SP{,1s$nC$10s$SC$s(XC(1ۅÉ؃^_[]hWv%hBv%hlhu%T4USWVt$ kFllPv[Nj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ ! 1/D/D/D/ Z{l$ }$Ffs$fCEfC S USى1M1^_[]WV$|$hWP t,1HhWWPjjPh+ WP1^_USWV)Rt$ 1$V蹕/} V7$T$GD$ pjVvD$D$ 1ɺ<t$t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$S )Ɖt$׉|$}C;\$$G\$PwI}Ɖ} w$pfXGklPwڻUG$D$klD$щT$E@ډT$)|$T$ω$PVQ E @D$\$ )vkL$l$klPRQ 1WSV!1 t$klPSt$ 1 |$,taE $L$T$уhT$r0qЋrq؋2qԋr qrqrq܉A $ẢyCl89ut$T$;T$ L$w1ɋEfHT$M Qf@ PL1K&L$t$ 1L$t$ Q>V諗؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWdp#Vdp#RPPQ: EHemL$ U UWRPVQ tD$8hL$8jPPQb $l$P tRL$8jPPQ Y0ƋpǸdp#<$u heL$8T$ RUQPWVSjjA$jB@ɑ$ L$+5RPWVQI jCL$5RPWVQI j-L$5RPWVQrI jDhV"Ńw-RW!ãR~$Uj-P- ň$E Eۉ4$~Sj-P- +@$QPhfw%jPSH -R5Rj.SPWVt$UD$)PD$:PD$KPhw%hhQH 0h8%'^_[]USWVUu @(D$=RujR]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;QD$0BD0 Cfd0 j5(Rt4#LdI9LhD$$r1CExhPSt$t$hw%WMA9QD0 tfMCfL0 L$ D$$(R1RSD$PL$QD$T$t$,|$(1PSVWdD$T$ t!|$ t$jSVWCT$ D$1L$0]D$ uuut$@t$@hj2j3j4Nj $Ut$TBDL|$D$uCD$0 ttt$ Vhv%D$DP;p D$8D$ D$8t$XjVt$(1IQjFj QP D$89D$ t PV$Pl |$YtZV MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWVrA )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Qb ơ(R}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP/ $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋(R1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSfD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hA$jV_8 C `L$rL$DPhv%uL$DPhv%jQ"8 D$D---D$D$sRCjOd SjPX ƋEx tjPC SjP7 1jQ' SjP ÍD$ tSWVhv%Pj SVhv%Pj VPWGS>(RD$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hA$j$P6 t"?tt$ Whv%D$LPi D$@D$ D$@|$tjWt$`1IQjFj QP` D$@;D$ t PM$PW{{ t|$uuxD$t HL>@D> >jhT> wE%rh;D D$uR1jPPPh/hPj jjj%VjM}4x!t$PSWgVG1@^_[]hv%hv%hhu%jWVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ p'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS9/ t$]EەfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-h%jlu t1@t= Rt@u.1}hjؘu tEx y%rty%ty%M u@=Uu,>t'D$ L$)R;\M`|ˀuK(Ѓt tu tPjZjW kƍD$(PV$1 $$QPV|j $Vk9$ul$`=u]tP$PSV $5fǃU'V:kWh׬$hy%f uGe^_[]SWV0\$@1҉1 F FFF = RtjP4D$VjRRSD3<^_[USWV)R(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hy%jt1e^]USWV8= REM 0~klP1ËE E8؃lklQSP' ߾')R$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C ,SPSU u |==l$UhV uUc t$V|$Wh{%N RVWh{%P 5Rhr%50NPVhox%j[1PP.rvV&D0$ t$t$Vh{%hW> t$ RtWh{%P 5RlWh׬$hr%k 1 ^_[]SWVt$|$Fpk1V|%t|%;JRtSh1|%P 5RShW|%hD|%@k WV1^_[WV1|$hVW& hWVhd?t[hel#R`$jjۭ#R {%tz%WPQhWh*{%h 1^_iy1hX$o1hhz%hVUSWVu|$\h jWD t 1Tp3D$D$ Fw$'}<+Rhp3CzPc:^j T$D$D$PK Ph؎'jK0RPE K0R|p34 Rt P}t5hy|%h4 Rjk 9t?h|%D$PjL PPho|%h4 Rj04 Rp3D$Pt$h|%D$PjRt+L$L$QD$Pt$ h }%t$ D$D$PD$t$蚡|$s p3>p39;FKhRhRhg0R# Dp31ɋFtu:v߅t$1G GGF G D$ 0AD$ 5T1VV5T 5T5TʁD$\hLVVhHh:j&jFVjVWPV謸4ƍD$PV腪V虹e^_[],Rh6jPR/xVFuhKWUSWV|$L$D$pƋ%}%|$t0}%SVPUW萣^_[]USWV`5T΀1WW5T 5T5T蠀D$$USWV D$ =D Ru RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSv F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h~%h~%heh6~%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$p1Ru }p1RD$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth|1Ot1L$D1 L$8ɋT$]t"9tjQP T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(p1Ru {p1RD$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$$'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh|11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut~%1^_[]Ãt ux(tth ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD3 l$(Ph%U h@$U [Ɖ$Uh%j q D$Ph%Vp wXw\w`h(%VpPwdh?%VpwThP%Vp f1ۍ{aE4@'WuWuWh[%Vyp E< t<uEMPWQWhs%VRp$<IX%9|<1#PV+pC9z1hkb%WpV D$PD$Pt$\$4Sh%h%WS1(^_[]h\%hD%hBht%hD%h1h%hD%h h%hD%hh%hD%hh6~%USWVhjr{1O1ۍD$ShPS$4Ɇ9+ōF,PhedAU l$$4$0$($<$8у|1҉$$ F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$ft98t4 .jPL$QՅ D 9D$ u D$4$,$F n$9Љ} 1F$F )ЃF n$,$G9t$uD$$h%jP r=t31>t9>u 9>t0uk9uVΈVƈOV辈UC1@19$,|;ЃV聈t$C؁^_[]USWVHD$1Pu蕄Rhji;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d\'u } FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h\%h%jg6ht%h%jh(h%h%jih%h%jj h%h%jkh6~%jD$T$ L$DrRQP) ËD$Djt$ P蠣 USWVl$j/U 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=D Rui"sv<< R h1Rl1Rtx(9w4Ju1AQP~ãl1Rh1RH h1Rk4+$1 4+Vh!K&jR 1D+ <+ hthVPh'%jW 1D+'<+(D+($D+,t+0^_[]V΃=D Run< R) 1t(@"uh1Rt l1R9t 4Hu1^USWV|$4L$0Rt$`VQWE ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=p1Ru hp1R~V19|(1@@89|~@w1A^_[USWVP=x1R|$(L$111=\'"\$uӀt0t u@ tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h\'t$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVihh\'h R  Rl RH11Kj%mƃwD'DtGCuޅtH=t1RPlx1Rt)1ɀ<t  'AuV8}^_[1V t1Rt(x1R1t ҡx1R t1RF9rx1RP|^fUSWVPt$p1h_4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hox%jQQWRjjh%x,1^_[]USWVhu}WWPHD$T$)RL1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv)R@u ǀ@>1t$(F F>D$,Vt$-|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W/D$0F;trԋL$4T$B9rwP.|$4r!1FD$0P-F;t$4rD$0=0D$pD$6ٲD$vʲD$  dp#1ۺL$#PWVSh0RQ t$kPWdp#PShPV )RVL$'Qt$t$t$ t$PPhc$h8%)R$0$)R$pFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC|ffC C CfCC=t1RrC fC*C,G1ۍD$(hvSSSSSSSjjWPh裎48Pt@,at$VWcWwFuQ1K5 R9vt P'vt$25 R v1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h%h؁%hyh%޸USWV$(E]0 ƋEpljl$E@ t Pdp#PWVSjhX1U5(R|$ wwح w%t$R5RRPSQV U5(Rw$w 袭l$45RRPSPU G\$skh@SjP4@ PVl\ Rj!h&%V蝑 VThF%L$5RPRUQe hƦ$5RPF%PUS: h蛦PSD$PhG%hh R 1҃9Q\ RA \߉$4QPWh @$j$W hWh Rwh Nw@EƆ\ R Ft3N$t.1@Ƅ\ R-H9s Nr,\ R$EBL$ ;QU RVhY%Wg Vh\ RWg h8%vİ^_[]USWVX] E81hdp#PPPPh^%PP 9_ vSL$QSWPL t@D$ tWD$8uN Ruh RD$9H*hdp#Vh @$Epm+D$8u RPt QPVW҃(R1VSt$t$ΪD$$VSt$t$赪L$8QRPt$ t$h^%Ep{mD$V9p1h$YQVu WPTtY$UtOwGD$VPn)vVQj Pw W@ )Q$YQPte H LCF;puD$VPh׬$Epl e^_[]USWVLt$`T$d\$1*kvs0C41GPjhq3  9u vEL$QVUPL 1hPPh)h!hj6Pjjt$(SP蒀4ōt$ VPbrUvSVh~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5 Rh|$. RL$`ʉAfAD$ 1Ƀx fJ1O Sg1L^_[]USWVpU t$01^F4jj`1AǾ4'D$ǃ@'SPHD$ $)RL1OًP|T$|$`1 |$0jP4D$DD$ (R|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ h˃%jt$TW~ $ ^_[]USWVՉfD$/D$jh%D$5ht&_8tUSPhԃ%hU豽 VSUP 991j/Uz t5ÍD$9tK9vH8/t@PjV CߍD$ PWq!D$%= h$PW  FƄ$/u&t$QPhox%hUɼ /h$PUO hh%UO e=@uWU x*|$VW$PbO 9r>?0|$W WFΤ01Ĉ^_[]hUB t}/u }$$tcD$U虔W莔Ɓ`|$tVhb%UcO 9=VWUKO 9%|$W x(Wy 7>1F1S0jh+j赳 SWVύD$ PQ1xVD$)tOjW x@ljj PW  W  u $=rɁ uƉĜ^_[USWV hljPhW@jl \$hjS? jhڃ%` D$ƍD$ PhW@V t$1hUS ,$'tWPxu- RD$C > E,$ !u1L$PPPPhx jPPjjj!Qhh4t$t%j荋t$VWWZWki6V  ^_[]VD$@t(L$ 4@Ƥ'VhW1( F R1@^ËD$ RfH襌 RtPPQQQh%jñUSWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj WY>D$48T$y:D$ػ˺{$L$~D$<P t3dp#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$dp#t$DRQPhS%jV訶 D$ T$Bj5(RQP"dp#t%t$DQRPhS%jVd D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5Rt$hox%jt$hVD$XP1WWjjj0,(R|$4D$0)RL$QW<W,D$DPV{ljӍD$DPV7|$߉څu D$$H؋Pٸ"D$<ho%t$|$,] {t+[1hb%Sʏt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$hox%jt$hVD$XP1PPjjj0菏,j D$DPV D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW詹 )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5(RPQ7|$ RPhA$jW; ;RCV蔃SjP jPPh RE VH(^_[WVt$ 5T^5T)~$uFjPAF$1O~(1h RQQhhhRjFj WjPv$h Rl`4F(x;F,VP@Rv(Rav$0HF(F$~,v$HF$1^_USWV4ˋA@Pjq$ C{$t%K0 u G fG lJuD'fG G5Gp!G G, #G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QP^+{$4^_[]V$j)Nv811Fu >tlIut5t.j+j, L$PVh%jPQ舯 'u tEj,j+݀L$jPPQ_B h<1#臁j*趀L$QjP2 h8%`j-菀t$R5RPhɑ$jFV j.jhD'PVhZ%hh Rޮ İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5(RRQL$RPhm$jQe G<(\(|(Pu#]j#L$>PSWh w%j&Q%j5(RSW贅L$t$>QRPhS%j&V $F|(,u)|$hhMPhy%j(Wέ <$1e<(Ou*?D(Ltۍt$hPWhv%t$t(Tt(P/PWhɑ$j(Vi 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%vGt 4$C|$|$upd^_[]1؍L$>PWho%j&QЬ  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h}t$PWhv%j(VP 4$h}VjP lj|$D(dph}}PVh~%j(W *USWV)R$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá)RH1WjHDWWQZơ)R$1$ )R@u <@TX uDHXT=,RtLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wdp#WRPPQ1ҍD$*W Qdp#QRhQPeD$$W Qdp#Q1Qh0QP=&)ߋ)R0{D$pzL$$QL$.QL$QPt$SPW+ )R0zNjpzL$$QL$.QL$QPWSSj'+ h8%j~0{z|$phzG$DŽ$$T$0<$tT$@BfBBY%ffJ B g%BfJBu%B fJ*B,%=t1Rr~(uB0fB:B<%@1L$0hvWWWWWWWjjPQh W4t8PV@,a$PSHSW$X(؃u )RTXK$0'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VPz*D$0VP9*VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u hb%P2T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5)RN t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Ohb%D$ P;wt5ho%t$ &wu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0 R)ދ$R\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$还 L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A5|"R 1Fh%h %h]h%sL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4NS tt<1^_[USWVGD$5x"Rl|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 11R9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX((AL$D$~@ 1ø11OT$LhvQQQQjj PWWSRh&v149tBƍ|$WPK#V_2x#9}(Rk<4LE1UЍe^_[]USWV11RT$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=+Rt*= >R11M<t9\@u 9DDMHEr=+RtO=RD$PP1ipt$1t9 :ut$P9t:,@uލEpr=@/Rp=RJ<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@ >RD WVR1Ƀ|t9TtPH= u#Oи0=R8zt9JtCu)Ή7 >Rr4)΃؍L$tu)y8u.q$t"y8uqxu Hu^hU#hW%hm h%ZD$x8u@hU#hW%hm h%ZV R; )RtDx"Rt99t‹9u€x"R2t x"R^WV΋$tRttN WhՇ%h.m Wh%hm tsH@#Wh%hl u`tQ0|@Ru+R=@/Rt$hjp=Ru@/R ]p=R5=R<^=R=Rp1ɉ =R5=R5=R==R=R5=R<^=R=R8 =R5=R5=R==R=R5 >R<^=R=RH =R5=R5=R==R=Rt=R5x=R |=R=R=R=R =R88=R=Rt5=R=R=R>R >R 0R,R11E1|$<|$э$$0@h#Vh]`hZhZjRjKVUUPWh( 4(RSWW (RuW )RtM$t?x"Rt6xuhaBjt VVb (R (R1H^_[]USWVD$ T$t C@(R5x"RtA$txuPdž$ytƆyjhv%躕=@/R\$1ɡp=RL$iɐ $|1 $kt 8e 8 8M$Ѓ 8QPhԃ%h$P\o =x"RtAt*GL$xQPItuƇy1uRy1LPTX) p=R $ف8Rǀ,ǀ<j\$|SP R"hSP 9=x"Rt R Rǀx"RWRWjPS Ft p=RrL$AE\$ x"Rt>yu)x"R9tЋ9ux"R0u1H|$5x"R,1C1҉T TTCD uk<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D u$k81T$5PWW1ۈ\$5$4$4?GL$5Ph%hQf <$o@}t$VU$<Sl Vh\%S] 1C8Ou111$H4$8 8tsuV4v8)ω$4VRQWh%hS7f M1T$5SPP$@PGG t$5Ph%hVe }AI $4jj hdp#QPjSDSVh%Wuh+t5$4Wh$SC WVS8 Wh.%S) uD$ L$ $4jj hdp#QPjW躚$4WPh%V$4w$h!K&Vn |$$4wh*X6WjPL ƋMjs,s(D$AP-VfuhN6Ph׬$V Euh=uhV51T$5PWWWT$5j SX-4^_[]ËD$@0RUSWV(R=x"Rtp1NxtZ$tIP$xt.jVVQtPu wƇxu=+R00|$1ip=RPi=Rt(h{%jW[c h@$Wg t$Wh%j =Rt(t(l$t( h%Vh‰%V0==R\$t$| |(P$PQq D tWL$tN1FVVV1Wh$,WQPRx =R T :<$VVt$j1WjQt$RD$ Px $Ph#V1 ==R,MQhЉ%V0==R\$| |(P$Pp D tYL$tP1FVVV1Wh$,WQPRx =R<T $VVL$j1VjWt$RD$ Px $Ph#Vc ==R,MOl$ t/$t/ t/t/hމ%V1h%V#hkb%1VW9 Vz=Rt(|$Wh%hY\$t$uq =Rt)Ph&%hYuK=Rt(h;%hxY u,=Rt(hN%hYY u =RD(Fp=+R11 >RPt4 >Rt(RL(@t㋉$tً1CSSS1Vht$-Vt(DQRx >R H4$S1SjSjPp8QRx >RD(PVPh%hQXi >RL(@|D(NtR1Nj Wh`%V =@/R^@111 $D$ip=RP@p=R 081tsuL089\04t$1Ɉ$$|$ |8tkPhҊ%jPlW p=RPh%hRW Ph%$U$ p=RQPU p=R8NuL$L(ɍ$~,Qh%h|$%W^ hWV p=RL$L,ɋ|$ ~,Qh%hl$%U] hUV p=RL$L0~,Qh%hl$%U] hUVT p=Rl$$QPVh%%h5Vl1p=RD$ $ 88Ƅ$48ntyPh;%Ut$%V\ PV$ P p=R$d8ntyPhB%Ut$%V\ PV$ Pa p=R$08/"tx0#Phx%Ut$%Vq\ PV$ P p=R$t8ntyPhI%Ut$%V*\ PV$ P 5p=R$,8U4t4Uhg%ht$%V[ hV$ P 5p=R$,88Ug4t4Uh0{%ht$%V[ hV$ P5 5p=R $X8l$~4PhP%hUF[ hU$ P L$ 5p=R\8~~Ph\%ht$%V[ hV$ P L$ 5p=R`8~8Phc%ht$%VZ hV$ Pd L$ 5p=Rh8~8Phj%ht$%VtZ hV$ P L$ 5p=Rl8$~pPhq%ht$%V'Z hVU L$ 5p=Rp8~1Phx%ht$%VY hVU L$ 5p=R7 878h%ht$)VY hVUY p=Rt$PUh%hBRD$p=Rts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=D/R@D$1HD$$D$1i8=R$P5x"R\$ "$x 1ۋWSPQL $($0}U$Wf W0|8/tW0fDŽ/=R $< R0P$PW1 t $L|$$t0|$t)$P[0t$M09Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4==R,$V/ PVhԃ%hD$)PV 5=R.dp#tw0#PSXe >tiD$Pt>Sh%hmO$\$ =R$DL$4L$0=R0|]t$VxPh%WN =R( ( PQVh%WNt$\$ CCa5=R.> >,>(>$> D$)Pt>Shދ%h[N$$(t$,t$(r Rt P(R1`RtWWh)%ChbWh%hԆ3Y Rt8Wh%PY R1Ntjh?%PX ^_[]1N=H/Rtt$h%jP|M SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ )RV;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$$ytPhptYWtDžtFE tWPV u WVjVSB E t VPKVE1HPPSw ƃx(R0^_[]hU#hW%hm h%C5USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4d'jP8 D$$tI܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP$ Qkd)Qh%VH ^_USWV$h_E|$hPW $$$Ԗ'{ha VPh%{hbvvPh%W[hc1~,t[hd1~0W[heǃ4Vuh_bV0FT~Ph\#hW= shf[hi"1~`{hgvXPh%WF\~Ph%hWm= shhmFd~Phfp#hWH= shjHFh~Phfp#hW#= shk#Fl~Ph\#hW< shl\WPh%V/[hmB1~pP+PWh%S-^_[]USWV$@1N R$qT$' 1jWWVVjjhn|Gl=Ol)R,1۹oWS<S1,G,10G041jWWVVjjhp 1`G`rX"s\td uhD$4hfp#QPp; 1PD$PPVVjjU, D$Pf x1pGp1^_[]1wwVt$F~|F Pt1@1FF^SWVT$1ۉZBr 1Bl@Zp胬Qkd)QhĈ%VOD ^_[VuMU D$t$$$Q1e^_[]f=8+R=H/R á<Rth)<RVt$<Ruhv)<R9w1 k<DR^Vt$=<Ru hC)1t*uHR <RtDR92tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%h|%hh %SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$LRuh]LRs1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IO sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW &Ow$$$p'@21^_[Ã!t*Wp1@<QWPV rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Phҍ%Qv* D$D$uPhٍ%jct1ۉ؁^_[]E@USWVx$ HRU $=8+R$D$d D$`t$0ShW%jP Shi%D$dPjjDjǻ<1#St$`SjD$0D$XD$(D$HD$D$D$4D$ D$L1D$$D$TD$PD$8D$<D$DD$@|$\$D$y1$D$ D$D$1h0#V& -À8tt<L$D$j jS~ lj$hA$S& L$ ٹL$ L$Xuj jS8 D$D$(|$t#D$(^j jS D$ T$G|$,|$,D$D$(|$y|$ythh\%Wر hSWɱ |$,E1Wt$4j WS袃 lj$ teD$ʉ $tTD$ D$tJjh7A$$S' tOjhEA$S tdjh(A$S tp|$uh<1#jE}D$0wT$ ׋ $L$BD$DT$@|$<|$TL$P+|$T$D$P|$D$4|$\$|$ $D$D$$j h'$P^ hj$ۍL$ytȍJ@j`PQT$(蟯 L$( $A0y,D$A8D$ A4D$Hu6|$d\$t/ȃt$`P L$$uD$H\$ȋT$Lt D$ D$8D$ L$L|$ظD$$D$Xh<1#j{D$0T|$\$JD$ D$8D$<D$DD$@D$D$41D$$D$(D$ G,D$8G D$tPvW߅uv^_[h%h%hh % D$ph%j iSWV=<R5DRt^s蕭3苭tE#$t$j(PV{ 4$I_u9ht|$0VPhɑ$jxWB WVV &t Ĩ^_hu0&he%hh %' USWVσ=<Ru h 1t0?t+<Rt!-DRE WPF tt/|$thh%SA !hvS, u4$$$$$St$hĎ%j ^_[]SWVD$Qt$Rhَ%Pjh<1#t$m$jh'P uWh<1#jm$tAt$h0#W/ 8tjt$2h<1#jim$ut$O1ۉ؃^_[USWVӉ΋|$|$tBh%S h%S h %S h%S h%Sp h%SZ h$%SD \$h#S* ǀ?t()$'WP uE F@j`WV -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|h Pl$ 3hfp#WU WUUjUR H>wѻPD$x0hfp#SUj SUUjUtR H=wˉ)RDD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áPRtr.PRVt$ PRu X. PR19vFt=N`>Rwu1w >RkR^ËD$Hs-s '.hU#h%hh{% Vt$ =PRu-(t;u2L$ rȃs'$tu`R1 kR}R^WVP|$t$=PRuJ-j PVc =v1t-h t $>Rt4 >R^_Ë $9u։^_-=WRtWRù^-D$1ËL$T$t$ h6.WV D$$s1!t$ T$L$7GWhQ. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jhM-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh~A-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phg,D$PhuI,1\$}UM;t;Gs} Sh%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vhߌ%h$P $L1QhPjVx`WhydPA D$VTR|$t;jWS1 \$;MU}h%hڐ%h h{% 1e^_[]RSQ Shh%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H >R)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVf )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt RL$)1҉B=w Aɉuu1H%|$11N1D$D$ wBtR)1@w r҉utH >R)1@w r҉ut$ >R)1@w Wu=u1HMD$|nu D$|$ D$‰T$vT$;T$ t$|@9t$t$}4M Qt$q 9׋D$o1HMA6r*1Hu#1T$ɺ )ʉu M19V|ȍT$4M It$pL$jP}wPV%U t$p1;rB t$D$4D$D$8D$<B >R)Aw r҉ut$tQ >R)1҉Bw qɉut$t) >R)1ɉAw PuKExD$1D$ 1VQPWӽ L$ )NjD$ 9|1ωD$<|$8t$L$@T$DD$ t$19ι})D$ t$@D$D|$7¾L$8uSW,&D$8@t+4t 9tQt$P莀 47L$4hjjPğ D$4M{t 9CJuD&1T$8L$t$ЉˉPunlj\$(#D$$jD$PVWt$&>É1 u:L$(#L$ hL$8QPʣ jt$VWt$=ÉW~1 l$\$t$u0|$,D$$P~9L$4^_[]h%h%h h&h%hh{%M hU#h,%hUSWV4$L $Phjw$X$T$`ljƉ$H s |$ G1|1M1ۋD$ Xhǀ?ǀWh>SU @$\Cǃ1:k0hWV D$4WhPW$XxD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(;tÉ|$Uk#D$0jPUQt$(;1 Ⱦu#\$,hPt$ N W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,͞Po P肞D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhj@rtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x P3tn{ C K$;}sL$4QjSPL t_D$HtW >R)1ɉAw Puu2S"j@jP fdžUSw1ۉ؁4^_[]hC%h6%hh{% USWV4D$L D$PhjpƋl$X\$T|$Ht'Wl F|11Kn^؃N$F Fdž?džjh>USȷ @džPW;st%D$ D$D$D$F114^_[]hC%h}%hh{% USWVhED$$11@D$RVh!K&j S [Ћx'Cԉ0CC TRPR`>R5TRu^_[øw,RXs"ÍurtuÁu ø1@V΃=PRu)1w$>Rt  >R^É^USWVΉ< >RT>RQh!K&j U ,>Rht4VPh'%j(S k[CC4TR`>RPR5TR^_[]USWV $q011ۉt$tS9tzE|$ t&1ɀ8>@,19Q财vPW9d D$vP6d 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([R)1KCw pu9r1K1iQi Ŀ9<uT$$tF |"R <+t$<$wW _A t&L$ ɋT$DŽ BSDDŽ NetB4^_[]USWV qQq Q$A Y01$L$1튄+th;$tt tЉ^_[he%hI%hxh{%豪 USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]USWV0$H$D7 15$R5 R5(RD$D$ D$1D$h%WU$R pu U(Re~ft$lt*zD$ƒbtCeubD$벡UD$ ChjVV5Uh%4$R RzVhVV5Uh($4D$Vu=$39}4D$$D$l$ t%1PPU D$yUh׬$IL$ tHt$(Uh%V] hx0#6^uRh%fD$0Pt$/ #D$8=$$ $R RjÍt$0ShV u UPV UjD$0 $R RSy hՓ%t$(g\1|$P^y h%H y h%vuWjt$.^1St$^4$4t$(%Sh #PP3Ft1h%t$t$]4$t$54R50R8R|3|$tԆ3tq1.SPt$  y 19u20R4R)u 8t1FVh]%1FVShk%VFt$,D$D$L$D$ L$ D$|$tvD$ P%ƋT$ уƉǃtωÁtt؉D$ u K 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj 6 U6YL$ɋD$tPֺ Vp P hdp#PVh%hԆ3 j襺 V jVק jRN VP>^Ð=lr3u Jlr3pr r11ݜ$D$8d|$<) 4̠'RSt$DhA$QP荼  $R Rȃ||=4R0R݄$|=s4;T$D$r(|$$\$ ؍4)hc$؍4)hV$QP ƃ}u 4)h<1#QPӻ ơumFOKu$t$1VQ$Ppu%h%W 8t 8#u$SjV}q tGtV $1E48FB$)Ex t$7@[h%h%,芝 h%h%s 7h%h %FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPGuh/%h)%\VÉhPKt4Vh4jP5Guh/%h)%V1H^_[USWVp $$$!19L$PVW1Hl$U ƃU VD$PWs tb$UtM$Tt訬 $TPUX t$jWn tu)$j4'WUm 1Hp^_[]Ë$j-UPE D$L$PjD$L$PjSVt$ t P닆t>PvG!džW1ۃ1ۋt9P+Gdž t^[V: VN 1u 19^SWVlT$|$$VPC1Nt/ǍD$P PSW t W#l^_[USWVӉjh0jU ǃt{jjjV轕 L$ FG#tdp#|G#tŃq%dp#dp#t i%؉dp#t%|$udp#SQRPhy%jhVo ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQ l C$9u1$WQo ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)5 jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$P'k ^GNON1wOWhPw cBvEVE1H^_[SWV$uSh%h=%&Q $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6– 8 贖 89h%h%hPNF G8~ ~u3FVhjv ;Auh%h)%Pt6hWv ` t%uhɕ%OPWVu  s V^_[WVp׉$ftPhY%h=%O jL$PQW@ jjP PjW tnjjW~ t\PjWj tHD$|PWV t2Phjp @u6hY%h)%N"hY%NWg hY%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jWkCjW`C5^_WVPt$4%@5@u^t8tW%V$%8Vhj%B#45@ubV,>jjP,6 u h%K,odž,sh%[KjB3 t1t3u5$09$ ˪$1Pha%J 9$ ˪$1PWh]%J^_WVt$ hD#OK8r4@84^_6t8t uh%W蟲j;A^_WVD$  uzuq0x t-@ h%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uh'%ID$n D$SPU6Yt,Ǎۉ,$t1j@SPA: SUhN%JI SUh<%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P} w_ǍCWt$P` ;)QjP芉 h{%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQh%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYh$%Q{~PtVFDtt NLtM{#tw%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h,%@jjAVB u h,%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC PhT%>G$C$G>C>>l$ tك**PWQX IWtsDtZƃx t@ Wh&%A>WhE%k>1Bj FNt*HN+躄  h=%t>1KtJV @1} 1KGOWtQWVl$ GT$tIO9tA tBShj%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhhpd t$h%h~%<$1Ph%<1F\$ MbihS$(  EuVh%o<u貂 87t 訂 8 uF띃tVh%@<D$$ \XPWoB5Ƌt8t* SVAuSj$(= ҋ>$ 1GOtHONG PtFA),uUGGtIO9tA tBG|tOxD@UUP# [,WQjj0>[V/t?t$VtS? t@VS@ h%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/菀 7 Vh%h5#B:T$1|$`F(f9t(~ tωӍV QPRh %9ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$IP\$Sh<%:9 <PUt$W"PShY%9T$ V>t*4$QVR H^_[]USWV(|$H\$@?hv%W;q )h%W%q t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkb$3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtUm t|$>@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp  D$l tEl$9u9l$ D$ D$L$$ tT$T$tt3uI,VhE%T31Bj$!#L$T$1Bt$sD$L$$L$ D$ @UӋ|$<1Ҁ|$ ‰SVU ,T$9|$<4tt8tPT$BT$9|USWV֋l$8 苑4 48tt84G@81ty1C td 鋐 tG PhE%1jOI9u$1^_[]SWV׉΋\$tu)\%t1PVZVnjVSud%t[#PV^_[Vy t\΋t V5t>VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4S]h tE9uD$ 9t9~ ux<$hv%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uhk%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/XhĘ%Sg hv%Sf l$$hWU/q jDž0ݘ%pr31K$ 8@DjW9u1,1@PPlu1AjjS uD$$l$ D$D$ $\%t%Uh'P$V6 ?u$\uYM'4tQ6uD$럍Hv H w?$ 'U$Tw$'D$ ߝ%D$[D$PxGD$ %D$2 $\ $$$$`"!5U $`D$ Ɲ%D$D$ ؝%1@D$x ˀFD$9$3t$ZSX-$`q-$$h$d$3)$|$t$$V|1UUUV;Å$U$SjVFދ$hS%j D$9$3Vt$(VC$31UU4V^;/$$Pjl$4UAF@h% 1h%$\u($\uh%辻 $XL$9 $3%ދ$HS` 6G#|$tdp#|G#|$l$$th%QSh=%j+U $\$hd'h˘%, h% 1dp#PPPh=%j+l$8U蜇  $X$\$X $3|$tD$$9tD$tnU荺 C$X$\ڃt@  u% 艌$\$X@l$$$hb%uh2"hW%0)k"$jj tl Uh]Kjh<'$o!$!|$tYUHr?Pt$h%S( |$WV}mn 8$UǨ $X$\$X$\$3T$QR$4A $$Xh2"hd%l$$4D$t<t.<unh%褸 D@U uDhf%| LHU[T hs%Z TPU5{ $Km (Sh"N' h2"hs% h2"h%,'$l$$$Zu UMuh2"h5%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t P}\ $$Uw$U(UH$;pr3t P$\P@1uhF%%$\t3$Pt'jjQP] uh2"hT%%$H'$`h|3v= $$\$S ^_[]Ë$r,u'$3Qj$4J $u*$X1PQQ$ $$[@u hؙ%$$VU h%&$$X0 $\$X$\Uh]Rjj$t'UhRj$$[h2"h%h2"h%Vh%#U UhMj2j$rh#i 8th2"h(%#$Xi L${oZi 8 L$X$\$\l$$hhO% u!gi 8thO%h2"h^%# hhl% u!/i 8thl%h2"h^%" UtUh2"h|%Uh%^"1$Xr;$\@ щ$X$\U]tePh2"h%b"KD$Pjh0j1@@ B|h0#%UPh%1" 贪$X$\҃ ׁ u$X$\r>1r$3$L$QPU $X$\=%r $3$dp#dp#tG% tN%WQRh/&>UY#0t$$1:D$OhPVu hh%!VhOj$$uh2"h)% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x u%%$4P; C$$|$9|-h/)&D$L$$PP ƅUQh%虝$\D$L$$PQ&l$$UhNj$\$puh2"h)%I$$h2"h%%h9%&h2"hU%h2"ht%h2"h+%l$$t׃z Ruh$\hǛ%PHD$$P$Zh%tRj$tKl$$UhNj$\$9t3'$\h2"hΚ%h2"hٚ%h2"h)%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$RQ Ph%V$X8uDu4$\@h%PED$$Pl$$+ɍl$$t#%@tD$$PhQj$t$D$(P4$01ۅ~ tVh&jj$vP` WVjh%f%t*VPiuVh%Wmh%f%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQ u!h%hT%S j^_[]Ã~+ajjji ˃ph˝%hÝ%h% 1m>h%h%h%W <Ph%>h%h%h% 111dh%h՝%h% @+X1BWDP h%h%h% 11G18 4 ى48rPyWeh%hܝ%h%L t0LvPh %-Vt$VjtVhMjdjQ^jQ^Vt$V/tQPh@% 1@1Pd^WVPt$D$uPh%h=% jP,( tuIh%h8uM,z ,%dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS* F>)^_[USWV$lt pvh%PW; t=wM$lDW 8th%h׬$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ UF =wfD @PUhh%Wudh%h.%htI{>tA,$fEC(ffEEK*S>RQPT) C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht h%8~>t$fF(ffCCN*V>RQP( F>4)mC Phۣ%$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0T 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@k t_F1ɉNF FNFF(N(F,0N0F4Fdh@> FXt"uVG1 V^_WV΋I\F`tljt F\~`11H^_Vt$t+1FXt Pyv\7^.^ÃD$ 1@A1RRPQǹAr1D$  щ % ЃUSWVuFh~jtfFi~(tGtx!O 1~u-\O 1 1Ҹ1ɉD$T$ L$D$~it>Nt3yu%ytzy~ ~yNхuFiPv`v\1PPvX螳D$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR u$|v3Wh׬$t$ |v30E (1ND^_[]átv3ËD$tv3@PW uv3F SVt$  hjhtr3hԆ3tv3 s1fà =C jSP  tD V1H1@^[ fVt$tYVV8VgV1jVB VzQ6v|`^W^SVt$ V葆1Kt=jhj7 t!jhj 1ۃۉ^[ Vt$t'PYdžtPdž^D$t$t$t$% SWV$hjWe? C jPWv WhiP% 1NtF$$T$ !fD$f9t hWhi % t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv \B 7 OB V1H11Ʌt| $BD<IG9uލ|$$ ^ F>L$jPWV uF>*PWV" 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0ۙ VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV%< Fjŋ$@V1 $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP1 tًv\$~;1$D$0Pt0 tF9u19D$$"$8ЃD$P1~11TjT$4R4K t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVhj%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV CG$C D$ jt$ VUd C yQPD$|PG D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0. R`~/1djT$4R4 F;`|ӰD$|$0WQt$\yWh% $_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh%oW$7t)|$ jVW+ w_ jVS r9 1N^_[]j:S t/@1UQhQQj QP? G8mt]9 (G8GjSP O t 3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS4 F jPS WSh~i tD$Đ^_[USWVPr!D |R xR xR|Rh%F|R xR $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD h%j,jHt ǃL h%j,jgPt ǃT h%t$$Wh'V D$9rh%h%[H$|$ 7D$PWݒD$t$h0#D$P:R ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$S # J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0h%h5# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h0#D$P4P ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hNJ$U" h%U" h#U" $D1)h%%Ua" 1Ʌ<$t$V{ H9t- t u!H\Ht$9u1@$D$$<jPS衹 1Ʌ $1@D$S$@tXtT$@S! $1B*$Dt,t($DSo! $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$ `Dd<t A`Nh%<$Dt&u"t$ $<. 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$Up' tu;uHUh-%t'D$uuUh#t$$t$$P|'t$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$($3|$$t)`#L$# $ 1CƋl$ \$18%s%Sh'Pt$t$XhȨ%j|$XYt$1VWjWWWWt$t L$P9>t$Xh%%|$Xt$1VWjWWWWt$t輫 L$P9>ut$Xhr%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPh$ fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$t讨 L$P9>gt$Xh%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\W  j,D$Pt$X=h%V h%V Nh$V Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh#W( t$P^hYU&W -h%W h%W Wh%D$PD$PzD$Xt$P jP#h%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\W( Ê@tC< t< u CCu1j hߩ%W j h%W 0jh%W ojh%Wl ejh%WT Mjh%W< 5jh %W$ jhA%W  KjhJ%W jhT%W j hh%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjPI 'L$ r L$rL$ T$t$XV%1I $j/V uD$|$P jP L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;pr3t P 11j|$\WtdƉD$"V[ jWt>th%f%VJ  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb h%b|$XD$Pn<a't$Xe <PD$P/|$Xh#|$\WG  t$1VWjWWWWP& L$P9>t$Xh%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/Pd 1|$Pt@j/PN tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 h0%|$Xmj,|$\W 9ƀx-9l$Ps%ƅ |$1WShSjSSt$t ,9h>%{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP   L$ j / % < t< nGG|$X{t$P$t$X $ hr%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU  8ut$Xh%t$Xh-%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vh%pD$PR |$XG D$P2 D$P" |$X6t$Ph%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV" 9+aVh%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$tߗ L$P9>t$Xh%Rh׭% %Pb|$Xh%T Ct$Xh%W à \$S ƅ|$PPh%SV+  j Vflj/t$\z G1|$P# 1 t NOGN|$XC1j:W t4A|$1WVhVVVVQE 97Xh% j=W FD$, h% @1 t  H@Wh$%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQ HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh-%ZT$P   Vh@%)D$,hr% h?%aƆ }hĩ% D$Pǀ`hd%f 1H$Ta Vh+%rN D1DDD DD.u h%  12D$,1hW$W>hߴ%W(1h%W(hB$Wh:"Wh3%Wh%Wh%Wh|#W7 hȴ%Wvb h#W`X l$h%|$WBX hm%|$W(l$ ht%W f hz%t$W h%t$k h%t$ h%t$ h"t$ h%t$s h%t$Z h%t$A h%t$( h%t$t hf%t$b h^%t$P hʹ%t$> hִ%t$, h(#t$ t$hM%t  t KC  t KCWhԪ%Ɔ  gt$Pq1pƅhih>%ottC< t< Cuh%GDžhr%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉h%W t-h%W th[%W t h|%W t@Ch'&Vj th%VX D$P@ tsFH t t@@1 t  H@ttC< t< Cuh%ƅhhG%sF< < F1$SUjZ tUh%t1C CC"$f8l$1USjxSjSSW- $D9]$ƃWhu%- # t KCƆ L$P1SnF D$ PV N   7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hF9#1E1؄t  H@hͫ%%1H$$<^_[]ËD$PǀǍ0PVjeW Zhg%F -{L< < Ch'%11_Ho@@V ыD$ * * hr%2 C]{/< t< tCCB؄t  H@h% yt$1VWjWjDWWS薈 L$P9>OShY%L$ 1SK 1I $ԉljUSWVL$D$ T$114Ér GE9u1D$P$tj~>$ 1W4L$ Qg 9s: $T$э A@)E9uы,$t&h%hk%h hɧ%F 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P蝖 T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vE 71M^_[]USWVՉϋRڠ j=Pe ,$|$D$ V 1ۉ\$t?t9D$ 1j=S# )9uWVS D$\EuVͪ4$I t5ƍEjPt$  4DL$h%Uh%h% |$$t#4$ן tzSAD$ t$tC/1)1ۅt#t7Uh4%\1K؃^_[]USWV׉t$ tkƍD$0h#P tN4$P tMŋ@jPW1 tJƋH ,h#D$P u4$V7hK%蠲0hK%蔲4$hK%育4$Uۦ^_[]USWVPӉω1UVjVVVVRZ{ 9ut2jS~"1GtGG ȉ1N^_[]ÐUSWVhR% D$tHTNPRghp%h%hhR%j WVt$ t)1WWVַ tL$@Tt8QVW ^_Vt$t$Ƙ^h%h%hdhR% SWV1SSQm t&WV}W荢SSVI Džu^_[WV|$ t^ǘ1PPW" tPW2h蹑ƅthjV- ^_hî%觭1h%hî%huhR%; D$t L$tHThp%hˮ%hh%hˮ%hhR% Vt$t61tpT^h%hԮ%hhR% WVt$D$ L$zVP~9tV 1^_ËD$HTt1Pt$ h%hۮ%hhR%H USWV\$tF+1PPU諵 t.jVU虵 9^TuVU訲VWu^_[]SWV D$4toHTty9|$0uPLjPW>t<Ƌ\$8PWJSh%%j Ww VNV ^_[hp%h%h h%h%hh %h%hhR%9 USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t Etu D$tBHttu#xðÃxux uxux} /1h%h0%j}h̰% D$t>Ht4t uxjh'Pd ! /1h%hB%hh̰% D$tEHt;tu&xÃxu x uxux /1h%hP%hh̰% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^> Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=RuD1FFFF FFGFRSVrVW_uPRމ^_[]Åt 1u19[:Rt1h%h_%hh̰% hk%h_%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=Ru+RW9u!Rs /1N^_[]h%h%hnh̰% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ` ^_[hű%h%hhѱ%h%hh̰%* USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQ9 ^_[CPh$WV' 1t߉h&h%h{h%h%h|h̰% D$tL$tf Hh%hݱ%hhE'&hݱ%hh̰% VD$t&L$ t/fqPp QPI H^h%h%hhE'&h%hh̰%o fVNJ$Ԫ'Ph% u^USWVD$t$VP&1Ij0Vi'1|$/ooo WV'5X't-1C <'I?r \   DE9u֋-`'t/11C \'I?r #   DF9uWt$V' 1ɉt$\T$\RVQ2PߍV%t 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP) tbL$1tHhd%h@%hM8| /IG?uWG9rD$^_[]hP%h@%hh% USWVl$t$|$t1ۅu>t7NLw%t^&M{#tÉS1ۃ1Ct:tVtXtShx%t؉8txt@HtPt؉CjVat.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t 1NA~0jh%W uWC) W G9rh|3F ^_[USWV |$ 7u ;l$$Ujh%UQ \$C UPWh%;S$t^DžtnjSW&  8th%h#z9h%k1HzSlt$h%h5#? tG11CGt0WD ؃uh%h%?Ņu1 ^_[]Ë$t|$u%tPWhA%h*% =mQPWhA%hO%論KUSWV֊B D$L$$t WT *QP謁NjD$$4$7@uMh&#蝐%tQh%W R Ph%Wb |$t$h!%W= $D$ D$h+%$U t$hx%U|  U |(6h%UR 1,h$%S8 hM{#S" 'hw%S h%U h^&U h0%U h%U 1ED$D$AtG~DtAD$D$D$D$D$D$sjSȉD$4D$, ED$D$KD$D$D$D$$1D$D$D$1D$|$t<$ Ph9%W u4'hF%W W$7$@|$L$ uPD$@tEL$qPt$h%WA%D$ |$t4$h%W詰 |$tJ$t=8t44$t%D$pHpDt$h%Wj|$t4$WND$ t7t1Ph׬$W D$ 0uW W輴ǀ|$WD$(P D$ U#t%PhR%W; $HL%t_$M&tRhc%W Y$pHhp%W <$@PPh|%W $p$h%W 4$覞Ph%W ${Pt;CQt$(stPhhV tVh%WC t$Ph%W tt$7@#ǀ\$(h'S{$t0ti~ tVt"PSo9uvh%!h%1OĨ^_[]1D$D$h%Ws t1VVS t]VVS 9th\%h׬$W9 {ET Ph׬$W ]jUS覘 ŅuVSWV .h%$VN (h+%V8 h$%V" hM{#V h[#V h^&$ hw%$ h%$ %tt|$"D$<u D$xuZ|$t4$euD|$"D$<u D$xDu*|$tjt$u%U#(U#U#D$ U#U#t%Uhij%W_ Vhͳ%WG 4$?%tPhس%W u$0?%t@ $ t1tV>%u vuPh%W #V@th%W|$"D$<uPD$@tEL$q Pt$h%W;%D$ W|$"D$<PD$@LAL$qPPt$h%WXUSWVl$t2E1Ft/׉˃PWh%StEu11N^_[]fUSWV\$l$|$ttUPW| 1tk<.tgh#W tUh$W tCj hZ%W t/tj.W= tUWv 1t^_[]D=|Vt$ 'Bء3H 3;3h|3j |3H |3 Fut$3H 3;3h|3j |3H |3 Fshe% Fsh]% FshB$ F sh9" Fl%s%y%%% %@uwxn%rh"r]%rR% rG%r<%r1%r&f{#rǴ%r%Q F sh̴% F shմ% FthV$ Fsh޴%j Fs h2%T 3H 3~|3H |3 h|3j h|3 ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVh%hW%h%US 1N@t+9w');@MQP'At9w :)߉h%hW%h%US ^_[]USWVD$<Pq t$ $h#V ]NjD$@HD$?1jh%W ujh%W u|$D$4Njt$0tNF tA.t;\$SP耿 D$P1U1HPUUUUS_P 9l$u9t[,OuD$,Njt$(\$Sv + t-D$P1U1HPUUUUSP 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#V Dž4$z14$z 1H^_[]4$zo USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ3 t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$K V > "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DHJ \\$ $2f\\ $$$T$$$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1 T$$t4<$t s%|$$u1F 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Vp 18U 1H(D$ %t%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS C@G jPSe fC $4CCD V$4PЎ UShip覝 C O*W>RQP虎 UShipo  1N^_[]WVPRQ ~u~uF $uG*SVP3 tu@ 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$ã V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS薟 |$jjJ`Ƌ$(@h@h% ljFuJ1ۍl$Sh%j UY h@U[ FuCڢ 8tǍ\$($PhqB@W f<$f|$ jUSL ShlBWDŽ txD$PhpBW詄 tZ$$VЃuBD$PhfB@vw t(D$FP?F u+ h'%[Ft PY VP1ĸ^_[]USWVt$fFtV)vv v  AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ t FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP ^USWV L$@T$ 1H^_[]Ël$ |$ $9;l$ tWj Z L$tu!s^+9ED$tSUD$ P(q ݋D$1P腘VPh;%W au^Phw%W߸ $P3Wj 1Ƀ HJ "USWV$ vS$$AKtGu4|$QPhW"1Nt8Wh׬$S, u!"ќ 1t轜 1F^_[]0pPh׬$V 1Ntҿ9tB$Uj t$48'Ph׬$U訷 u$j} HVPL$ uEt9BSu3 PVjp] t<$uffDw D1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  tdp#3EoD$T$Pht$  x%L$T$ s 1K41ۉL$$$ s09t$@OōGD$ t=VPǍD$Pn 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PUEL$QP谶8L$QP蝶Ut$@!t1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ Vh|%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P軑PVhP%S'1I/ދ$0$4Wj$@U t|$r $,84$HPLP$0Vha%W说SyGPVhs%W芴$0$4|$WjU $,t|$w1Ћ $ QPVh%$4'$4#]S菐PVh%$4T$ }ltE$u?ClhPhhWzWVh%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhVt$$@$@$L0 >}k|$`$0PJDL$L$QWhPt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VQd t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$螐  葐 V1(^_[]ËL$DtD$L$tPVQc D$ƅuF SWVD$ L$tT$$w! .11t$|$X+9s "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`F`^SWVjh0jJK 1NǍ\$PSPhWotrjSjjWot]jSh@hWotBD$$1ɉ $L$ L$L$D$fD$DtD$jPWe t W^_[USWVt$+VjU=Chu,$t#tVh6 PjJ=^  r%s%PSh%膈PShӷ%G 1BhT  ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%F ^_ËD$$PL$1BhT : SWVt$tgw]Vhk ja<^ w$gPSh%E GLh3M ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGHi%_0wF SPh%?E _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%D w$w(3<PSVh%pDG0GH>% w$觅PVhE%@D G0GHb%c1HG8G4 w$nPVhq%D 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( \&|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ \&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu PSw0PVh,%B w$4w0PVh,%Bt$6u$HujGtGht:?P%tPW%I+%GHPu萪j19c@O;Au<t M%?uI%GH0ts]Shk w4Q 8Sh'w8P7Sh(w0P7C w8w4Ph]%A 1HG8G4]@uPD$u>C wiVPh%]A wwhV3uVh%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;th%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hۻ%hѻ%hh%7 SWVt$^ Sh%L?G0+G8PSh %> Vh3Mj%51Ghd%WFiP7 Wh&%>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3VhNNjP"/uhe%h)%=^_[]he%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(hd%hX%h h%| PPV&5 tSE EdP $PEt]U$uu h*]CF Ph%c<6u%EHPVQ Vh%< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$h*VD$tF9tAtIdtI;u D$ thd%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V><'C'C 'n w${PUho%: y1WVVWU0VhG:SU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLih> D$ɀwȈGGV*QRPhQ T$  |$t t?t`t[\$XSjxoD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$Pi PL$|$)9 OGPSQ,L ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSP"J \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Ph%/t$=$]tVSt$Dj`%e^_[]Á G AQSP"I ǃL$G)ˁ+),PjWq ,1OD$0@hX|$ 1|$CD$PjwǃSt$PH G D$G D$ GGDCff_f_1ۉT$SfGEh fGG@D$ffGScf f_ t$WhD$wK*PQt$ u)C Pt$h%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Pxdžx|tPrdž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5&D$\$$%&Wh@Vj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GH$%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWh]jPh8%h)%$sY EX>@P UB( A J*R>RQP=  ]rts4 t*Mq @T$hRQPPV]ho%2C>t2Mq M*T$hRPQPV]h%O# Pj[1wLw !w wL$u]rruG XixiF SPh%" D$h$PS61Rh8%*#@uB3EpCP t: @ NH M plYhH%"u VhD%"h%"23=u1HL$h$QP t=w:F h%Ph%c" wqh 1Ƀ8tmF SPh5#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQPs; h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$`PVh%; M+1C%j7quHWn댋Et {WtstـT$sO$tPЃ8u)ʃAr ha N@H@USWV׉΋D$$E t @9u ;M$^ P[PShq% EiP6բ$u!}@uHhjjWV Džt jWVjj|$=$tDd%EHPV#8#4 u2jn1Vhjjv؃^_[]ËL$h3MYWVP֋T$D$WPt$K 1Ht<$u 1t ɉ^_ËL$hMSWV1{\t^_[Éjh Q C\t4WhcNjp4 uh}%h)% 7_ 8u"5v3hp%  Wh}%h5# 1NcD$T$ PUSWV$$($$$$_\ftPh%h=% ch$US迼 t'sPUVZt3_\t,Ct$?tF Ph%h5# V$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h=% t `xjW0\ tD$ WV h%6`(^_[]WVD$ t01r9wu f΅t0^_USWVӉ΋$$D$~ #5;L$GTK9u@F>$wGKV*PRQd T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9D$ %t$t$t$ V%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$P_( 6VhT j|$XtVhC]Pjh{]j|$ GPG $9OsP4$L$ A t=|$ $OQt$P' G@Vjj*hR% D$ @\$ sCCCC C KCK1{ {+%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$hξ%RE \$ t$t;ED$PMP $,uzh% $,tKPB Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$L4$teSPh"Vt$Wh%t$(C "ۋD$t$0?% PkL4$L$ t/PUVt$Wh%QSPh"t$Wh%t$$$PUt$ Whο%Q h% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWPE$ +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$7KPVh% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Phۿ% v 1F FFL^rL$h{]ËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F Ph%lOhGL^_D$ȅtȰ (1SWV\$C rN 1H4t${GPhVJ ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh'|$,W8Edx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVP  VVP  ƍF8Pauv3TV[hVP SWVG| WD$,P\WjVP?  ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0S  tzVS ~xF| uF|EhtF|FXMdQPeV$9tVTVGS1PP\$0S  ƅu\$ C$t$|h'D$P1PPV  ƍC D$~gV_Vn8U_B1PP$  9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j Vt$u.jt @h%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGh%1lj$gL$$\$ G Gw u> Ʌt ѹ )QPh;%jV)[ D$h @$L$tu"D$$0t>PSVUh %WjtGt $AG8y-]C 8th%h)%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQh;% 2C(K,QPVWutAhAd &B 8u0t0t 9Ft!6u Wh\%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$} b PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&@ G@ 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u:L$( Ʌt ѹ )QPh;%jWV ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]hw%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yr> t$ $ q>YtiDD$ \$fl$Ӌl$ hm%WU( > 8th%h%t$@s"j@{Dž@7| D>tSPjjS> t'O N ONWVHHN@LF |8 VUSWVD$1tW8tQ\$l$G@tjUP8 u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y 7 V1H^[ÍQF*v.q Au41USWVL$,Afw\l$t o*Shh'U贡 Shp'U蝡 TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUf#% V % 1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPS衠 t=m<$hj.PSjbz 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p/$ 4$U$ 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPUܞ tKd(1tD$ @`C`|$u%CdtC KhQt$(PhO%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$," 1H1^_[]SWV\${C KhQPWƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h% GdD$ D$1xG O4SQPl t $tsOdtYG %t%%OhQRPh%"Wjz[u!Z 81tP 8t h'% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPh7%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhQj苹D$ t;t$(hL%j6h%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  sh%V*^_[USWV] D$@Cxt$rj.VL$0Qj^ |$,wVhw%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPh%h%9e^_[]T$rRQPh%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPhv% RQh6% \RhY%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVP< L$  uhj议ËD$CNC KFCF CCj.L$vQP` Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h)%|$$HL$Xxp jP$P D$<t$hw%|$rst$h@%$p΁Vt$ h%t$$蚻$x|$D$ƀt$hU%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h^%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h%e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h+%t$TD$u%D$6jϬD$@`L@O|$ut$h)%誵몋sLߋD$,9CPut$,t$V)x VqGPD$$t$,әGLtbt$,Vt$Pd wPD$(À|$$*"D$$ h%s|$$/W̩!t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%Դt$[t$4t$t$h3%葴|$$tL$11BL$jOD$(D$$UWV}u WYhw@ ƍG 4$D$,$5&D$\$$%脳WhrVj覩e^_]WVt$ VhW辩VhrW觩VhCW萩^_SWV|$G Ph5%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWP tF F^_[hS%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%RL$jQ~_ u h%許$BHJAWhCjj G Phc%۰WhCWh iSh%,Yjt7Uh jP*@h%h)%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhq%ï t#@uUhI%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%賮j봋4$VUh%Ю Wj`Du!@ 81t6 8t hw%L$o@G WQSRPUitDD$GdՃGdD$ j.PUjJ t'OQPh;%j.V h%z)h:  WhPj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW p uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuh%Ph%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h=%藬 jSWqZ tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh% PUb D$C,9r|$t"w 7h% PW, ,Nu^_[]WVt$ tqwgVhvjW1GGG G XGt^_# Vh@%h5# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUjF \$wWh%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVk t0 D$ PSh,%̨ ^_[]h%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PShL%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%觧$ WShl%8 F PSh%y t){4t#D$} t*tu Vh% Vh%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]E?%f'9t Qf9Au<< <\$H $'|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p Vh% D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPh%D$`$T$BWhNW˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Sh7%P o1@GGG,G o$ t?t/ShY%h5#VhJj jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPShjPAh%h)%$1ۋ6<$tD$D$$t;F SPh% D$$hPS6$Ch%舜Jh%23=u1HL$$hQPJ Ã37@$:VL$QRP,$ \$\$TSjjPz D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F PhR%КT$E|$wD贏S(GDtL$$SQP輴 _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u2 8tn 8tdD$ Ph%h5#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh%讙t/oVh}j j`1Wh%h5#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$J4$h\%h5#_ f%1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 tV%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5Fdž ^_[]É ^_[]L$1jSWV|$WhNj׌txWhS豌WhrS蚌WhS背WhSlws^_[SWVt${Du ?~ Who%P͓ 1@1ɉKCCS(C|S KtHd sHdit xtr^_[Wh%h5#諕 ^_[ønL$xtrBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O WhPjPuh'%h)%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vh7%P\$ D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0g D$ L$)1H] t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$ܶ'a   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ PhQ%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@- VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%S D$P4 uOt$ pffBfBpɋ<$tXQlR{ ڃ p7t$ffBfB<$tD$WVPR9 ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP聤 |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPdtKWUP譙 D=l$_D$ fǀ<+ 1fw ')hp%R|$Qh\%j WK D$l$ f9<t1}~ QWh%P(}t$sf< fu.Wh%~(Ex(Et(Ep(El6tjsuD$0^_[]USWV΃|$$w Vh"%~1H׋ 1ۉt$$S1ItU $]h]d]`\$,Džu\$SjIƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh=%&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh%f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%t|},WVh%} ^_[]V΋Qhrjr1ɉHH@@ @ @$t H^D Vh(%h5#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth\%VP6'uVjjq-wx9Dth`%Vku Vhi%|{^_É1j9VދL$t1Bhf%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1`%8WjjpD$$Pjy<$w$L'8uJ%=ǃ8^%8u+c%8uj%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%y ؋?ut$u {`<$uhs`t$ h5%y 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%q:fD$D$D$PjUVD$0T$4)̓w! t$h%qfjPD$DP% D$LȉD$LD$PȋL$LD$P9v)衷 t$Pt$Pt$h%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%oص t$h^%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhq%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph<%Ent}u^_[]8Vf6!^_[]SWV΋y WhU%0n 1CCCC CC$t^_[Wh{%h5#0n ^_[Vt$F Ph%2n1B^L$Vt$?N Qh;%Pk 1B^_L$H}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjvb1CC C XCC~ ;u Wh%5l Wh%kt^_[Wh%h5#l ^_[ËL$Vt$VhjaF Ph%k1B^]Vt$?N Qhk%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%h=% k tjS0 tD$ WSVn h%j`^_[]ËL$oVVt$?N Qh+%Ph Vhoj?`1^L$L$@%|$u.D$8jPj+j)5Teu>h%P1|$L$8jQj*j)5T1u h%TrN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5Tey h%QTt+DŽ$j$Pj&j)5T'uK1ۃ|$$v3D$,tD$t3S?(Tuh%h%ƣRR|$$tF1FFFFF  F)F.N,RR9rF t$ƃ|$t.t$L$Aut$h3%+v3D$,|$,tF)F/v3F T@;DŽ$jjj&E y hN%TTȂTT̂TTЂTTԂTf‚T'u T؂T|$tjt$ j.j)V芁=v3ujhTV  yPh%UPhv3Pj)VDuY=v3tjhv3j j)V#th%$PhTV yh%hY%hv%V4 D$ v3 | h%]$jPhh5T腀t$8jVj$j)5Tfy h+%E7 jVj%j)5T@y hH%7 TH H r8r v30 s~|9~ h%tt$jVhh5Ty h%jVhh5T|h%d8v3PQhf% TЃ1۹TPSSQVRhTـTt"Qh%譶 TЃPSSPVPhT蓀t"VQt$0tWNuVj Vj趚 1,T0TL$?V1FhԆ3Vhh%i V: USWVX TDTt91ɉ R R1GH DT TTTf T r+rm ]1sqRRYRRTRTĂRTȂRT̂R RR t1R $T TR RfRv3UfR Tff RfR=Tu"t$@jVG ȣRFȣRv3RTR1L$@A ARY RRPhR5T  ƅx9t&y h%^3 VS5Th% TuWhv3W @ThT%xTxTTTv3vv3XTD$vXTȉL$|$fD$1@L$|$(TL$ωspT lTL$L$ |$(TL$ǡT=L$|$(ݜ$ЃTP1PPhWjRqt"t$|W|$Wh%肧 t$h %q T1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃTPWWhVj$XPpt"Vh%迦 t$|$\$,=Tu ݄$\$$%荦 D$D$(t h)%v D$|1|$ ;|$Dw|$D|$x R8j@9uD$ g ȈT|$Tt$ЃTP1PPhVjRot"VWhN$ե t$Ffff9fDfPha% 1@Phv3P:Ph<$hc% hn% h}% h%w h%m h%c h%Y h%O h%j.$Wt$|juj.h"W6 Wh%ܤ j.Wt$,juj.h"WW6 Wh%"h%蟤 h#蒤 Nf%fw 'Pl TGNju j.$Pt$ j"]hM%<h% h# Nf%fw 'PУ TF h{%Ffff=fh%fPht%FffQPh%D sFPh%, L$$T$ /Ftc|$ umh%h% Fz$'h%t$Ɖt$ t$QRPh0%踢 h$Ph%`4Թ'h0#肢 TF<<%h%F TtF?%s+%P K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( 3D$0LA B$sv%PQz F9uEPh6%b h% h%h%E |$ FPhD%. 6Phe% |$ "h%h% h$h-$L$$ 'j.$Pt$ jF$Q4ȹ'h<%ThW%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Pv $@D$@|$ Phdp#hox% t$ 9|$ohq%hd%؞ D$$$T$ $@WjWh$h}&P菞 Ft h2%| 𡄆3H 3~|3H |3 h|3j )L$|$$t1 q΃j.PL$Qjuj.h"$Pt/ $Phw%违 |$u"tVh\%襝  hP%薝 3H 3~|3H |3 h|3j  t$GNjL$+{h%ihv`$+ Tt$Nh$ Ntu%h}&P 1L$1΄u j, D$H%x%%sVQ蛜 D$9D$t$uKj,裛 h%v D$4L$:D$tHj,z D$4WPh%D $D$4D$ uj,K h% 3H 3;3h|3j)襡 n|3H |3)hq%hv`$̛ T؋ 3Q3~ |3Q|3 h|3j 5 Tz|$h ot$dc~)/F1#ty1h%n2td3h% ^ F N t$~WRQPh)% \$SE>ƅx*VhN%њ 'h%š N h\%訚 D$@Pho%蒚 ~`1St$O>t:j.$WPjfuj.h"W+ WSh%C Shx%3 C9u\$,t$ |$d|$h19wƉ΅h|3R (MlTT$p1Ʌu9Q V&jV~ % VPj辐 5Th%{ 5DTh%h 5lTh%U pTtPh%> DTtI lT9~h0$ 0D$D$L$d$ `& \$$S$ 3H 3~|3H |3 h|3j h lTTtzpT$$xT|-Tv3XT$\$\$\$ \$$ %5 $h|3(Q h|3Q USWV $$919gՉ $t$ $;8t$hh%$,&* =&GШu+$ ؃?9?)9K9si 3LA B$sv%PQhV =hV$,) =GC~ 9r9$$ul&hh%$,VC) =wDG$8:$ t-؍L$VSthV$,( 1 ^_[]USWVP։1|$4$u9|.HPhL%X %wS$'W )1@1sC9uÅu.Ph K& t$߉E1 `^_[]USWV4)ȃ'h%试 :։ϋ ˉ hZ%fˉ $Wf_oUSRQt$Ph=%G Gl$j.UPj2uj.h"U& Uh_% Gj.UPjuj.h"U& _U()|c؉<+<'ueh%0<9#<,uth%褔 '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5Tt$PV;hD$$HL$L$ 1x1PPPWZ jh@P~ 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$TD$PVPL$@D$D$ 1 G|$<$D$=v3$TD$j=hQ&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hQ&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPm SVUb |$|$t$ "+Hj=hQ&P Ņt$,]"t 04$Q"t 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4m "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H l dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=Tu t11jNtT1TTt P襔1@hx0#ht%蟇 T1USWV1=TMT$ l$(L$DžD$5ThhTב  |$t$5#j hT6 D$Th5#VTtUP] uTWVTWVt7j L$QPo x#L$9uT;D$ D$uL$us T8 TAPQ~ PQ[  T tuQhhTՐ  |$uT1^_[]TīTīT1Ҋ+~,u"1t$L$t' t" t΅tAL$=TuT t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=Tu#TTtP#Y Tt T1^TTtPX TVtJT$1Aj<ƃ=Tu#TTtPX Tt T1^t Tt D$T1@1USWV D$,L$(l$$~ )$1H$`t T1A\$9|ωL$ tgp9tX tt$ PY t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$TTtPW TD$,L$$ ^_[]f11f11Ã=Tu /t(T11hhTPjNtT1TTt P1@hx0#h% T1USWVT$1=T+\$0L$ D$D$|$(D$5Tt$8S l$,D$ D$D$t$j S1 \$1 h5#VQE|$tt$(P:X u~5#WV'EWVt^j L$QP覅 xJL$9uAE;D$ D$<u/h5#Vلtj L$QPe x L$9t[ T8 TAPQ~ PQV  T tuQt$8S E h"#VLEth"#V7wh"#V!ah5#V EHh5#VE /h5#VكE$j:t$ @0 1@|$ uT1^_[]WV=Tu et3t$|$ 11t$t$Wj1tЉ^_1@PPhhThTt$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=Tu+TTtPL$S L$TD$$tˉ01C؃^_[TTtPvS TPPhhThTt$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=Tu+TTtPL$R L$TD$$tˉ01C؃^_[t Tt D$T1@1fUSWV\$l$t$VR PVW UR PUWn SR PSWZ t$ V}R PVWB ^_[]WV t$uRt>DžtA="Tt ^_Épxj Ph" ؀= Tu1F1=!Tta 1맋5v3S` dp#QQh%Pփ<^ USWV1ۀ=0Tt ؁^_[]a D$ |$GSSPh$TjW&u $T 4T 8Tr1H#L$Qh%PՃBTv3@CTv3 t%ƍC!t2)É$)t*TL$ T$)PD$p xPhT=BT=DTWjD$hpj Ph" 5v3W dp#QQh%5v3iW dp#QQh%PփRU 111{PZDWhVT ESWV 1L$ |$ ru\95|Ts(>tGǀ=BTu.;=TrN;=TrD(T DžtVjW:T =!Tt^W 1ހ="Tt& ^_[À= Tu1Ffu]pxj Ph" 뺋5v3V dp#QQh-%PփS NUSWV|$4t$0Ë |T9s&lT9 8Ս1ʅ/dT99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95T95TH_ŋ lT!9r؅ HT9s9s_8T 8!9t.M9wI9rE`T8! v3!9u!=BT=DT(TRf ʼn9rPVU(  8!!ōD$p TPVL$QD$PVt$8_pTPt$jUV־thŋ$L$Ai QhTd=BT=DTu=!TT 1="TtM^_[]t$hTO= T1GDu3t몍D$0xhj Ph"J 5v3R dp#QQhZ%PփP 9U7)SjZP)MPjS?P :9/ $)QjZP)PjS P tƉ111USWVˡlT!9ta)‹ V$T (Tr!1F<u. (T$TF9r^USWVP $1N=lT1!׉) 9uP_;TFjWV^ *1ۡTt  T8TH@; Tv@jTH@ T 3H hTHPhThT9rWVS u=@ j@S0* -v3> h<1#Sh%PՃ=@T9=hTu]Tt  T6TH@; Tv@u,TH@ Tt=hTp xPhT@^_[]9Tu)TT; fv3øv3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á3D$t$PfWVL$T$ ‹q~y ;q~ t 1~9 QP[ ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4 'W6. tF u1^_ËD$t w$'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ dp#dp#tƀ>t"w%+; 0DPWVhg&hԆ3oV ^_Ð1|$w L$t9tøv3f|$3%G#tdp#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]I 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PS `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P5 t F;'tm'D$('D$X'1FthPt$$VZ V) Ft$N tVD$PS0 |$ut$`e|$ \$|$u,1F|$uu1;$'t$`=u-h8 01H^_[]Ë ' r ,$P't u‰,$P'`'<$t9rPQt$g 1t/<$t9v7 |fL$;%9 (v3fL$P%9 ܨ(vȀ3føÃD$L$L$ L$D$Vt$ t$VhԆ3V hĐ"VHt"R7 0kPh$hԆ3R Ԇ3Vj x_V ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t5 0 5 1$^ÐWV|$ W4,'8' tFu1 ^_D$ftL$Q'1USWV$п$$ u V%  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#4$Y(]111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$TL$L$ tU |$$1Ĥ^_[]USWVt$~X>3܃ V$x' j F H @(N]_?[\;^r~uFFTTC><% ^q{t|~F~F ;^r~uFTFF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFTF^9րրw t$rI{i9s <$=3]D_\,<$t~uF FTTAu~uF TF>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF TNPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF TF"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF TFЉL<$USWV t$ ^h.\u/;nr~uFFTTEMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFTFF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFTFωωD$$xt~uF T.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF TN$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF TFVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFTF~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj tCKf<T$fTAKD$8 T$j-^9H8]D$8L$| 8tF @tL t$0l$ 4)81=311E1L$t$M9؉L$vL$ 13^vыL$VtGt$u>3TXL$21@u"3TXL$1t$1ɅtT$T$1=3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uTF4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA TQ^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FTFUSWV\$1=39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh 31҃9v1B 33Dh1҃9v)1BuG TG^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFTTT^_Ã~uFTNUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFTF1^_[]É؉D$t%4't$t$U0 u U# t/uՃt~uFG롋$USWV 1=39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq tF^~uF TF1^_[USWVP1N׉$1+t{`tswsK$L'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ z ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$|'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4読 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ U ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t Vͷ @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhȴT`ȴTø%Vt$1Ʌ1t э^fVY~T$<ws<^ÐUSWV[Hl$,D$(u1T$|$;D$ T$$75,/PW辭 E' PW覭 %/PW莭 / PWv t7 PWb |$D$ tH /PW) B PW /PW iJ PW tR PWͬ |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [e$ @$ $ ,1|9r 胼$ t+$ $$ FhPWb D$D$D$j1҉$ xfD$4D$d /$$ AfAfI`QPRhWrt$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ VhPWYa j:WN D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP#t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.rqPh$P9$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R f RQPUh$P $$,$ 9sL$4rqPh$P$j$,$o9sD$l6$,$/9s狄$ @rPQh$P$$,$9s狄$ @<hp,$9suF9snF9siF9x|$B$ y| ,$9s%NM9D?<$ @<L$|IL t$xjhQPRt$Ph$P$$,$9sL$tWrQPh$Pd$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ ,$$ |$jj Rjjt$,$ $,$$$49s獃q ,$$ g ,$QPh$P$$9s獃t ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HPt pRQt$Uh$P%D$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@Z l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P`$,$$_9sjjjhRt$,$ 諍$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F] PQhWo1ɃD$D$ D$1 v fffUSWV`[Èt$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?rM  l$8D$UPjo tCL$HD$ QPV t2VY t+jPj5 1ɃىK'輨 (jD$LPV譧 襨 (l$8蚨 0jUj 膨 0`^_[]fffffUSWV< [D$yXXD$/Xty$/dev jPt=ƍD$4PhFtHVk Vt|$4l$8$<D$ oD$ $<T$${PhQRV=D$ t@D$D$D$SD$ p! L$T$ t$F 9t$D$0l$WE?tD$pD$ jjR tkD$tSt$PD$P ut$D$PuPujjD$P7 k6諦 8[ 萦 iŋ$\ $X $T $P :)tt$ P?$` tVjQtw 1tWhgtQm < ^_[]ÐSV[êL$t$ t$ t$ PQft+@ ƃt;u"t$%4$:01D$L$4$^[fffffffX@ÐX(!ÐXƀ,!ÐSV[ý@tPaǃ@ۤ (!Rǃ(!^[ÐSWV[\@tvtEH 9ujjj@C !ƒt#@D TPQV@Q 1u衠 0蕠 04$N^_[#䐐S[[ÐS[t$[ÐUSWV[u } D$<$ t$u$$D$P 8ut=k<T$JL$|D$x$L$x$PQ2t$$$Pt$oslH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $DD9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$h D$@j PW56 K 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQh|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRαѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6耡W8G4jjdv6r jjdRP[WPGLjh'v6r W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,u L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$<2 ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[[L$@tEׁ<u$C t+t9u11ՉL$!։1^_[]ÐUSWV[ۥ|$GtB#l$%t$P"8t!G t7t9uӾ^_[]ÐUSWV[kXtC#l$T t$P7t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$PB7t!G t7t9uӾ^_[]ÐUSWV[Èt$0t$, Ǎ VP‰t$D$(%D$1퍃<D$ <$l$@tg|$ !RP6tG t@/t;L$uЃt'D$ t$jR…<$uNt$0t><$9tR a PUW >&t1<$W^_[]fUSWV[Kt$D$hEt'1PV5t%D=u10!uVPj] D$@ 8^_[]ÐUSWV[Ȣ|$ D$hEt$1PW5t%D5u0!^_[]ËD$@ 40tMo D$jPt$Vp ŋD$18txuo r"u##0!uB"tt$0!a,4$WPjуHWPj SV[Ýt$ vv V^[ÐUSWV[XD$,8tD$,1퐐8@uj$ HƋ|$(W F$"jUF D$ D$,F> D$Pt$O1}nu1ɀ}ouL$D$j=U49 tǃ|$D$,t1PU2tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ80!t 4$`VW1^_[]ÍUPj USWV[å$4$,l 0EjPU uj:U8 jjPU} tKt$}/3t$UhV jVPUb\ P t$UD$PX|$ jjWjjV|1mt$ jjWPjVL1t$/hD$PVǍ,D$t$jDžjt$W\ uj$4$4jWMtƍD$Phzd@VM VD$(Pt$\ uP$0>$0VPW= FD$ GL$ jjQPjR40tqVUW Rj 0M$0Xj 0pksj 8uj/UKŃt$ $0UW :j 0KQPW 111j 0M$0P$4Y 11,$j$4V$4WjUP.PWN{t$t8HPQ膏&i 0p$0P$4 1,$D$PUMi 0^_[]Í,$UPVW茀1i (WP$8$8^VcfffffffS[ËD$D$ $L$T$jjPQjR.yD$[fffffS[+D$D$ >$L$T$jjPQjR-yD$[ÐS[˚D$D$ ?$L$T$jjPQjR]-yD$[ÐS[k$L$jjPQRyD$[fffffYT$4u f4ÐS[t$wSWV[̙|$Wt$t$_ 9rf ?WVPj4^_[ÐSWV[||$Wt$t$ 9rf ?WVPj4^_[ÐSV[-t$ ) ƅuPj4^[ÐSV[t$t$U ƅuPj4^[ÐSWV[ì|$Wƅtu0WPj4 ^_[ÐUSWV[kl$|$UW ƅttuJUWPj4^_[]ÐSWV[|$Wt$ ƅtuqWPj4 ^_[ÐUSWV[˗l$|$UWt$ td 0UWPj4^_[]ÐSWV[||$t$W胀ƅuWPj4 ^_[ÐSVP[<D$L$T$$RQPZ ƃuPj4^[ÐSV[t$t$t$ ƃuPj4^[USWVP[êPt$0t$0t$0t$0t$0jt$4@ Ɖ׋,$t1c (t$,t$,t$,t$,t$,t$,Pj4 ^_[]ÐUSWVP[*Pt$0t$0t$0t$0t$0jt$4- Ɖ׋,$t1:c ('t$,t$,t$,t$,t$,t$,Pj4 ^_[]fXL$"wÍpffffffUSWVHXxD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjGy~D$ |$4R|$D$811|$<,L$4L$0 GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjj"r\$Pʅ~D$ |$\$0VRD$ PjjqT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjj#q1҅l$D\$0WRD$ PjjpT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjnD$ u|$,L$ t@;L$s3$ >"\$0\W L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[ވjt$t$t$t$t$8[fS[îL$T$ Pt$t$t$[ÐUSWV[h|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuU{t$ t$ 0n [ÐSV[ {0t$t$V|/ tt$t$V& ^[ÐSV[ýzt$ t$t$V0/ tt$t$V ^[ÐUSWV4[hzl$Lt$HAQ$)9ʼnʋA|$ |$uƋD$ L$ ׍L$ ~=4$|$l$QPVWlj_]|$l$uPt$W=. Wv14^_[]øS[Îyt$t$t$t$0[ÐUSWV0[Xy|$Dt$Lt$LW- l$Tt$PGO $)9ŋG|$ |$uƋD$ L$|$D~94$l$RPVWlj?\|$Tl$uPt$W- Wu10^_[]SWV[lxD$taH8|$tFH81@:u8@0Qj<G> H8 H81^_[þD$t@:$ðfffffffSV[w8t ʽPAt㋋QXQP)& t.PT$06ʹ^[ÍP@ jvTfffS[.wD$ ~ L$u [ËPQ2  [ÐS[vD$~ L$ u [PQt$ [ÐS[îvjt$ 0 [ÐS[~vjt$t$t [ÐSV[Mv0t$t$V* tD$~ L$u  PQV ^[ÐSV[ut$ t$t$V`* tD$~ L$u  PQV ^[ÐSV[Íu0t$t$V) tjt$Vh ^[ÐSV[=ut$ t$t$V) tjt$V ^[ÐUSWV [tt$4@|$ǃ!<ǃ!^ǃ!vǃ!#ǃ!:ǃ!'ǃ!#ǃ!#ǃ!#ǃ!-ǃ!-ǃ!_ǃ!|ǃ0!oǃ!-ǃ!-ǃ!<ǃ !>ǃ$!*ǃ(!!ǃ,!f2Ot^t8tjtfx8!؋tvQjPW;1D!QTpQTtQTxT|=u^_[]ÐVYL1D!T$tpqttqtxqt|1=u^ÐUSWVP[:L@!l$j+GG(ujj=QP upPjj3.aQP2ej>!j< !j^H!jvp!j#!j:h!j'0!j#X!j#!j#!j-t!j-d!j_T8!j|D!jo4!jp$!jr!jy(!jzP!j{x!j|!j}!ǃ!!ǃ!+ǃ !!ǃ!,ǃH!!ǃ!-ǃp!!ǃ!.ǃ!%ǃ!0ǃ@!%ǃ!`ǃh!%ǃ!aǃ0!ǃ!fǃX!ǃ!gǃ!%ǃ!hǃ!&ǃ!iǃ!%ǃ!jǃ!%ǃ!kǃ ! %ǃ!lǃH!%ǃ!mǃp!<%ǃ!nǃ!%ǃ!qǃ!#ǃ!oǃ8!#ǃ!sǃ`!%ǃ!tǃ!$%ǃ !uǃ!4%ǃ!vǃ!,%ǃ!wǃ!%ǃ!xǃ!ǃ0!~ǃ!#ǃ!pǃ!#ǃ!rǃ(!d"ǃ!yǃP!e"ǃ !zǃx!ǃ$!{ǃ!`"ǃ(!|ǃ!ǃ,!}2NthtBt'zx@!:!ϋtuQjPV p8!Ft$0[ÐUSWV@[F|$TED$G8$u!O9OuO9Ou 9u_uWEt W%|$XE3t:\10蛏Eǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3d/1j ‰PD$<x-.D$8|$AG $tJt PwW7 W~"G @t; 8u1E3t%\10蕍Eǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u*E2$t L$Xu$ L$Xt$AsiSV[íB0t$t$V tt$Vj^[ÐSV[]Bt$ t$t$V tt$V^[ÐUSWVL$[B|$0D$(T$ 2D$ED$4D$D$8!ftW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ8!ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ48!ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ8!D$4PjjjO 4449)4L$ 4QWPt$ 4;4}2Dž4t(D$4PVt$ t$ 1|$0f8!4)Ɖ4fǃ8!ff9t |$ u |$ t)Q)Rk* t$VUF @f|$tg&D$@ 4444H44L$ 4QjPt$le4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f8!f1jD$` `4rփփ19‰4 4f8!fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f8!f1Pjj!Q j/S[:t$j[ffS[þ:0t$ [ÐUSWV$[È:|$u2t PzR2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(P谺tjjP/ ,GTP膺tjjP GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PvD$$<$$u$P HuǐuUs PD$$鐐<$$u$}Pc Huǐul$Ut$VzVU$|$~"14;;>|&V^_[ÐUSWV[u1fǃL!h]u$ DHDHDHDH uǀ2ǃP!ǃT!ǃX!1IT<,$j T<TV$2@4tV =wlj<$hVt$ V V 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍQPj S[þ/0[ÐUSWV [Ø/|$ EG8$u%O9OuO9Ou9$uxWo/t W貋`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PHGGMIAG GAE3t4\10xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R*G4$&=u8 $A @11 $<x=D$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a U" 8uE3 $tԋ\10vL$Eǀ3뤐SV[},0t$t$V t V^[ÐSV[=,t$ t$t$V t Vr^[ÐSWVP[+$t&T$t$2PWj $^_[ÐUSWVP[Ø+1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[*T$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[)1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[h)D$0>ƈ2L$ȉT$ D$D$ D$t$%fG T!9X!L!f$t|$u!|$t'QL$ )RW ŃuRG @tG 8u=D$3t.\10rD$ǀ3G @|$tmG  fP!\!HȃP!T!L!fftVW=VtX!\!HȃP!T!9P!\!HȃP!T!f9ufǃL!f АT$ftiLjfx_ɋ4f>t%fG t~t-P!19X!fL!D$DhhAX!\!Qʃʃ19X!P!fL!^_[]ýG @tBr 8u8t$3t)\10)pǀ3g 룸sPjj Qs jSWV[ì%|$WƃuOG @tD 8u:3t)\10oǀ3^_[ÐUSWV[+%tt$339}3AP3͚t' 333343;33PQRP 33t331^_[]ÐUSWV[[$tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐSP[Í#$tT$ 2Pjj $[ÐX?# tT$QT1øUSWV[#TAx43fTFT$P蠘j 蚍+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]øPjjQ,PjjQ j&PRjffffS[>!0[ÐUSWV[!|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW&"W1^_[]ÐSV[Ý0t$t$V t VN^[ÐSV[]t$ t$t$V t V^[ffSWV([0Wt$<3WV0^_[ÐSWV([t$8Wt$@2WVt0^_[ÐSWV([Ù0t$D$t3t PKV[ø[ÐS[t3tPVt^[ø[ÐUSWV[û0Ɔ43t)2FttrPVPVa3tR3~>11;3}:tt3PT^_[]ÐS[T$t$t$ [ÐUSWV[93|$0t$,T$ $upXMDH@utl$4D$ U觴 鐐t$ D$PL$ QD$ P x)t$ltL$9D$)<9u AT$)RUTgt( $4T$4R7D$0D71^_[]ÐS[Ît3t P[ø[ÐUSWV[H8D$ $4VjPj:tSʼnt$U`ƅtMD$ $t$UD$PVtT$t$$V V*q^_[]ÐUSWV[Ë|$3t P 3~/11퐐440p0;3|4p<3ǃ<wwLJ3j0ji4tW2Ht<@xX3~3Pl72@HX3@$4Ƈ31^_[]ÐUSWV[kt$3t P3~/11퐐448o0;3|4o^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([Ø4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W衮 1Ґ$t$V|$(WD$0Pt$$dŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V $4D$)Džu |$ $tR1VT$ ڐ 4$)tWj V襹 T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVPV8hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W虬 PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP0y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQXNj$D(PD$$L$ ;47&ffffUSWV[|$$D$hjjUT t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[;|$$2t$<~Ƌl$r:D$0f~D$4E~uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U裌 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[|t$V~tyы9uv0fv,f9p9p 9pt PxfVof1^_[v4^f9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PeffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[Î|$ uT${[ø[ÐS[^|$uT$ L$O[ø[ÐS[.|$ uT$[ø[ÐS[|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[l|$u8t$D$|$% Ɖ81^_[øVXt9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[^T$R[S[>L$T$ 6[ÐS[T$[S[L$T$ [ÐSWV[t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[\t$|$tCGX2@TtgAWfW]@x8tg@ 1^_[ÐUSWV[΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vt"G8tt V:1t$׋NX2#N@N@Rz8t N@^_[]øSWV[<΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXoHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXoHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[Ìt$8Vߜ PVW ^_[ÐSWV[LL$|$t$x"1t%<t9u Wy PWVN ^_[ÐSWV[t$|$WC PWV ^_[ÐSWV[üL$|$0x1t!<t9u W PWV ^_[ÐSWV[\0t$t$V˒ t|$W虛 PWVn ^_[SWV[ t$t$t$V t(L$ |$x#1t&<t9uW" PWV ^_[SWV[Üt$t$t$V t|$Wݚ PWV ^_[ÐSWV[L0t$t$V軑 t$L$|$x1t"<t9uWb PWV7 ^_[USWV[$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PjxNjT$u$^_[]$USWV[$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZL$1~t$ ~9J$u9r ^ÐUSWV[˵D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU7x71^_[]ÐUSWVP[Jt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ÍT$L$ Aq D$t$jVPt$ ^[ÐUSWVXH$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQ&EE;~} K(t$몉SV[mT$L$ Aq D$t$jVPt$ ^[ÐUSWV[+l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Ȯt$D1Sl$HGL$\$jD$@, ! jt$UWV*|$ D$$hxD$0\$u$py1,>;i|+A;D$D$$x8A8 $T$\$Wt$ D$$xuL$|$  $9hL$l$,T$9JыT$,uRq9~K9}Gph\$jG, \$jVUt$8U|$)T$@D$$p P֋|$ 9'L$i95X9<$uL$I, tE\$ \$jD$@,L$  jUQVQ~(T$@D$pD$$pt$$<$;T$(Ջ\$t$W"tG‹yuD$~ $\$D$@i$@\\$jBD$@0j!V *΋L$0IvXh2tjt$$l$,A8\$tjD$@8L$<$ }1;|$Lt$tWH y~@bPT0VjQcU T$t$ UNjD$@Vj4U -t$$tuD$<H@!QP>0Pjt$@T D$|$ x xD$<;x}x@,L$4p!F!fFV!!Z!!fN! 49D$<;x||$G,t$wp#O, A3T$t$ t$;|$LofrfL$ f|#udl$0T$(ft$ΉD$8)jVl$UQU8%T$\$D$ PUKL$0)ϋ\$jWUVU$|$(D$@f|$ut$8Qq0QjPT$t$ VǃD$<L$,;HL$}hD$$pyiW9u9l$ u A,t>\$jT$ D$@, !D jUt$t$V $L$$AʋL$$ ABAWd0PjQ(R f~XGuRD$$Gh2u@9u%PD$@0;7A?w t60?vut$@u tAGj>@0jrQ ytdt0PjQHQ @듃xHpo9u9uD$@@,\$jL$ D$@@, ! jWUt$Vj"L$@I1f|$X,,Et\$puED$@H9ƋT$@Zz,1f1Ճ9G9pPoO9u9uD$@@,tC\$jT$ L$|$@G, ! jt$Ut$VT!wWD$<pP`1l$t:$T$ $\9Gx,1L$(cL$< q@A\$jRD$$p( 1҃ډЃh^_[]Ët$ ;p tZ$\$([,t$4$;subpt{j\$WUt3ul$dx,t$ |D$Kl$dt$1PJ҉t$p,$T$J׋L$t܉|$8${[,;{ubxts$h\$VUt(ul$dp,L$il$dT$t$T$8ʋHL$N1T$9x,L$\$9|ʋ IT$TRZ3YttL$<$׋\$߉|$ x|$<$<|$()˃$1ۋL$ L$|$9$t(ً\$([k3lډl$u\$ \$|$)ߋL$9׉\$ }<$1D$1%|$,1ɉ11_D$8d|$\$T$,z<$Xڋ\$|$D|$49T$,<$|$,|$4|$4WT$DT$+T$,|$ |$9|$DT$4T$B;T$4T$4\$ mD$/t$t$(؉$ C9ӉtD$, L$~ыD$0dD$ P,y,\$ًt$[,;]u ;L$|\$ډ$T$T$(;L$l$|$DT$4vptEL$0 I,$ y@,L$(h\$WU%t.uD$( $ȉ $;L$} D$ 떐l$\$|$DT$4L$$9t t$(dϋHL$, $t$(9$<9L$8L$ًT$ 9щL$ L$0 QD9!\$!!Pq|\$!BfBD$0ALfBt,jAD\$Rq|\$l$uvdx;!D$u!T$P~1r01덭!Ph U ǀw !PQR d I!D$P!D$0݋D$\$T$)ډT$HNjT$ )׉|$8)B|$HD$0p@D$+|$D$@H0t$(ɋT$xpuFt0t'|$  T$d?;WߋT$HT$Rt$$Qf 0VjP!H jjjt$t$8D$@t$ VjppG jjt$ jjlD$@WQ{ft$ jPG t$D$8|$HT$ )׉|$|$l$H|$TI,|$DD$L uLd T$9Quul$U0VjP> |$08|$|$E@VjL> u PQhR> B USWV [xD$41\$t$LL$H\$DT$@|$L!PQJ t*NjD$9T!t#WT# $~ 1ɋ$0PjW+ P!X!L!T!^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃT!USWV$T$ [e\!`!T!X!D$PBpL$ t$tIT$$`L!t)ʋL$ ׉)}=)9hgʉt$T$ 9P!4t2t$ t$ )t)WP!D$)1Ѝ /9L$|9l$ܣPjt$) ǃX!ǃT!11ҋ`D$8L!tlj)D$4>$,D$8 $<t$u;P!} t$Ћl$)$t$@@9 9<$ܣPjQ0) @xX!H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$ܣPjt$( ǃT!D$X!;P!;T$ 9<$\!tod!j Ptwx)`!@ltܣQjP%( F\!t3d!j P)wx)`!j |j mX!X!ǃT!1;P!d!$ܣl$*ǃT!X!;P!X!@@ltWjPV' `!yA\!t`j t$Lvx`!)ȉ`!}u D$8o@@lU8 LQj `uT!;L!d!ܣ"UjP& T!;L!~U`! T!@@xuă\!tjWsux)`!j띍ܣX!;P!~-X!@Uj% `!yxD$8L!T!)ȃ,$D$d!D$4$jP% T!D$(19 ș)Љփ<L!9D$@u\!t!j t$Ktx)`!j tT!D$@,X!@D`d!D$,$.`!`!T!T!-;L!!D$P,X!t$j<L|$ tv\!ufL$L!;H@L$uSDuLf~54tT!X!t [L$ fu-@t!,$UjP# `!\!t0j t$rx`!)ȉ`!j ǃ`!\!tD$ T!D$X!`!$^_[])ȃ|,9t$,$,@tUjP# <,$\!t!j t$rx)`! j fT!;L!~nUjP" T!;L!T!@@xu̓\!t!jt$qx)`!j룉PS[\D$\!t#d!PQIqx)`! P1[fffX[Hy8~DyD~>Hlt htðuu냹tt u1ÐX_[@ xÐUSWV [8[AP8p|$hD\Alt huu |t$r/ǃ!4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|L!fp"Nfr"Pt"ǃ!ǃ!21CdD$L$ /jt$YD$L$ T$R29t9tT$! FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p !p0!0 !0(9uD$t4$L!L !Lq1tt  ^_[]ÃttِUSWVP[jVL$9 ft$9|$ 9l2uCUw$-4$t$skw|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX(U2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYKS|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[ëRL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZQL$x?9J\~2D$t$|$ Irftf>vf1^_[S[ÎQǃLǃP9t%!DŽp"DŽt"!t!1[ÐUSWV[ QT$L$l2uI~w-ssw!ff fffLfNǃP>t*!f0p"f0r"DŽ0t"!t!1^_[]ÐXPh2ÐUSWVP[Ot$!t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[Ml2tu6@t!|$0QjP (!G@f@d^_[ÐX_Mf@dffSWV[Et$ t$ 0 [ÐUSWVX[E|$lt$p1 6NxŅt$t$lFP蹯D$]L$tvt$ D$p@L$F>ʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j SxL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$覾7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vbx;l$tl$l)"P6x‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$t0t$t$V< tjt$V ^[ÐSV[}>t$ t$t$V tjt$V< ^[ÐSV[->0t$t$V tt$t$V ^[ÐSV[=t$ t$t$VP tt$t$V ^[ffffffUSWV[Ë=l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[=|$8T$XD$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ {T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K4Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K4Й~ ƃQWT$H ^_[]ÐSWV[L:|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[9!!jt$t$t$P1[ÐSV[Í9!!jVjt$PJ1^[fSWVP[K9|$t!t9t QD$PL$QjPWeL$N|$kK)l$kK) $;$i)tPUt;y t0q$t~fuUvu1 q x^_[]ÐUSWV[x7D$$L$t@1D$D$>D$PL$QjPWdL$kL|$kC)l$kC) ?%;?%i? )PUt7q tAy$t+nuUwu Ay^_[]USWV[X6D$(L$1҄t@1D$D$8>D$D$P~L$QjPVcl$-?L|$ ) i)ʼn) i)k%{%lj*SiŠ)ǍPD$Pt1D$H<tzp t:h$D$t}suPuYD$uދ} مt3l$,t+Et$WP=(uVaEЃ^_[]ÐS[4t$ t$t$ [ÐUSWVH[Ø4t$\lD$PxND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPU aL$ȿNt$kK)kK) $3$i)tPUL$D$$xED$j=UxtƉH$$D$<$|$WL$QjPW `L$Ƚ-?Lt$) i)) i)K%s%Ɖ*SiŠ)ƍPW6D$5tcL$f <$|$W?L$QjPWN_L$ȽkLt$kC)kC) ?%3?%i? )PWtD$EE!D$DW $$D$VPU-PUPUPUbcPUtPUtrPUtePUtXA4PU}u^O1<5.' D$URNj$tP@ 1L$;D$v==wL$L$Qt$L$uD$ 9D$ tf, UQ",$t'UW"|$BU質4+1t$ 1 t]|$uf, FM $QP"4$>  $LD=uVQ!V $4D$ H^_[]1|$t4$1USWV[f.hWWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGTM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$@ 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]8)2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[Û'1l$E<%uEpuEπ r?уstlu~;|$~,|$ts릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[&L$ T$D$$Pj [ÐUSWVX&$1h ։ͅu4$!u'$hq!5 @0t$E4}0u"$h9E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjPV l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $+ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $-$t"A$|t+H$D+$1$uՋ$1ڃV$.!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,vRE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$j1L$ ʀŸw Dʀ¿~4r$&1ۋu0M4A9s E,u,߃$Vu,薒rE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,rtRE,}0M4$V$0Pt$QE4E,M4},$}1^_[]ÐSP[ T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ÝT$ D$$1Pj [ffffXoL$TÐUSWV[H|$(t$ l$uʽPƅ>l$$uj[hj褎L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4F9Pk1D$tGuP|$(ux |$(tF|$(mV|$(Phht@UV t$t$tL$t RB(JTtRKbPtjjP~ IA(VbPtjjPo~ IA1t^_[]Í$PjVSVP[T$L$D$tRQPVƋ$t P.^[fUSWV[ët$|$t$jt0ʼnVU|$T$VŸPt$Wt~Pt$@tkPt$)t[ Pt$tKPt$t;Pt$uA1 @VK^_[]ÐUSWV T$L$[Mǃ!P̗Ņt'}/u{L$$ t$  (P萗/P܆PV7uU謆DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ 貐V`'u1V='0P莖$|$ $~:s1퐐Nt:t됐tÍMwUPW) D, L$$ t$ [tuiPޕtG>T$ PQhR~)T$ L$$ t$ $Kt$ $:uw1퐐Ot:t됐tÍMwUPV) D, L$$ t$ [tu$ $ȁ ^_[]Í'!USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%R\$L$ A ZAthhP+jj!G(hhP|$ Gt\$h(jP|$ "\$jh†|$ G9ouG)o\$UD$p辇|$ Go\$UVPX W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjPe ~ gC C$ދ\$P3F$ދ\$P~ F$D$\$jW7F$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$VST t6u0,1(Vr9ſuUt$VT ^_[]fffUSWV [ D$48H L$@ 1퐐/t <,tEPuUWP! .,v3l$4uWEED$\$cD$D$|$j|WȢtD$4@ T$L$ tp17t<,t\$RT$D$PttDl$VWQ& Ut$P 1<$WNjt$D$Pl$8u EW|$WV謩 W|D$D$D$ Džt$Z\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0}\$<u3D$u'\$Ur\$8C k$K($fC K(K(|$T$ t$4kPl>p1\$91\$-4$ۂK\$wPlD$P謂D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q膁 ^_[]USWV[D$t uyp|$ 1퐐/t <,tQL$$Ppt2ƃ$UWP 4$t$P  1^_[]ÐUSWV[+|$ t$FN,9vtU6zuCu;Uot.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[Ê|$ l$WPWuLt}D$x@ȃǃtVot$ UT)Lstƃntfuă뿐1ɋT$z H&D$8l$|$ u)1|$WuPt$D/WprWuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[[|$ t$FN,9vtU6su]uUUhtHnNT$l$f,Ninf|FFWRP臝 ~F 1^_[]ÐSWV[ìt$FNy9vtW6vruCu;Wsgt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[(l$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|U)D$tL$j|Ut L$U踸=rUPt$P 10^_[]ËD$tP肸L$ =r"D$t+P^L$=rQUPt$T^jjPott$ $@ 1D5t <,tFPeD$4 VUP D5$(L$tSD$HtJ11t <,tFP,e Vt$P辚 D5$h|$t+D$Ht"t$j $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0h$@,t'<$O 1҃ ҃f91wуu蠿<$O G$1҉L$‹O(Q9T$0RD$p g$D$t$HjjjPjfWjQQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$!$!ftGt @1@WG(f!hwU` =wb,ŭ!Ƅ!|)ƋtVPU_ 9vD|ŃƋGtVPU_ 9s D|ŃE$^_[]ÐSV[t$ tavKcv@cv5cv *cv$cv,cV c19!uǃ!^[ÐX_!@ÐY?!@upUSWV[$(E$$4D$$0j:WtjQP0 t0V$0Wk NjE;$^_[]Ãxu 1\tMudt6ultxtf$O:t @t@uS4$l$w$D$j@UP] <:t$EF<:uEl$4$D$D$OtuXPcxPqc`MǃX|D$O3/$$,PQhW t" ǃt SjUXfX7\(j|/x|]Pc^]PPetj/V荒t|$u/$jPRQV0'/T$ĩ$jPRWUQVVPj%KSV[}t$ j:V|tjQP轡 tt$Va1^[ÐVY.T$փ1u\t^1x^USWVH[t$dl$`L$\D$Dȃ=\ux<$yL$VPj@Q3T$tLT 9 $ƅtID$\WUx ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\x\DŽxDŽ\ $;D$Du ЃH^_[]PUSWVT[È|$pL$ll$hD$P=\ux $t$ uL$WPj@Qt$t$ T$Ijj wD$Wt$\ $t$j N9<$u-;D$PuyL$T^_[]WQU ;L$PtNTxM\>DŽxDŽ\谭;D$Pu T^_[]pOUSWVD[8L$`T$dt$X}|$@uM\u xt9ƀRQt$dPj@W tRQt$dVn M;L$@uD^_[]NSWV[||$=uj\u xtVw;/}tL!x\DŽxDŽ\W^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуuc\u xtOz=m8@tW=mP/T$ vPQj@R x. VPRԍ bk<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$lx 4()uT$ff׺r$σߺfDfu,$tу$$1#E;D$Lu^P^_[]Ët$dxe\VDŽxDŽ\ȩ,$1,$KS[ND$u&\u xti-[P[ÐS[D$u&\u xt-[t$ Pb[ÐSV[Ýt$ j:V6ttjQPݙ tt$V#袨-^[ÐSWV[<|$t$j:VstjQPx tWhV WhV ^_[SP[D$ L$ $L$ƒu&\u xt-Qt$P [ÐS[nD$u\u xt1[P蔃[ÐSV[t$ j:VrtjQP] tt$V""-^[ÐUSWV׉[ôRjj D$UWt$\  t$j 19tG4$x\DŽxDŽ\w^_[]ÐUSWVL[D$D$H1,<jUxK u} t @u D<@u^x]\NDŽxDŽ\D$;D$HL^_[]Íl$ E< us{Ui8|$jWx  u|$ u}Fux\DŽxDŽ\Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:00"D$t$DRL$D00"A @`? 19<$40"D$D@ @`ƒ? 9130"D$D@ @`Ń?+ 920"D$D@ D$@|$`D$? ;|$  ՋL$10" <$‹D$Dp50"D$L$ D1 <@4$T$<`Ń?|$_u+ 19QL$ T$D $L @`ʃ?|$_u 19 l$ D$L(D$<_D$$D @`Ń?+ 19 ՋL$ T$D |$_$D @`ƒ? 9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$H0"VRPQT$T$L$ t$ ?3 |$D/? D/ ? D/D$ /T$T$L$ t$ ?3 D/? D/ ? D/D$ D/D$L$ < L/ ? L/  D/D/ 00"<$<$r?USWV[5$D$$! ǃ0"ǃ0"ǃ0"ǃ0"ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"@P0"\g3g4t2tkƷ< sԃ1@ttP0"tlj瀍 ;!1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃP0"ǃT0"ǃX0"ǃ\0"ǃ`0"ǃd0"ǃh0"ǃl0"ǃp0"ǃt0"ǃx0"ǃ|0"ǃ0"ǃ0"ǃ0"ǃ0"]g|$| t!qtAD>1tBD>׹@P0"\gD,|t.tkŷ< s݃1@ttP0"tр‍ 0"1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ0"ǃ0"ǃ0"ǃ0"ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"]g|$| t!qtAD>1tBD>׸@P0"\gD|$t=2t$Fi%I<<fw1@ttP0"tlj瀍 ;0"1ttD~tW0"h  fABg w~4ABg w~4ABg w~4ABg w~4ABg w~4Ag wʼn41 @ttP0"tlj瀍 ;0"1ttD~tEh$Qg$AP0"g$BP0"$u1 @ttP0"tlj瀍 ;0("1ttD~t⍃hS0"0pQPQPQug0"D$pf0"D$le0"D$hd0"D$dc0"D$`b0"D$\a0"D$X`0"D$T_0"D$P^0"D$L]0"D$H\0"D$D[0"D$@Z0"D$<Y0"D$8X0"D$4W0"D$0V0"D$,U0"D$(T0"D$$S0"D$ R0"D$Q0"D$P0"D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فhр3ʉрUɀʈǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"΀0"D$0"D$x0"D$t0"D$p0"D$l0" ʋD$h0" ыD$d0"D$`0"D$\0" D$X0" D$T0"D$P0"D$L0" D$H0" D$D0"D$@0" ʋD$<0"D$80"D$40" D$00" D$,0"D$(0" ΋D$$0"D$ 0"D$0" ω D$0" ɋD$0" ? ? ։? T$ځ0"$T$ 10"u0"E0" Qu0" ƃu %?? lj%?  $T$ @D$Xƃ!$ ΃!! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0! 4!J΃ ! ! 0" 4"J΃ " " 0" 4"J΃ " " 0" 4"J΃ " " 0" 4"""G"4$l$T$ L$ Ń40"x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]#.USWV(]D$<X%UUUUʁUUUՍ4P᪪0"4"x " "x 0" 4" x " " x 0" 4"x " "x 0" 4"UUUU " "$؃0"4"x " "x 0" 4" x " " x 0" 4"x " "x 0" 4"T$H ݰ"l$ ݴ",1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y("$$"D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 30"30 "30"30!"3<$t$3~30"30""30"30#"30"30$"30"30%"30"30&"30"30'"1#t$t$D$|$811t$3=0"$3=0 "$3=0"$3=0!"$3=0"t$$3=0""$$1L$t$|$l$3l>l$|$l$ 30"30#"D$350"350$"350"350%"30"30&"30"30'"D$t$D$D$$7֋T$ Bl$l$l$$xl$ 0("4("$x (" ("x 0)" 4)"$x )" )"x 0*" 4*"$x *" *"x =0+" =4+"$x +" +"x 0," 4,"ȃx ," ,"x 0-" 4-"x -" -"x 0." 4."x ." ."x 50/" 54/"x /" /"D$@P1(^_[]ÐS[;D$1ɐȊt tT Tt t t4 uP1[ÐSV[úD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[ðMD$$D$DD$@D$9\$6D$L$T$@jjPQjRJqD$HPj &ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWF D$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPtD$0Pjt\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjptt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]#USWVd[Å$|D$<$`0"hjD$@PI DŽ$@D$V=%$@8$u H$@D$$@UV,ljD$P]qt;uHWPsWPruD$WPrD$UV蹟ljD$$jPWq D$,u:|$$@PW#x$@L$,UV_D$l$0 t$\$UV?D$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V+1$xUm$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-aPQRc_h$DUt$@VJP j jW hjU} hj$Pf D$@hjPR D$<;$`u`d^_[]D$RWOD$tT$@PQhR譓l$ $ fffffSV[ͮD$ h`rƉP)Ɖ^[ÐUSWV[Èl$0ujD$PUl thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,]kō|2"4$t$L$QWPjbVt2"L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V2"2"2" 2" jQPR ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQPS ;2"2"2" 2" jQP  Ƅ;2"jjt$ ^_[]fffffUSWVD[ø|$\w x2t$`tD$@jPVT NjD$@9t8txD^_[]x8"u tr׶D$ɶD$ 軶D$D$諶D$<D$8wD$X$2a$WQjP艏0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$D$ tKWV(tD(1t$Ot$ CU:T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[Ȇt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[jt$t$t$@[ÐS[þjt$t$t$[ÐS[Îjt$t$t$[ÐS[^jt$ [ÐS[>jt$ h[ÐS[jt$ H[ÐUSWV[t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[8t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX_L$Q##wÍ#ÐUSWV [(|$(l$$t$ D$4q?D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[ÎD$ hPt$K [ÐS[^ht$t$! [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[̀D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[TD$pML$LjPt$lv D$h|$df$D$VL$)L$D$PVW D$ |$$v=D$t$.D$lp8L$ QjjVV|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>VnV|$)Ƌ $PD$2PL$Q+  $ $,t=D$D$lp(t$ jjt$>VV|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VV;|$)v#Ƌ $PD$2PL$QU sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7L$R)уtuÐWVt$  r!̐cw^_fffffSWV[LNt$|$G@hjP d{j@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[%L$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjVw h$$VVhVU< hV1;$u Ą^_[]輹USWV [xJl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_I$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX${L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$$ $u$$$@$$…Ƅuk@wftQP$RyH$Px2$UPP x$$U ƉhP蓽;$u ^_[]賬USWV[p=D$$xE D$ u@wf$PWD$D$ jPW uuW~ u VW D$$hjPY DŽ$g jDŽ$HɽDŽ$gDŽ$;ʄDŽ$rn<DŽ$+DŽ$:ODŽ$6_DŽ$RQDŽ$тDŽ$hDŽ$l>+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQe $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]ffffffVT$tz tz$t Jt9t^þqwA BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[(7|$ G$xom9}dMST$ x0} $-$tуM8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGG,H tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[k5D$81|$ 8l$tsEE tl}$t|hju(Ѓ twNjt$hjP }/G8G4?VUtGWu(U$E4-|E E(}$uM$v1^_[]ÐS[~4t$t$jt$[ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]3$D$l'~ '~$x'^m'93e'KS'|$~ L"T$4"|$4ߍC??u @?@?D$V^G<$G@D$GD$,4D$\GpD$L$D$D$D$ GXD$XGtD$TD$PG\D$`$@D$dD$ T$D$\$(\$8|$T$l$$#~B E L$  $ɋ\$#Qt$>L$ y#t$V$t$ӋL$ uL$ Z $#T$2t$Y $#T$B$T$\$ËD$ T$ L$ $\$L$ \$5B$L$ |$ $"L$L$ X\$T$T$ ōA|$"ˋ|$WET$WK"|$WET$OY|$T$",$L$AL$\$Ël$$L$5\$ ـl$ $!T$2t$s "$T$rt$ލKw,!$T$rt$ލK T$$ L$ Q$W!T$2t$Y $!T$B$T$\$ÃD$ T$ J`BlL$9ȋ $\$ S $L$L\$ ׺)¹)t3L$|$l$$\$;D$rZL $ӋT$(CDL$4L$4T$(CH?L$ B JD$|$ \$ $Qt$>L$ AY $t$~D$ H@ $t$~D$ H ҋ|$t$V$t$ӃD$ J \$ D$L$ $\$VL$)L$  FlFF?1D$ |$L$FdVhD$H‰T$@9VPNX֋$D$t$|$;D$ r؉,$ыt$t$)ЃJL$ 9ȋ $s0t$>t$|$l$$;D$ rЉ $ыt$)ЅaL$TYrt$D$ |$`JL$ 9s(t$>t$|$;D$ r؉,$ыt$ t$)Ѓ1҉D$ |$l$$;D$@A΃t!|$T,_1fT}9u)ދ|$D$rfTXtfTXvfTXxsfTXzupl$D$D$ $L$L$#|$|$l$$\$;$r;L$$h%$FD$Q?\$,$͉ $Ct$ʿ $#|${H|$)t$$ډ|$D$ |$$D$L?L$(D$8)ȋZH)v;J0v't~%/D$4)؉ӋRD׋L$(+B4)v B,)B8)B8ΉӋRD9֋L$(w9w)SD|$t,1L$4899uL$4T$)\$L$(|$ra1L$401\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$4\$L$(+L$L$(ڃ{Dt$L$ KL$H?$ 3\$Gl$$$$T$$ً$T$\$ZuKL$ \$A$L$ \$T$D$$L$T$$$T$L$9D$BDBB?D$ $D$C?BDt\Ӌ$9wD$(9w΅Vt$t$fL}tT$;D$ $|$$b\$ w\$ { $T$L$L$ڋl$덉\$ $FL$Q?T$ B$t $L$t3B t-f\$hD$hjPD$40isL$$T$ \$,$6?11ۅL$ L$L$ $D$Ӊ\$D$PL$ ,$A|$ˋ|$WET$WKf|$WET$O|$T$}L$AL$\$Él$$T$D$wL$ApATA\AdDAtt$Pt$dt$TqhPj<D$ k 6%FL$Q?T$ T$t$$|$$T$tmuez(uB(jjjq L$,fD$hL$hjQPqT$ L$,L$5?D$D$ rL$ J$tA0\$t i{=B $t$$D$ T$b t$$L$ |$$L$(T$8)VL$Q L$tJtF\$L$4)ыD$x@t RQPpRQP`x L$AF0I L$\$tT$zt 1D$ L$(L$8D$T$#;JB1D$ L$(L$8D$L$O?zL$|$  $Qt$>L$ As~$t$~D$ Hw`&$t$~D$ Hw7ҋ|$t$V$t$ӃD$ t$$D$ t$$L$ |$$T$1D$3;Z *\$%FL$Q? \$%FL$Q?D$(D$8 L$l$$|$T$\$$B$tXBL$t/B t)\$hD$hjPD$40nL$$T$ \$,7?11ۋ$\$ $D$$\$\$Ӄs3\$|$A$L$AL$\$ D$D$$T$\$B$tT$ʉHP T$Bt0B t*D$fD$hD$hjPD$40mT$ L$,B8?B1۹D$D$$u"$B$L$ t@L$D$\$ $D$$\$ \$ӍPs3|$ \$D $D$PD$؋\$T$D$ T$$ZDJ$tY1D$uD$ L$>B L$t,f\$hD$hjPD$40lL$$T$ \$,1D$ 9?D$BBD $9wƅыz$tL$ \$YsCҋ|$_ t$V,$t$\$ӋL$ $l$$T$ t$$ً|$$l$$T$\$B u11ՉډˋL$, 9uY11ɉ|$L$ \$J$t A,A0jjj i L$,F0L$??T$ \$ T$Z$FL$Q?|$ D$ D$G?$T$- D$H?<$L$(D$4F ND$$FD$BL$ #|$0D$D9rщD$0L$ oD$0t$,$ʋD$ ȈL$@D$Dɉ\$fD$<ȃ|$D$?D$D$ zjjjlT$ L$,F0D$??|$dzt+\$ ـD$\$ L$N?D$ L$ \$w: $`D$ D$ $L$L$L$ ӋT$L$؃BL$ t>tCuH\$t$L$\$ T$BG?$u8D$A?D$D?n$FD$Q?D$L$L$ \$L$ L$ *$T$B$T$D$؃ X$$D$ -$$NL$Q?D$|$ڋ t$$$NL$Q?D$ |$T$ x~|$$D$ ЋL$щL$$D$ D$ l$$|$T$UD$ L$<͉l$$D$ D$ l$$D$ ȉʋL$щL$$D$ D$ |$$$D$ |$$\$$ыL$щL$:D$ $D$ D$)D$ $L$@ˉ\$$D$ D$ l$$|$$T$d$D$ D$ |$$T$l$$=ًD$ 1\$P?L$D$ t$$D$ D$ l$$$T$|$L$ \D$4F D$(FD$$FD$B?t ^>?u(jjjRb t$WPDb ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[ØL$(D$y y$Q9 $JsD$(xu$z@VS?t$u$plL$( $BS?zUP4)r*9w $с4JPMT)с4JT$Mp) 4Bpt$tu0u8V辤T$ r8W1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$t+D$PtD$ff|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,t‰ЉT$P9rD$L$hT$Z)|$)|$L|$|$@)|$)|$D|$|$H)|$)|$d|$ |$\)m|$")^|$X|$$|$<)G|$&)8|$8|$(|$`)!|$*)|$ |$,|$4))$D$0t L$0 $fD$nf\$pL$LfT$rD$@fL$tL$DfD$vD$HfL$xL$dfD$zD$\fL$|L$XfD$~D$<f$L$8f$D$`f$L$ f$D$4f$f$$t-1upt!LEtTLlzf|Ll$fQ$L$D$<D$TD$8D$4 ك19tTEt|Tl_f\Tl$$fzTEt|Tl_f\Tl$P$f~뤸|$ 0D$<D$2L$4D$8D$TD$0>|$ D$0D$<D$L$4vD$8D$TL$(D$TD$8D$4D$<D$0FD$`ʋ$D$XD$@D$D1T$\D$ D$d|$T$PL$@t$HЋ\$D)؉$$L$@?? u)D$(L%L$(h%É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,At$t$jjjjt$$t$$ [ÐUSWV [D$881z|$<8o|$ ^GG u|G G(T$$$u O$L$,tՅx|'D$D$$D$$T$0zƒ|$( |$4"$|l$ tʉ$hjl$(u(Ѓ IhjP3 }/G*D$GG $O0G,HO4L$0OPWLWTL$0 iɫ OXjPu(U G8jw,u(U G@jwLu(U GDLJL$0jPu(U GW 8tG@tADt;t7ȉID$D$4G$U*!G@EU ^_[]ÐUSWV[Kt$~ V$N91yoǃ8w~At Pv(҃NADt Pv(V$NA@t Pv(V$NA8t Pv(V$NQv(V$F1q@^_[]Át*t쐐SWV[\|$WwƅG,ODG$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃdžl$l$T$ y_V8Vt\$U%FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+hD$T$t01tI ^_Átփ*tWVZt$ t=~ t7~$t1Nt*91u&q~ǃ8wLT$1t ^_Át*tUSWV _hL$ y y$q9NQǃ8|$0|$$N9l$(4$Jى\$!4$f ؉\$V_AL$1)t,)9멁f*] ^_[]ÐUSWV[Hl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9z4&G,OL WDqL$ $t$ 1fj94$J)r=* jU L$T$4}Gl+G\Gt0GDOLfDHɃQjP8 1)t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$sT$,n$1 fti9,$tQTi)rftiTi)rftiTi)rftiTi)r뢋T$,LJL$IG|1USWV[|$$ $w9>NQǃ8wHl$(e tWt?t u(t#IO5t*t#F(n(~taV<NG9wͅt2Uvw } o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj4 G0FqoUO;,$Eo9wŅt0UD$pw | o $ho)o)hu $AA~Nl$(9jjj, G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0% G0F FEh1҃ҍ,j1҃ҍB9 l$(@G; FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoUk8,$Eo9wŅt0UD$pw 5y o $ho)o)hu $AA~5 Nl$("ܑFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQx F NFy,t)vNPQw0# G0$F oUw7l$Eo9wŅt2UD$pw @x o D$ho)o)hu L$AA~> l$+,$V 19> $ $F@F N $UPQwL$ nnFx,t)vNUQw0*# G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0" G0oU\6,$Eo9wŅt0UD$pw &w o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0" G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0! G0oUC5,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0 G0FgFx,FH;N v[oUj4,$Eo9wŅt0UD$pw 4u o $ho)o)hu $AA~41O0Vhn G1NVjnjjj% G0FqoU3,$Eo9wŅt0UD$pw t o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(V~tu"~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQV54 $FlF\iU^2l$E$ыj9wŅUD$pq s $i D$hi)i)hL$AAxl$(Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV2 $FlF\iUH0l$E$ыj9wŅ(UD$pq q $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVwuF(uaV;/~l$(džMN\hF8`jjjV,uFFDNLfDHɃQjP dž~tuFlF\džoU-MG9wͅt3Urw T$ nT$ o joG)G)juJJl$(1NG0NVjnG1NVjnG2NVjnG3NVjnGNVjnG NVjnG NVjnG NVjneF(1^_[]øV$nUV$*FVjn G0NVjn$NVjnoUx,,$Eo9wŅt0UD$pw Bm o $ho)o)hu $AAF~؉F1~;l$(HN\F81Vl)jRPV- $FlF\iU+l$E$ыj9wŅt5UD$pq l $i D$hi)i)hu L$AAxl$(~1Vl)jRPV- $FlF\iU:+l$E$ыj9wŅt5UD$pq k $i D$hi)i)hu L$AAxl$(1F(WVZt$ tR~ tL~$tFNt?91u;q~ǃ8w3hD$T$t$|$A|1^_Át΃*tUSWVP_zL$ ƃ9r\$ ƃΉ9ƹrt{ t{$t st9t9wʸrЃ^_[]Ë^kǃ8w6L $~1tGt&u81Ƀ~l<+*t΁uċ^ۉts{tt{q^0nPu1u,A ȉ9QN9w u$/,뛿kt }muk$t }mu{,f^S[t$ t$ 6[ÐUSWVX$l$,]M U,T$9wL$t$0KL$]|$*{T$)Ul+U\KT$ щʁr9w׉;|$|$s,…ր<4T$9&11 ‹$T$RjjU&EMTEMtЋMUD MUd unUJ'E~9wDžt)$Wuv h ~ }~)~)}uEEL$ tFD$9l$,w΋EM8M\$VQp g Ep )ppu\D$)l$,D$t$0|MQ $P+Ex )xxWD$t$+sM,9U~^_[]ÐUSWV$X8$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUuElE\~WGn9wŅ$Uwv ^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUuuElE\~WGn9wŅt)$Uwv n] n on)n)ouGGD$8xt1$^_[]ÐUSWVXx$l$(l$(ElEtEx}tw0$Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQU>mAlA\uVgF}9wDžt)$Wvu 5Y } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu W } ~})})~uFFD$(xy1)Ћ$jPQU+mAlA\uVTF}9wDžt)$Wvu "W } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XXÐUSWV^سL$4t;T$8\$0Ӄs3I͉у1&Ӊi913XƒT$4zR13XƒT$4zR13Xƒl$4M1ʉ3XxT$  1ϋL$ 3XÃ1ؐ\=13X\=13X9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3X3X3.X3X $3QX3X3X3X $3AX3X3X3XD$ $3A X3X3X3X|$D$ $3AX3X3XЉ3X|$|$ $L$l$11D$D$33X3X3X3X3W13X3X3X3X3G13X3X3XȋT$3X3W 1‰3X3X3X\$3X3_1ˋT$ )3X3X3XÉ3XϐÉ13XW13XW13XW13XW13XW13XW1Љ3XO13XRЃ^_[]ÐS[Ît$t$t$ [ÐUSWVXXD$L$ \$  $),$9߿ʼnˉ$sRt҉L$X1ځ 1Յt1Qu1^_[]ÐUSWVXD$L$ \$  $),$9߿ʼnˉ$sRt҉L$X1ځ 1Յt1Qu1^_[]ÐSWVL$t9T$t$1ہ 1ޅt1_u11^_[ÐUSWVXhD$T$(\$$ й$+,$9޾É$sMt։T$X1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]ÐUSWVXXD$T$(\$$ й$+,$9޾É$sMt։T$X1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]fUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[t$t$t$ [ÐUSWV[ûD$ x_|$l$jhPt$(;T݉Ⱥqi)Ǎ)w B4vv 4v ^_[]ÐUSWV[D$ x_|$l$jhPt$(kS݉Ⱥqi)Ǎ)w B4vv 4v ^_[]fffffXÐÐXT$J r ,ù)ы,ÐS[îD$D$ P[ÐS[~t$ [ffX_L$ T $ h, | 0 |8 fǁǁǁ &fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ǻT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXxD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV[N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$XجP` Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tk |OWrw ~OWrwfLJLJ^_[]11fTfEf6f 'uUSWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1ث\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +б)9~P fHpnh1pXkh (f  fыt$r t$t$ ة|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +D)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>ثfr ة f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[\t$xƅt|$7V?G sO ^_[ÐSV[ t$ )tt$PV?F1$O O^[ÐUSWV[øt$ԯtLƋ|$$l$ $P>D$PWU1 1uN(Vu N(^_[]ÐUSWV[+|$GtE/D(U8]wUzt#V譡=yarau D$0VSN1^_[]ÐUSWV[ë|$GtE/D(U\wUt#V-=tcidu D$0VӞM1^_[]ÐUSWV[+L$A1t3)D(U6\NjD$pUtt D$82M0^_[]ÐUSWV[l$M1tMuD1V[uVt(WJ=yarauD$8L W1^_[]ÐUSWV[[l$M1tMuD1Ve[uVt(Wڟ=tciduD$8UL W{1^_[]ÐSWV[~Pt$ t$ n. t6D$t7<$D8WZt$W!tD$ 01KK^_[SWV[i~Pt$ t$ - tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"KKVq9K^_[ÐSWV[}Pt$ t$ N- tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"JVћJ^_[ÐS[.}L$T$ jt$t$ [ÐUSWV[|QƋl$$P;:D$PUWW, tgV2D$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6I 4I8Vu 댅t D$ 01oI^_[]ÐS[{L$T$ htcidt$t$ [ffSV[{t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[{{t$t$#_P=loobul$VEloob^_[]ÐSVP[{D$Pt&Pt$t$` D$VbD$1^[ÐSVP[zt$t$Vt$t$` D$VD$1^[ÐSV[}zt$t$t$!^VP8^[ÐSV[Mzt$t$t$]VP9^[ÐSV[zt$t$t$]VPg9^[ÐSV[yt$t$t$]VP9^[ÐSV[ýyt$t$t$a]VP':^[ÐSV[Íyt$t$t$1]VP7:^[ÐSV[]yt$t$t$]VP:^[ÐSV[-yt$t$t$\VP:^[ÐSV[xt$t$t$\VPW;^[ÐSV[xt$t$t$q\VP;^[ÐSV[Ýxt$t$t$A\VP;^[ÐSV[mxt$t$t$\VP<^[ÐSV[=xt$t$t$[VPw<^[ÐSV[ xt$t$t$[VP<^[ÐSV[wt$t$t$[VP<^[ÐSV[íwt$t$t$Q[VP<^[ÐSV[}wt$t$t$![VP=^[ÐSV[Mwt$t$t$ZVPg=^[ÐSV[wt$t$t$ZVP=^[ÐSV[vt$t$t$ZVP=^[ÐSVP[üvD$QP0t&Pt$t$\ D$VD$1^[ÐSVP[\vD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[uD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[ÜuD$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[JL$t 9t1[ËD$ IupPQ5 [ÐSV[ID$ t9u L$t9tf^[ËppЅtItRPאS[ÎIL$t 9tf[ËD$ IupPQ[ÐUSWV [8Il$(|$$}(tD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY >D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY|=D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y<D$t9u@H@ty1ËT$ BÐSVPY<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY,<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY;D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY=;D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX:T$t9uBJBuy1ËT$JÐSVY:D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY<:D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY9D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY-9D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX8T$t9uBJBuy1ËT$JÐS[Î8D$t9u L$ t9t1[QP*Y[ÐVYN8D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY7D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY7D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY^7D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [7u t1D$D$ D$~N~(DN+t 0tV-usD$WPv% T$ D$1ɿ98"yxuD$j\D$WPvK% T$ D$D$9T$rF=8"u<3WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[^5l4"jP5q4"PQ_1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[=4D$04"VPV蟯1^[ÐUSWV [3t$4NswD$8t(@ta@uppQj WWjUVEZ tWVWWt UVI[1 ^_[]Í7(('PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[2PQql4"Pn[ÐS[î2l4"Pn[fD$w sÐS[^2D$ ;D$uPt$t$k{ [1[ÐUSWV[2D$ t$tPkD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPy 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í(((PQhR3USWV ]X/D$ \$$p1}<"$N<\u< $1ۃރSTP$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋ Hptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ)((PQhR USWV0[%+$Du wj011<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w4$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p[)D$a)D$Ews 搐<<}jt$W) tfjt$W tSp)jPW E $AEtLt@<-Eu<-u}>u$h\t u94$誢10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$UD$m$hōj)D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[#jt$ [ÐUSWV[å#$j$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjUYtjVU_^ |$t'jjjhjt$P角|$t-$U~jWU^ WUkTVUkCS[n"jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[ j@ƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[É t3Pj.tjj@aDžuU՛Oj@F1t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[Ê|$oU[1tIp9u?$jjt, HWs;~$9uG-&-z)PQhvRS[D$tp9uL$ t 9t[ÃQPS[ÐS[ÎD$tp9u L$ t9t1[QP*4[ÐYOD$t 9t1ÃÐYD$t 9t1ÃÐS[D$t9u L$ t9t1[QP3[ÐS[îjt$ <[ÐUSWV[Ël$}t^_[]j@n}tƋ|$pPV^0jPOF,F0F4F8F<}(t7h }tL$7PUrV`0bUSWV ։L$[|$ *?u-wG"}MG]jjWU -u)jPwwt,ut$$ɌujPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'ujPWX t4jjWG t# jt$(P6t$>t1t$$轋U. ^_[]Ís-Q-z)PQhRS[Pt$ [ÐS[þjt$t$T; [ÐS[ÎPt$ [ÐUSWV[[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(*)z)PQhjRwQ*GP5LW1^_[]É.))z)PQhhR(0)z)PQhyR ~*)z)PQhRS[L$A4tPQ4I,Dt*Pa,[Í**z)PQhR~**z)PQhRnUSWV,[È D$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jj蝁tt$ At$DVL$*L$ql$$9.|$FWUP jJmDžt!PW> Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Ult^Ut$D$PJ U;1$D$jzlt"WPt$ED$E E^_[]ÐZ?L$1t 9tËA ÐZL$1t 9tËAÐSV[T$ t19 uL$t r ;t$v1^[ËR1ttVRQC ᐐUSWVP[zD$1t 9t ^_[]ËHh t( $tDU@kt؉Ut$P֠ ąt .--PQhR0.--PQhRZL$1t 9tËAÐS[ÞD$t9u L$ t9t1[QP: [ÐSV[]L$ t 9t1^[ËT$19Q ut$tRVqNH ֐USWV [t$(>t~(t  ^_[]ËFMjQvPgt҃~$tD$jPv p ʼn$u 8"tD$N N$9u8"t=n.W.-PQhR'1jPj N,$U6i7ǍFPD$PU tcD$;$uZFejPV tD|$u Wfy1,$jhƅt-PVF~n W)yt WyD$$0USWV[xy1D$4$G=w ՍjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[ÝD$0FuFt PwVv1^[ÐUSWV[Xl$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í7(z.-PQjtRzSV[ÝL$t$ 9t8V 1;Q u.FtRqPA 1uyu"^[Í..-PQhR..-PQhRؾffffSV[ PQ6|$ u4"4"V^[ÐSV[ít$ 1t9u V^[YD$t 9t1ÀxÐYOD$t 9t1ÀxÐS[D$t9u L$ t9t1[QP[ÐSWV[t$~uo~(tijPvvMt4"!jPvv*t14"|$ PQf5V7^_[ÍG/0/.PQhRSV[-4"VPƃ4"4"VPƃ4"1^[Ð1ÐS[D$L$ yt0@QP`[ÐVZŽL$1t91u T$ t92t^19^ffffSWV[Lj@@`ƅtEPWV4>jP2F,F0F4F8F<^_[ÐUSWVP[t3Pj}itrj@_DžuU$pWj@_1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tvP9uloU1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[*։ $|$?uwG8]u<GcjjWr tCF jPwwt,t1jjPUt$t1U^_[]Íe2H2/PQhRRS[pPt$ þ[ÐS[jt$t$t [ÐS[îpPt$ [ÐUSWV[{t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%k0:0/PQjmR迯QrdGP}&W]d1^_[]É.K0:0/PQjkRs0:0/PQj|RWS[~D$H4tH4[Í00/PQhRUSWV[8D$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jjN\t|AD$0t$PL$T$rL$9Al$ F9(u:G@D$PP[ÐSV[t$ vVX^[fffSWV[t$NtFt\V9wqu QPRtFVL$z~ ^_[1333PQj9RD 433PQj:R((433PQj;R SWV[,t$t$|$PWtu^_[ÐUSWV [t$ F|$$4$/wbg\tbwtRt$jD$PD$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð7(L43PQhRŠSWV[t$~ t 1j Vt ;~ r^_[ÐSWV[ì|$t$t0t*PVtuj Vm^_[1SWV[Lt$F|$uLPVujVm1^_[Í7(p43PQh$RSWV[,t$F|$uEPVtiu]jV}1^_[Í7(43PQhERUSWV[;t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í7(43PQhdR補USWVP[D$1ɅQh Dt$7j@1Ƀ#h}@$GGG wtHt$WՃj W=tjW$$<4PWtiu千g5PQWq tDj Wt5D$h VPW`tj WZ7OWO $ȃ^_[]ÐUSWV [E$($$WtEP舑x=ŋ$$t$t`?t[Wet.H|/t+1]$,9/;9sfD$ .t$ VH r̠?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ 8t$h t U 8ܟ8V N̟8$ ^_[]É,$9tG9t iy/t)rD$ UWPr D, ,$S[jt$t$ [ÐS[jt$ [ÐfffffD$ǀǀÐUSWV[{T$$L$ |$l$t$u2jP<tUhxL$ H L$$H*s3uFˉ,|\T ^_[]1555PQjAR螗555PQjBR肗USWV[ëT$t]D$ |$L$tKutUtMtM L$$tEUKL1Ht t L t L |$$t L2 ^_[]Í36#65PQjZR蘖ffffUSWV[øD$8t|$4D$0uhHL$HL$HL$H L$H L$H $x p PHbl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Èt$@|$[fffffS[Nt$t$jt$t$t$8>[fS[t$t$jt$t$t$(>[fYXZQ̀QQrS[t[fffffffS[þt$t$t$t$[ffffS[Ît$t$t$r? [ffffffS[^1;D$[ÐS[.1;D$I[S[88t j衏1[ÐS[88t jq1[ÐS[î88t jA1[ÐS[~88t j1[ÐS[N88t j1[ÐS[88t j豎1[ÐS[88t j聎1[ÐS[þ88t jQ1[ÐS[Î88t j!1[ÐS[^88t j1[ÐUSWVX+4"?) R44"ѐ>t1 @u~1ɍ4">t 9u#;T$t$8PQj;R*ffSV[Ýt$ tF(^[ÍP88PQj7RfSV[]t$ tF$^[ÍP 98PQj7R訃fSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[n7"Pt$t$j [fffffSWV[<t$T$(с wdp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[Í)P9׍9PQj9R[USWV [ȹt$ ejVy<$A1jt$V= Ƌ4}<|$l#D$,D$ltBL$4$t$$Uw u͋$|=uU<C9l$}q)t"uDur;MDMDMD MD9uA1 ^_[]Íon9X9PQj>RwffffUSWV[$ÑL$(soL$,r)L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$L$(;t$0QUjRV/3?Utq0$l$T;jP141ɅjWjjWj聂 jUjt }|$T l$TjVt$ T u'8t$jWj jUj jD$pPjC $ȁ^_[]S[ÎL$T$ hPt$ [ÐUSWV(T$ [RL$<\$%t$@|$t;D$<|$"v+f1t$ \$VP]n\$u<+t<-t D$1 1ҊD$L$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj=S[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[ôt3T$8tOl$@to:VPt$DR*::}:PQhRs멍::Ս}:PQhRs뉍::}:PQhRsT$HkXODH@uyD$ j PW $T$x8"u,x"x0@UPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ) ;WVPQt$H蛎11҃^_[]Ë$T$|$(9ыl$,}!;|$09Njl$4}<;UWRPVQt$Tt$TD 맋L$8fffYimNA90%ÐXOL$ffffUSWV0X($t$DL$H|$PL$%1|$L$WD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$G T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ 1$cp0^_[]Ë$;;Z;PQhR^j$;;Z;PQhR4jL$XUSWV0X$L$Ht$DL$1|$L$W\ D$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU@ T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U.1$i0^_[]Ë$;;Z;PQhRcL$XffUSWV<[Hl$X|$Tb D$\}  |$T  D$u D$4tǃ$ǃ(T$PT$$9L$$pT$,mT$0\$|$ <$D$(\$(ǃ$|$ l$XL$1L$u HD$4;L$$D$T4 >-u FD$, t$0E<+<-~(L$ $XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő(

 $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VgRD$\(pD$D$ 1T$ $ $.T$tf\$QURS uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:LRQP" \$(+$L$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:teRQP蠆 1L$\|1uD1 <-t<+::BtD8tD$X8:tRPA?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP莅1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8p D8t}:tٻ4$P $E<-t<+u:}:1<: :<<;PQh_R-Yw.<<;PQh`RYD$l])<<;PQhaRX|$T;<><;PQhRX.<><;PQhRX=PQj4RJQŐSV[ýt$ tjjjV/^[Í">=PQjARPfffSWV[l|$t$t1hPWV/^_[Íc>->PQj6RPfffSV[ t$ tjjjjVܐt^[Í>>j>PQj0RDPfffffffS[ît$j t$t$P[fffffUSWV[{t$|$tBjW/~G0t ujW0^_[]Í>>PQj/RO띐USWV[t$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H T1^_[]ÐUSWV[xjl1L$,l$(D$$t$ T$wGo Ouu u&t,t+$yt ztڍlyuft?$L$ut: $fH f@xp$L$H,h(@DPQj;RjLu0?(?֍>PQjD$.D$D$ t$5x9L~8j@@P>FFHQNF )PQj,,^[ÐXL$x9L~8Íj@Í@fffffffUSWV8[øL$Xl$Pt$LD$4ut |$Tu+AVP?QAVPr?wAVPZ?AVPB?AVP*?AVP?AVP>BVP>ABVP>t`BVP>fBVP>XBVP>JBVPj>9BVPR>CVP:>q0CVP">`]CVP >O` t9uuh/l$t'j2pU0 "AQP { t@@@PQhRPEL$h@F@@@PQhRE l$rPQj2UbU:ƋD$XtPUt$\ ;D$4u 8^_[]YffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[,||$t$t2F)F31uF FF^_[ÍCCCPQjYRGC뭐SWV[ü{|$t$tg~uP\$wGN QtDDCPQhR.B~uр~|$^[ÐSV[}zt$ t ~t/FD#DCPQhRA~uN .wu^[ÐSV[ zt$ t41~t^[ÊV u.wL$~9|ԍD9DCPQhR'A먐SV[Ýyt$ t~t0^[ÍDNDCPQhR@~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[x|$t$t@1u6T$L$9w"QjVRB FfFF^_[ÍCdDCPQh.R@뜐SWV[|xt$t>~u/L$Fy |y|9IL |F1^_[ÍCtDCPQhMR?랐USWV[wt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍDDCPQhhRQ>DDCPQhiR'>SV[Ívt$ t"~uDNu;V9r1-CDCPQhR=~t^[ÐSV[vt$ t31~u(NuV9rT$x 9v ^[ÍCDCPQhR8=fSV[íut$ 9y ^[ÍEEDPQjTR<אUSWV[[ut$|$t.l$tGMϸwG)o >1^_[]ÍC0EDPQjbRz<뱍CE0EDPQjcRY<또USWV Xt$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ=D$0 28t p׾$VPU 7+D$p)t5u+VQA$RjP= 7D$)smH1 ^_[]Ë$DQE֍DPQhR:D$4$fEQE֍DPQhR:g$tE΍QEDPQhRa:D$a$aFL$MFՍDPQhR+:L$USWV[Èrl$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQy; D$ }+$x)t6u,WQARjP,; l$}<$)s8O^_[]ÍDE֍DPQhR8tE͍EDPQhR8렍aFL$MFՍDPQhRv8L$;SWV[pt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9DEDPQhRz76EEDPQhRP7)뒐SWV[üot$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1DEDPQhWR76EEDPQhXR 6VL$t"T$ tփuQ^ÐUSWVP[:n|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP 7 D$$L$(l$0O}^_[]ÍEE$DPQhR4T$L$8D$4VUFEՍDPQhRo4\SWV[l|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[\lt$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Hk|$$D$(t9D$ L$,ň̍AFL$7FL$D $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[|$ ]$$juD$P D$jPRrt$t$X4$PjVDVPVWn V9a|$(fD$,t$t$0fD$4F-D$(jjP肕 ~ D$64-8HPpjPWؓ $l$$|VPVW诓 $VPVW葓 $VPVWs t$XjVW裔 u2|$X;jVW臔 u+jVj5 |$X uL$1P'<$$0|zHPt$D$PD$dPVl VA$(D$a<t<jjD$`Pjjt$(D$xPbuD$XP%=HP"Ql$<$7HPQV誔l$W蝔D$8jPjg E;$d-h^_[]ÍHP$먋D$p*0PVQRFl$yHH~FPQhR$;FH~FPQhR$#ǍFH~FPQhR_$FH~FPQhR6$H~FPQhR$S[~\jt$ t$ t$ t$ t$ t$ [ÐUSWVH[8\D$D|$\,|$dND$l|$hfl$tt$`fƍ-kt$$PQj V@D$D$D$D$D$ l$D$ D$L$PQVt$h6^t#6PUPVQnN Tl$p $At"8"hPV D$\0t$\ $Ut$pt$pt$p4$s;D$DH^_[]ÍFF~FPQhRK"|$dFF~FPQhR"ƍFF~FPQhR!oF~FPQhR!XoSV[-Zt$ tjjV` ^[ÍFF~FPQhRk!̐S[Yjt$t$ [ÐUSWV[åY$E$$$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ ǸxVtuTfD$D$PWL,$D$f$%/,$$ffD$UD$PW  yQ%80uN$=uW%#,z%,$(Wߎg%(,$WƎ,$M;$u2Ĉ^_[]ÍFG~FPQh REHUSWV$[èWl$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRVuT<$t6t$t4$$$WPVEP)$$PhQR$ZK$@l$$hp V oGhPVq Y3D$$p C$p 0m$pPvPV=tbōD$ PV聝x\#D$=uXUTL$ QP&xED$$t $;Au=D$G0=OxG1CGGG9"U+WBt$Vl$E;$ļ^_[]$$$$U똍PGDG~FPQhR ƍ(GDG~FPQhRq6GDG~FPQhRY[USWV[SD$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[ÕR$D$$D$hP1$S$k$$UhhWDD$ D$$GƄ4$$$UhhWDj W[t$X8D$1$0U t u뜐44 w$L|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&P$@|$L$ t$֋$^D$PjL$Q$&PrD$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP賴+JtD$Hɋ$@tD$$L$Q$jPY؅$U$ 1$$׋$$Pu\~$P$' 1u7Yu,N$P$ t/t u $Uhh$$WA@11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύHG~FPQhR^6GG~FPQhR7n(GG~FPQhRV賻USWV[xLD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[];USWV4Չ[KD$$0qƃ9"9"Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/u9"IPRQj814$ D$;$0u4ȁ4^_[]ÍPGI~FPQhRh^USWV0։[J$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$P uo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1P; E;$,ue0^_[]ÍPGI~FPQhR$TII~FPQhRx肷fUSWV[HH|$,D$(/D$wl$GQjP G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=м݋t$|$<$$t$&$$1 $+L$ r#J΍ JIPQj`R1D$,H$$t$,F $)ʃr#=J JIPQj}R F$)N)!r s.^_[]ÍQG JIPQjCR cJ J׍IPQhRa 몐USWV [Et$ ~Nƃ<>"V҉$t`L$FшT$?r?鍋="$j@UPQP\$+="~t0|$>L$:$u ="uL$>͍ >T$1ҍ<>"-9si$:GU;L$s>t 9sE.9r9s34$Gh9s맋 $<>"9s$=" ^_[]fffffUSWV[kDt$|$lUl8PPWVGUL^_[]fSWV[Dt$ W!PPV- W^_[ffffUSWV[Ct$tLD$F$V~nF=>"PUWRt$t$QjV&($^_[]ÍJJPQj3R 듐USWV[8C|$,L$T$ |$l$捃JUWRQL$QVPt$H 1uA$L$O>"O>"P>"L$Q>"L$ R>"L$S>"L$T>"^_[]ÍJJPQjBR [USWVH[hBl$`D$ D$D|$\SrE$MUu}mKUWVRQt$PjD$JP&$$PvKPQ+jjjjP&qƍ0V(jjjjWpƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV'${D$L$ D$D$D$?D$D$@D$D$AD$$H$0WD$ ;$L]PvKPQ'Ÿ4$jjjjU+mƍD$$1 V(jjjjUlƅbt$$V$L|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$rD$$LD$ AD$AD$AD$AD$AW$L/D$(PA;KL$QL$ Qt$($TPt$"ffffffUSWV[H;t$,l$(D$tjuj! ƅtRUP8K1 F LFuF ;D$u6^_[]1ꍃKKUKPQj4Rur辩USWVp[u:$E$l D$P1Ahh@Vo 1lj,$t$\hVWo Ņ~UVD$ POA 50Wp%0,$xj$uj!軤ƅth$\L$QPI1\F LFuF E;$lu5p^_[]1㍃KKUKPQjNRGUSWVl[9$D$h$U?$$U@ uj!赣ƅtXD$XUPH1LXF LFuF ;D$hu2l^_[]1ꍃKKUKPQjhRJQS[8t$ t$ [ÐS[7t$ t$ [ÐSV[7K]>"jPVm D$ jVPjZ^[fD$ȉty!fUSWV[h7t$0l$,D$tjuj)@ƅtRUP1 F LFuF(;D$u6^_[]1ꍃKLKPQjFR?urޥUSWV[Õ6$ $$P'h@Vl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$k ƅ~.V$P$P |) u84$l8|$$uj)2ƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1ؤãS[Î4jjjjt$t$[ÐUSWVt[X4$D$p$U$$U= uj)ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃKLKPQhRG螢fffffffUSWV\[X3|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍLL$LPQhRLL$LPQhR$HffffUSWV[ t$0l$,D$tjuj)ƅtRUP1 F LFuF(;D$u6^_[]1ꍃKMLPQjFRur~USWV[5$ $$Ph@VT1$|$$ $ u#D$P|$WrP|$`l$d$$ʃ|&jQPt$ I|=P$Pt$S ƅ~.V$P$P` |) uS84$TA8|$$uj)҈ƅ~$$QP1F LFuF(4$W T|$;$u^_[]1xcS[.jjjjt$t$[ÐUSWVt[$D$p$U$$U uj)襇ƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃKMLPQhRG>fffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[út$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP謻 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8 PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWr ;D$u ^_[]sfffffL$$Yai qyD$A(tQS[ØRjj#9 [1ÐT$D$ Zbj rz $z(t RPS[HjRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[óRjj>8 [1ÐT$D$ Zbj rz $RPS[njRj7 [Xt@ffffffSP[=D$ L$T$$RQPo[fffS[jjt$jT7[fffffffS[jt$t$jb|[ÐS[îht$t$j/|[fffffUSWV [xt$ D$D$$|$jjUVjW1D$D$ $jjUPjW˔D$D$$jjUPjW蔔D$D$$jjUWjP[u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRѓ1u ^_[]ÃtOw OsҍHon]M*MPQj"hVt$ t N81^_[ffUSWVh[} pB"uj'N\pB"D$PjIpB"L$@B1lj1L$ED$$1Mt$ƉqD$PjxxpB"L$@B1lj1L$EHD$$1t$ƋEp jPwu(pB"L$@B1lj14$e^_[]ÍMMPQjHR%pB"USWV[Èl$zjPUw u @t tQUuMjPUPw t 1^_[]ÍujPV+w DžtjPVw 1uú!?E1u<-ut<+uXMDHt$}D$j PWb L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ.L$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[Ùt$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVZ ^_[fffffffSWVP[t$tBtB"PQhRjx>L$ $tB")QVWRtB"PQhR(tB"tJ"t@tJ"^_[fffUSWV[;t$D$D$I@t NQw `ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í NNMPQjbRUSWVX[D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í4N-NMPQhtRSWV[É|$t$t5$D$ WVjjjP1Ƀىȃ^_[ÍonNNNPQj:R衶ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[8t$(l$$.PT$(18D$8tTP) ukt4)puD$(8rl$ ugPt$Yŋ$t$b0?uD$8tTP(Wg4$&#t$#袹01UPt$ŋD$G6"oD$ G xJ"xJ"D$8tTP(G^_[]ÍNNPQhRPNNPQhR&T$(#r)soÑ;jUPQRVjeUSWV׉L$[R2jeVj+Vt-1|$WjPj%eyFu<$|$1jrV聙tP` $UW`ft1jUu%07\!wQ!ٷ01^_[]ÐUSWV׉[gxJ"tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8tTP%gt/D$08rL$ ubPt$ŋ$t$]耶0D$8tTP9%Wd4$t$A01UPt$葢ŋD$G6oD$ G xJ"xJ"D$8tTP$G^_[]ÍNNPQhRNNPQhRůt$,|$(T$0VWU jUSWV[t$8$8tTP#xJ"t9ut>mt9uu+$8tTP#h1V蟤EuxJ"$8tTPy#|$jWu ƃu 膴8tUbtt$^_[]ÍNNNPQhRvfffffffUSWVH[D$`|$\t$$UVPWmKtUVt$aǃu.ֳ8ujD~;$} VPaǍD$9tLVaA$jD$PZt&UPt$hWJ{D$$oH^_[]Éƍ.O"ONPQj>RafffUSWV4[D$\l$HSt$XoL$`upt(uRu6t덻DtǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ tphL$ Vb 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$ɟŃ|$jt$ RU謟|$tUjt$ RP蕟|$t>jt$ RP~l$t%jt$ RPetjt$ RPPT$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQ臞щ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP1Ɖр|$ul$эO4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0Xo0ŞL$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$nL$,T$$ QO4$Qt$(V0WRUt$hm$[4$|$2jjdQUыT$,t$$rO4$Rt$(QPVt$dVt$d 9wijt$ QR脜щ9|$}T$ 4$T$\jt$ QROщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\ijt$ QR輛D$ ы4$T$\B:.USWV։[$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ| D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÍePOOPQhR謡[OOOPQhR股4OOOPQhR[USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRV@uD$t @ t$?D$ h |$t$($iPXt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVP@)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPMt$FPMF^_[]ÍOOOPQhR襙USWVYT$tht$1BtBظkw+`tրztЃːt *u1^_[]ÐUSWV։[Ä]F,F tv蚞FUPGl$~D$uNtQjP葚D$ L$$t$ F1퐐fPOPQhRuOPOPQhRKZ݉MP$ORQhpP!D$SWV[||$t$tt676^_[Í)OPQhDR貖uʍPOPQhER茖릐USWV[D$$ $ $#$;df1fMHftf/t;$sXfyٺҐ$f/u*;$s!fE/Hf/tfu /fE<$91 GtALGt1LGt!LGt=u1B @uD$$PQXD$$PQR$1z$B t;$NQV$rrE/.f}/D$%=@=K1 GtfLGtVLGtFLGt6=u $$$VPV$+yB @uD$$PQD$$PQR($u,#D$=@u;$s#E/$B$PL$ ;$Ĉ^_[]ÍPPOPQhlR *PPOPQhmRePPOPQhnRҒ$OPOPQhoR衒$nBP:POPQhCRs$O:POPQhERB$݉MPOPQhpR$BPTPOPQhSV݉MPPQhpVǑ$kc9USWV׉ $[ $;]$$o|$$$D$f$9 $9=*uG=*uG=*D$GD$ 9$6D$$)9$f:6B1D$D$ D$ $f9u'KD$D$ D$f9)1AtATAt1TAt!TAt=u1{E @uD$$$PQ(D$$$PQU$1ɋ $?#T$,@ts)ЋT$$Ut$P$$BT$$UP$ $D$fD$f9ft>$t=tsAuE @u1$P4-$hPQ> E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YO:POPQhERM lt$10蔐D$/ Njt$$E @D$uPPUu G8t E u;$6Ĥ^_[]ÉNjt$몍P[POPQhR$*P[POPQhR|eP[POPQhRӉ$caP[POPQhR襉OO[POPQhR~7O:POPQhERWL$ OuPOPQh/R,L$0USWV[ÆT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍on΍OPQhRІP΍OPQhR襆T$8P΍OPQhRsT$8ffUSWV[վ$$c$$tu1D$$tŋD$3l$ vh@PD$(D$$D$ iL$L$\QPgtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPzPWuk uh(D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$PjPv u|$1D$Wt$/Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$QjPD$p =jPD$p D$ |$t$ztG$`L$tZPjPq@jPD$p /1ҋ$tQjPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8݄< „Y1D$ D$l$t)蠄D$D$\PjuU |$~8|$ $%|$tHQjPu> |$t&?D$u|$"8|$ $tt$Dtu V\t$jl$ U 1$u U2;$uEČ^_[]Ë|$|$[|PPPPQj_R}yQ%S[jhjt$t$t$[ÐSWV[J"t-J"jhjVPt$$t8|J"0jF3J"|J"tP J"u^_[ffUSWV[k|$J"jjj J"l$J"tUQJ"ӟ J"t]1i J"9J"wHt Qk0 J"WJ"t$UWPx J"u 1T$ Ɖ^_[]ÍHQJ" ^_[]ffSV[ÍJ"u*ǃJ"PvPV|J"ttJ"VP1^[ÐSV[ǃJ"J"tP9PvPVJ"uVP 1^[ÐUSWV [å$ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"J"J"hhUD$ 1Ʌ$t$q N"PPQt$$q L$ jQPt$ q xNt$ PV$Vt"SPVVu 1  8O"VCj:Pt$E^ t8O"l$0UPt$v tL$O"͆UPt$v t D$O"UPt$gv t D$ O" UPt$Dv t D$O"D$ PVt$o dt$ 8mPVirh{PVGrFPV/r9PVr,{PVqPVq PVqPVqPVqPVq$PVoq*PVWq+PV?q/PV'qjPVqPVp.PVpHPVpcPVp5PVp cPVp;PVgpu qPVOpeX1DQXVVJUVt$s tD$1fN"5lptx|onSRPQjhR6ZmeP/SRPQhRY6.&)fN"t$ UPt$@r tD$ O" O"O" UPt$r tD$ O"O"O"UPt$q ftL$f(O"FUPt$q ftL$f*O"ӿUPt$q 1tL$f,O"UPt$^q tL$f.O"qUPt$4q tL$0O" UPt$ q tt$4O"UPt$p tL$lO"UPt$p tt$pO"fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&tO"aD$ `|$4$L$ qL$%L$)L$-L$1L$ L$5D$ PWt$p tD$ UD$,Pt$o tD$FUD$0Pt$o 1ɃtL$Nt+D$PD$4Pt$o t D$1vF UD$(Pt$o tD$ 1L$ F L$ D$ PD$(Pt$iL$ L$ t$L$ R1PQwkt0EuዃX 1DJtVut$F t$  L$ L$ l$|$4]P΍/SRPQhRUSD$ fjO"fD$4dxD$6D$50UWt$Mn 1tL$pS7SPQj1RO̐T$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[t[Ḯ̀rS[t[ḭ̀rS[Ćt[̀ffff̀ffff/̀ffff^̀rS[tt[̀rS[Tt[Ḥ̀rS[4t[<̀rS[t[̀rS[t[ḇ̀rS[ԅt[̀rS[ôt[ḓ̀rS[Ôt[̀rS[tt[`̀rS[Tt[R̀rS[4t[2̀rS[t[ḩ̀rS[t[P̀rS[Ԅt[ḷ̀rS[ôt[Ḷ̀rS[Ôt[ḉ̀rS[tt[̀rS[Tt[Ḛ̀rS[4t[̀rS[t[Ḩ̀rS[t[1̀rS[ԃt[Ḍ̀rS[ôt[òrS[Ôt[ìrS[tt[l̀rS[Tt[t̀rS[4t[s̀rS[t[r̀rS[t[p̀rS[Ԃt[j̀rS[ôt[m̀rS[Ôt[̀rS[tt[Z̀rS[Tt[ ̀rS[4t[!̀rS[t[S[t[ᐐ*̀r׋L$Q1fffffỲrJ!QS[ît[fffffS[Î^KSV[mtX"tF|X" Pj ts|X"4+xX"4X"X"R! ^[ËxX"H|X" jjjhjPj1tȉtX"uj$Pj jLS[îD$|X");tX"t P[à QP[ÐS[njPNX"uPj[ffffS[.hPt$t$t$ [ÐUSWV@[uD$4$8M D$(D$0D$D$,\$<1UB|$D$D$ ^D$L$$RAt$yXDP@t$T$%7D$D$ OL$ۀU|$$ɋuL$ |$$1룐|$$|$ODH@uT$ EHhL$8D$D$8W;Pt$W ]D$xW;Pt$W^ FD$xW;Pt$W6 [D$x W^;Pt$W GD$xW6;Pt$W D$xW;Pt$W rD$xW:Pt$W bD$xW:Pt$Wn AD$x W:Pt$WF  D$x$Wn:Pt$W D$x(WF:Pt$W D$x,W:Pt$W 1D$D$\$T$ EHL$D$D$8W9Pt$Wo D$xW9Pt$WG %D$xWo9Pt$W :D$x WG9Pt$W &D$xW9Pt$W hD$xW8Pt$W QD$xW8Pt$W :1D$D$\$D$рD$ G H:D$/D$(҃ 46"T$(T$ Ѓ 9|$z D$|$GDA@ut$D$  N:D$/D$ 4 "T$T$ Ѓ |$ODH@u|$$t$ |$$D$D$L$:|$P|$Ѐ 7 O:D$/D$ 4d"T$T$ Ѓ dL$ vSKL$ S|$ODHut$D$  N:D$/D$ 4<"T$T$ Ѓ +ot$D$  N:D$/D$ 4>"T$T$W ЃU >S|$D$ O:D$/D$  46"T$ T$ЃEt$ʀD$l AЍ~Ƀ 'w~N0rv:sqɍAAЍ~  'wNN0rF9wAɍAAЍ~  'wN0r9wɍAЃ='v1lMAD$ L$oEL$|$D$ O:D$/D$  4d"T$ T$Ѓt$T$ ʀD$ T$ w~AЍ~Ƀ nwVN0rN:sIɍAAЍ~  n0 N0T$ r9wɍAЃHmv1MAL$8t$D$ ;N:D$/D$ 4"T$T$Ѓ4|$Ѐ O:D$/D$ 4 "T$T$Ѓt$ʀD$ F:D$/D$  4 "T$T$ЃT$ ED$V1Pt$V D$V1D$Pt$VT 1ɿT$ ]D$IEt$1 \ЉD$8D$<Nt$ʀЀ ws119º !ɺ D$T$ы\$;L$ |FD$8t$ j\$SjWP S\$SjWP <\$D$ 0V!'D$PWV AD$ p\$V&D$PWV \$L$8|$D$L$8DHtXD$8\$P\$t?uF \$jPF$F(\$W\$|$y|$zn1 \$TiUB$J(-1 UB )iJ$\$hB(1UB \$1+1|$r$L$ B(D$t$D$L$ȃШ UJQi)1uB,i)\fиwi)\f1uN Vk4ȃ UD$(D$(uBL$D$JL$Bk<kQ)D$$kd)|$$< i)ƍv4A A$I2Ѝ4))΋|$(7$I7u э)ȃT$0 ))L$ȃFL$Ш<L$JQiҐL$)1uB,i)\fwi)\f1=‹E@k4<3ʃ;D} Ur+30BD$BJL$tRu΋JQi)1uB,i)\fиwi)\f1UJk4JȃB Jkʁkʁk4QkdkiҐсk I4HH$I2ȍ )ȍ 0uNʉ)ʉVD$4;$8uD$e^_[]Ë\$ ffffffUSWV[ct$,D$(X"H9ttkHw l|$T$ H w ,ň,$HP x(@D$US =*SfF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эTQPUt$Wt$$t$t$(R|$,WVfG,9s1=SlQUt$ WRt$t$$P|$(WV5G(9r1T/8^_[]ÐS[^bX"Pt$ s[ÐS,[+bPt$UTTPQjIRH&USWV[û^l$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[8^t$$|$(9jVPƿgLjVt$,# t$(<D$l$,L$ t-|$,RUT$rT$t .l$(RRl$(T$tX$|$  tQpT$ <$Zht$t$Pt$[fffSP[ ZD$ L$T$$RQP[J[ÐSVP[YD$L$T$t$4$VRQPeH^[fffffffUSWV[ØYD$,|$$l$0trjjWWMG0tW@9t QG0ǀǀ GGG yw}%\1|$,u"fG GGCGGƍD$ L$PQW  T$T$tD$(Չ 1tL;l$t1Ƀ|$, fO Gou GAu0o/$U9tB1$ʀ;l$uG݉ojW^_[]þD$9tPu$UUPQj?R%D$<UL$U$UPQhRL$T$UUUPQhRffffffUSWV[+Wl$jU}(t4UE u8jjjuU(!ЃtsE jU$^uP}Tut5Et.+E EM0)׃9t E<)jUAjU4^_[]fffffffUSWV[;Vl$jU}(t8UE uEFt P!F tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]Í@?VVPQjKR[?eHV?VVPQjMR0?efffffffSWV[ÌSt$W葏X"PVpWx^_[ÐSV[MSVVX"PpV>^[ÐSWV[ SWX"X"PQpW^_[fffffUSWV[ûRt$l$Vv]Vt$Z^1u<$Vt$2^DžtpU7t]wtуUPYt u막t$~utQ^_[]É1ԍonVaVPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsV8WWPQhR>W8W֍WPQhRUSWV [HL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$uc:t)2MWWPQhR_' ^_[]Ël$ u렍΍MWWPQhR΍MWWPQhR S[NFt$t$jt$ [ÐS[Fjt$jt$[ÐS[Ejt$t$t$[fffffUSWV[ûE0Y"|$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉ4Y"uj(EƉDl$Uܠtwn$Nj 0Q輼 1HY"utjh=訹ʼn0Y"0ƃHY"LؠtMjу4Y"@1t*n$FUQj PA)|$z^_[]Ë4Y")USWV[KD8Y"|$i)Njtt+~%L$9N$ut1Ƀ|$tΉ3i=)Nj$,tu~EPt$t04Y"tuR:ؠt!jу4Y"tiE$S4Y"uj(fŋ$,tIEj |$WP WtE@E$L$1E^_[]t$t@ϐUSWVP[@l$U8NjDY"$tOs;1҉vTY"ljhEDY"$uƃTY"D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0t$|$ tЋ0Y"t61=tDtP ǃ0Y"D$L$ƃHY"@Y"t?1=tDtPйǃ@Y"D$L$ƃLY"ǃ4Y"ؠD$ ܠ1^_[]ÐUSWV[=t$|$ tЋ8Y"t61tDtPǃ8Y"D$L$ƃPY"DY"t?1tDtPǃDY"D$L$ƃTY"ǃ/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[:t$tD$tdPV$xaa1ɐ΍,?UQƯt&UP$y.w8"tV* 1^_[]ffffUSWV[{9t$V\Y"PRXY"ƃ`Y"X tj~V:u^tVtDi@u\uRDQ@u말:u~u'XY"t PǃXY"ǃ\Y"1 ^_[]ÐUSWV[[8|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í:\\PQhR ]\\\PQhR6USWVP[Z7|$t$t#l$ t?tajUjW^_[]Í:\\PQhR빍]\\PQhR]uon\\PQhR7xUSWVP[Õ6$L$d$p$l 2L$|$$h\$T$8u{XY"tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh蟠$p $L$1xjjjU |$ `~]PQhl$XUjjjh@Ujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$on]\PQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPT$ )ʼnl$‰$L$\$(l$$|$ t t$it$,D$l$ tEF4$ hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$q؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU衦5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP辠 Wt$DU谠 t$$t$ t$0ի/L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PUܥ|$u(Ub!|$ |$L$1|$04$0r\Y"PwKXY"P"\Y" L$ <$14$豪$lyD$0P||$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW莙t_WVPǞ UUx~1L$ ȉŋD$8L$D$8B\$W̩ |$ t$dUUf |$;$LP^_[]60WH\L$\Ս\PQhR9L$,8r]L$\Ս\PQhRꋴ$tL$,]L$|$\Ս\PQh R|$L$,onL$|$\Ս\PQh R$|$L$,Ń|$ \$t t$c4$Yon]\PQhR,$|on]\PQhR$|Y\$U|$ t\$t$c\$t$0ǧdX/,L$ÐSWV[ ,t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í:]\PQhR}on]\PQhRVSWV[<+|$t$tGtidY"tP1ǃdY"ǃhY"ƃ`Y"ƃlY"WV^_[Í: ]\PQhR?u] ]\PQhRpS[Î*dY"tPǃdY"ǃhY"ƃ`Y"ƃlY"1[ÐUSWV[5*$,E$$$(hY"uhY"ȋdY"u!PvQ0dY"XY"t%1`Y"dY"PQA4t $D$uz1dY"VgMVVǃdY"hY"HhY"@MPvQP"dY"u<X1DN@u:t#t lY"<|\lY"XY"`Y"$ƃ`Y"l$L$L$ $Dt\uUdY"3uًdY"t:tuT$ T$V@tfV3ǃdY"ǃhY"ƃ`Y"ƃlY"l$=ǃhY"ƃ`Y"ƃlY"D$:l$VǃdY"l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5dY"tP9ǃdY"ǃhY"ƃ`Y"ƃlY"GV ǃdY"ǃhY"ƃ`Y"ƃlY"ǃhY"ƃ`Y"ƃlY"1E;$^_[]À|\u ƃlY"ƃlY"C+]\PQhR$<E]+]\PQhR$<8USWV _%T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd4XƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW.ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU覙tL$(U$W" ^_[]Í:5]֍\$PQhR|$\5]֍\$PQhR|$|$(S݉5]֍\$PQhRv|$&:\֍\$PQhRA$\\֍\PQhRUSWVYx"T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd贌t]ƃdNJD$$ƹdEt#<:tu)FdPWVu`)nu N$UW%t1L$$8$>]S]\PQh`R$W{^_[]Í:S]֋$\$PQh"R9L$V\S]֋$\$PQh#RL$|$$&݉S]֋$\$PQh$RL$:\֋$\$PQhR$\\֍\PQhR]USWV[l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPڼ F(N8D} '~wF^ FPE^ uWv$aR )tƒN ~?:V|@uH)ƒVԋ^ ;FF$BBQWP uvvQ K~?:uFV;~t^ a ^ Q8u^ DF,;8u e^_[]Ë^ S[þ0t$t$ [ffUSWV [Á} F FEFUVzRu)ʃԉF:FJFx9u0Ru}P N ;Nue^_[]fUSWV0[D$(}PQXpY"t$M L$ML$f|$ L$T$|$QRj WPDuOt$ rF|$j WPxb u0O L$FD$D$ PjL$Q 79_t$} urt]"tgM9uWM % ][QPR}Wuj19r"y";L$(pY"|jjPC PMD$t$L$ WLt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\ uEPVu腏 ;EsD$t$W;KL$%D$"T$ ;UwRPuF 1ɋt$;D$(u ȍe^_[]覆S[n]jPE>pY"ih PKAt]"[SV[-tY"hVt$t$t$%t1^[fffSV0[t$DD$@t2D$D$ D$HL$ $@D$1L$]^[^PQjNR00~1ÐS[Îht$t$Pt$[fffUSWV[[t$|$l$jUhWVPUjjU^_[]ÐUSWV[ t$l$ |$jW謵UVt$ WjW蠷^_[]ÐUSWV[õ$$D$D$F0u ǀ$D$D$,D$8D$ D$(C|$ 'OL$ $PytRF$&D$ FF VuWP2u뉐%$1틼$% $Bzh  ,HЃԃ $˃ $‹$tU% @뛁 $룋$z| $넁 $u $ fJT$ F%D$ FF VuWPu˺%~VXc9cFD$ T$ D$~;%T$ $T$ $7T$ $'D$0<^ZBD$0T$ NT$ $ $D$~T$ T$ D$D$(~D$8 $0@lD$T$ T$ $D$D$(~T$ $D$D$(~T$ D$~T$ $D$D$( ~T$ 1ɉl$ύ$hPQ D$004D$T$0‹L$L$ T$"L$$D$D$$A-D$ D$0-<]tL$$D$|]"|]"D$~]"~]"$WUP h1qD$|]"~]"$WUP yLj|]"D$~]"$WUhP D$ 뒄tT$0]tD$ L$ $ D$l$~ V$ ui$WPFWP/D$ t:FHN}V$$D$T$  t $ȃVRjD$0L$D$ b1 D$ $D$b8|$teFAOL$D$tF~V t L$FPQT$D$uD$)gϋL$ȃD$,2 1 ŋ $D$c8|$Q $Ptu3FHL$QT$t~VtL$D$ȋL$ )L$L$ D$, E$L$=r $] ՀMJ ɋ|$( 1 $$? L$(KL$($$? $@  $T$(S $$?L$(l$,$ $9L$ ,$D$(l$W$с|$(tѺuu?tT$(t? $T$(L$QT$FHNV E=r$D$ ,L$ ^_[]fSWV[<t$|$jWj VW( jW؝^_[fffffffSWV[t$|$t PPv\_PQ ~^_[ÐSV[Ýt$ tP袱FtPoFFFtPoFF^[ÐUSWV[(|$(?u Pv\_PQ!t$$o`Սk_PQjyR袶t$0@(QVURwЃt I0$^_[]ÐUSWVP[t$ l$T$h$ t t@(u0S`>`Սk_PQjyRt$0@(QVURwЃt 觻0$^_[]ÐUSWVP[:t$ l$T$D$$$ t t@4u3``Սk_PQhR_t$0@4QVURwЃt 0$^_[]ÐUSWVP[Út$ l$T$h$ t t@4u3``Սk_PQhR轴t$0@4QVURwЃt d0$^_[]ÐUSWV[t$,|$0*T$>t .$ tEt@u%Ea/ak_PQjJRE@NT$RQjjjuЃ>T$u-aa`PQj[R迳T$,$ t|$ tEtHHu0apa׍k_PQhRh|$0EHHPVt$0t$0WRUуt 0$^_[]Í$aa`PQj}RS[~hPt$t$t$t$t$S[ÐUSWVP[:l$t$D$ $ t t@8u'bak_PQhRg@8QUVwЃt 0$^_[]ÐUSWVP[êl$t$h$ t t@8u'bak_PQhRձ@8QUVwЃt 腷0$^_[]ffffUSWV[t$l$PQW t"t$ VW .WjjPtU+PQWZ t$fffffffS[Îjt$t$t$[fffffUSWV[Xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]XUSWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr覵 :T$$EjP\D$tk|$jW\D$,D$ tND$1ɅujW\t3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWOux9!xt19)u|$T$(l$);$Pw|$$XD$0PNƃjP[tQ$1 T$|$$T@uX$L$0PVQWGut5WwD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ Ju‹D$$t $uCr.P|$<1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Vq DžL$~9t/;$WVQƒL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j蝮|$l$t$D$P\t$ \U\V\l$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$6\t$ *\t$\넍bhb7bPQhRAbhb7bPQhR"bhb7bPQhRtbhbՍ7bPQhR蒧`bhbՍ7bPQhRgꋌ$hRbhbՍ7bPQhR52bhb7bPQhR\chb7bPQhR=NUSWV[XD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]NUSWV[l$ |$t$t V*1L$1jUWPV^_[]ÐUSWV[Ël$$|$ t$t Vڛ1L$T$jUWPVp^_[]ÐS[>L$1jt$t$t$t$6[ÐS[L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[ÈL$(T$ 7t$T$L$pD$L$11jUt$,jP`xD$Ƌ;D$u ^_[]LLUSWV[D$(L$,T$$>|$T$L$pl$L$T$ jWPjU1xL$ȋ;L$u^_[]KUSWV[Ë|$t$t Vޙ1pL$1jUWPVp^_[]ÐUSWV[;|$ t$t V莙1pL$T$jUWPV^_[]ÐUSWV[|$t$t W81p1jUt$$PW^_[]ÐS[ÞpL$1jPt$t$t$[ÐS[^pL$T$ jPt$ t$ t$ Q[ÐS[pL$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WjuGكs^_[!t_t$t%<FF ^_[ÐUSWV[[|$ u ^_[]l$ t$Wjt t- t(Wjt,WP5 u뵃!}/=<`F`F ^_[]Ã=t̃~~ŐUSWV[è|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv4<$|$Dփ 6D$4)D$4@u \҉L$x MVeht^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ h$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWgu#XDxuGws>4$$^_[]ËD$4  !rfUS [eE$D$D$D$PQ D$e[]fffffS[t$ t$ [ÐUSWV[$$%= uRl$0[4$@ƅtZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$ QD$112fOH|$4D$,$t$Wl*t$$U5ƋD$H(L$tXP=ǍHTD$t17YGPPUQs w,L$AGG GJG GGGDD$ GoD$PfGt L$y|$1l$9l$^|$4l$trV$$M(tXPl<t<$tM1QE<$twWLut$ LuVLULYHP@T@,MH@ @J@@ @Exf@H u"jh@Pe EuM(L$ uEQL81~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u ёG OJÑD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR8l$ǃt$<)l$ D$8D$D$14$D$Lt$78DžN( u" .uGt<.utʐL$tXw PW.ōG UTD$t1 .YMPNQPT$ Rc u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR~84$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$h1L|ccPQh1RlD$u‹.(1F)EHftf },$FtpP 9u|$t$u N)$xDuW@8/tOF(uIjh@P tFFU<$U<$u~yljF^_[]FUSWV[t$tf8}t v$>V }t!v$v$v$8V 8W:^_[]ÍdccPQjBRփvfffffffS [;hPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[λL$T$ hP[ÐUSWV ׉[ÔT$4$xtb=t= T$4t=uD T$414L$,L$(L$$L$ D$l$ L$RPQUWVC/=uD"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[~L$T$ t$[ffffff̀rS[Dt[̀rS[$t[̀rS[t[ ̀rS[t[SWV[̹|$t$t-9t!t F9u1^_[Í)EddPQj*RfffSWV[\|$t$tt1WVjx^_[ÍTdLdPQjBR藀uύTdLdPQjCRt뮐SWV[ܸ|$t$tt1WVw^_[ÍTdLdPQjBRuύTdLdPQjCRfffffffS[^L$T$ hPt$ [ÐUSWV(T$ ["L$<\$%t$@|$t;D$<|$"v+61t$ \$VP-q\$u<+t<-t D$1 1ҊD$L$] edPQhR}v말SWV[t$v ^*Ft8PA*uF^_[ffSWV[Üt$|$tt;  QPm^_[ÍVeKeePQj:RuuōaeKeePQj;RuffUSWV [l$@|$8T$4Txth=t= t=|$8uF1|$8dL$\L$XL$TL$ D$t$ D$UPQVWR!=tot$<ȃwX18fFFu:<>@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[Ĭt[USWVTXD$|$tt$ht&L$ptCwm\$y\$чelePQjxRs뵋\$elePQjyRs$vl$l1 D$͉L$4A\$PgD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$HlePQh&RqV\$eHlePQh'VqqePQhrVt$xbq$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP  \$R1T^_[]Ë\$elePQhsRd$\$elePQhsRd$LUSWVTXD$ L$pT$htwL\$ j ֋\$ чelePQjxRd$vl$l1 ШD$ʼnD$4֋\$ P_:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ eHlePQh'VObqePQhrVt$x/b$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Qm 1T^_[]fffUSWVP[ʎ|$88tqw$G$t,GO4$6tV1‹n1 uV ;WujnƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUjƅtF PVWo+ u$*jU7t@ PVW<+ 1D$t01^_[]f̀rS[dt[ḃ̀rS[Dt[SWV [)t$ |$t[D$D$4$JW0L$jjPWjQ1u#W9 u W01 ^_[ÍonMffPQj񐐐9t uD$))t8t)Pt u+D$ PeD^_[]ÍgfPQj@ROND$(SgfPQjAR'ND$(7fffffSV[ÍL$D$T$ y9 gRVQPR6Q4P 1^[ÐS[.D$y%9 g]"PQj@R{R ]"j@4R ]"[fUSWV[˅t$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JTmggPQj?RL눍TmggPQj@RLq1^_[]fffffffK̀rS[t[USWV [؄t$ $D$PD@7$L|S_ NL$ 9t6ʉi)iAi ˍ $PXH4L$TT$ o9s9s}$?9r|t$^uA$t209r9r։XHt$豿^_[]É݃t209r9r֋9s9r9r봐USWV](@|$0||$4$D$PDtH@)1ҋ@P1T$,ރ s;DžDDžLDžPL$0A@TQ1@t$ sAs(1ہ1)L$DL$PD$0Hމˉ@|l$TPt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉XH)D$L$0t$轼^_[]ÍggzgPQhXRG[USWV[Xt$@D$.̉)ō$$P3DtH@)1ҋ@PDhL|P@tH1XT4$譻D$^_[]ÍggzgPQhRFUSWVP[J$WSDtIXH010T@$9r$9r$XH@i0mNA900W޺^_[]ÐS[î~t$t$t$b [ÐS[~~t$[ffSWV[\~|$t5jWt ctVW(1^_[Íon%hgPQjARxE몐USWV[}l$t{jUt=ǾtUWUt1l$UPt$ L "19s#JJ8^_[]Íon,hgPQjVRDaffffSWV[,}|$1t,zPWzt |$t=t=tƉ^_[ÐSWV[|t$t-ܡVW tPW V,^_[Íxhkh6hPQhRC믐SWV[l||$GPZtƉx @ܡVP1^_[ÐSV[|t$ t%ܡVPMt L$9H 1^[Íxhh6hPQhRFC뷐USWV[ø{D$01t:>t41 |t$t$ t$ W9 uD$ <=u.|$$ ]"9ttD$0]"M9u;]"s|9v9tfPwǃ]"ǃ]"$jWP H0H8uyPD$0t$C )$jWP` G0G8u4)  $PjQC $]"L$]"^_[]ÐUSWV[z]"t]"1t0ܡDtPVt]"Hى|$ܡjjD$P tE t5jVt$ F:]"tVt$VŋD$]"9tPǃ]"ǃ]"]"UjPB ^_[]ÐUSWV[x81tR/tL,t4t$t$U(7 uD$|=uօt D$1^_[]ÐUSWVP[zx|$1|zPWtfƀ<=t^tR)tI1 $ $lt+Vt$Uw6 u|5=uمxD$8.1^_[]ÐSV[wPVƅtD0^[ÐSV[ÍwPƅtD0^[ÐSV[MwPִƅtxD0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[êvD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[HvD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[uD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[HuL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ÈrT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t WV-1 WV轔^_[ÍCiQjiPQhRguejQjiPQhRAhUSWV[ëU|$t$tLtnWV虍t3oUV(t"}uG jQWPV蔘1^_[]ÍCipjiPQhRu~jpjiPQhRkSWV[T|$t$tqGG>t1^_[WV轌tGPVLtۍGPV蛌tʍG PV芌tWVy묍CijiPQhRmDjiPQhRFUSWV[ Tt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    DjiPQh$RnjjiPQh%RDjjiPQh RGFGF^_[]ÍjjiPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[ÔQt[v̀rS[tQt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[P|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1UjjPQj:R] kjjPQj;RqVAUSWV4[O$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF-kl$0PQjUa3U $\9ȋ$QU$`- FfN`QPR$`U$`21Ʌ9$Fx$P$T)kPURQ2*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L`QPR$`$`2l$ 9+ t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$pkPQ|$W$`U0t;$Tg$P$T)D$D .P|$Wt$L$QRb0L$)D$D Pt$t$t$R)0L$)D$D Pt$t$t$R/L$)D$D Pt$t$t$R/L$r)D$hD Pt$t$t$R~/L$9)D$/DPt$t$t$RE/L$)D$DPt$t$t$W/19D$F$PED$1$1pD$ .D$kD$׋D$ tD$ $ 1QPt$t$U.H)D$>Ń19t$un 1f$PL$$T)fv fD$ !kVQURt$.L$ ;$T$ڥT$0L$RQPWt(8W$\9vpD$0Pe;fǍ-k$0PQhW-W:$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aG-kT$ PQhR(= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í&ik0kPQhR QGik0kPQhR $$bFik0kPQhR ;KfffffUSWV[C$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPRMt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP谊 uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tOfffffff̀rS[At[USWVP[@PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pg 8^_[]ffffff̀rS[D@t[SWV[,@|$t.jWG=tjW^_[ÍkkPQj@ROfffffX?L$rÐSWV[Ì?t$u8mlkPQhrRVӺtF~tP躺^_[ÐUSWV[?$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W賸tGotP蚸܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$]oRokPQhfRF HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RXNjD$$fxxt$ T$@>P\fD$>P\fD$>Pt\ f|$fD$f|$"D$<$$!|$hVWt$8R$XgD$D$$fxxVT$@HVNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$dVWP$Pj%^΍Gfwhj$PG DŽ$DŽ$DŽ$DŽ$jND$$%ND$WN|nPt$t$t$DQ$Pj%譠T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWlYfD$FP[YfD$FPJYfD$h$!Pt$ Vt$8W#UfNjD$$fx$!xVUAV=*h(tL$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~Vi<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yH{"T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V;L$tL$8$tYt$`~l$(u2D$4t$%Ut QkvF Ut$`)L$8uBffT01l$(E;$%b%^_[]Q聀TǍ_n΍Un׍kPQhREnn΍Un׍kPQhR$%]m΍Un׍kPQhR.H΍Un׍kPQhR$% mύnkPQhRx$%~݉ύnkPQhRC$%MTrWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jPwŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P" ^_[]ÍmnkPQhR@nnkPQhR|$QGnkPQhRoUSWVT[1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW~ ;D$uY ^_[]ÍLRpoPQhR<LRpoPQhR]ffSP[}Pt$1Ƀ $ȃ[ÐUSWV$YHt$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RGWjPP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W| Pt$l$ U| t l$ /D$D$<F\$hPWf| |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~{T$ \$WjRFT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R{ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$zT$ L$E E$\$l$TUgU/4$UTU$L$$9sD$DQ3U1ɉȃ0^_[]D$D捃 qppPQj]RW\$@SV[]t$ t VT^[ÍqpPQh/R蟠fffffUSWV|[j$1tGljPW节t)l$XD$\|+Wy Wc1|^_[]jjWjjUjcHW8t҃*D$ l$<$D$ƅuUW 뚐USWV [(|$$(rl$ NBCD3EB 3M tI1 ^_[]Ë|$,jF4~F:F:t1F;pS[^t$t$[ÐD$@ ÐSWV[,T$|$9W v#wG,ʃt$<u0 Ћ0<L  )r;GvD$Ot$1^_[ÐUSWV[xt$,~$ED$\$Pv(t$Q 9qud)$?cD$\qD$4$iUw2藈 t$ rL$$D$4o |$D$ l$qqD$$$$`$ttl$$;A&$`t %"l$ q$D$D$ft$H D$0Iut"l$ q$D$D$Sft$H D$0 ut"l$ q$D$D$ft$H D$0tt"l$ q$D$D$et$H D$0tt"l$ q$D$D$et$H D$0Itt"l$ q$D$D$Set$H D$0 tt"l$ q$D$D$et$H D$0st"l$ q$D$D$dt$H D$0st"l$ q$D$D$d$`t|$4tS{xL$DL$ qL$,$D$t41Nt yI u6J rL$$D$ D$ L$@L$ D$q|$,$軲Nt yI u6ڄ rL$$D$ D$s讄 L$ L$8L$ D$|$,$$`t% tl$$ )"l$D$$t$H$l$D$ $vl$D$@$Zl$D$$>|$Du(f|$@u f|$<uf|$8ul$$ !x^_[]ÐSV[Mt$ tLtQ 9qu/w' rVQjP謬 ^[ÐSV[L$t$ t S{u bxtXt4t Q 9qu'i rVQjPL ^[ÐUSWVHT$[A$`$DL$`!ƅteT$|1t3ʼnt$ 4 t$.y6Ty.^y&sy5yCyny^[ÐSV[Mt$ )tYj(PV;t ytY-kVQj(P躝sY^[ÐUSWV4[$D$0D$I<u t$HFL$j.QPjuFyT$PQj.R;$tEL$PQVQ D.0;D$0u 4^_[]'USWV([8t$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXH1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$NzxjPU" 1uRXMDHt?uj PU u8u$8 L$A.&L$0t9^_[]ÐUSWVP[úl$ PU)txF u6|jPU! 1u[XMDHtHtj PU xt8u $8 6D$t8^_[]fffffffSWV[ܦ|$t$jWMGHO~;G~ t H WRIjWLO^_[ÐSWV[lT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[|$(D$$u$PccD$D$D$D$ jWLG0u ǀD$PW.@jWqN^_[ffSWV[Ì_Ht Jt @t A ?t/t5GtPWu0: E49s%}|jQjhRE4M01U0)E41u;D$ / u E P&yPL$Qjd$+Wp~9E4>PWu0X: E49s%}|jQjhRE4M01U0)E41u E PrPt$jd$+W}9E4=PWu09 E49s%}|jQjhRE4M01U0)E41u E |PQjd$+Wi}9E4=PWu0Q9 E49s($}|jQjhRE4M01U0)E41E4u0} MU $PVu,W<CE L$)T$X$h*RQPID$ .}4$V<E0f (E4w($}|jQjhRE4M0QU0E4A${I.}$$u M QU Qqu I4${$QRPVjd$+P|\$9E4;P$ +Pu07 E49s%}|jQjhRE4M01U0)E41E L$)T$Xh*RQPG"}4;ƋE0f (E4w,}|$jQjhR\$E4M0QU0E4A{D$"M }4E0T$WPo<B|jE }4v:E0 E4u($}|jQjhRE4M0QU0E4AM }u ;L$:T$$WE0P;$( E |PL$Qjd$+W%z9E49PWu0 6 E49s%}|jQjhRE4M01U0)E41E HM @Pt$jd$+Wy9E4J9PWu05 E49s%}|jQjhRE4M01U0)E41E E PE Pt$jd$+W%y9E48PWu0 5 E49s($}|jQjhRE4M01U0)E41M AE  L$Z$$`L$ L$}L$|L$)M01U0)E41E E |$$V$Pt$jd$+WDx9E47ƃD$PWu0'4 E49s$jt$jht$(D$$E4tE ;D$7}0 $|T$}T$ |L$ M0QU0E4AE ;D$77T$$E4PW 9 E E ;D$sƃ}4 7E0 E4u$jt$jht$ D$E4t}4u0E WVu,P6r}46E0 E4$u,}|$jQjhR\$E4M0QU0E4AMU WVu,E P},}$u E |PQjd$+Wgv9E46PWu0O2 E49s($}|jQjhRE4M01U0)E41$E HM L$HM pQSE T$(|$$~|VPjd$+Wu9E4?5PWu01 E49s($}|jQjhRE4M01U0)E41|$$^E `L$ L$}L$|L$)M01U0)E41E E D$$$Pt$jd$+Wt\$9E4a4PWu00 E49s$jt$jht$(D$$E4r}$u4u0u jM t$)΍VUUUЃ=7E43}$E {PQjd$+Ws9E43PWu0/ E49s($}|jQjhRE4M01U0)E41E $E  8;L$T$D$dD$`D$\D$X)*Ƌ$P$ +Pu0& E49s($}|jQjhRE4M01U0)E41E4D$E0D$<|$rv)$L$}L$ |$E0 E4ujt$jhVD$E4M0QU0E4A}4s$@RD$|$XWu u$Q>E4u0} PVu,W()E L$)(|$1ҋ$՗L$L$ }L$|L$$+р਀tpRPt$jdVh9E4u(PQu0$ E49s $jt$jht$$D$ E4M01U0)E419T$ (ыE $+$[}$ $u E E $PE  ${|$X$PVQj2W h\$9E4'PWu0# E49s%}|jQjhRE4M01U0)E41M u4}0T$VW)$ E }4$'E0 E4u($}|jQjhRE4M0QU0E4AM T$$VW(s$E }4&E0 E4u($}|jQjhRE4M0QU0E4AM T$$VW&($E }40&E0 E4u($}|jQjhRE4M0QU0E4AE MU $VWu,P2}$E |PL$Qjd$+We9E4%PWu0! E49s%}|jQjhRE4M01U0)E41E HM @Pt$jd$+We9E4 %PWu0i! E49s($}|jQjhRE4M01U0)E41E E ;D$$ $`T$T$ }T$|L$%M01U0)E41E E ;D$X$$Pt$jd$+Wd9E4E$PWu0  E49s$jt$jht$$D$ E4zE4u0} PVu,W $}4#E0 E4$u,}|$jQjhR\$E4M0QU0E4Au _E PB&yPL$ Qjd$+Wc9E4S#PWu0 E49s%}|jQjhRE4M01U0)E41u E PPt$ jd$+W/c9E4"PWu0 E49s%}|jQjhRE4M01U0)E41u >E E P)E E PE {PWVQjd$+Pb:}$u E E PE E PE {T$XPWVQj2Rb9E4!PWu0 E49s%}|jQjhRE4M01U0)E41E4u0} MU |$XhWu < WS:9E42!PWu0{ E49s($}|jQjhRE4M01U0)E41 }$E H }$ T$XPRVQ1-o}4${ ƋE0f (E4w,}|$jQjhR\$E4M0QU0E4A{D$$T$X$PRVQ,D$ T}4$E0f (E4w($}|jQjhRE4M0QU0E4A${E4wt$(M0fA  QU0E4A|$XVWt$,u +9E4$$VWu0o E49s($}|jQjhRE4M01U0)E41L$$M M E4;L$s\}0u $M0fA  QU0E4AMU E4PWu,V&E4L$9M r$[E0f )E4B$}|jQjhR$|D$+E }$t!p|VQPRjd$+P:^c9E4$V$ +Pu0 E49s($}|jQjhRE4M01U0)E41E t$9$Q{L$ )M0\$U0)؉E4} } 9$Ƅ$ +fDŽ$+ )lj|L$|$L$D$Pt$jb$+P*]ƃc9|$tGE 4+d)8$Pt$RQ\}ƃcvn$|$9u4ZV$ +Pu0 E49s($}|jQjhRE4M01)U0E41$0}4E0)E4u,}|$jQjhR\$E4M0QU0E4AM4E0.szD$L$.)E0 E4u,}|$jQjhR\$E4M0QU0E4A~`}4sf E4w,}|$jQjhR\$E4M0QU0E4AƄ$ +fDŽ$+; |$~.L$L$D$U X0}1b\$1< +9t4 :..x DN.ẗ< +L:xDN.t뼍G$D$t)D$:x DF.t.D$+9E4Pƍ$ +Pu0) E4t$9t$|$b$}|jQjhRE45}BD$E4D$E0"T$hL$D$L$}L$|L$D$ ,M01U0)E41L$0ЉȉL$9L$ $t$ 2\$9E4Pt$u0* E49s $jt$jht$$D$$E4M01U0)E410|09u4$D$XVPu0 E494$jt$jht$$D$$E4' hL$D$L$}L$|L$D$ /M01U0)E41L$0ЉȉL$9L$ $i $t$0\$9E4Pt$u0 E49s $jt$jht$$D$$E4M01U0)E410|09u4$MD$XVPu0 E491$jt$jht$$D$$E4 NjE ;D$ HM 3M01U0)E41D$ $+$L$ɃtyL$u2E4׋M0A  QU0E4A D$ {RPjdVV9E4XPQu0 E49Q$}|jQjhRE4$}$ }$|PL$Qjd$+W0V9E4PWu0 E49s%}|jQjhRE4M01U0)E41E HM @Pt$jd$+WU9E4UPWu0 E49s%}|jQjhRE4M01U0)E41E HM @Pt$jd$+WtVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s'D$D$Q@(D$ 9s$}|jQjhR)))x ^_[]1))lj$|||PQhR_!뽐USWV Չ $[YT$8D$4 D$L$D$"u$}|jQjhR|$4QA$93<$779$x|D$D$}D$ |D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$}|jQjhRMQUA+<$- %$D$4L$D$ ^_[]ffffYWT$4D$#ħÐUSWV[KW|$ l$t$~Jt$~2UV1x(ƃ|$tލF9wȉ9v-$(+t$^_[]ÐUSWVP[úV|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }#(^_[]E ffGftC,$RWxǃ9w,$)xD$ hHGftf,$RWšf 8 9Xσ95,$)5|$ oGwtc,$RWS 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [8T|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.  ^_[]Ð~34$U菟x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quu賞]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[èQ|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.a^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu[U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XO\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō}}PQhR[|$ ]}}}PQhR.}}}PQhZRfffffffUSWV[kID$$L$1w|$ u p.0}PUWVt$(t$(QR1 XHL$u@ÐXHL$w1USWVXHD$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$r= ~}PQj>R7;\$0~ ~}PQj?R USWVP[zFt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í0~?~}PQjgR 1fffffXE"ÐS[^E"ht$ P [ffffÐ1ÐXE"ffffffUSWVX[Dl$lD$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: r\MnsL$"jWRPj2Q) 9D$"PD$tPp7D$p$)$iǓ$))ŅtVT$sT$"jDPQj2R()D$"Pt$t$V64$t$ T$T$D$@L$)L$tOt$ s|$"jHQPj2W()D$  W|$W}6D$t$ $D$kTWPڋ$+D$pffffffUSWV[ëAl$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[A$$$hWP! x3l$hU$( xUW<1Ʌ;$u ȁ^_[]襯ffUSWV[k@|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[?|$t$l$tt$$PW%t ^_[]VW t W LJWVUF ͐SWV[l?t$|$jW1Ƀ PVW ^_[ÐUSWV[+?|$tt$O#PW$tG 0l$VW/ t WRLJWVUM ^_[]ÐSWV[ì>t$t5|$r#u#jV#tjV$F1 ^_[S[N>D$tL$ ttu H1[i [ÐSWV[=t$t_|$G?wSp>1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[l=t$tAjVq"t2|$jV"wsf~ 1c ^_[ffS[<L$T$ hP[ÐUSWVT$0L$@[ø<uD$\VD$ Pǃx\$D$t6\=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$|$t$p$l$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5QV t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$Wt$,PVD D$,\$VPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  7 >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$HrM %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[mt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[îD$ L$t9u[Í_PQjpR9S[^D$ #L$t9u[Í_PQjpRD$t&L$tu1u 1tÐS[L$ D$Qss)ǀ[Ãuu ǀ[Í_PQjpR5S[^D$tL$ t 1[[ffUSWV[j 1tQ@@jjPl &(8t(WF(^_[]ÐSWVP[Û|$tcOGQ9u0$jQPHl 08t  G $GT$pw1^_[Í PQjZRySWV[t$tRtC|$t3~t-0X~r4?;~rP,V#^_[ÐUSWVP[Êt$t@F$t*.1tt$Vt 9<$u1^_[]Í PQhR뜐USWVP[ T$J $Ћ*1|t$Wt94$u|$ l$tW1E$F;$} $)Qtu<|uprP $كU|v|"u|"PPt&D$j.PWV!tl$t*$|"D$PL$QRPD$PWUM $t!Qzl$|$TG )|$TWT4$yl$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(c Qt$@Ff$w-j"6D$0$Do5Vd5|nPW|$t$8t$HQj%UT$T$@t$$P6#t t$6Pj%$D$@9F f|$0u D$(8gt$|$u$L0V葮ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP}T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRf l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V =~ $!D$1$D$$1D$\$|$$Rj1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<$=(ƋD$L$,)9Qt$@P7e D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURP踍 4$hl$l$$T$8)ƒ)19s@QZh1$X;$(,^_[]Ë$LnRPU5 1‰(_nUn֍PPQhRֳnnUnT$$PPQhR詳T$4z?|$46[USWVT[$h>Wt1T$ T$G j(V¸hl$D$D$ D$$D$<$1|$ D$ l$Pt$ Vjǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< t2PW5jt1ɀ8 L$L$D$D$L$ t WP賩tT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍPQhRw]PQhRPBMUSWV։[ô_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUEw$T$ E ulD$;tM ǡE=t܉t$L$4QP~t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP}L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tRMD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQMD$e ߋD$)D$Uɐu E;D$UqtjUzİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QLE0EEEe jUz1뙋t$uyb)EۍqPQjGR菘qPQhRhD$D$ D$NƃqPQhR1EtfffUSWV [Øt$@|$4u]>FD$FD$\$jt$8w1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$rPQhdR^uK>rPQheR8aUSWVP[ê|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍCiWrPQhR螌uuWrPQhRxaUSWVP[|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍCidrPQhRދusdrPQhR踋aUSWVP[*t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]ÍCirPQhR{VrPQhRTCi͍rPQhR辊4USWVP[*t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]ÍCirPQhR{VrPQhRTCḯ͍rPQhR辉4USWVP[*|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]ÍCirPQhR{CrPQhRTUSWVP[J|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍCirPQhRAuQrPQh RdUSWV[Ë|$T$tL$t )ŋt1tXuQBWQRP t?t=G"UQWP%BWQRP ttG`UQWP 1^_[]ÍCi֍rPQh*R@FVՍrPQh0RL$(,USWV [xt$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u.u^[ÐS[t$t$t$t$t$[ÐSV[ݳt$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[þt$ t$ [ÐS[ÞD$t$ P[ÐS[nt$[ÐS[Nt$Z[ffY/ ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$8t$4D$0<D$|$щ9t9}E.L$ D$D$$<@t<S3A6D$!t  9$<@A)ߋD$t‰T$$PWL$Q|$9L$ 9T$t$|$D$)$8RWQPݒ|$L$Y9OErt$\$t$X( ;!ЋT$ )$PWRQH݋\$ƀހ:w6$du9E\EQ~߃^r}};|$tE\<< $:PukdT$Ɖ*t$i $:P|$ui (Ћ4$PUh|$9EQ\$( ;!ȋL$ )$8PWQRL$9D$\$t$;)$VRQPӐL$xW9sQxMl$ŋ|$݋\$\$ҋt$4L$8T$9u ~n.9s E)$ y(^_[]Ë$xᐐS[Îjt$t$t$[ÐUSWV([X|$@t$jt$t$t$t$t$[ÐUSWV[D$0L$(99;D$,/l$4p6|$8|$)lj|$D$,)ȉD$ D$$;$$WQP(E րt9@A1!tfY;L$,sf?1 ֋|$ 9}PT$yL$ʋL$(,$9}4,$T$Ήe,8;l$s 49;t$,$p(^_[]D$D$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ Rn0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ΙL$T$ hPt$ [ÐUSWVT$[Òɉ$t$4|$ |$0t=D$0|$ "v-f1T$VPR\$u+t-t$0u#D$ D$t$0t@D$u20u- iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF#:-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F#:-00u҉u#11Ɂ<$)ȉ#^_[]USWVP[èfD$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[|d88tWƅ~102jj!jPu W蹡^_[ÐSWV[ d88tW芡ƅ~,102jj|!jPfu WI^_[ÐSWV[ÜchRƅt(T$jtV081^_[SWV[Lct$08Vx08^_[ÐS[ct$jt$t$[ÐUSWV8[bM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3#11uPz,R4h#H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF#JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[_8}tl\<PQ諞#$l#ul#;Dž<$}t+P ƅ,$~,01K#,$|$1jPUjW /DžuP誜^_[]hmPl#ZQWRFUSWV[û^88t P9ƅ~+01Rl$|$#u1jP UjW [DžuP֛^_[]ÐSWV[^t$|$\PQ#1WP(t 4h#H(^_[ÐSV[ý]t$L$#t$P'tt4h#H(^[ÐUSWV[k]t$8#8t8\<PQ8l#ul#ћDžtA,\PQ#1UP't 4h#H(^_[]htPl#8tW4듐USWV[Û\t$|$l$\PQq#UP&tt4h#H(^_[]ÐUSWV[+\t$l$8#8t<\<PQl#ul#荚ŅtQXl$\PQ踚#WP%tt4h#H(^_[]htPl#tU냐USWV[K[88t(Pɘƅ~k(0z|$1jP t j&\PQƙ#D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[V|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ \PQ踔#O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[T88t+Pxƅ~"0#u1jPI4$t$|$ t6BR lP~;yQi|1)΃<$uPّ^_[]ÐUSWVXTL$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[(S88tV蜐Džt> 8#ujj}l$(D$$$ t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$V腏$^_[]ÐUSWV[QE$$fBt π?:t c?:uʀ/\$ uucPW%jPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ WuD$HhPW荅 ,D$(W跆$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xW%~t$D$(0W~DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[qCtK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9u@<;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$ip/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףiQl$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$iQ9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[ç; +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍ1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $X5D$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[Þ.l#PQPll#[ÐSV[m.#j}tPj^[ÐUSWVT$4X.D$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[ë!l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]ÍPQjFRqPQjGRj|$$b;PQjHR@>ffffUSWV[ë l$t$|$tU6^_[]Í^QPQhRʐUSWVP$[E t$l#UB\t,jtPx $Hp l#l#17"l# xuxt)txu8u밾U[^_[]Ã듍jPQhRKUSWV[hl#D$ Pm[l#l#l#$l#L$n#L$ǐ|$$tD$$9G t GtOl# tGwЃ GЋl#9tl#DžuZl#u';|$r$;|$s<$$<$C<$1l#t$ ^Zl#u#t7W衙u^_[]ÐSWV[t$l#WY"l# xuxt&t xu8uj蜈u $p@@ l#l#1W~Y^_[ÍjPQhRIfffffffUSWV[$$$$$tD$$DŽ$DŽ$ $$jPX$@jP5YDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^ӉƉPQjPRhO^ƉPQjQRAT $ ;$u ^_[]踊S[~ht$t$Pt$t$7[ÐSWVP[KD$L$T$t$ 4$hVRWQP^_[ÐSWVP[ D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[LL$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[D$ L$ $XQPRv[ÐSVP[üD$L$T$$XRQPV`D^[fffffUSWV[xT$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQKP֍PQj=R:P׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]ÍPPQhRL$8AffffffSP[MD$ L$T$$RQP[ÐSVP[D$L$T$t$4$VRQPA^[fffffffUSWVP[t$|$PV13ht$t$ GL x=|P3MfF FfFfn vF$F,F(F $tjjjV|^_[]Íys>PQj>Rq)ffffSWV[|$t%jW聼w jW}^_[ÍPQj;RfSV[}D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[;t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍÊPQjL$aD$t?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P]\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $tXD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $dxT$ L$D$n6 D$0 L$ I $dT$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$dD$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q&,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPbƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P|\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$|B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$$PQhRBU|$뉐|$UD$xT$ Ӌ$|Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P4E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PD<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [æD$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$eB$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[ÃEET$@t$DT$$dpU }jjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP0 )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[óm|$hE t$p |$<$ MM$Ujjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػh|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃hL$T$vثhv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU!$t?$L$U9'$1xL$^_[]þTx0ffffSWV[lt$|$ty8L$tu1 1 ^_[Í؋PQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[ÐM1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػhD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃hD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثhv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[üD$1r 1 9vW<t8Ɖ^_[ÐSWV[\D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[͒D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[ΐ%SVH[åD$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQjT&D$$D$ D$D$D$D$D$jPj-\ j[j[S[þIS[ÞfffffffUSWV[{t$|$tK1tƅtUWV/ .^_[]Í݉nPQj?R}VffffUSWV[l$t/UBLƃVDžt VUWc/ ^_[]Í݉PQj:R Vffff̀ffff̀rS[dt[S[Njjt$t$t$t$[ffUS[Mt6C$D$i@B)iD$jP1e[]ffSWV [ù|$ t$t=D$D$ <$L$jjPVjQG 1Ƀىȃ ^_[Íon'PQj;RTffSWV[<t$FN ue9rF;F|@FPh6tHNjFN PQR- V<7GHND^_[1L$AQ u9rÃÐUSWV[kL$t$y9~}V6W5ƅt\ȉ1ɃFщNt2 V9w)yQhP}U >t (h1^_[]ÐUSWV[ð}uu\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ Wt$(PV'T$4D$(VPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[Z |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[Yu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[Xt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXXǀ@o#ǀDo#fǀHo#ǀqo#fǀuo#ǀQo#fǀUo#USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[VD$H~( 1u 9r1$PƉ^[fUSWV[ËVL$8?tP胒 wp#t{p#?u1>P-ƅD$t/Fn?tP#FF ^_[]1?tPp#)ʉʁ oΉoUSWV[ËUt$tbF!r VO8}t3Wm}Fp#p#tWKp#p#^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[xTl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P}T$,Bp# p#ti4$\8}th$Pӎ1}Fp#p#t14$譎$p#T$, p#D$TG^_[]Ëp#p#1␐T$1Ɂsrr@r"y(6s@sރx @tS[Qj,tL$H@[ÐUSWV$[ØQD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU/<8?t:V譈?Ep#Mp#$t#V興D$p#Mp#$^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[KD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [#IE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[EF$t|1q1j4PQjERx P$1D$jjW+| ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[Dt$t$jt$0[fffffSWV[D|$t@jWqGHO~ H0 WjWR^_[Í?rPQj=R 럐SV[MDt$ t%FHN~ H V^[ÍrPQjIRy ffUSWV[Ct$atrt!w 11ҊNtgtGɍyw,@ؐ+u˽뿁뷁 ՋL$) p1^_[]ÍPQj>Rw fffffffSWV[B|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QϽG0踽G0ǀǀjWG GG:5PQj8RW f  ^_[f̀rS[äAt[SV[ÍAt$ t;F0u ǀVNuFH^[ÍpG81t&WhG GGfG u WG t'DV}lPV}GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍxPQjJRSV[Í?t$ tF Ш u Vk1^[ÍxPQj;RSWV[L$AA A AAAÐfffffUSWV[U>$u hj1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVq VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC/p(1Vٴ(1^_[]14dž$j$&tJpH H|H H HHH8 8oUSWVՉ[ä8jqRlj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[)74jQ@# t T81t>0trPtB_t u8~)1 9}8tQ݋t PmVܱt81^_[]ÐSWV[,6|$tOW蒱^_[ÐSV[5D$ p|$s t.jt$ 1dž,dž,^[S[~5L$tAt[[ÐSV[=5D$ p|$todž,1t$t$^[ÐSV[4D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[h4l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNC׍ˎPQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wKQύ֍ˎPQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRԳu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[<1|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[0|$(o(o(OG0!D$;G9} $wD$D$ Pq$L$L$D$QPt$荠 $L$QjP t$襫$D$ Gjw¤ $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[Í/t$ t$t$ #F,;F(~#F0^[ÐSWV[F/4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrkPQjbRrUSWV[D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]ÍkPQjbRPfffffUSWV[|$oEtjPu7 EjWu,EtP E EtPDžDžtPĕDžDžU衕W蘕VP^_[]ÐUSWV[|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[D$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_mD$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[èL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$kPQjbRT$(L$?kPQjbRZT$D$L$ kPQjbR*D$L$_yffUSWV([È D$^'PQj5R虿ffUSWV[$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W, $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j>ՍgPQjXRgꋌ$!1Ƀ8cfffffffSV[íD$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[XD$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]ÍPQh<R0j$jU0 볍P#VUSWV[u$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$RđePQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$@щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$RđePQh|RƐ\$T$\$kPQjbR蕐\$T$\$RđePQhRa\$T$\$RđePQhR-\$|ffffffUSWV[È|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZckPQjbRɍIkPQjbR虍w8kPQjbRn;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuEkt$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tT$ kPQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtP?E EE($}fu E(jQt$xsB tkt$t$jbP臈эkPQjbRdD$T$ kPQjbR8D$T$Ǎ֍kPQjbRUSWV[k|$l$t$FtP;F FF($nf~ F(^_[]USWV[t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7kPQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU ҸˍkPQjbRR!fffffUSWV0[óu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍kPQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$kRQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$D$$kD$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYoD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^xL$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[t$t$t$ [ÐS[ޮt$ t$ F[ÐS[þL$T$ j[ÐSV[Ít$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVX%$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8$D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[t$ tAj@PV{D FPhjPHm F@FDFHFL^[ÐS[Ît$t$t$ [ÐS[^t$ t$ [ÐSWV[<t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[`MD$$&ydḰ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <y#1D$D$ D$D$L$8T$jjPQjR=1tD$8y#D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$FL$-L$EL$]L$hjjjPQRCD$L$8T$jjPQt$R/L$81 ujPy _UiK1D:0D$D$D$ D$L$8T$jjPQjRNQ;WvRP t,NQW QRP FEE1^_[]ÐSWV[iD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [T$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[(L$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[Tt[̀rS[4t[S[t$ t$ jt$$t$$t$$t$$t$$  [fffffS[ޏt[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[($D$D$huET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR.!ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ԬЬج|$ W$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ` $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PWo |$ u9nuqF$hPWN nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0v $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP7 t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWP, t$l$$t$|$t$P@E$$8$j`+t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[tM΋uA~8t:~4~"`N4F8 I9rP#F8^_[ffffffS[~D$L$ AQ jQ0 [ÐSWV[,|$t$t+jP6 tH  W6,^_[ff̀rS[Āt[̀rS[ät[USWV^ƅ$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQwæ1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[ìkt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øZPjj%Q4SWV[jD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[xj|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,蠤L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[mht$ V PtHP tQ P V1^[ÐSWV[ ht$>gthGt tww$Ѓ gpNjPQwU;u<tww$Ѓ 貝4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[üfD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[Hft$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[xe|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍPQjGR(T$4“PQjHR}(T$4USWV[`|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDWP=W1fu- O @1jW^_[]ÐUSWV[_t$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍΓPQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[l^t$8uEN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[ÍC PQjPt$t$t$jt$l [fffS[PL$T$ hPt$ [ÐUSWV,T$ XOD$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E HT$B=sD$ DP[Í=[ÐS[GT$B=sXDP%[ÍG[ÐS[ÞGT$B=sD$ DP%[ÍO.[ÐS[NGT$B=sXDP [ÍY[ÐS[GT$B=sD$ DP [Ía[ÐS[þFT$B=sXDP@[ÍkX[ÐS[~FT$B=sD$ DP@[Ís[ÐS[.FT$B=sXDP%[Í}[ÐS[ET$B=sD$ DP%[Ín[ÐS[ÎET$B=sXDP%[Í&[ÐS[>ET$B=sD$ DP%[Í[ÐS[DT$B=sDP[Í[ÐS[îDT$B=sD$ DP[ÍC[ÐS[^DT$B=sDP[Í[ÐS[DT$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[äBt[D$t8t9@€tuuuuH+D$ÐffSWV[1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[:l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[-:t$t8D$ t|$tT$t121Ҁ9 11^[ÍPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[%9$pЉׅt{ϋ$tJRWPQ$$$4UhVH$yPVjl S[Þ8t$jt$t$PUSWV[u8$$$$pЉՅt{$ tJ$RUPW$,$<QhVt$t;l$VPQhUJPUjk tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃ:P趸҃¿+w狔у̃ǃƒӥS[Þ6t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[6D$ D$D$$jVjj 0z#uƃ0z#tjljj0jVjCj jIjfffffffSV0[z5t$̀rS[3t[S[î3|jPt$t$t$[ffSVP[|3D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[2t[PS[2[fffffffS[î288t3[Ë[ffff̀rS[t2t[S[^2j1[ffSV[=2Lz#u#Dz#V>u1Dz#^[Ðfffffff1ÐÐ1Ð1ÐX1Ð1ÐÐUSWV,[X1l$D|$@8|#|ƃ =sdfD|#Fw%T@|#=uɋH|#뿐<|#QUhWL$L$뀋@|#|$@l$Dt1D|#t& 9s8u+p<|#ƃ8|#D$D$(D$$D$ D$D$D$<|#D$@|#D$ D|#fD$H|#D$D$Uj(P׃8^_[]ÍסPQhR]fffffffUSWVXe/$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$t*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$G8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$GD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$GD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$]G PQhVRT$ $1y1ɃD$D$ s$tl$\$8D$$T$ T$0ՉT$$4$4$4$4U$0R&U׶=r,j$ ?I;$u;^_[]Åt|.u|$`UPQhWf,hffffffUSWVX[$L$p|$lGtG,t$x<t$|H<DPVt$|UQ$$E$ 5BBWXfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$vCxnNj$L$|PQG$L$xPL$QG$ǃ$fB$) $W 9$A A L$|PQ G$L$xPQF$PjF$PQF$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPBƅxՍ7Pj 9F7Pt$&F7Pj5F7PjF$ 1۸$IUSWV[Ël$ |$t$D$@tPN ) l$$FPj)uEF|PQXEfFD$@ u1ftҥP VPEVj EG fffG )^_[]ÐUSWVP[Úl$0t$$T$ |$D$@tPX T$$։)͉ $9L$(B99t$4D$,WPYDGPl$UHDGUVP誔L$4 )΁r&ePQh=RCL$8QPC+l$ ^_[]fffffffS[Îjt$ [ÐUSWV[e$ $D$0$jU!CEt U uEEEj^U U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžha]tkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUAD$ djVUp PQsƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w `1҅tމ8D$ Ϲրwr tt$$D$ PvP tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$P1$<#t<;t΋$doma1$in $sear1$ch #%j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P% $< t< 0$< w A< vhQt$8 ƅ_2Pt$NnD$ kc$< t< H$< w&hA< vhQt$V襇 ƅ_j VtuDU`1aL$ t ut1P&;L$4r$< t< L$;L$ $F< t< t0PVd< D$<@@@@ @@D$@D$8-kj5Pj $PD$PD$;t$ s E$EtJPEDt%uH?PWu퍃@PFPBitcsV[ML$0 ;$u ^_[]VUSWV[Kt$xPdžft91 9s)tQDŽͅtMtt|5X9utfxt PRWbdžtPadžf^_[]ÐUSV[DEuX|#jP<_$D$F$FWfF e^[]ÐUSWVx[EL$ L$puX|#D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]TUSWV[Kt$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[$D$AtRt$0UP EO $L$(T$ L$tL${L$ F< t< tjt$V jPV j PVҡ NjPV踡 &ۦj PV螡 zyj PV脡 ijPVj  jPVP jPV6 j PV hyjPV jPV jPVΠ jPV贠 j PV蚠  jPV} jPVc $`FP5d$/FP|Gt^GddGtAPt$'F P;|GGtPQX7< < {$H׋$ut$0UP $KP뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]|$ t0oE1tVPtEuv|$tT$D$D$L$ 9AD$$A D$(W街)D$ QPt$z |$|$D$ @1tjD$#gRKǃ)|$ KWQl$Ukz L$l$$XD$ @TȃuD$D$+D$L$$L$;ED$ @ ;D$ |$ OP1Ry L$l,G )D$ L$D$D$l$$X|$#44$#F(|#th|#9tF F$FNj(|#|#r|#R|#|#|#|#^_[]19u뫐S[QPR誦 j0SWV[t$8|#t3|#9t^t,|#|#z|#|#t7|# 9u |#~t vq8Vh8^[19uΐS[μt$C8[ÐWVXL$ tsAQQBQQAA,|#tD|#49u4|#4~|#v|#|# |#|#^_19uSWV[ t$trT|#|#t/<t)|#|#z|#L[ffffSV[}t$ tjV"]f jV#_^[ÍܪPQj5R}ffffffUSWV[$t&j$$PY$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjr诌Njh$t!A3APjhjjet{Njh ʁʀ $4$!jjjVd!ƒu.8u$$! Pށ(p$t u|! D$$Pt$^-D$| $WPPt$m @ &l+C8(ɀ GGA)VPP.T$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍."PQhRoL$4T$0^L$IPQjbRyoL$T$0z.L$"PQhRFoL$ffffffUSWV[ët$nEtjPu> EjVtE 1t u1@u)6d1Ƀ Vt^_[]ÐUSWV([t$@l$<}GtjP71> G ujU躌0 81qujWjjjV 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP%` u !1(^_[]fffffUSWV[|$ t$tGw#jPdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUV&u^/|$$KQ;v RP t2MQUQRPD EG/1^_[]ffUSWV[ȣ|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$׍IPQjbRi\$8=$oD$L$,td;l$tX14Eju77 t%MLH4jP7^9 ;l$u*oL$1 Gw)f_ ^_[]ffffffUSWV [è|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$Re $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍϫūPQhRgT$믐USWVhXHD$|$|G =tŋ\$jj$W_{$jj$W;\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$o ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ# DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$W臅O t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhTRQbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$ޫPQhRa끐USWV[D$lAB9w}) >P2Q7 D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj &`1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V/1Ʌt‰ D$0L$ЃVhP|[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08 1\$$PQhRX\$T$ D$4@USWV[T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJPQhWRdQffUSWV([؉D$Ht$Dl$@UL$NL$ɉ$L$p|BL$D$t$l$9wƉD$|B)*t$VL$QPT${T$ Hf,Jf6ŃflBf|Bfrt$t$@ŋD$)D$tt$$L$ 9TyҋD$Ht$$t 9wu;pu faDy)ЉD$$t$$Rt$VPT$,D$0L$ \$ މt$t$)ދT$fyfDy9f)\y$fyUM|BL$s4L$.MPQjyRWOT$.Mt$֍$PQhR O\$L$$t$|B,1o9wl$t$uL$H;qu LJ)L$*Vt$PT$iT$ t$|$)Hf,Jf6ŃsxflBL$fLB|$t(fr$t$t$@ŋP frl$M|Bt$sFD$D$$g$.MPQhRMT$W$.M֍PQhRMt$닸1(^_[]ÍZM׍$PQjbRTM\$D$XNL$uM֍$PQjeRM\$D$Hp.Mt$֍$PQjkRL\$L$$t$.Mt$֍$PQhRL\$t$USWV[t$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UlƋD$cPULT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σsZʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]Í.PQhRJ$E vUSWV[8|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ uhDnjt$Pt$0VjtRV tm9u.NWRV_ t ^_[]ÐSWV[t$|$LQjPQW!jt2HfyuftfDHjWPVfi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P] L$,1TEMGDHjWPV.h t&dž(@f8u$dž  ^_[]ÐUSWV[ÆzA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVf t׋@f8u$dž wSWV[ ~|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[ö}T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQLetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[h|t$0l$$D$jPj |$"uOƃ\>"Įt%9HuHP X>"@[fffffffffffUSWVY tT$r 1t\z:_X"_X"_o ݃xX" 9stǃuƁX"^_[]ÐSV[ÊsVjV輯l#VPL^[fffSP[Msn#u;$ n#jjPQjRft<$ t ǃn# [ffffU&ձܱnnnnnnnnnnnnnnnninnnnnnnnnnnnnnnnps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleanersegment %d: bad seguse count %d%s: inval seg %d%s: rewriteseg returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALLusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ... bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: failed to read cleaner infoRead cleanerinfo: %d clean %d dirty %ld bfree %ld avail flags 0x%x%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: must clean%s: enough clean%s: dire straits%s: busy clean%s: failed to stat ifile%s: idle clean with fs idle %d%s: failed to get load avg%s: idle clean with load %f%s: default no clean%s: fcntl returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segments%s: fcntl returned %d (errno %d, %m)%s: errno %d, returning%s: reclaim failed with errno=%d%s: wrote %d direct and %d total frags to clean %d segs (%d%% recovery)%s: cleaner not making forward progressSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such error%s: coalesce: LFCNFILESTATS: %mcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodes%s: coalesce: LFCNREWRITEFILE: %mbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpwritepseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lld/home/builds/ab/HEAD-llvm/i386/20260702043748Z-dest/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystemillegal inode block size: %d cannot specify inode block size when version == 1 %d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblockidx < lfs_fi_getnblocks(fs, fip)%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedexamine files in%s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260702043748Z SMALL REJECT_NULSLINENO#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures test containing automatic test programs manhtml containing man pages in html format Some architectures offer different CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.6xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %spkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-30s %40s%-50s %-10s%-30s %-10s%H/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist