08P!!> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4P%4 (JJp"p"PP}$22#TTT,,}$22PtdP(QtdNetBSDLwGPaXU,SR ffffUSWVP[O.t$DujPjjj܇j0Fɉ$u& Q/tu|$Tu?;(s(U9r\|$u t W.P.;sU9rHP-$06v? P(USWV [hN.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]USWV[ÛL.; s' ~*u.UE9r^_[]aSWV[LL.;s9r^_[f$SWL.5u1ƃ5$tЃ t$k_[SWöK.4uYƃ4$t|$<$kt(?t<$nktЃ_[WVD$0tP>tKj/Vt@Ƹ!q"̍&PVpt&uVhp"hp"hĆ30^_`SWVhp"hp"hĆ30 1۸!q"̍&PPCPrFhĆ3j f=whw%hĆ3_0 uhĆ3j 7=j$D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc53 u$1^_[Vhs"Vhs"9 53hs"jLwVhs"j USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&PtutD$D$$D$% D$t$@N D$l$h3h׬$h%D$ @l$0tD$Ph$C%j Y$D$  |$\$4t$,s$L$)L >QPhu"% D$  L$s()@L$L bQPhu"$L$ D$  s D t 4D&hu"$L$ D dtPh v"$D$(@9XU&\$D$T$T$9tt$N9BD$4D&53h*u"4$ 1h^_[]t$|ht"1%WS$h>u"h[u"jUU蜺53hyu"jjt$|hs"53hnt"3$hu"jhc 530 u153h-v"jSWVPD$Hw#t$>$&Wt ub(&$h"s"WZt N1AQhc53 u 1^_[53hBv"jUSWVP|$t$7Ah>s"WV fu U3u 3)u 3uhAs" Is"t 3hjQr 3u 53hRs"Ih;u3$(ؐ&SUJt uUh{s"jqh[s"j蕣$NPVS& PVĆ3PhVv"Vu$ Vjjhv"cܐ&ؐ&hv"hĆ3@$ uj536rWVοVd&tuVhs"j财h&^_VPΉj PQ\ x $9u^Vht"j{WVοV&&tuVht"jMt&^_USWV\$$1p3 l33 3sV被j=P-x<$h٣jjh,&U 3H F H 3VP3u3t;#=t%{ 3##=uthRw",3tttut!tcu3h 3^_[] 3Vhv"W Whw"4$hv"4$h"w"jŠhlw"hw"D$L$01f1PjPjt$hy$茋p3l3331PjPjt$hw"\,3(3hw"jA1hjPPt$hx"($3 31PjPPt$hx",2tVj3u$1PjPjt$h)x"̊33ËD$3h:x"j觟1hjPPt$hPx"莊33h\x"js3u$1PjPjt$hsx"Tp3l3ËD$x3hx"j/1hjPPt$hx"331hjPPt$hx"<383fSWV03t/ 33 t53)փ>8F u3X33 3 `3\3;l3 p3r*jUX33\3 `3 33^_[á3 3 t \3`3h>&h׬$jh>&h׬$jh<&h׬$jh<&h׬$jUSWVt$|$6a;dp#SjSVW覥 u=3P]3u,3^$ 33T&Ahx"je3T&1QQPk 3y 533 3 =,2r3uhNy"롡x3u#|3x3y"3T&13H3T& hQPk |3yJ13H 3 hP5x3Q |3 t3y 5x3T3T33utS1V 3,3(393rZ 3t= (3 l3@ T3t# 3) 3I l3 3ujgT3 3X33 3t 3 3t 3h`u;53 l3=3 35p3VP5|3W 31Vh؏3֬hj'hj5D35H35L3@3ho-,2`3t%33 3 3; 3 $3ss$3 3tQj QjP 353535 3P$ xd53-31‰1 3 3=3 333=3 33 3xPh׬$谗,3u63j53535 3P  t53h׬$l3 33 33=3 33=3 33C3s 33=3 33=3 33u@s)t3ď3H 3PQQJ 333=\3 `3j133133hzy"j3Ph׬$j膘WV3=t=h=u <3`3 \3t;l39щ5p3s))Rj5X3 p3 l3`3 \3 u\53=3 tJ5l3j5T3 p3 l3`3 \3T3ʉX3)Ɖ=353 t jY=|3u3jPu -8u*35|3Pt^_hn#jShy"USWVl3|$,t\3T3(p‰D$l$|$,u 3 xT$ 33 t!3jQP5|3R !ƒ~t$VShT3 $~ D$ `L18D$ Z 33 ʋ-ԏ3Џ3t>5p35l3QP%ȏ3̏333133T$<$t$ Џ3-ԏ3l$13L$ 33D$11 t3t,P3u#P35x3h y"$!T$t3L$ AD$)ʋ$tЃ|1@|p9@|533*l31 p3T$1 uK33I$T$ `3\3)ѣ\3 `35p3-l3933$ t X3)PQ5T3v \31T3X3 <383 t(335353QPVR tjh%ja$^_[]5x3h/y"5x3hx"5x3hx"j5x3h׬$jUSWVt$(|$,\$$Uh@3j` C4WVs(P( 8jUj` 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"j腓V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h׬$jVP9v VnVPQ萜 t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV83 <3t/jh<1#jB^ 83 <3tjh<1#j$^ 1t$PVFȺMb׋ 3-։+؏3D$H ܏3iى tL$ 1FD$|$ 5353535353535353hy"jdW ,WwPWj;] ď33 t?ƒ ʺ!%t#RQPhy"jd|$4Wp W'PWj\ 33 t?ƒ ʺ!%t#RQPhy"jd|$4W WPWj\ t$ ̏3ȏ3 t?ƒ ʺ!%t#RQPhz"jd|$4W WPWjG\ ԏ3D$=Џ3jPt$ t$V'ÉiL$it$V)QP#RPVSt$Whz"jdt$@VF $VPVj[ e^_[]EVt$;VLjWfUSWV353=311C3W535 3P$ Mtg3u53h׬$93W535 3P$ ݅~3t )u=3N{T,2rOH,2d53 3=3 353jVP5 3W !ƒt^_[]hQz"j讍53h׬$j̍WVt3uD53 l3=3 35p3jVP5|3W !ƒuuJ3 3ti1135l35T35|3P$ ~J;533r,f 3H 3Phm5|3Q xw^_xof@ 3Phm5|3Q tD;533s5l35T3hT3 3l33 p3 t5x3h׬$jwfUSWVX $p $l 7)hdp#j"j\,hkz"WS H-$&H383<3@83<3@3D3P3\383<3uT3i83<3S`3Gh3;L383<3d343X3l3=p3-UE=T3u =M=`3ui $=D3u=P3v$ =t3u j Vh*#t^_[]h~"h~"hJh)~"h~"hKh}"'hL}"jzUSWVt$ D$ɍ L3 ˍl$Sj hdp#PRWU6-UVh @$^_[]fSWV|$13A3GO 31ʋ31 t$3 3jP53  39}3W$3 39|_SQ聉33 $3u 8353WjPx!9u=3353>X90膨Ph#hĆ3 h~"'0]Ph#hĆ3V h~"N^_[0(Ph#hĆ3! hH&hN $3uá83u tjwGjFUSWVjm}Ƌ|$11K< @u=3t?jj53p 53蚺33353UjW] A)߉n3 3N F53q033-3F 30צPh#hĆ3 hH&Mrh "]1H33H0蕦Ph#hĆ3 h"'0lPh#hĆ3e h~"LV\1^_[]Vt$53q0F33^WVL$ $3539})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 3u 83uu82^_É1jDjDVT$3t=31363t@9uхt3uh!%hK1^SWV133j? h"я/"tWt|8/uWh5"WhA"h3% 3tLPut$hh"P31ۅu@W|D53h׬$rk"jrN"PJV\^_[V3tAPxG33t!P5331333;53Z0解PVh&hĆ3h"I^Vt$3t3P3t!P"53a3VjhL3h3` "x 3331Đ3@=ujuSVL$D$ T$t$đ3Đ35đ3Đ3~A2Đ3BI^[fV1ȑ3̑3ԑ3Б3PgqPbQb3Fu^SWV5̑395ȑ3t$ȑ3Vjjh3ut=333jjPP}Lth"h׬$[Hؑ303@uБ3=ԑ3V莈tVPG~*h "53r0h"h׬$G1N1Nyh0"h׬$G5̑3~ȑ3H ȑ331H^_[Ë ȑ3u!T$7̑3ȑ31̑3xD$Qȑ331HSVփuUؑ303@u3jjPP9Kth"h׬$G3 3 ԑ3Б3aˍ3)Qhؑ3P荪 3ؑ303@u3jjPPJth"h׬$FVjjh38^[Vt$ ȑ3ȗ3ȑ31̑3x 1H^USWVh"0SƊtx<0uFD uh"h׬$$EGuȿ|w WjP 1T L ш @u3hjVZ P71Fth"h׬$De^_[]Ã?w )QjP  1L$ 1 Gu@w ۃЃ6w1$@& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhA"XC^_[]eC$t硘38u@353Nj-31;-3M1WtÃ=3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-3|1MV$315353535353*53 $3u 83uu ^j:jq;V53953}3I$3P536|tC533 $3u 83urufL$3r53 1^0^Ph#hĆ3W hH&A $3u‹ 83u tj:j9USWV l$ D$fD$p 1P 33193@u 9u3Sk3 t$$PPh,  $ 3| t % 3ڃuh<1#QUuhr"QjD$P 4Ë $39}=3]$39|A‰T$R53SzNjD$3=3 $3u832$@PSW蘣 =3?5ƅt3VPP,+ 38uK=3뜣3Gh<1#53t:jPDž["x Q:? ^_[]Í|$g0贘Ph#hĆ3 hH&> $3u83utj8u"j&7WV 35319}'3FىDuw9@u1=3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEhx0#PUT1hx0#PÅt*t$Sǀ}!u?S=0KPUh&hĆ3Ch"=eS薽x(=03uWh(v"hĆ3 53+t$00ߖPUh&hĆ3h"=^_[]USWV |$$Wơ3$3D$31-3-39-3t\$=3t$ gDž~w11$35 3Y6ts3PPjJ Å $3u83t$ Dž|$$\$9t$utt "<$u=3t!ʀ"9u 3 uhĆ3PX9¡3Ƌ 3Ӏu1A9|$t $ 3 𣴓33t )) $3u 83ut j4 ^_[]j3USWV1|$=3t WrGHOHt uG `-39} 3V$39rFU5 3t-3 3 $3u 830u 3F8W<1ۍF-39~N$3 39wUQatt7-3 3 $3u83uhtk 30 FH0蕓Ph#hĆ3 hH&9 $383j2G @utL 30 F380Ph#hĆ3 h܀"Y9-1 30=3=3  )Ɖ^_[]js1USWV|$?!uGh@$Pt$WI,VPÅt2l$t$ US NjD$8!u?S=0<PWh&hĆ34h"{8mS臸x-=03uWh(v"hĆ3 t D$ )@ʼn3~0ˑPt$h&hĆ3h "8^_[]USWVPl$Uƃ=3t1ۅtf;l$ `1V$th~;-3u=3t =3u8 GWPt$ F x4EEs @6;l$ |=3tt$$$^_[]USWV|$\$l$19t[=33t UPrUPFyR0蟐Ph#hĆ3 h$"61^_[]USWVP\$53FEx @u}|~PVq6tj39~l$339SPpgƉ33 $3u.83_tO53;^_[]Ë53W53V贙 . ,1xщǃ|$uE3| /539$~Z$39V53ocÉ533 $3u83t 3W53U ,$+HPS53D( |$tM1BDžh["480腎Ph#hĆ3~ hH&41 $383539} 3|$N$339͋|$|MVPnt0533 $3u 83umua(/ y0ƍPh#hĆ3 hH&4 $3t183uj-j/,SWV113H 37h3u8 3@%f 39u3H 3ÍF=P39~Y$39wW53^m=P33 $3u 83t 30u 3F |3C$0qPh6"hĆ3j hA"2% 31t 3033^_[0Ph#hĆ3 hH&U2 $3u83u tj_+j*USWV\$ D$1tt$hS"D$ l$1uHD5t3J t3;3у  l3Ql3;=D2|hl3hR%gN1GD5 | <\t<t3H t3;3hl3j\l3H l3\\5tjj ShX"  tVGX")Ȋa"t3J t3;3Vу J l3Ql3\$ !0t3H t3;3hl3PNl3H l3D50 t3Qt3ɋ\$ ; 3hl3P l3Ql3D50 t3Qt3; 3hl3P l3Ql3Dhl3Q4 t3Qt3; 3~;ȃ t3 l3Ql3D$F9hl3QAhl3P똡t3H t3~l3H l3 hl3j 1^_[]fWVD$L$L$$$0膯| $ |r1(3hj"t$t$ Ca ot9EtzS43ǃxtostypfU@3먡3  $)D$|$ta$8-uW03D$|<3b,3S 3D035$L$jjqthj~1FhVmVjbhjShD3ƅux'<3|$t$8t$0|$t[hĆ3hr"RJ$8u h"_-j豙u$hĆ3hq"Jhu"--y = 3thT3h#hĆ3 @3tPh׬$hl3 xt` 3| 3x51g3QPP M=x3=03hĆ3hr"#Ih":,j茘% 3x3h[",% 3΃t0hĆ3hr"Hj515x3hĆ3hr"}Hh"+VQ= 3thT35|3h"hĆ3jrjkPh&hĆ3 jd= 3jpunhT35|3h"hĆ3f$j0yj0t$8!$h0h@3Se uhT3h#hĆ37 jL$ ɸ!83Phht@j x#$r@2D$ rD2ËL$=$3t1@ 83Ql"L$=$3t1@ 83Q#WV1F=(3t9|$ ?!t!hA#Wtj/Wgth")1^_3333x>3 3 33 3;t,uQ39;u3빋 3| 33t9t31Ƀ USWVP33DJ@t t@3@DJ@t uHH 3~Ã=w$&=3!h<"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=x3t=03y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h("=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH-33=3=3 9=3 -339 9w hm" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sOƱj h353J 3w藱8"%3 3:o t!gc ptrP  A 3< b=3Ho13PP9 3-3 =3=3 9=33-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@3 3AQP2 3<j h353H @2譯8"h"N@2 3x w =33t30h3& 3x A =3u;.53O1@3 3AQP@ 3jPP>3x  1q1ۃ=03Ƀ=x3 ˃h!% 3x  =3u-5353 53g 3x ? =3uL-5353: 3@;3?73-3x =3u , 3IQ T3x =3u,3 39QPn3x QVP 3y F( 3y 1 3y P5353g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+ 3 3uF%3x Uu<2=@3t1@33x =T3hT3h#hĆ3 3x }*x1Hptntlu  ˣ3@У3x '3G1333@Hptnt lu  ˣ3У3x =@3@3u`%|$Wt@$5353QP';3x33x ==3uJ)=@3@3u53Q5;3)x3hX"h"h"3h!%31< *5 3y qt3@P3@P#=03h%+3x )53j 6'(Y$i*tEEp $A8GMi 3913)@أ3=3t W6Ux31 $3u 83u u^_[]jjSWV=<3uj貽L$ɸ!833Pjh@$h"Hy|hI#KtkP訇=Yà P]6tGWPS|3/tf/Vmed.hDhup53jh@$Vj=<3ujL$ɸ!83jhD3USWVPl$53'Ƌ=33-39ʼn) u)E1u1$$3E@$3V}tzP蘹t_3PPj DžtOx3$3H$3u 83u[uE6M3@Pi1,$l& $3u 83ut j1^_[]jUSWV$(3 43th"ckjP~3L$F$ ē39} 3V$339|BVP?5ē33 $3u 83! 3 u1C1E҃!%=@3h@3P݄Ɖ$ ē39V$39V53Y>5ē33 $3" 837 09L$]9$39|WP==ē33 $3]9~[$39V53=/5ē33 $3u 83yt v3 3 (E 3Q39\u=Q3I ( 3G (E,$s 3L$A 3 3y ȓ3)9~_$39VP<I5ē33 $3u 83 ȓ33| 3A(EA3ȓ39r 3L$A 37 833/ 3Q3 ( 3݀ (5̓39}3R$339|KVP;t]5̓33 $3u 83S53P e 3ȓ3D$1!P肑0ZPh#hĆ3Ȭ hH& $3 83u!u#^_[]h"qhu"gj'jVj/tL$Qq p PIH10.ZPh#hĆ3' hH&n1^V@3t.L$19 ؓ3uؓ3H@3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hT3_XWV 3 td< uhA"1 Q3I t;8t7P1ǡ|3t?=3u6Pm|395|3h"R5|3js.|3tV35,3WPw[ |3t.h'hT3QP8A5|3>|33/"0oXPh#hĆ3h hH&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M$339|KUP;8tYlj-33 $3u83uyS53Wa 53=3tsj jSWme0MWPh#hĆ3F hH&1 $3u*83u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwR裌j h353k% 1wu8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[$39V53z5#533 $3u 83\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t % 3ى38$339|NWP4t8=33 $3u 83uuuw5303M1Iq0SPh#hĆ3跥 hH&1 $3u 83uu^_[]H3,j'jUSWVPL$33193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP3$31S̪á3tP芬EPPjM Ņtl9u $3l$ u83ue$33+39}yF3@3P%Ut$ Pt$$hDž+9 $3u183uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=3tj jvS肮vލD$jPjSuxt1t$ED$$D$1E $A9T$ 439Ɖ $T$~c$3t$ 9V53Y1\533 $3t$ T$u83=3tjj RS藭T$=3RSWZ 4$D$D$ 3 $9~bt$ $3$9V530533 $3t$ u83=3tjj t$(S=3t$SWY Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuv&D$)D$39~V$3 39SQ/33 $3u83|$~#D$$ D$ ud$th/"$=3\$tjj SV賫3SVPX 3f |$%C<0dNPh#hĆ3] hH& $3t e^_[]Ë 83u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y$39W53.=33 $3T$u83%$9C 31F9uEEπ;D$$,$L$l)39~Y$39W53c->=33 $3T$u83ml9}C 31F9u,$y^=39}3_$39|W53,=33 $3tT$ 83T$M 0E+3;3539}3J$339|KVPJ,t)533 $3u 83u^u`I?0KPh#hĆ3腝 hH& $3u 83uu؃^_[]jjfWV3 39|ld 3j Qh3I tJPKPh#hĆ3 hH&@530133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWW'09u33H23L2^_[USWV=H2=L2=3t x33$3D$j荣$33 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H23$H2L23D$L21 $3u) 83u&tj\hJ"$^_[]jlUSWVL\$d3hZ"2_"tNjt$`hj"SV+  fttu=U߃u 3r|$L$ D$1,&"D$PmƋO9rPSt$ n tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ ho"jkL$j QP $;Fl$|1ƋD$8u&1zPUy!Uh׬$jJD$ th"jNjC=m@!sHQPW xs{QPWr x4$Uh"M =muqB dut\$fCShmW* HefD$t$Shmh=m8@u֍D$Phm8@W y?60PhЃ"ӍL$fqQhmW 3Uh5#D$ukD$Pho"h"s T$"h"T$"h/"t3H t3~l3H l3 Phj"khl3j 蹙t$8t$8t$8t$8t$4h"t$Ht$Ht$Ht$Ht$8hDŽ"Ǔt$h"趓t$ h"襓jˊfyPhD"hĆ3& j謊SWV֋|$t 8"?t>"VQPX JB8t3H t3;3hl3j<Řl3H l3ɗl3H l3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hk"2-th}"Pju3h"-th}"Pju h"Ujh}"h"L $P u h"j~0D$ u h"jt$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$&U$뼃4t6맃dtket/1@D$#=UumWt$SiXh΅"5UKD$71@D$$+L$ 3 3T$uA3$T$uȋ$D$,jj@R;Bl$L$ $tL$ $L$,1ۋD$PfCEu Sj)St$PʼnD$$  Uxfl$$T$DtIL$ىL$$U$E L$)QPRm  4$"fEuED$ush΅"h%du]h"bh҅"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh3t$ t$,QPRKt$ $yj!=3y h"|$$tQt$(jVjhSVy h*" jVjh53Uy h<" h΅"Lcǽt$(1CUVSwD$PUUVSw53Ut$,i!1L$XAAA @D$HPQS =3u'l$hD$h8jU&*s ul$uDžy h0#1O~fVS53@V VSt$V1V |$h535l$0fE<u1su@hWj us8zs18tƉjjU tD$68Zt8s8tEVSt$ x )bs8#Th%|$l$8fE=3ul$0fE9EjD$LPj  |$@f9fGfG3G$jVU tQf|$<tٺtf|$4t?3L$0u+fD$<=3ufD$4 .r8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hN"jt$Dj躁h#yKph"PhS"hĆ3j茁PD$L$jQ53s XUSWVA1K8uSt<։\qhU7w ~WUV& ~)u1 q1ۃ8#ۉ؁^_[]ÐSWVP|$\$WS5_ƅu]jjtqƉx jPS  ǀ;t$8u1A8Љ4DAtt;L5rSh"jJ5 1<0h"USWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hˇ"j4NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxjQWP]Yl1eUSWVl$(D$,8tщ$PQh" D$|$,x D&Phу xBWhD& 1yJt$t$,WSh'"jI3#t$t$,VSh"j"3^_[]USWVu ]33,̕3?ȕ31=Е3ԕ3=ؕ3=3hM"VS%  I~Hw0$&ܕ3уCt DGUؕ3봃JU3333x5U3`3UG3I5Uԕ315U' ȕ35U35UЕ3 3) =ԕ3x =3tD$)T)&1PP0D$qU Qh"j. $N tut ttL$8L$t Ht D$\$$|$1¿ u׉|$L$pL$ |$x\$|څy11Pt$RQL$D$T$$D$4t$$$SWt$h" D$pźHt;T$v$uuD$,D$xT$|$$)ډ<$9|$\$߉ËD$lD$ @"9ؿUD$uD$Pt$L$(tT$Rh1"`(3L$(D$TD$X,3tt<$11D$|$PD$PPh K T$ t$$t$t; D$XL8T$4 2L8L2 8L$L8L2L$L2 L2 L8L22Pt$S 4L01 L0T$T$B`$|$ tt$t;< zD$p$tF8DQh܋"j+ `jPh"j+t$(V5(3a0Vh" $4TK4ҍ4v֋T0|0T0|0u׋$8tthxUj4 PT$8H Ht1<D$@$L$D9ܕ3tx8D$,D$ tD$tD$,4 L$p3ލQ։9w9681 3D$pNt$u1G|$D$ 9ξ|L$T$ $8T$$T$tL$$t$Pt$ Qh"$¾tt $<1|$t$  $8:O_ d$1F$+4im۶D$D$uD$$SQWPh΍"~ TK<,KAgfff‰t$@ҍ@TK$tD$D$t$;4 ;t$L$ 8t@1ɍA;r^_[USWVXKtWjjPL XK9u XK4t0jQ跹x!=3h#"j{t$XKxi8tPWh\"Q&VtPSh"WjT`t8VhB"j 1^_[]fWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21|KIu顀2PK 2~ t1@K@9uUSWVD$921A9|G2SOƉ<$~ SjV:K 2D$~Q1ɡKt<2*tBEB(B$B4!؉B8<:tWBuA;L$u5K5K$2^_[]V$dK hKD$D$ \&T$ t$ 25lKt$T$L$D$\$ $ǐ"f$^Vt$FtN H N tNHNfr v RVI `K^VD$`sH) pKtK xKHtP4BPQ@@1ҋKv9tKKrh "jtp4F@K^USWVD$T$#25KtC=`K11-lK9| n-lK9t%9P4uH$3L$X(3\$ t Fu1^_[]h]"hV"hh"KFUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv ;F V>`K xK 29|[5KtFNu K5Kt5FNHNFy F4VPV`K@`K1@j@PVU1@PGF ~4D$F(^$F0^,n#2^8K Kt q4K^G FtH 7~ F^_[]É K=hs"hl"hh"hl"hh"DVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP KHKN^,H pKtKxKH@KP K KHKH4IKH89t;tprpK40Kt4F KH^h"h"h4h"CUSWV}]uuu W@t dK1@hK1HCSuu WW KN0F,xNF4VPe^_[]vjv HE fUSWVP|$gT&sP&G4$O,52w0VPww D$0^_[]USWVPt$ffT&sP&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jZ8p KHtƒQ K@ K^_WVt$ KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvxC v^_USWVPT$|$:%4K\$ K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4K1ہ=K| t PtKK1t 98t@^_[]Ã^_[]`V15K5KhVhKYB 5K^ft$ t$ /jUSWVt$frLN4F,=2~0WPvv 1T&t\fv4V1AN4F,=2~0WPvv 1P&1;NuN^_[h"0 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"u;USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FpaFaF 1bF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h""$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthuW1$2L$1 QWPUSVh4jÍD$(Pu S  \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4j Ël$hu P  $\ E1PU\$tE|$8t ho"҂,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"Xt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"OB$  $ V)19tQRhڕ"O 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȒ"UN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthْ"Nhl3D$(u KHKpStURQPt$DljT$t hږ"%u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" KVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"Vt$Ht$wL$tI9ȋt$ tPQ$$h"1t$\^_[]h"hv"h)h"h"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ },LD4@hD$D$D$,$D$ N,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UW輮ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPOERP?$GW #RP*ERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW膩Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP{T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPȧ|$FV D$t RP諧|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP3 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP薥|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP $ D$TBL$?ttXLT$BtJ J T$$T$ QP螤L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv i  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p zA L$H SjQ ^_[]fUSWVL$T$ BKulF1G&Uh#$,$t3H t3~l3H l3 hl3j i*u q1^_[]V_ Ć3PPhd"V'Vjjh" "@К&Ph@#hĆ3&ܚ&ujcUSWV׉΋*h"U> &tCt[PU$jhhKs 5KbKt2KKWVS5Kht^_[]Uh{s"j5Kh׬$j!USWV$:$D$VuP 9$j uP q 1ɉ\$QSu?, Ƌ8H 8"u11F9Ή$<$ 1ɉQSu  ËD$8Չ 8"u !t$$Vhyd5K tbVhg"J"^_[]jh"7jh".uh"$h"h"$p h5"hM"jS$05Kh5#jhUSWV}E ph`J%VFhȘ"Vh$VSD$(P5KZ#D$0= M$L$A1yyy D$Phwd5K D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhj舰D$v1111O w+Ow?u$L$A1AAA D$Phwd5K  \$tmt$ NL$,D$(KD$FD$FD$ FD$$~D$(PPWt$,t$t$t$h" KuD$1D$|$Ynhxd 5KR5K1111VQRP5Kh"Mhxd 5K KLQh8"ww ww5KhQ"w_G|$9w  jPQ5Km!¡KtNSVPh"Wt$ 5Km 5$9t#"QRPhl3eSVPhk"蓝كT$;r ZƉ[|$?e^_[]jj裟5Kh"lh"h"hΘ"hĆ3  j Qh"WV$u>$jvWN s'Wh{dЀ5K% t^_jh"jў65Kh5#jVPPhtd@5K $t%t5Kh"!$"uʙ"5KQK$$>">"sdp#QPh" K$$ >"sdp#QPhC" K$$>"sdp#QPhk" K$$>"sdp#QPh"f K$$sdp#VPh"F^5Kh"j违WV$u^Vhzd@5K tH$D$PWVh"$PwwwwVh "^_%5Kh"j8USWV}D$Phd@5K  tzD$Phd@5K u5Kh?"肚K$|$\$ t$jVSWYVRPSWt$hQ" e^_[]f5Kh."jySWVP|$uX|$_ho#SƅthH"Su+1Qhwd5K% t ^_[75Kh5#jUSWV|$0t$,1@U3$1ۉ؉D$h|"WV膣 qt\$te+$9531|$7wWh|d5K{ D$ ;D$t-i9l$sUt$ժƉD$l$묅hhPVKL$ dp#ti#RQPhݛ"_|$ t\ư1P`VvvvvQPh"( G;|$ ru5KhÛ"$t1^_[]W5Kh"jj5Kh"j(jP|$u1Phd@5K6 KtQh"XD$ 0Qh5#jSWVP|$t$^h#SdtDhx0#SRt@h@$S@ttT$da3 D$dD$ tTj/StF1;tٍT$d#3D$dD$,t>\$:t$1\$(X0&,&h" u1\^_[]hG"h "z3=ĪKuj=̪KԪKȪKKK KYh"5UhӜ"Phd"j`K=ЪKu th|"0"ȪK Kt uh"t=2uh˝")ǃ|u D2j=K|$\G1PPL$lQPjWLt2t$dut"1PPD$lPVjW t52=Ku4$P52Vru#$=uKЪK ̪K ԪK ȪK=K ɡ2=Kt&jQPU_ 2u[52hO#jhhKQP2y"8hKhܻ"L2K=Ku'L$dQP52h "hKhrdAP 52hI"!hKhedA52Y 52h["hKh"ލ$$t(hQP52h"j$$ƒ LK>s1@![Vs ) ȣDK@K8Kr$r$K K KKu 22]u1hQP\ 2u25Kh׬$/52]2j52|VKu Vh"8 11h Kt1A1A1ۉL$@1h KlK hKhpK=Ku#KKKKKK t$\F|$LSSWSjVt$LKn 1QQWPjV迹y5KjK52j/V-t@UUUU)ʹ3333!!сisK1Kt!ttK KcԋK KK1K‰ KKK1 K1AhQhKu i-K=K / KًKP+==w !r%1H$D$ ʀŸw1D$ $}ȹKytKt  uK1I $L$9 K11O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj LK1҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$K-K=KKD$Kt T$$T$ȪK=ܪKuu 2; K7=KlK_h""EK81uhU"!6KL8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRAPSt$@t$,t$4t$K1K1Kޅ`1PPPPPP =28h"1K8LFu=KuRhx"%tajh"1к"WjWWWP+h"t҉ Ku K=ЪKuȪKu ԪK1g=ЪKKD$tD$|D$h_"1K1N=t 蹵@ 1<"WhVVWP+9tigfff։f5KKL$ȃjPaD$ u hp"jh}"911HL$ Ajhk">1۾KD$KtB?t=kWUh"  KL$ DD 3$ D$tD$D$ uK K1K|(.tq<(tk{PWh" KKKt (BD$,T(2D$ TL 3$3L$ щtT$ KT$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R:K=ueK$@D$ $#D$u D$ ,&1$L$19;ta $ȢK=ȪKu̪KuԪKu ЪK=Kt8 K~ h" pK~lh" ]h".=ȪKu1IK |Kt h"Y.hZ"t KopKe$jut1 KKt Kt3$ D$ K u=K5KKK1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ K|$E9u KD KDKDKDL /K KWQD$lPʵ D-K1ۉl$(-D$D$DK$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$K K5KKD$t$"5Khe"Phs"qh+"D K K525lK5hKRQP5Kh}", hK"K K5 K5KRQP5Kh"5K5Kh@" USWVPˁˀ K K K1KK~t=uKt 9r u֋ K~:K”>u~t:t  IuЪK щ $ ԪKt&=uKօ4$u KGKtiKȨuh "hҘ%KtjK=uKЅ$tNK=Ku"PhB"y0h "jPhw"t K =KuQ8$$t|y%tjy%1KtiKх $t4$P5Kh˴"=Ku5Kh"1t"1K=u KK^_[]VPD$ L$ $QPph"3H 3~3H 30h3譹Ɖ t9tD3H 3~3H 3h3mƒ1Y^h"jLbUSWV1=K˃y CS t lK5hK11 uY1ɉNVt11@5C Cg"t"Ph"_ hT"61He^_[]SWVP$2;2u+Ku"QhmdP艩 y h#(_11h K<=Ku;5K|- K1Puhe"V=K~e1K111 KKPt,K8C;K|hC"l^Shz"\^$2;2u+Ku"QhmdP~ y h#^^_[USWVP։1ɉQPU^ 1O}t#Ë$8u8"u r1^_[]USWVP։ϋl$=ĪKT+K Ktúdp#td$76PSRh"T$7St$h"D$7UPS\$ Sh"7PUSh"77PUSh˰"7PUShܰ"7?PUSh"n77PUSh"H7PUSh"07?PUSh""'1PPPUt$(SRht"^_[]USWVˉ1u=تKh"T$$8$43|$͉)uhdp#Wh" |$Z)uhdp#Wh" D$|$K:KK Kl$M?>KKKL$ u}tGE)9H9^_[]USWV,։L$D$DD$+"tD$F"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"4 KKD$HL$LVSQP9D$T$D$PVSUPD$|$ D$@VSPWljӸ1=2ƉT$ L$@PVt$QRũPSW|$LWVUl$lt$,t$,t$(t$@h"b,h3jdhK |h0#hKdK\$ $t < uC{ - 3DAu<-j D$$PhK D$$\$ h &S-cK|$(@D$Ph"Sf $ϋT$ t։t=t$hA&Sf t't$h "Sf ct$ |$@D$1=2ы5KjVWRED$ՋD$D$D$D$D$$t$t$D$$  T$Ku1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th0#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh3"-KVxƀKt$Vh " 5KD$,$t$P։ω,^_[]h"jRUSWV΃ twttu"^T$(|$$+KуD$ ;K"L$ K|.|$,T$0 K|$9=K|=Ku|$4u 1^_[]Ë-K~} ʉ$9twK|(tk Kt( T( (t1+K9\$ \$$}2;T$}#=Ku6|$4ttD(OG1nFݷ"t(n9Չػ}n9l$\$QAuƉKtt  $tt ^K K11 Kt$ -Kt$|$$|$}K] ʀ|(tP Kt( ;L$T$|L( (9Ή} =K{|$(t ;KKC KK"1$t=t K KS_"=K|$(5K5K9d1KKKKKKKƆKt$ |$(PK9Ku85Kc1KKKKKKKK1Ƀ|$(T$3\$1 5Kn K|+D$Nu K[\$j5KK)؋ KP|$(t$ hhj3\KVfǀUKL$ KD$KƋD$$ȉ5KKK11KuK=Kh""u׸"D"=K1|$(9 Ku85Kb1KKKKKKKKJu UPQ`U K1|$(tD$KD$K5K=K^_[]hp"jjLWVKt^ tڋt֋|҉tΡK4 K QPVT Kƀ^_USWV T$L$K@hPhK8  KK~CKK$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRT K;UjP2 fDŽ;UtZF , M ;M;MU;; K KT$)ʉUL$  K1 EE=K KϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MK ^_[]h"jIWV1=تKAut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$!1Kl$ 22uhUPDzQ5KPr ;2u[jVW52薐!1Kt?D$H5K#$SUP\ 52V52 ;2tÉ؃ ^_[]h"jGUSWV$0$,1@D$l$D$D$ $1h"WVO suMoj U5U áU8=L$9068"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-3)1<$L$jhQP4WhKhedAPԎ =K^9l$| ^@fKUjDž\$ t|t3H t3~l3H l3 hl3j jhKhl3 t3H t3~l3H l3 hl3j 7<$ D$ttdp#t$"Ph"PD$fKKWafKgdWPV襍 xnu)D$PhwdV芍 h"h"V1^_[]Ph"25Uh"j E4 hW"hz"pj輺WPh1"hĆ3 j蝺USWV\T$DK< $SqID$9d$ՉjRPt$ VЌ11 Sl$UVu 9 1U\$tL$j@PQk} 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW44&h"`T$l$ K1ɺK1MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$Kt)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf KŅtMaQ44&h"IT$ t tuf f111K|$ KKT$KKfKl$E<$g\$ttXaQ44&h" ;B Q44&h," <$\$t44&h]"~<$l$!F1D4  h~n3itVnKЃa~.btCdK봃otBsK띃NuSUKK1=KKmjSh&5U.tHPz.EuA3)ރu4t$$V43ut$(t ^_[]h5"j,6bPh"hĆ3" j訫$"=KuD$ D$@"Kt $P=Ku %=Ku "=Ku m$@P03h"hj)&jq5WVPhx0#Qt1ƉPjPW] Wtt jPV謊P^_fWVt$|$ VW菐t$?/tWh*"hVhC"Z^_Wh"j4fWVt$ |$7#WVUSWV $$l$WVSU$ $ hU3WhXq"HuWVh"jGX4D$@tF$j$hd&hVDV$$$h"~j褩USWV$$$$D$1 h"SUy; $D$D$1G$D$ȃ 1$(&N|w5UFt|$`N|Z5UFx|$Cj$hT&5U\+P +5UUFp<$h"SU: V3H9$|U4n$W^.l$\$t <$tu;D$ PW@tD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h5"j42Wh$jG'2bPh("hĆ3" j@訧WVPt$jWV0 9u9t x^_Vt$he"j1Vt$V/t@^h#V^Vt$V4t@^h&%V|^WVPt$jWV/ 9t9u x^_Vhw"j1WVt$|$ VW跌t$?/tWh*"萼VhC"肼^_Wh"j0fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$ Q;2D$ T$M⿪t׋E4D$P9$E0D$@s h",1VWt$ t$1P:1@PPVVu4u0ufNË\h4h|&Ph }D@u hh& hh&Sh }D@\E,CEhAs%V$thAs%Vh"+ E]u"Mr u%1ɺu; L$M υu"Mr $9\$~\$~tSh"0+\$9|1} t h"+hW5Kh "t$ }4xME0;E4ru0h^"*u8E,u.D$@ E4t h"蕹D$P 1u D$@E|@L$tɉ$~ș|$u D$x9~BQh"P*D$x,D$xt9th"+*D$x$5 t$ D$$$$ $$$E@$D$,D$(AD$|AD$tAD$0A $CD$ D$TFD$D$HD$DAhD$LL$$AlD$dD$XA D$8X$$AP$$p$$$$tD$hD$\$$A`$AtD$pD$lH$$x$$DŽ$\$|$$S (L$ L$,tL$(|$1F9tSh"'D$ D$L$ 1۾Ë$||$|tL3L$ 3tD D$ Wp'\$t4$1F9tWh%"P'D$ 1t4$ tЉ<$TB7D7R&tt htD$pt\$1t$$2:|$$xtIt$%Whd"Ć3P |$)Wh"Ć3Pߪ D$ $L$t$}D@tBW&1@9tWhD"% $G$D$D$||$tD$tD$L$\$dT$,T$T$8tD$T$\$XT$(T$T$0\$`T$<ÉȺ$L$`D$L$<wD$ $L$t$L$}D@$t1ɉD$d|$$tD$X$D$8tD$08$t$1ۋd|$tTt˹)$E3|$x|$trE P|$t$ \$t$ lt $U<$uL$$|$t$$t$ \$1ҋ} P#$t$D$1P#L$hT$tL$\},D$dD$tD$X0#1T$(L$t$D$htD$\0Mt$  $t1D$uAAQ 1D$1L$HD$tL$D $L$h|$tL$\$tT$HD$< u M։ ut$< uƋ$ș)Љ$T$ uD$D$u$p $pL$WxFD$(+D$L$,L$ ʃ{1QPWV;th"jT1F\$D1VPSh"wD$XWVPSM%|$$u1Ʌ|$t1ɉAw1@|$Ph5"QwD$tt$5K5K5Kt$\t$dt$<5K5KQ5K5K52PWt$L@ƃ|$4tVnUSWVӉ $^|$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ 7]8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"jUSWVĆ31F/WVUh4"(WVjhd"(WVj!hz"(WVjh"( WVSh"(WVj+h"(WVj;h"~(WVj$h,"m(WVUhQ"](WVjh"L(WVjh";(h"W-wWVj h"(WVSh" (VkfD$t1B9| 2I 21,KIu顴2PDK 2~ t1@DK@9uUSWVD$921A9|G2S'Ɖ<$~ SjVW 2D$~Q1ɡDKt<2*tBEB(B$B4!؉B8<:tWBuA;L$u5DK 5DK$2^_[]V$K KD$D$ \&T$ t$ 25Kt$T$L$D$\$ $ǐ"r$^Vt$FtN H N tNHNfr v * V!  K^VD$`sH) K$K (KHtP4BPQ@@1ҋ0Kv9t4KDKrh "j_tp4F@0K^USWVD$T$#25DKtC=K11-K9| n-K9t%9P4uH$3L$X(3\$ t Fu1^_[]h]"hV"hh"#RUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>K (K 29|[5~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRY׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"MGUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FUFUF YVF F$9D$4toh4jilj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthiW1$2L$1 QWPUSVh4jÍD$(Pu S \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu P $\ E1PU\$tE|$8t ho"誎,$SktUW ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"0t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"[B$  $ V19tQRhڕ"[ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȒ"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthْ"nZhl3aD$(u KHKpStURQPt$DljT$t hږ"u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" \KVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$h"`1t$\^_[]h"hv"h)h"~(h"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ U ,LD4@hD$D$D$,$D$ & ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$D\KuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWϺƋD$0 u$$$UW蔺ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RP'ERP$GW #RPERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW^Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP޴t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPST$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP蠳|$FV D$t RP胳|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP  t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPn|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QPvL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVȭD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv A t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p RA L$H SjQ ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QPq51 ^Vt$ V(1y?1I+F$ыT$ptj42QP%51 ^Vt$ V(1y?1I+F$ыT$ptj42QP41 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jL藱Ɖ t,UmFtf^81FF"P?USWV=XKtp\$1 ^uXGourEr?E!u$t.E( E,tWt$t$' Ut$t$ F(u1^_[]USWV(l$Dt$@|$<]N(;LrN,t 9ы|$H1|$<΋t$  KuN KNVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVhA"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"j脁@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ KKuPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp v ^ hjSC V^_[]h"h"hh"YUSWV l$4E}0I\$8u tȉFSt T$$uF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$"袵\$8u;l$L$4A(I,WhT$L$$D$  l$u L$4A(I,T$L$$D$ t \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$]sF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$rF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tW|ƅuWh]"j|$$<$4D$Phd@U謖 tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$1 Sh"U CPh "U诜 C Ph"U蝜 CPh"U苜 CPh"Uy CK,C,Qh"Ua C0Ph,"UO $@D$t P11-Uhzd@$<W t1 VhedAW hjU D$ P$4O[D$, 9L$跑L$9u0$S11:8tx$0ht"wb$11҉ $ƅ*ŰP}j PUЉ ^_[]$0h"jyUSWV81ۍD$4ShPSuh1NtAljSPSWuWrHuMU D$t$$$Q1e^_[]fUSWV $( $$ hojS hx0#Umt.PN|$:"V(t!UhU"JUh;"1OUh"l$D$QUPh%WɶtPUh%W貶iD$$Ca2=ouV\$<&V{V|$( ]hh"W ƃaT$q"V1u\$ىjW$( h" VT$X"V$$ h"V ^_[]1ىj=ߊ< t< uGjhQ#W k2$( aj2WP EKu$( 8~y$( 1\$ىj(Sh$Pp u$PUhl" "j2PWv E2$( ;(|V\$}"V$( @VT$d"Vg$$ hK"h"SuD$ $PUh_"SuU<Shhg"  $( aPWh"Uh&"$( x?$( Z1ىjPySh$Po uSUh" j2PW E2$( ;h||$jt\h"@PUW֭ $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W襲L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR VYqy8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjhQ#V/ u<^Ft t u^F t tWPWV tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPh׬$^_VS1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh"+C< t< t< uhx0#SpƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P t$$$ىh"rC< t< t< uS=$<rLjSh,"ShH"nSh|"wh"et$<L$D$D$L$ oP\utXljo 1tX L@uH~vCtTjhhV" V$^_[]V )UjS1 D$ D$ CD$CD$C D$C$Cl$Uhfp#V豃 u D$CVj)1$<;obD$D$PSh"( =USWV$0xjW}ƅ~F$0h$1jU}~4$hP5 C9uЋ$4hx0#SǍ$ىh:"$0St| uƄ$ $0phi"QUD$$0qhs"QPىD$PUMPUSB u׋$0EED$1ɍ$D$ $PhSC D$PD$PD$PD$Ph%SWD$L$ T$ ыD$E L$ T$ D $A9L$D$uP<h"h"Uk}Sh"h" Sh"h"3k $02t$t$h"$@t$Ph" |$W}~14RG;}|VC1^_[]USWVD$(}~;$ ~VE pS| $PjVWjS}D$11D$D$D$D$$D$ D$h$"u Vu/t H5$t&D$>j 5UPW| CrK밋U$P+Crj ho#VLx ىVSF71PuE$ ~S4Vx $PhjSPt$VzuVh\" kWh"jgÍD$LPS©u $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV莮 -8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQ? $PhV"Phr<rr h"jhr +rryt$$$PVW>ލ$P|$xh"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP, $Phq"Phr}"t5"PSh"s .1$P;$hn"Shrt$V"9;$PVh" |$$Vh"h{"jhr t$Cje$=K:$h"Whrt$"?c.\$j$h"WhrS$d|1$XAA$Pj2PQ艓 $Ph>"Phr9rh" $`>ߋN8^&w&PVh@" `Ouet$$P\$ ZSh"h"$P\$;$PPh=" Vh-"Sh*rt$  09rh4"8h@"+$\>$ThV`Ouj $X1~$1:t @`9u9u$\Ph["]1@\D$,\$H|$PS1$hjV L$,9F Vh"VhrWN h^"F0Ph"F0Pv,v(v$h"j hk"$Th"Ph"h"Fh9%%VD$0L$4$PND$8Fh9"Vh(r W  FtsShX"%$PtPh% hu"$Tt*Mbi)QRh" j $XqPSh" ]h"n $X~n$1Wȃw,#"$L&L$S7"!""^& }""PRhJ"# F`;$X|ۋt$~G$`>G8tu #P^&w &QWhJ" `Kut$hn"VhrP >"t"Pu t$1 E$`$d $jj h_$QPjVqyjhv`$Vk V$`t$Vh"#$XMbi)QR$\Vh,"$|$|$|$|$|$|Vhi" $\uMi#1wh"q L$!r"$PPVmt$h"!11҉4hӀB9udp#ti#QPt$h"=K~S$h1hR#1PQh" C uߍ_ j  rt$h"Vh&r@t$<#;$Pt."}"t5"RPt$h"gt$ USWVdp׉L$$xph"SWtÃr t1C$|L$ PVQ莒 Ou wu pu o$1hoVW* owt1$4 j2tW*i F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0Ghh"W`h Ƈ$L$h"Qh+r|$W9uh{"jhr Wdp^_[]ø"1@$" "$Pt$h"hĆ3WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhz%Si tVjh"Si tBjhP#Si t.jh"Si jho#Si u$D$D$h"PhrWh"PhrW=Kt?|$"t"PVh" |$u$4Ե&Vh," ^_[$oWV蚺ƿĆ3Ph!"WW Vhd"WH Vh"W9 Vh"W* Vh"W Vh"W  Vh"W Vh;"W Vh\"W Vhs"W Vh"W Vh"W Vh"W Vh"W Vh"W Vh-"Wv VhD"Wg Vhe"WX Vh"WI Vh"W: Vh"W+ Vh"W Vh"W  jVRhQN t^Vh׬$jTWVPΉ1WPhPPj PQC= u^_Vh"Qj6TUSWV։ωl$PU\$hjSW E9C Sh"ShrW Vh0"ssss hI"ss3h"y{""t"t$(Ph"R t$4t$4t$4h"9$t$Ht$Ht$Hh"D$8Ph6"$t"VhI"$4Ե&h\"$hs"Ę^_[]t$ t$ t$ + tt$h"jSUSWVӉύD$(jPsd1t$`FFF FFD$hdp#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP)TD$HD$PD$P h&5\&|$D$ fD$ l$ \$Tl$+D$Ty1h&Ph׬$j($PT$D$ +T$(+D$0хyL$XD$\D$\5l&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<PhQ&W/  Uz ,RP3$ $P$P$WԖPh&S#Wŗ  U5 @ h,p pUa($WyPh"Wj R j^-=Kt%KI$W!PhY#W h"h"h"h"h"hh"hB"h"h"h"h"h"h"ha"hA"h%"h "h"h"hĆ3P$W艕Ph&Wz bU*yŃ=Ku#4KMIрK=Ku }8$V+ƹV])uV+WC$VVY+DžD$u hj"Xul$Vh#hĆ3ҿ Vhe|%h$ P跻W(yl$`t$Xt$T1ҋ\$މT$̓=Ku4KMIрs6=KuA}t']h%SthA#S讕uWH(Ņu{D$TƄ ML$XE|&hP$ Ph"hĆ3׾D$+hP$ S{N ىV1 D$@W'$W8Phܯ$W) $'hĆ3jjh"=o$WPhA"Wٓ j)$W貒Ph"W裓 =KtVhĆ3jjh"nK$W]PhJ"WN 6WKThĆ3jjh0"fnK3hĆ3jjhi"EnKꍬ$U$P֑GVʑ)1;$v7$5<P{3$P苑$$1EhhĆ3jjhW"ml$WK(_D$hYjUP*dL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=K ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S[t jh#S臌 t ;/u f. Gf./W`SU9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS艈tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 4KH $s-t$$tHfHxt P2)1^USWV=Kthl3jjh")bjj9#tvƃ=Kthl3jjh "a8K1GNIIˋ^s 4K tVfV(8KޅuDK=@K1WS"ơ8KKrk=KtV$Ph"hl32 ~uV7dV'%V`v v"KF$5Kvu;@KDKK^_[]USWVPl$4KM1t$"Džt.w w!ƅu h+"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=KtW"PhC"hl3 W_1l$$ttF9u t G9t$&Qt$hKh("hĆ3艮<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hĆ3EuFufFFV!|$WP`WV&N=K1ۈKK|NILKhK9KǀK|NAMǀKEFNDt$hKh"hl3D1N1@=K1ۈKK|NILKKWǀKFNDǀK|INOW褁KǀK|NAMǀKEFNDVdPt$hKhg"hl3襬C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=K#~VPt$ht"hĆ31t$hKhE"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=K$ WbPt$hKhg"hl3NUt$$t$$|$$WƀH1@=KىV_bPWhKh" |$u V[v vYKF$5KUt$$t$$WDUt$$t$$W.PZN1@=Kt-ى,VaPWhKhg"hl3]؃^_[]S1KK|NILKt!hK~ǀKAPEǀK|ONTt!hK~ǀKFNDǀK|INOt(hK~ǀK|NAMǀKEFNDƀKt(hKo~ǀK|MODǀKECHGƀK[SWV=Kthl3jjh`"pZDK=@K1VWftmxtg 4KW sJX tCf{u7=KtSPhz"hl3 S\S [빃;=@KDKk5Ktc~ tWuLfth"W Z=KtWRPhz"hl3n Wy\W9 륋v$^_[SWV=Kthl3jj h",YKtSK1{ t$C$Su[SFuՅu5Kth"VKYv$^_[USWV=KRKutDhl3jj"h"X,thl3jjh "X5Kt$G!jj#^ơK;@KKDK,׋-KWV]Ɖ׋ KK9sAWV2ÅuWVh""p\ SPh2"hĆ3 c렉1‰1 u`WVÅu hj"%\Cuh"SXCt SZcSSPCcQPWVhI"hĆ3]:KK9tPt$ ZU-KK;@KKDK^_[]USWV=Kthl3jjh"VfKjY9T jj\ʼnT$DK @KPQ\D$5K5KJ\Ɖt$U9\ʼn$St$p\Él$9$\$K K9ˉs6fKj8DTk D$;KKrM\$ -K9sIK95Ks9-KtS KE9uK K9\$ K K9ΉsZWVÅu h+"YSCPh2"hĆ3_ cWV[ƉסK K911 uU9t$D$ rIWV<Åu h+"|YSPKAc9-Ku*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5K5KfZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=Kthl3jjh"CTFtVPXfvu݃=Kthl3jj h"TDK=@K1ҹ$RL$QtMƋhtDEt9VP|$ W:1ۀ~UiCSPW+W em븋L$$; @KDKr^_[]SWV=Kthl3jjh"9SDK=@Krc11CWS5t:FfN~u %fFfth"VYSvuȃ;@KDKr^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h)"VRWh"hĆ3@ 1^_[]fUSWV`=Kthl3jjhT"R5LK5HK5Khs"hh2ܜK t=TLuFFF%)Fu9rV9=KtJhl3jjh"LF Kt(t$hl3jjh"LF K1V9vtRPh "hl3K Kthl3j "$ 9̓>t9߁^_[]áKtPjt$t$Kuù2WVIAfF=K|CK)fK5KjQhKKu5KF1KPVQ! =KFK^_ù2Qht"~8u"h"h"5Kh"hĆ3j芎WVjh21t)h `t 8@ W^_VK Kt7#K=@u%o>K KtK!=@t^USWV$$$ $jhWV<^,KtE1M1 tmjWVS$8jWVS$8t$She|%hVܔVm$ KU Rh5KDžtGh%PotShF"hĆ3肘 5KDžtGhA#PntShn"hĆ3D 5K[Nj5K1jPP6,_+^^$DOGrhPD$Ph"hĆ3֗:hPt$V' $(j7V@ Ku D5KNj5Kj1PP6^+^^X^_[]SWV׉1jPP1R^+FF9tX\$)yWh1"hĆ3 %؉jQP6^~tF hP6 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFh\%Pl;-@KDKrv=KtUh"hĆ32 \GP1=Kt:Ph"hĆ3 %1=KthĆ3jjh"F1^_[]USWVD$$PGD$x/@th\%Q1ƀ81Mbi)KH1ًP1 t KP RVi5KAt\G9uGSVPj t5KDžu*h\%D$PPtƀ8MbE^_[]USWVt$!M1 tFjhRW|Y,Kt(E1M1 tm`ƋU R^_[]ËD$0H=(USWVX=Kthl3jj&h"EK D$(PW0=Kt t$Lt$Dt$Pt$PhY%W#K t$LW:c5KjLjD$P?K@ @h2h" hĆ3jj h"6B~ 4$4%5KeHu0>Ć3Phz"V h2h"V Vjj)hP"Ae^_[]h2h"U Ć31CWSjh"#h2h"0 Ć31CWSjh"wAWSjh"+USWV$ $$jhUV5UKtC1K1 tWUVh|"{E1hhW $ KS RK0Nj[~Xl$9|VUWs =KuVUt$ Wq4$f1@=Ć3Wh"V= VEs0=Ph#V 1^_[]þĆ350K5K5Kh"V|s0<Ph":Ć350K5K5Kh"V討@s0<Ph#V芎 jSWVt$|$jhVWcS K1tQ1Y1 t ȃ^_[V'=2#t12PPV Vͬ=2#t12PPV V詬^USWV|$\$1 tI;@KDKs9- L LQPWSRDtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;5@KDKrWVh "B  L LQPWV2R t߉^_[]USWV|$u h;">W^ Lu`Ɖˋ-KU DžuhE"z>-K)ً L9w؉9vlj< L|$ LWSN^_[]USWV։ϋ\$ t;=@KDKrVWh "= - L LQPVWfM{s LK$\=Kt%[$tC1K 1 uh:"S9^_[]SWVt$f~th"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh "V)99tt79uNH4~^ SW FtPh"V8.>W\ L L LF$5 L^_[ËAP 9ttЋR9uIHËIH hI"Qt8Vt$V[ L L^SWV|$t$Åuh*"V,8;^ty^C Fs j/WLGSD[ L LW W[FV86P\1ɅF fN^_[USWVd=Kthl3jjh`"7=Ktd|$xh@$WTƅu0vj03Phz"hĆ3輅 Wh{";t$ f DK@K1؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6P6vuݡDK$@K؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wp5[uDK$5@KL$T$9΋$D 1$T$| L~L1\$ L tAD$t$ jjS4G L9|͋ DK $5@KT$|L$<q$Q AiKKQA HKLKQAKA$t$ Vjj(Q4F @t3h0j1Ph"hĆ3c t$xh"8VWh^_[]USWV$=Kthl3jjh"4e1PPU Džy0g00Ph{"hĆ3ׂ Uh"88D$,PWCy0Og00Ph9"hĆ3蕂 UhC"7$jSƅu he"7SVW$ xD$j(PW y0f0!0Ph"hĆ3 Uh"{7WKRrD$l$K=K,$1Չ1 9$hĆ3jjh"jj5DK5@KO LjP Lu h"6PjPh%HĨ^_[]fKD$L$ KKD$L$ LKHK=Ku t$(6t$pPh"S6D$ L$$ DK@KL$T$  L<) L؅~ڋt=KtPWh#hl3Tc =dL LLhQV LL^_[]tK PUh#k s-LhhLU~ tG0Ph #hĆ3b j@WUSWVE0KfKK KD$#hĆ3U j>JUSWV$$=Kt$h#hl3~U Z$ $(މ4$9{CKQPh"hl$U%Q=Kt CU342h #hl3TtUCKQB+{))σ5#WRL$ QP$(CKQB3{))σ4$U#WRL$ QP$,/BCKQB;k))΃D#Vt$RL$ QP$,t%=K$(tqUhf#hl3S \{$(u0jhv#D$ PP tFjh#D$ P8 tk=Kthl3jjh#9(jtzwC@#P$.+6C@#P$*C@#Pj$$)!C@#Pj$$!* u_{C@#Pj$$i)!C@#Pj$$) =KJ=Kt&dp#;$ t#Ph#hl3R =Kthl3j ^^_[]!3SWV|$t$=KtLWVhLP =KuWV5LD t^_[Ë5K=K0K160~PSWVh#hĆ3tQjESWVt$=KtLVt$hLP =KujjV5L<!ƒt^_[Ë5K=K0K50PSWVh#hĆ3PjpEVs4KtufKVVVC ^PD$L$ $QPhĆ3T Xn?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=KuhVTx=KtWV|$ =Ku1VVhWMx!1F=Kt8Wh` #hl3I #.0PWh8 #hĆ3I^_Vt$~tht #V.FσfFVqƃ=Ku V\x=Kt8Vh #hl3lI #.0OPVh #hĆ3GI^WVt$ ;5@K|$DKs(WV=t xt@u;5@KΉ^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$1x Lt L|NILt LFt,ht L=ǀt L|REMǀx LOVEDƀ| LF t,ht L ǀt L|TMPǀx LNAMEƀ| LFt,ht Lǀt L|EXTǀx LRACTƀ| LFt"ht Lǀt L|NEWƀx LFt$ht Lǀt L|KEEfǀx LPF@t(ht L_ǀt L|EXIǀx LSTEDƀ| Lu L^WVt$ V蜱1t%t 4KP 9щrVh#hĆ30G 1^_SWV|$Ć3Wh#SG SePKHQP~ Q1 P tPKHQP~ Q Pj t PK@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#|$LS ^_[USWVӉ΋|$-x$LR PSUҍ S9u ^_[]j\=|$Lun#/#j|$LSWV t$t$4h2#jV=#jfƅ~'|$01ۍ)QP5x$Lx ~9߉ ^_[jUSWV t$4|$8\$Wh7#jSj=-x$LSPSU WV5x$LЌ 1B% ^_[]SWV Ӊύt$sKt$ tVWh5#0 |$Wl%01HFu|$L Vjj(hy#4(&$&h@#hĆ3> uhĆ3jj'h#,&(&h@#hĆ3= u1FhĆ3Vj0h#V=2|$ujhU 5(L u*h7#jkSWV |$t$ >h#Wt9h o%Wt'\$j SW賺 $ 9uy6hD#U$~h#Wt@h o%Wrt.\$j SW^ D$ 9uyvhW#j}D$PhU5(L u ^_[2hg#jsSWV |$t$ >h#Wt9h o%Wt'\$j SW軹 $ 9uy6hD#U$~h#Wt@h o%Wzt.\$j SWf D$ 9uyvhW#j腺D$PhU5(L u ^_[:hs#j{USWVh$(1hWD$ P3 |$ |$ D$~P1ۈD$$,,jUhg" tjUh|# tG99ufD$u\$ tR$,4jVh!% EjVh#h 4jVh#P 5\$ D$7f@jh0uht$Vj P5(LD$^ރ9tD$j@h#P' ߉tD$PDaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VlD defDectsDuVIjh#Pt V5(L5(L5(L5$Lh#6Et2tR}jh#V H}j1hx#V #}jIh/#V t6Wh"6Sh׬$6UփOut$ h#g^_[]1h]#jUSWV}\$j S5(LO D$t"NuD$Hj@PjSPh#j譶$j$Vjj5(LrF=tPh#5D$D$ D$$fD$t$j VE 0; 9 1L$81qAQQ a A j QV5(L-D$t$ *jh#E p   D$ @L$jhtjPjQ5(Lh#64hl3)D$t$H1D$`D$L'Ƅ$0VhQ`5(Ly $j D$tPS_ |$'y9D$(ȋL$;0&|"@D$Ph#3hl3j vD$$<JD$ D$ L$jhtjPjQ5(L~e^_[]ÄtH<t<u'5$Lh3# 5$LhN#hĆ35 P5$Lha#hĆ35h#2h&#jSE 0h#`USWV $ ~($ 1j4h#  ?C9u1CCJt$LUPV CJjh'UVjS5(L~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5(L5(L5(L5$Lh#1 vL$D$$jh'hVjS5(LFfȁw$VhU? VhU. ƅtL$D$jh'h$PjS5(L]$f1Ɂw$PUhWh#bWh#0vL$D$jh'h$PjS5(L$f1Ɂwh#Gbt$ t$ 1؃;D$ D$4ƜF>|$Ń &hj\&hAx%/ ~y)L$"dp#t>"RPh#+ $LD$tdp#VPh#+ $L|$ >"ydp#QPh #+,^USWV t$4}ty|$8h#St:hx0#St,h@$Sxth/"Sft '1̓uha$w=tR1ۉjVjj5(L7 f ?F$ȈFfFF PVQ5(LY 0^_[]Ã|$ u(1AA5Ph'PPjQ5(L$V(|$0D$40,uiб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P5(LD^SV|$$jVjj5(L^$LtB>">"@tdp#QPhY#z) $Lydp#VPh#]) Ph2#M)$L|$ >"ydp#QPh#()$^[`USWVt$,}ty|$0h#St:hx0#St,h@$Sth/"St '1@̓uha$wt1ۉjVjj5(Lf ?F$?ȈFF PVQ5(L(^_[]USWVhXƋD$(1|$|$ |$ D$D$~{ŋD$,Sh# tMSh#t?Sh o%t1jD$PSu. L$9=r1D$G9uD$@@ jh0uhVj P5(Lȉ$=r%ht$5$Lh'#2'$<$r],$1D L Tl| D  PW5$LhE#&C9$uVj^_[]ËD$,4h #jh#D$Ph#&VD$P H PpRQh#U& tVh#B&^h#X^VD$P H PpRQh#% tVh#%^h#W^USWV$Gh4&VL Vh5#% r[hG#%O yj hW#s%O,@tPhl#X%O, tPh|#=%GȅtPh#&%GȅtPPh#% O W hVbVh#$GtPh#$$hVjWƅtVh#$j #t)$1@9}$݀KAL$A1#tdp#h,L5,LPh1#SMY|@h,L PhE1#S! zGh0#Ph0#j9<|/iĹdp#D$4SPVPb ljӉT$tD$p!Ѓ8"0PPVh&1<==.L1$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R[A1OD$D$1D$ D$j=Q詯D$ tOAL$ \$ hk#Vt=j,SnAL$D$"hk#V21۰D$t$h%Vh.=#VNh}\&Vvgh-$V`h%q&VJ.hM$V4c |$$i \$ Ct$ɍQw1$d&>a΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PS D$ D$ 938*f8\$ L$ D$D$W|$hE #SDh&S;he&S7h|#S3hi=#S'hn=#SD$t$ |$@t1ɉQD$PS D$D$ 9؋t$8?8|$!1ɉQD$PS L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh.L4t2hl@#v 1<==.L ڍt$81 D$ \$phjSh.LPVT$R装$1BD$L4JD4`L$p$QRSRPV@.L .Lu1$Pv`$w &Qh.Lh?#  .L1<=4 j=V肪9=.L j=VbT$81 D$ t$ hjVh.LPRW耄\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$h.LhS@#D$49t 8Vh@#S1JD$ $$Qh@?#,=.LD$t$=.L$D$D$,D$\$(VGC@D$p9Vh@#0ԦPt$h?#|$oQh\?#=.LD$WSt$hH=#VD$ 81ҸD$ |$\$ Cj"$P{ÍD$pWVPSt$ $Pg\$ E $.Ljt$tS7 $.LjWV# -r0迥Ph.Lh6@# B.L .L$Ph.Lh&D$ $u1@t$2|$ Qh>#(11G|$1\$ tpupth#QݍD$ t$D$t1@L$ ɉ%t.=#PQ^Q|$t V8t1j t$ 變4$`St$h=#FQt$h=#7.l2m2L$ L$ ف$K{8P|$W*D$ t@j QS! D$ ;$|$8tQtUL$4 T$hjRh.LQWt$> l2T$ gL$4D$ .L1ɍAD$4tT8`T$ Q$QRQPW̠c.L .LT$Jv`$w&Pt$h?#t$L$ $d$ r $3 $tu¸|#tn=#PQh?#|$D$u |$u |$TF1@]%t.=#Pt$h =#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qhu?#0Pt$h?#|$L$lj% L$St$h=#{D$$P&;1ɉQD$PS  L$ 9t 9St$h=>#,D$ D$ D$D$0L$0RPQt$,t$$P胞tBD$tUtsD$ |$.LjVPM D$h|$t}811FD$&|$.LVVP  D$'$D$8|$.LjVP D$p.LjVP UD$1=.LD$44$Vt$h=# Ph5=#=.Lhe^_[]4$h>#ًt$D$t$$t$S@9s Vt$h|># Su@D$t$|81ɉQD$PSHS T$tD$pD$ 9t8u 8 St$h>#Qh>#1ɉQD$PS ƋD$ 9t8t}St$h^>#St$hu=#D$t$։D$L$8`OGL$0d$ rxL$D$nT$;L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h<# j8j-蕝Ph.Lh<# h<#h?#h@#h.Lh4#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS1Ht$L$ltT$d;WuT$h;W(u Qr ŃtD$ppPUu D$DGXHr PfoXd^_[]USWV$l2h0L8.Lt h0L/i0LSh.LtW.Lމ)ˉESQ|$ W DWh0LV IVfǀh0L/SUu.LUhh0LH,^_[]USWVhT$D$5#&1Chh0L1D$ CL$;rjt$V ufD$jD$Pjhh0LVt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPhWt$hg5#|$$j@WVPKWt$hw5#jgkWVPt$=h2Ph"W .Lt5.LPh;#5h2fD$$PV5h2O .L^_V΅tOHw;s1.L .Lte0Ph.Lh<#M Atʡ.L .Lt"x0řPh.Lh& u =.Lt^j5USWV=.Lˋ}.L .L t u tthl3jVuQ}ti=.L|}t j MO؃thD$VuP t$UtuRh"({5p2RhAx% bD$VuP虢 tMD$PVh&<# D$VuPf t+t$ t$ Vh-<#]D$ s*P? D$L$ r!QPhA$ rD$rIPhfp#QPhx$xt$h3L$K}u h6<#8j Oe^_[]PhK&USWVP=.Lu(ˋl$ D$$|$5.L .L t u^_[]Åtthl3jt$Wd܅.L| t j $^_[]uCuWt$h"t K4$~DN1ۅtPh#Rt#=.LuPhM<#39t.LC뿃u,h6<#'t+ORh"tct =.L9$$D$.L .LtT1΋$PjU$h:#1Ʌ7_l$ 11΍L$AAQUR9D$L$PUh ;#jdQ&$WPUV to.L .Lt$jjPDH1L$AAQ\$S8D$|$PSh ;#jdW$jPW Ā^_[]USWVP\$(|$$1PPUPSWŇ$P_1PPUVSW莇tu=.Lu5p2t$hAx%y $ $ r/1۸dp#WwwPh1;#HC #;$rj P1A1AyVo^_[]Ph;#jZUWV0EMT$1|$ VVRWQP迆t0M|$.L .LtT$ jj1Ay=.LuQh"y1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$>;#e^_]QhM9#j`YUSWV@$ @=.Lt Z$ Vbƍ$ h jU$ h %V6 t}1ۍ|$1E躾SWV0 L$99=z  h %j5ƅu$ 11L$RUPQ$8@$8@tIt =.L$,@$@.L .Lt.1T$Ph X1Ʌ1ۅÍL$MPҭ$@SPUB U$@ltW.L .Lt$ jh V0$ PhjPS Sl@^_[]8"tD$9t 8uVhl;#Vh[;#jWhN;#h׬$j4WUSWV \$0|$,1PPUPSWv)4$[1PPUVSWH=.Lut$ h"5>rt51t ttt ttth;# 9uЋkT ;$tl  1L$D$Sjh" {t+1:LtPh;# G,;{r܃TD$@TL$9uj Vk1A ^_[]h.Lh;#+USWV }=.Lt D$ toh;#Wtc&1ɉt$QVW68 T$$9t8u8,Wuh;# =.Lj11CL$ t$PSQVuuMtWt =.L1=.Lu?=.Lu6L$1J1ыT$1 u#MUPj h;#1ɅRaMUPjV tK=.Lu-=.Lu$1H3$3|$ uMUjj h;#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh;#SUh#S t9Vh4$Euuhdp#\Ɖ$t^_[]h;#h;#j-Sh;#h;#USWV\։ύD$ jPj P 1u0D$F|fD$Y|Uh;<#j D$ P$L$D$ L$/Ph#j D$ P[ $fL 3/LA .sD$ L<u\$ SjPj SR E9[|$ t D$ PVh@<#d^_[]WVth΋u\~8tU~4~`N4F8 I9rPg1F0F4F8FXHr PfFX^_fUSWV\$3L3LhnA#sP\su 3L躵hq"Pu 3Lj3LJmx &蹶'?c.53L芓hq"P虨u mL=mLyA#t$\#l$PKrt Pu|Qߋ<-t<+u{uNh` &StGSM16kh~A#q3Lt8u)hA#q3LPqt 3L#hA#}q3LPqt 3LA#1=3LtjhA#~FP7֛j觛N=3Lu0j_`ujjB=3Lt!=nLu=3LujhA# C1FVV7=mLuhE#503覦u\~jhA#B jM5mLf:0BuK@3L3L!Ѓt4LnL3LBzu=nLt0譚|nLjS=XnLu T3L=LsL~jh B#u j j 6GWVt$ y53L53L3Lut[<|=nLt=3Lt|2'V1Wu=WSBVHWV|$ Wl@jP[tWP ^_t$t$[tjh#B#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@93L<3LU5{L赎=4Lu 3L4LU(=v====,=XAf2 3Li 4L4L4LF=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff ftTD$ 4LD$L$d$ 4L 4LD$D$fD$ D$5{L%Pj5{Lb 3L,^_[]VPhht@jN t1h?B#ktP^$t$uչ%~4Lh:B#rkt(P # 4L 4L2 4L 4Lu.hJB#!kt P#Tƅ~54LhEB#jtP# 4L 4L 4L 4LP^V[tPX=H@Lt1H V^PL$$ 4L1Qw$&RB#M(uMf 4L xUB#4XB#+[B#"^B#aB#dB#gB#=YÉjB#/uf 4LmB#uf 4L 4LWV׉vu1=H@Lu WV7^_SWVPhpB#iPi1Ʌ 2h%uiM&tH@LQhH4LtH@LB#tH@LVy n)#L@LB#P@LB#T@Lo=&X@LK#\@LB#|`@Lq"yd@Lh@Ll@Lp@Lt@Lx@L|@L@L~ nLHB#t @LB#!B#t @L=nLt8=3Lu/B#@LR&@L=@Lu @L1@Ldp#u @Ldp#[$@Lt8u3L@Ldp#⹵Q&q@L=X@Ltt8u3L@Ldp##q#:@Lt8u3L@L8%B# @Lt 8t1@ @Ldp#1@Ldp#B#]%VWWh@Lh@Lq)#u&V5@L5@Lh@Lh@LHP#N%V5@L5@Lh@Lh@LA&N%V5@L5@Lh@Lh@L#;tlj=@L #m@L0&}#dp#dp#tơ@L8t,<$1QQPȧ PW<$W@$hB#@L⹤%=2dp#udp#udp#@L8t2<$ 4LIQjPL PWR<$Wv@$3#S>@L # tÉ@L#dp#tƹ"=T@Ludp#t‰hdp#Ɖ5@L>u KL^_[É$@Lz8{lV t<0 1=H@Lu Vq^USWV׋t$$\$l$;Et*+u(N%dp#t D$ L$M^_[]USWVր9tMτtC1@L U54LW贠 @L1@LU54LV藠 ;@L|ut$3L^_[]Ë @L4LUSWVL $։ύl$ D$?hB#W)?SWUz D hVU $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$rxt$4hVWb L^_[]Ë @L4LV=nLt =3L=XnLuF @L4L@L8t!@L8t=`@Lu @L1B3L=\nLu @L4Lb=nLt @L4LH@L=nLt!=4L|1Fj 2F;54L|^Ë @L1B^ @L1B @L1B=@Lug=nLt =3LuN=nLt @L4L=\nLu @L4L=XnLu @L4L@LÃ=3L"@LË @L1BY @L4LHt$j5@L蕢 1B)=mLtË @L9t4L =mLjË @L4L @L1BV=|nL@Lt@L1B5@Lt-F=X@L@Lt@L1BV^Ã=X@L@Lt@L1B^_%@Lt @L1B>@Lt @L1B'@Lt @L1B@Lt @L1B@LWVD$ #=$2 lj Ƌ @Lj" @Lj @Lj=nLttV$ @Lj5@L^_WV|$ 1Ʌ<+u OL$ GW躒-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%V蘒trL$PQV t4uRL$xB# $x2P B#T$x B#$x C#w^1JB#^aD$# $2  @L9uVD$ T$5$2! щ щ! ‰ 19^Ã=2thB#Ë @L1BSWV@΃=2tt@LtVsCtx1Cj S*VGVVSP_GVhs%P4 @L=@L!VhB#j@WRWZ@^_[ËD$@LWV92t#֍|$RQjW1B$52^_ÃwD&ÉfUSWVPt$ P!уtRPtt jhC#jh#C#l$$\$|$Q t^tY9uE}㽙 u yՃt(ˉ $19u tC ;$u~2KՃujhkC#t jh:C#jhQC#D ^_[]1ۅs IQRP踒fVt$t=2tjhC#52^á2xy=@LuE AL0@#4@u.@LjhC#?t {Lt2Pm253LRL3LV1N=ALt9t/ AL,@wB$@(@1҉,@Ɖ^USWV=2AL@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhC#1@$qQ52 9D$}AL럃^_[]USWV-AL1|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5{L(AL@9@S AL1JЅt8=ALu/@u1u0@4@ '[WVAL1t[@t @4v AL4@0@{!уt RPF1G)t {Lt^_USWVALt>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHAL9t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë ALt$@(@ ,@1HUSWV5AL1H(@$@9t#H1ًP1 u,@;Hs DtOOHOAL5ALwx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhC# KL1H^_[]USWVALti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áAL@u1I4@0@Ë9t1JQQ 9u@o AL4@0@1@@(@$@,@PPP@'v!ƒtjhC#81PPjt$u!1WVAL0@4@!΃t@@9} 0@4@^_SV\$t$ 5|3L({ALh8@jAL@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV u!ƒtAL AL@P5|3LvzAL@u@^[SV5AL@  ˀuH9tPQP PAdž @vv Hu5AL@uE u@C5ALdž@tV#A1ALP5|3Ly^[áALt@1fWV|$t$ t=ALttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV\tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hdp#jVhH#lLhtBLhBLhBLhBL\$ -uF :tjhI#]jNbt'.t5BLbt0:wtptcu+BLF&jShtBL BLjSQ ,uFtBLlBLxBLpBLBLdBLBLhBLBL\BLBL`BLBLTBLBLXBLhH#J1tPhH#J1F$2VhH#Wh ALP(hH#dJVhH#WhALP ^_[hH#>JPJj3T1B thH#Jƅu&hH#IƅuhH#Iƅt]h@$V裟u6hC#V葟u$hG#Vuh G#Vmt1BC#w1 3TA ruƀALƀALƀAL@=u=ALD$ALSVt$ TBLM1ۅuDdBL;1Cu12(u!= nLu2 1ۅÉ^[D$ALËL$=r!=ALtP5 ALj hBL 'ALu BLBLuBLESCBLÃw@ALuQhH#VPt$ u 4BLESCuw ALu;Vt V5ALB$4BLxPV@,@ALuPhH#V5 ALj h4BL74BL^WVD$L$ =AL=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=ALt'~3P19wKS>~-19s2C,9r9v)CK$SUruF8AUZ0VQ0o ɋl$u9tSv rt1|$jjSOF ~.EFE0uE^_[]VJLt";T2t1FVhBLP/ JLp^USWV\$,=ALtVJLtgفuHJLJ JLJL19*QhJL~-JL5JL1E4JLJJLJL1EJL=JLu JL JL1҅; <2t҉օt1PS;H*$&=JL+"JLШu*%=tS JL1JL]^_[]Ét$JL5JL 2yJLBL)É 2n1|$ l9} SWhBLo uԉndp#tJLBLVW3=JL=BL5* JL8u!e0JLJLtPb-JL%MD$Pm-JLE˨ -JLEJL JL? ǃJL^_[]JL] vJLeJLJL=BLv!x ux ;|JL=BLw%JLJL< t JL8 tJLJL JLJLB5JLaJLJL8r JLJL=BLwx u JL=BL\x tQ JL=BL.uD$ L$PjQ课 $T$e^_]Ë JL1; JL|BLáJLt @@@ 1141PPUSWV=3L׉΋$$L$ D$1AyōD$PUc#D$=xhx0#UU&W$ShU` 0jhI#U ShU1 D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU0 Se1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3Lo=82u=h2u =lhLP1TAPSe@PjVP W2e|8QZtQL8h@$WŐÉ4$pu1ND$PV+Qx#D$ =uhVhtI#a0tPƅdո(2Ex uָX2Fx uhI#h#S诏 T$Z6VUhI#S:Sc4$VWWs#Vj#Ā^_[]SWVhI#/P/tt;^_[&hE#Ve1ۅt+he%VetV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%I#+I#Qh#P tWhI#vj Y=82t"hI#h#vJ V(2=h2t%hI#h#v VX2^_[^_[USWVPӋl$D$ $uSPbSS1tD$ t}t8^_[]StV믉hBLjPN SPuSqWVJL8L$ ƋJL 4L9}I9uJLxtWD$JL$JLVJL8t,t$<$PD$JL8uڃ^_SWV BLJL$ 4L+ JL|51ۉ|$8tZO\$4L+JL$9|Ӏ8t-t$|$D$|$D$$8u$BL)ȣJL5JL^V^_[V5JLBLtRJL)Ɗ 0@u 25JLA=JLBL"JL=BL 1@^À=BLt8JLJL 25JLJL1@áJL8t AUSWVPQ_$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhI#O+hI#@+VhI#P@ Åt^_[]jhI#Wz@ t VhI#Pe@ UuhI#*VhI#P:@ ÅuVhI#W%@ WV9G t'փtPhI#V6 G?G uG^_ÐJLi ËD$u5Ã<3PhI#USWVD-3LÅE\$9uz$1ۀ|tisljDDs9u>rjjx JLJL$t,tV#hj:} ={LTeuYÃ={Le4΃eJL~o6/=KLu #=0KL t t =^=KL;0KLCt}.CЃ jS&ed~hKL KLKL=JLt JL5=JLu!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=JLiJLihV%jjS\Fc`$4&=3L %t#-l25JL=ES[jUY  xSJLH݃t =nL-JL>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5JL hK#9 4L93L94L=KLSKLC1Ƀ 8KL,KLῃ5KL5KLJL/U]VsWWr!2@*=3L%JLJL7nLJLh"#jj,KL0KLn=3L 5T2JL }hJ#JL _gh%y1PPvnL1; KLJL KLHKLKL/=3L JL%hK#1PP9 4L93L94L؉ك u. u.S莍i1KL5l2JL%aih%{jVy,KL0KL PZw JL *,KLуBЃ@*? !1҃ ƒ!D$Z=KL,9 4Lt 93Lh 94LW jh_K#j#t$(V{OVrlp1BsRtM&=3L=JL73JLЩuJLMj5<2ùe={LIv_*-t%+q1҃¹) ,KL0KLS\B D$t1< 8KLD$ D$ PD$PD$ P萪 KLtjD$D$-<{|Q<`ʃ=8KLtR D$HL$@븃@,KL|$ ^s 8eBJLemhJ#1PPL!ùe9 4Le93Le94Le e 1?PS1FP@/,KLPhdp#58KL5KL虤 1;5KLKL|KLKLn蔰VVA 1;KLKL  KLKL|3L'M1PP53L =nL 4KL t|7ػT 1;KLKL|KLKL蛻=dnLKLu' KL|5KL5KLPKL1QQm1;KLKL KLKL|3L|C=dnLu5KL5KLP1PP53LA KLKL1҉3P5LnL1;KL KL|KLKLLnL聺觮5KL5KLDT5LnLJJLNVhJ#h1PP5 ùe9 4Le93Le94Le e /йSE*re|褹ʭOLKL1OL nL KL nL nL $KLnLhA#CjjhkJ#KL݋5KL1ɸd9 jhJ#=|3Lt>t5KLOL KL nL$KLnLj)eD$t Pj{@eJr蘬 L$Qh׬$1;KLKL|KLKL)O=dnLKLu' KL|5KL5KLzMKLjjP1;KLKL|KLKL跷ݫjj蟷ūD$<3D$PhI#=3LjhJ#VR KLKLHnL KLKLHnLKL1ɉ KL|KLKL1@Pe(ejhJ#e1;KLKL|YKLKL 諶Ѫ=dnLu5KL5KLLjj- KLKLʃEݣhnLc KLKLhnL(KL  (KL1; KLJL KL|KLKLq j5<2?KL15(KL"5(KL1;KL JLKL|KLKL j5<2RCiKL1D5(KL=dnLt5KL5KLJ1=W KLiKLme5|3LV?P/V$KL1ɉ KL|KLKL1@PuGjhJ#KL1ɉ KL|KLKL1@Pk 2V_e!ֹe5LnLRPyJ1A诳է KLKL1҉AQPcMOLNnOLJL>X`hJ#r1PP?ùe9 4Le93Le94Le e S賁+̲1PP5nLn豲צ1PP5nLjP#'KLKLؽy蟦=dnLt5KL5KLGjj5KLd:0ؔKLKL艽*Pjj5KL9; eS贔D$D$PhIK#{豱ӡKL1ɉ KL|KLKL1@P"etbt3tFu j11A; KLKLxJ#|dp#L$QhJ#11%KL1ɉ KL|KLKL1@P'"e11A; KLKLxJ#|dp#L$QhJ#je5|3L<hE#PF5|3L1=tjh@J#o5l2JLnvh%1SVUh蠻Ag53LrSPx]hnL 4L݉KL KLOL9‰}KL5KL)‰OLKLehnL 4LKL KLOLKLi1KLKL15LnLQPHFjhJ#H3D$Ph1K#d ։u=KLtKL KLKLe,5KL5KLtI~V8Jjh%J#bUSWVP趮ܢGVD$1Ƀɉlj щ $OL OLAL={LuH9ljD$u21xUUjn6 9-{Lu;= OL$OLD$tAL {L2t8teue^_[]USWVPӉơJLuJL1 r4$0utV4$#JLJL1ESWPO áJL JL (KLtu1Fx` sKu j]j%u0SW5JL áJL JL (KLujhK#t 4$4$^_[]WV=2u=nLt =3Lu袬׮t 3L3L!ʃt]53LQYKLu =2uP5nL=ALnLALu _BLE5nL=AL1jPPB ^_SWV,KL߾%tE#JL/ V+=0KLu V@t hK#t u%%P1KLPP^_[V蛫ơJL"~S.#V$^%=3L1KLVPujhK#  tY>!t P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=nLÃB1ۃ=nLÃCɍH9 4L~Pj#|kKLSWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=nLÃB61ۃ=nLÃC%|$mu94L~HPj#jKL؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PN0V0ʼnP60D$X9vpG$11Ʌu2~>9sWt$V0 t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW/V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQot1=nLƃtEuG%t|QhN#hh.&AVh׬$6 Eu ?=u QhbN#$ u 覣!ƒtVHQh@N#^Ã=nLt$|3LtPP&t5|3LËD$t5|3LPF$1PUSWVu195|3LO|3Lt_jP%=|3LtJtWg%W"=3Lu"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =DnLuID$xAPt4D$8\$Ph4M#FًT$WVt$j 1@t=3LjWd$5|3Lt$V$t$5|3Lg$5|3L$h3L5|3L#3Lt$ t$ ۨnL=nL111{LD$4PD$,$jUuWPNW( Uڃ,$C^_[]SVt$ hE#Va1Ct'hA#VLthL#V:1ۅÉ^[WV$ VtVWVtWt^_USWV 1=pnL]=3LPj\hbJ#1Ƌ|$ 11@L|uM@-u)FhE#W{)1%tuQ%t s@AAۃ\$WVcWX؃D$jPtWVt$Ps>Ww "Se 1tXt^~u1O\$$D$jPW uQD$P4D$(0E#^jhN#4|1 ^_[]ÉOVq;t;V q1|$rɅuŋD$(L#1O;PrS USWV=3Lt^_[]j荈h*O#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh4O#U{PljD$UVWS\$,8jUHrS\$SVUP<4$ S \W Vo V|V$#N@ |^WV|$=DnLtaPW՟1=DnL#D$=W*jP`qWPgJhP2LPWtx#D$=@{WcjPqWPJh@2V諚 WoƉ|^_V|$PVOx D$XT$\1jPPVB|^UWV蒊lj5|3L# QP謞t1GL$ T$3KL3 KL1@ u,L$3 KL$3KL u!tL$\9|$X}e^_]øgO#Vt$VR9vHx/uAΉ^fVn KL1ы5KL1 u^ãKLKL=mLt^6~^P~SWV1ۃ=ALt^_[!ƒtj}!Ѓt111 1Ctj}1Ã=KLtKLUSWV-nL~ON}=nL~Q111SWuljӉ:}qF;5nL|؃=nL' =nL1=nL|=4L111;5nL| V|ljՉ!<$=nLFD$1;nLá4LD$ L@LD$OLD$$4L1L@LOLPPSUt$ ljՋD$ 4LD$L@LD$OL9pt$j pF1M4LH91Z{1@^_[]Vh 2F;5nLuj{ t j2^USWV\$,=KLtKL&|$$t$ l$4Lt  $9~ ,nL$x 9} H9$!tT=nLt lnLtCKL1҃=ALTRQPWV脘WV Ɖ1ND$(D$<$=nLt74LH9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=nLtzmz1@D$/1@D$=|2uu=2t hO#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 3Lt)!u =nLu=mLuKL=mLt XmKL9l$"4LHPj-|1Ot1E1=nL~1VV|{~ VVVD5 -ALt <$tw y|2j@ ^_[]USWV=KLtKL41=KLu!(nLy=nLt 4L'|$t$;D$||$$t D$94L~ =nLÉ!tF=nLt lnLt0KL,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=KLtá(nLy=nLt 4Lø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt4LHPjytm=ALtPay1u11FUvUVRPVjv!уu {Ltw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 4L~&111RP!уtF 4L9| 1 4L19^fVt$tsVGF95|3Lu#1=2tu1Ɂ2tщ |3LAF=2tH KLv v ^} ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12táKLUSWV\$S@Nj522tv WO 6W |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@KLVEESËnU9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P/ w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=OLjjPWV^_USWV,T$Dl$@ظBӃ=nLt  lnLt0KL @1)ʉ|ЉjSUQP虊كQP4v= nLtK uu|| t u+| t u{Ltt{L}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t{Lǃ݃ tkwRPW v=TnLt( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N OL CfN =OL=TnLti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1nLl$t$1E1!1M,^_[]Ã=lnLt׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhO#c^_[uƉס4LHPLi11 u^_[8iWV!Ӌ 4LIt*QRP4 4LHPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhQP#bKy1V[hVjRPUo=dnLjusj'hD$ jhD$T$l$ !Ѓtd9}\4LH94$SW!уRPvlj9Љ $A4LH $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$4L1VVjt$t$PY95dnL^_[]1K16-KL-KL4LH $)QUjSWP(1K[6=nLtf"g15KLSW=g4LHVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9KLS#>$4,$tt=t|<9KL|wC^w \$D$ShS#jW$4,$jS#f9KLu+9KL}9KLt9KLhu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuT#dp#6$4t$ t t_GS#dp#$40tUPtu!T#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVKL^_[]SWV׉Ή5KL5KLhS#hS=w )WVRQKLS^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl3 t^KLKLKLJtGtO GO KLKLl3 tKLuKL^_[]ÍZ w6$'tEGЃTZ$'btPeu>fKL랄tGOm><1#놃>3#w>j\&h>0&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]KLKLd   >KL KL KLKLKLRhS#jhKLS#KL_t>dp#vVh6T#MLP+t MLŐ"hGT#蹻MLPt MLXT#jVLMLjVLML5KLhtNLhNL1NLPҎ $uNL^1|$áNLNLSML1pNLNL MLML NLNL@NL;ML|1ۉNLNLNLNLNLNLNLNLNLNLNLNLNL1HNLNLhtNL#hNLNLP $uNL[USWV\$0l$,1=4nLuSUƉסlnL nLSU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| NL=lnLtU tNLpNLZpNLNLNLnL pNL9}QpNLƁNL NLك=4nLWV^! tt$j VRP)NVr1 nL)~$pNLr5pNLƂNL NLIu܅~+1ɊT 5pNL~=pNLNLNLA9uסpNLH pNLƀNL NLpNLNL^_[]Ë lnLt nL=4nLt1nL@V5MLNL9}9 ML<u"ML0PhtNL MLNLF9|Ӌ5ML5NLpNLNL^SWVt$\$u$D$0j?oP-/=ALt&v!Ss1҅ SVqt1҃Pn1҅t$StNL~- MLVt[uML NLLV3Zt NLt> MLVtV[t'i=ALtVs1҅ƒK1JFVY# x@L#p@L#5@L#d@L‰^_[QY# t@L#l@Lʉ# |@L#h@LáNLNLNLNLáNLNLNLNLËL$1wQ5ML1SVt$ 1ۃw)V5MLuV5MLs1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJqT#9u!B1@uDA;1A+u%uVt1@^ÃwV5MLu߸ع#L$1uj jE1ɉHH_ SWV=NL u|$t$\$t-1 |15OL5OLtm1@Z ugnLt  nLuU=NL~+ OL OL\@OLNLNL5OL=OL1NL=AL NL%=uaOLPOLOL19RhOLbmhOLmOL5 OL5OL OL OLH OLNLu"OLOLx,1WV=ALt OL1At^_[ÉШu-%=tS0lNL= OL5OL뢋 OL OLOLNLUSWVӋl$,|$(NL=@nL(OLuBu>%j jzC1҉PP(OLNLNLNLtwQPl'UWS (OLxtNLPhNL蔅1(OLNLu+nLt nLA\$l$͉=AL1؋5NLMLNLRk5NLUWS% 65(OL軤 (OLNLPV軄NL@NLVP诅V荄 NLAVUUUЍ@@NLNL OL9}ohtNL藅ơNL OLY$gQVlu&MLNLPjVPmNL$#5MLxNL9|NLl$ EVjUek L$ )v %uhNL蚃5(OLz (OL NL; ML 5ML|tq=ML0jf jML9u"_l$\$u4Шx$_l$\$u$5ML _ ‰$ u*nLt = nLuKuG ڃ^_[]ALm_uiud1UWjNL+pNL t3KL91J$;KL} qɉы4KL)t _ML\$ PjSi 1EL$ML) NLPjS`i ǡML NLtW4V)NL~ZNLt\ [5x3)Й)֋$F UWhV% N1NLE1-NL$_PdtUW ]ALt6=@nLt-QdtQd UWl $UWS t1@1^_[]SWV=OL~4։1OLPd VW u C;OL|1OL)^_[Ã=NL~ OL OLNL1WV=NL~ OL OLmNL|$t$ =NLuu 15OL5OLitb=nLtYNL4L9NL|NLNLNLNLA4L NLH9NL}nL j nLnLjf=nLNLtLNLtBx NL 4L9}; j,NLP NL 4L9}NLы NL 4L9|L=L@LtCP@L„u0=@nLt't4|$t- 1j1j 1j5NL95KL uML0ML^_V=@nLuajm5MLtMȺj9B#Fu=NLu"Ⱥj~T#Fu^SWV։ˋ=NLGNL9=KL uML8ML4D$ NL; NL~~ NLNLNL NL^_[SWVML NL9}1T$5MLׁtu Ӊ NL@9|^_[ËD$L$ NLNLVD$ L$=NLu=`nLttNI1҉ tK1GpNL9~NLNL+5ML)΋ ML ML0 ~^NLNLUSWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8{Lu/KLH9| Qu@ML8GO1H^_[]cS ML9t MLMtۉ>?SUSWV-KL\-jS jS DžtVtRU5MLV MLUPWj Un 5ML` 5ML=MLKL1t W= 1Gt V- ^_[]USWVL$D$ʃQPO1H…t$=KLMLD8OlV tn{Luc~ML>-KLu@ML (I=KL9rHŠIJML9s=KL)\8OVà uQL$ t MLt=KL91H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V襙 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15OL1KOL|EtESSP tOL@ԋ=NL9=KL uS1Hte1ɺ|3:tWAuN1|31I:t?@u21|31I:t%@u1|31I:t @u^ËL$H1Ʌx 3USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=@nLu1@$5NL+5NL~1; 4L^USWV։L$|$0\$,ЃtNL!t6tC؃T$RjQPWSQ=nL=NL1ۀ=NLtw4$NL NLىȺVUUUЍ@)INL~4,IŐNL1E 8Vt$0j* G;}|Cu4$SG NLtf $OL OL!Ƴttt$,9} 5 OL=$OLNL1ۃtQML NLT$ 1ۅ~&L$ PjQ\ NL~ML\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1ENL;OLuXNL#NLuD$,NL=NL=xNL~01tNL 8jG;=xNL|htNLtNL;NL~<$~NL NL NL$NL~1 ;j_G9uNL1;OLuD$PhtNLtNL ML9~~51ɋML4*1 ML444A; ML|١NL) $ NLNL NL; OL~(nL jNLHNL;OL؉^_[]WV|$t$ =@nLu1WVP PV WVt1@1^_Ð4OLH ȁgLr1gL4hL4OL8hLhLƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=4L~%GW8É!Ѓu O;=4L|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhP#20OL1111ۉu WVSU1PPWV+{Lu Ɖ!Ѓu0OL^_[]WVT$D$ =nLt 5nL1)|щƉ^_fUSWV t$ >-uF(s7h%+V+h<1#+艣D$1S6]+S)S\^SGSDjy WGh#À8t>tkV聪tmSʼnD$1$U% $ȃ$jP'袷t$PSh̿%t$U0t$1  Sa'Ņu>tVhq"F'U#UU jCWGWC1FVJ]V'D$$t*P*hT#y*/j ))3KLt$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhT#.1N\$h@$S4h%Q)SH)h<1#;)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhT#1KtL tGf;t=ËFHN~ ;F~à tQu VSpV"1Vj 1GWZWg%e1=KLVZ^_[]fSWV1phL1K4t 5u'#ar'G__ _Gt PΆ GF6u^_[ËL$ 1ɅV-$t:hmL'W.t7^uM|3LmL1mLmLmL|3L LnLlmL1xmLtmL |mLpmLt P pmLFu,~1S薺PW豺Fv詃 ^F~ ^v;|3Lt PNu VSWh ^_[ËL$t@;|3LtjhT#x)1HËA QUSWVD$T$1ɾ|hL=|3L9~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9mLu mLmLuUSWV\$SκƋmLt@PPVumLmLx DžmLWe u^_[]USWV=nL|$,t$0h#W$ l$mLmL!ʃtWj UQP"mLumL hE#VQtmLVUmLPh U#Wu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=4L9Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft Pހ  $FQF^_[]V=3Ltjh=U#&dt$D$tt/uKV3L;m?u7=2xCjhsU#뵃=2x%3LQhU#l&^jh_U#jhU#{Vơ3Lt P VޣP3LV 53L蛙 ^33LVD$$L$ t tC8.@L$$Vhe&Q 3>jhU#3xxPhU#j VCV||P|0tB D$0PhU#;D$$Vhe&P >t.jhU#1LnLL$QhU#$^ãLnL3V3x$ 4L1Vh@BVPRQ_LnL^VD$$L$ t tC8.@L$$Vh#Q 3>jh!V#3xxPhU#j V V||P|0tB D$0PhkV#;D$$Vh#P >t.jh9V#1hnLL$QhOV##^ãhnL3V3x$ 4L1Vh@BVPRQ&hnL^V|$u%t$jVt0PhV#N#^V|$u%t$jV؇t0PhV##^SWVD$L$tPmLp=3LtjhV#"VP>PR Zt V踘)X!ЃtV谕5LnLSW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t P{ VӟP03V{ 03QhV#!^V|$uJt$ =mLtVx3L-mLh\%_V_h@^^WVD$t t0t$XsLl7=tDMtGhuXF 3PnLXsLQh׬$5!Emtwt su!FF3F`sLF\sLF$37z V^_D$u57<wVȃ=nLutjhX#$FVPMy0PhX#^_ÉPhX#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;KL~KLA9s } uE9u9t},u E&| t3KL+KLx3 ^_[]WVD$Pt t*$TVPVLD$ps D$ stopD$Tab =t3|i1Gt$rV襷fD,V蕷4KLhfp#P{ G;=t3|ViD andD theDen t$VD5x3hY#P+ 0Ph׬$D^_à D$t t+uyL$tJQtQytWjh/Y#Mà$2L$%2AAD$PhSY#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh_$QVP46hE#Vt5>t nL $nL8nLtP9nLE#L$Qh]Y#O ^ËD$HsjhuY#/Åu 3LÃ|$u=nLD$u =nL~GTnLÃD$ u)=nL| PhY#nLÃD$ u)=nL| PhY#nLD$u"=nLt=|3Lt*!ƒÃD$ t t%uCD$ 3^u2@t+$3"3P7QhY#V D$,L$(t tC1ɉ nL nL8,uT@L$,t$Vh3$Ql >tejhZ#Ot$5nL5nLh2$jV80Ph.Z##t$D$,Vh3$P >tjhY#9 ^ãnLnLD$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GnL1 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$QhfZ#1QZSnL^[ÍD$PhKZ#҃=PnL=nL=nLË HnL1 4L+nLt$4Ph[#hmL mLUSWVl$,H mLt&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph[#hmL mLFVEŅ8D$EH$x'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=mLnAL$,9 ItIT$uWoD$,7mLj+o2Ph[#mLVR T$jV%D$,|$?+x3Lt Pcn GP x3LCE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt Wn |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhmLP mLImL^_[]É|$|$ u D$PhZ# D$PhZ#͉-mLōD$8PhyZ#uA0h[#j*hmLËI1Ph[#j*hmLUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph\#=j UQ xt-u)%tt0Ph[#1H^_[]SWV9toӉQ@jP ljtG\$=nLt <\u ~t F <$t)\tPSt GFFuD$Qh[#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$mLPh[#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hRn#3rtP~31@USWV\$(|$$1E=nLuhnL?nL{L9<$l$D$l$ =0} SLVA,jUVSh5#UP]^_[]Vt$VX} uVhbn#h%oL %oL^USWV D$0щL$l$ |$$t$4PWUOƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV]OՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SN׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPNÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWNi)$l$D$ ׋ $D$ՋD$1PPU\$SMыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP{Lt KLZ1@oLWP(t>1C4$$@oLu V WSCu ^_[S=HsLtHsL \$3=CsLr 3H 3DsL[V53DoLt(DoL3VP53 9t KL^Vt$53^Ã=HsLtHsLr Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVcيln#O u݃|$0xG-Wt$8* ^_[]USWV\$8T$0t$,11|$GUSRVيln#O u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$Fln#NuxF-VQn^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuV赚^_9Hw @sÃtP=USWVPt$|$LsLV<$=|nLuԇTh=d@L T#Vt$ P]Eu h@L48JMp;54L| KL^_[]VWj .^_[]ËL$T$dp#PPh}n# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuHsL^_[]WVt$|$ zt!3Phn#Phn#dp#PPh}n# ^_WV|$t$ t%WVra7ft=4L KL j Qu jF^_fUSWV\$l$=0nLu<؉%t1U1GWP?[PW1WPPUVd[1 jj1=3L1Ƀ={LHPVWs Åt!WV |$t8jhn#'D$ tPD$ 0V D$ 89t VV ^_[]Vt$tP҄6uV ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQU ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} 0nL@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø$_&fL$tt"u$ 4L4LHI 4LIPsLʋTUSWVD$T$ 4L5PsL|1Gll\G9uTD^_[]SWVD$L$54LPsL|F|\\|N B^_[á4L~Ph5PsL- USWV 4L; TsLPsLth!t 1G31K;)1G1I4:tl!GtˉPR  4LjQJƣPsL4LTsL~PhV膟 !t\l^_[]USWVPL$\$As 4L11H$(u4L1@$1PsL<#|tZPsL4ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$PsL1H; t$z|#=4L|O1;Ll |C9u^_[]USWV 4L~.PsL11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5PsLA1G1֋l9߻rB9u^_[]ËT$4L!х1A9Hhe'*XsL=mL't'P \sLh!'`sLh'3h' 3hT'$3USWV \$4d{LdsL|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$P'=4nLEQ-s4C$ىË $Fw$'#Fw}$'X!уj WRPBBtDt L=4nL!15|3LhE#Pt1sTu~-\$PuYQA tLу|=RP螽1 $1=d{LdsL7f1=OLu ÊCCs|,v, l,uȡ3L!ƒtظ:,u5|3L资j W5OLQTу 4L5nLn9|$ V5|3L5|3L蛅PtmƉVrM +1+5Q ic+Ɖ!уRPUVd{L=dsLH8 d{LH=dsLwA5|3LkP豄 !уRPaٹ nL 4LVQRPʋg 3L5|3L,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15|3LMj WP j W1P9<"@|dsLdp#9 d{Lt dsLdp# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5LnLQ^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5nL1=mLtȉt 3XsL0A3L^5$3'SWVQHNjd{Lعd{L9r Ѝd{LWVSe ;d{L;^_[VQ!уu$x 4LH9}FV!уtt^^Ð1h{Ll{Lp{Lx{LWV|$ =KLt5|{LtZ=@Lta=4L|<1W!уtRP虆Ws@G4LH9|vu|{L覍5|{L^_USWV 22D$L$!ȃ2D$2D$ 1H2222=@L=KLt4$=4L|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$4LH9|u $u^_[]Ã^_[]鍌^_[]Th{LK|$th{Lm={Lt1=|{L|{Lj jhn#"V΋At PF FVC^h{LSWVt$>t_w F WF ߅u1F FF1H{L{L{L{L^_[h{LSWVQ1u(\$|${LSt ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-{LVt;xH|p$x Hȅu^_SWV|$t$u;{LWt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=lnLuH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^{LU1tHt$ !t Q9y}1I(t(t$=nLtT$$1=|{Luȅt^_[]h{L|{L=nLtUWVjW7!t"j]jRPWV je^_]Ã=t{Lu 0nL{Lh{Ld p{LVj5<2t2h{LjVx 1F=nLu=|{Lu@11N^USWV(U ]1Nt$ t$tr:tm1h{LPSi( nL1 lnLt)1V5|{Lh{L nLlnLttxq @3p{L nLt =lnLtj)nLu=|{Lt|{L9|{LJ\$tP1ػ&!Ѓ1ojhn# Ft"WC@PjFWPn11H^_[]USWV׉Ρ4LD$@D$D4LD$<5LnLD$|$WVӃ=nLt)5nL9|FSVyljT$T$!уD$,Mu4$f΋M !΃ĉT$4|$|$0u L$4ED$0UD$)D$D$Pj@t$>SD$$PL$Qt$Tt$V>{L$u:{L {L!ƒt&9L$L$|D$;{LD${Lt$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d{LT$X/ t$9 t$ 9 \$(T$_CtN4$jjD$xP$Pt$4t$5l{L5h{L2$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$*9 V!9 T$1H#E t0E t L$PL$THD$$e^_[]Ã=nLu?h{LL$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ OLL$OLL$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$OL}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8OLKLt$7 t$ 7 }tEL$L$H1USWV8={L{L5{L{LD$$8u={Lu\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}{L {LȉT$!Ѓtsu!9t$ƄuY{L5{L;t$T$$|@Ut$ 9D$ЉʋD$4$KL@Eh{Lh{L}!KL @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># p{LL$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o={L{L!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$${L {L!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ {LD${LD$${LD$ {Le^_[]1JЋ4$|$9ωL$}@D$ KL I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd={L USWVt$h{LtH>tC\$1EjU1GGGUSxL{LG={L-5{Lt~'V2 u{LKL^_[]W1 USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5p{LjjSt$DPV5l{L5h{Ls$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@dLPh4|L2USWV T$(\$$t$ 1`3PURSR)ˉ<à uVh׬$|t$|$u u)u%u!1ɃtsQl3Phbq#G|t DhOr# ^_[]SWV \$ hShp## uP thq#ȭ ^_[xEhSh.p#o# 4$]t t$Mj Vh[f=3t'+\$|$f=|3ip#tp#WSP jh L5|L hLjj.(^_[]USWVP\$D$jP5L f=31=hL5l3jD$P5L W9=hLttػ1FU Php#uKtMVh|L5L- =hL5l3VD$P5L W|9=hLu^_[]WVjPhLhp#% t ^_h |LhLHrh$r#ы |Lu |LQ[hx0#PxtAf=3|Lp#tp#PQhW|sWhp#V \Whp#tLhN jYhLUSWV$t3J t3;3у  l3Ql3t$hVhp# 1GWh~z"5tLB WSsXWjhXhDLSjh, Wh L5LD x>j)Ɖ׉U芊~*9u$hl3QByEhjIƉ׉U誈~*9u$hl3QbwEht=|LVFPVW踽 1FVh<1#5|L衽 |$VW5L; ?nu53h1q#Eo ^_VPjPVhCq# t=Lu.5 3VyVhIq#nhQr#̠P^Vt$j5L¾VtVh]q#nhTr#芠EjeWV5,3t)>t$=LVEPVW裼 jj{VhVhkq# V3t$3jh_$5tL@ 3u3$3%3t$3t$3f=3t53t$$53f=<3T#t~"Pn3t$33hL3t$3j3t$$3f=3T#t~"P^WV,|$8V5L0h~"W*Ft! $#L $ LL1GVW5LJ% hLWj:%8^_WV,t$8W5L]0h~"VE1Ʌ#G OWj5L$8^_V1Vh{t 5L5 jïVhzt 5L5 ^S\$1ujP[ESWV|$\$1FtCWPt1^_[fUSWVl$$1$LLԀL%PhP3hs#t$4U11I~1L$$D$=hL8O>HЃ sX 4HЉ5ԀLjhP3hs#t$4U߃ufH1K$ 'U$L뷃EFUjh"S1C jh"SC h#SCD$QPuVUh6%SCh#S}Czh#SgC$_=lLU؁L1@D$<$XD$hL=LUj/S`Lk<$$YxD$ P1PhPjPP5U- ԀLL$ !P5Uh1t#QL@LL=UWz@*Sh%hL薚 1@1H1HD$1@$D$~1HD$$3)t5|$L$(4hY%VAt5؁LL@LLg VjLVjLVjLVjLpL5ԀLht#j VfV4$jhl3dN#wX 'P_ D$tu1=lL 1A111ɣ<3 333=hLt 3=Lt5ԀL uW6uB=Lu5ԀL u3^_[]xVhet#Hht#Aht#:ht#jX5ԀLht#!ht#hs#ht# hs#ht#j#hĆ3jj@ht#Pj]hĆ3jhh-u#0j]fUSWV,|$@h^ jJW^1ۅ|L=LhLU|u.j 1=LȍPU踵LjLx3=|Lu?jP| LteQyLUh׬$|LWŅ?1GVjI=|Lt1O,^_[]ÉVQ!)=LuL$ @Vj5L 1Vh t 5L. VjI1@|LjhLf{fWVP=Lt 5Lt$uhw#kƅhw#Tt8/u33w# P Vh3P %1 '9uQPt$ d 'uڃ=ԀLu%hԀLh8$t$ u ԀL%h/5LjVL$L58LL@L=ԀLu ԀL%u+t$PLt P V5ƣPL3h#V;4ts̃Lh#V4tah#V 4tShFH%V3teh6%V3t1Ć3Vh_y#WO] W̃L$11ɺ30 ߈PLBu^_[ñ1WV,|$8V5LWV薶WVܶ#NF=Lt L$f=3t D$#$d$d$ wfD$ f=<3t $Vj5LD8^_hLjj0 SVPf=3tjt$R 30utztD$=̀L„u30u1f=33몈D$< t< u>jV5Lz f=3t|$ 3#tdp#PԊ`u 2 <3tu 3tt A8u1f=3t 3DAt 3DAD$jV5L f=3D$PW/hLjj USWVt$D$ $1=Lh l j<D$1CSj<hLSW Vh׬$WhLntWD$ hLjjK t$j-<Uj"<=LuD$ 1;$ȃ^_[]Ët$$4$3H 3~3H 3h3/eȋL$ < U;t$ KD$ V1FVj;5Lh3#VhLXmSWVP3\$ x3t%ĀL39u Gt+t' u9tpD$jP5L Yـƀ_rȃL^?t@آɃLʃL ȃLɃLhȃLh׬$MVPW1^_[P3H 3~3H 3$3a.t1Ƀ=̃L!YXD$_rȃL^?<t@ ɃLʃL ȃLɃLȃLSWVT$L$D$=̃Lut1<1ЃL1F9uRQP蕣 y<8th%^_[hQy#USL$ \$1B1t 9tA8u[VL$ȂLtSA .y#8t6u(^@\VPtȃL)ƃuf^?݈@ȂL^VD$Ph9y#T=x3x3ĀLFt3_rȃL^?<t@ ɃLʃL ȃLɃLhȃLh>y#)T_rȃL^?<t@ ɃLʃL ȃLɃLF t*vPhȃLhBy#SĀL~ v 7^ÐWV1F LVW5L͡ VW5xL ^_USWVt$jV5xLۢ  uD$41؍oD<jV5xL貢 D$< t r֍,f=3tTLt P* u3D$y1D$h`%PUTLtD$y3D$nD$jP5Lߠ^_[]1f=33USWV1GWj6Wj6r VW6Vj6pLfCLCfC 1l$jjS跡 ~}D$tvjh L5pLw ~] LBt8StGWuG1GW LU5L WUl$5xL1 1f=33D$hU5L jSUƉ,<=̃L  A9rWD$Pjp f=3TLtyf=3~g|$_r5,3Pt. TLYSQ;Y~ڃ tZG9r QRbVl$!y-78u!PWjl$U)VTEh@LTjf=3tTLt PY'joGfSWV3t33^tPtF tFFu҉5 3hy#hWNhx0#WRtRVhW\] t4=ЀLtWhy#Oj W&tWV&%%3^_[USWV|$h o%Wt(j Wj=Wt@C@uShG%W%(u S6ÉXj?Wt0tO@t8JSw?!tOYt@t tWhy#vN~5=3t,3Ft = @t t~vuك=lL~h3#lL^_[]SWV΋lLC!w\ClL؋ t3Qt3; 3hl3j ySlL l3Ql3 XlL#|>W$أlLNI$ 'Who#hMlL@lLN Q1f~ @lLt3H t3t;3lhl3j!RllLv Why#L `Who#LlL@lLN tEPP$lLVl3H l3!6h׬$LlL#|lLh3#O~^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!ny#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhG%S$uW 1@WljR1^_[SWV31t8ϻ3WPH$t!CtWP3$t Cuމ^_[USWV׉A tS^؃H$ 'n tWU#tjPu U[ WF tQfB t thz#^|*N 1?!9~ t~ N 9tF N^_[]hz#fSWV,1f=3t h{#J|$Wh)}#wM+t%thz}#ZM|$ DL$ $ 4hW衻 uW$ 4h5#9ō$UhP tʼn-܅L=ЅLLhPUm Lu%t#P5܅Lh}#hLP&u5܅Lh}#؅LuG=Lty؅L,L=,LtV,LhЅLQ؅Lu7J$ ؅Lz$u+hЅLPu,؅L05܅Lh}#Z:u5܅Lh~#E=ԅLhj$$ tf dLu$ th~#hhLP)u$ th~##pL=$ D`LЅL5܅Lh#)>؅Ltpp 0h/# > ЅLuG`L#tt##pL#@tdp#QPhd#= LtPh#=ЅLuu+ ԅL0Au*h# ԅL # ԅL##hЅLu Vh##L=u#5LIu5܅Lh#55L衍u5܅Lh.# dLtPyu5`LhG#j3 ԅLAu$ th~#=@u5dL'dL$ th~#hw~#h2"h00USWVt[ׅtf΋ 't# 'tVP0t%]uWVh4#H j3ԅL^_[]h#h #hh##h #hh6~#oz!PPPhĂ#hĆ38>ԅLt@t hЅLЃj2D$t@0h#SH1hq#hf#hh6~#D$t@0h#H1hq#h#hh6~#D$t@0h#G1hq#h#hh6~#USWVhށ#G1j\&, 'QhAx%hĆ3= 't*tu6hĆ3jjh#hĆ3jjh#hĆ3jjh##t#FKrhĆ3j I^_[]USWV҆39u1Ht$Vhht@Pj V$PPftхu! $hQ#F 'tc D$j\& '0tBVؽ ;$ݸ#D$VPhAx%hĆ3;D$#uhĆ3h<1#^_[]fL$t11f3QBuh #h#jThă#WVD$ tRt$tX|$t3fPh$#8fPhG#8f1@^_hq#h#j` h #h#jahă#4USWV @$ @F~  ߃| RQh#%19ս|*Ձ tRQhT#D 1 @^_[]û l$ WWSUP艌9tmv h#ܶ$ =Ut%tv hÅ#v7hjU 1$ PPQÉ11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQP褙T$ L$D$19عPh#DCch Pv tOPSQh#C6$!u$!$!j?PQ t$h#BQ+PQhI#$ "u!$ "$ "hPQ t|h%#$ QRPht#]hq#h#h8Bh#h#h91hԄ#h#h: h#h#h;h#h#h<hu#$$j@P$!P Pt$$"P$$ Ѷxl$$ $8v+)t)+8uHJRQP t h#Í$  tL$(SUP  l$ 1rh$ US |4ōPUS < ߁WjPd N1\$ PPh; tB=NýjPU  98t 8ux8u2N1 T$ PPS 9ǃu8u8u<\$Shmdv t*hC#G#Wv hy#v hl#FN1 T$ UUPB ljl$ShmdvJ 91EUSWV$F~ 1jUWSP/9u!D$=жxt9wwF̓uv h#e v h#?ST$1uD1Gu<jUPSv聆9tu&v hl#hĈ#>1^_[]hPv h#>hq#h#h h#h#hhԄ#h#hhu#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUP s DD$st$s 8D$ s <D$tf4$l$4U ' t_uhS#=ho%h֬$hĆ33 'h0#hĆ32 uhĆ3j ? 'D$l$4$sf@8tD4$t$xVP@S`PSVEQ \$$Vt$SZK1D$0D$,D$(D$$d$sD$4j@HPI st$st$hƇ#{/t$h܇#j/t$h#Y/t$ h#H/t$th#7/L$9 't uQh # 'h#/|$4tD$4Ph##.|$ gvVD$PUw 16D$8uT$Bg)QPRё thz#;1@^_[]USWVӉ͋t$V觴 1Htkt$t$VSUtGU~t$t$VWU9uVSWO t'W Z W 1H^_[]W USWV$$$|G8-t 3$D$ 1FD$h#WS it 1( '39t9At&9IuJuiu3$tHPhNJ$ AtPqh5#9: 늡UA뀃Dtou&t$ mt$dU$W$uQ 1t$hWVa jSV $FWPP; uh7(&VhiP. u hɍ#jW4}T$( '3l$D$G_HrY7ShjD$*P ft$fD$CL$fA37SvhjD$&PU ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$P \$ $ sh #*sh.#*s hQ#*shn#*sh#*sh#*s hЎ#*s$h#*s(h#~*sHh-#n*s,hT#^*s0hr#N*s4h#>*s8h#.*sXf|$rL$I#fw @ 'L$T$ t$"VRQPh#;(h#h#j胩D$f=313hjD$$Pp  fD$|$<3fD$ $T$3h׬$'H$ 'L$f|$#t#Pu'D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPh#&~|$ujjPP jt$t$ Vu VhiW u h#D$(|$ u,$PD$D$,$|$ 1hSWa  GG?t$>hSD$$P3  G$0hSW  jl$UW wh#v%hl3iWh:it$V uO j.b$hl35jhc Wh:iV u Cw: 8)|$Ò##PV$rkLPD$$PQV $<1|$Vh#$t$kL4t40 'h`#m$hw#`$48~1D=Pe#G9uh#V4 D$4!4"4#4$4%PSWRQt$h##4(h##444,40k<SWPRQPhϑ##4`h2##hW##4\t hf#i#t hk#W#h#*U4d6|$1A t$t&u/7t$t nu Qhp#"FL9Mt$ $t$qVsP$t$RVashL#oPh#hĆ3/% jUSWV։1hUS jWS sUPPȭ t'Sh9iP tVrĔ^_[]h7(&h؍#j薣USWV׉1hVUh jSU  }VPPI tAUh:iPC uGPh#ܠ1FS@rĐ^_[]h7(&jVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph#!^WVh# f>r1D~Ph[& GH9|j]^_WVh# f>r91D>Ph#  9} j:G9|h#n ^_WV$fGjRWw WhiV t Đ^_h#j諡fUSWVu }6>hdp#jY hӒ#VW, Hw$X 'TLXLԃBu|1PP5Uȟ PL불\L`LdLhLTLlL너\LpLsjhl3ϯ_\LS3=3=hLu.1L$A AAAQj jQo =XL`LTLlLpL\L"31O=txL^$3tchE#Vt^=dLukjjV n ƅD$ PVD$(!=<\$yB  "3u1PPVm Ɖx\$xLz3=t|L5PLPL$Q m ƅ~E1|LVPSk i)u5PL5|Lt$l ƿy5xLh׬$ztL"31O=\$t$9ȉQmL$5PLu ύD$ PS5PLr*V |LVh2#)|LPL|LLLVm3h׬$蜛tL3Vl3h#))ˋ$B65PL9Phߒ#hĆ3 1@xL^$;3t=hE#Wt1#=dLux0#PW;? \$3\$=xL 1$ӋFHN~ HVƒ =lLu u u1G1=TLup=XLu< u7 =`L>hdp#h#hl3o x3@t>$@$Ph#hl3Eڃ x3@ t_  =`Lt3H t3;3hl3j$  =pLxt3H t3;3hl3j^:=\L,t3H t3;3hl3jMEڃl3H l3$l3H l3^t3H t3!;3hl3jI l3H l3I l3H l3Mt3H t3%;3hl3j-ڃu!l3H l3-3DPuWt3H t3;3~ƒ tl3H l3hl3Rڃt3H t3";3hl3j^ڃuvl3H l3^?tЃ@Ӌ t3Qt3; 3~ ȃ t l3Ql3Vhl3Pb=F @t5xLh׬$ΖtLf x3@ui3\$t Vu(3% 3Wh׬$臖tL1;`hl34utLe^_[]hy"j蒘h^$fUSWV$$05hdp#j6 11E1D$D$D$D$$׉jh 3hK#$VQ~Hw@$ 'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jU$ىY1ɉPXuG 3$T:-u"j9uzuI 3 u 3)t u <$u|$uM1ۋD$Ã<$D$ `tD$ $4u9>WV6uTWh#D$u5t뢍D$PWjwu!Wh#Mh\#j[$1 |$ $jSV Z u h0C&Ptc1u8V 1CHHf wy$ '|$uhU2cÅu뼋ss PVh5#]! |$u.jSUeo ss PVh5#&! 1F $tCPpQ3|$t KP;AmPsT$Z|$Osh׬$ 1F7hEC&jC~PPh#hĆ3=j fUSWV$$6a21hdp#U -L-L-L-L1Ch*#VW臜 e'H wu$4 'L-L-LŃo'filL뙃prvLoaLLL%L-L-L7L-L-LL LLLLLLLu 3)ǃ=LLu-tX1Ƀ=L=LtL$H=L=L=L=LtʉT$4蟤LjLPt$lVUhH3蹢 9rUh#\hH3`H3 @3QT$/u>t$|9A@3A @3I3vy/th7#hl#jt$ D3Dh j=Lu$PhH3r$PhH3'su@8uT\=Lu=Lt@L Lt3D$ P6ar1#$=@txUhH3D$ P6ru6h׬$jX#D$=@uL L1ۉ  t1ۀ|$/uhH3h”#.t9Ur|/u (IHr IH9/touɉt$P_LUSWVT$juQ8T P]D$1t$CHfw?$` 'ss M PVt$ h5# Pshؔ#>|$(5D3C,H3)=|5TShH3h#X t$V\1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$hA#Q T$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3h#t$PVL L$@3@3=I3vx/u H@3=LtD$PhH3pD$PhH3oT$KP3Qt$31 u@T$(3Qt$$3q u.shH3h8# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h^# 1Gt$#KPqt$1BD$ $ '=LL$ QP T$ L LsHtbffM LQLT$ Lt$/D$ !=@8fush#jSt$ Vf 1G)=LtRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=Lt$tjQ\LH LU1hH3hT$赃4$hH3h׬$蛃|$t$ D$L$PQfy#EHQh׬$i1@D$|$t$ =Lt#Vt$脂thH3hQ#.4$T|$tVT1C؍e^_[]Ã=LtVW1ۅÃ=Lt@1ۃ} t8G t2G;Lu'D$`PVt_hH3h׬$褂1CVTthH3h׬$肂1C=LbWhH3`IGG;D$|uL#G%PVVwUSWV\$|$OǴ OOtQPS&V uG1CQPhH3LU t918thH3h#躁1F#GGtPSUG1PhH3UthH3h#v1Ft\=LuSolWt USU UhH3IVu%,8-ulthH3hĖ#1FuWhH3t1F^_[]WV$ hWvP t,$t'hH3"thH3h#"vhw#hH3WRtWh#r1@^_Ã=LtjvP(1V|$ thH3U"t hH3h#"t$vhH3!SthH3h#1@^Ã=Lt jV1V|$ thH3!t hH3h#(t$v$v vhH3-thH3h#1@^Ã=Lt jVF1PPhЖ#hĆ3j5USWV|$j/S|t@Ë$h.y&SuGhdp#WV  X3)ƃHt4%Rj1h}#WVĈ e~!r8$ 'ԛM˃K~3LtgPěM믃st\vtcwЛM듃FuXMțM̛MЛMm̛MțMZěMN؛MBܛM6uX3)ފ ؛M4 -ݛMMu=MưMuțMЛM,ttu'MUj M%jPbt=ԛMu4PV`u$#D$=u@Yj!PV8`uB#D$=@tM19t<1jA ŋ9uUVh׬$j"]PPh#hĆ3jUSWV׉΀=؛Mtj}$hVSَ =w6S9t)$ PQh΃%WS94?A&!=ěMu%!L$QVЃu#D$=@`Vh׬${1C؍e^_[]Í\$SWU_u#D$=@=ԛMu"SW^u#D$=@=؛MЛM>/uD$PVe^#X$hSW薍 W軈t?$ VPh΃%hWkD$PW ^#t VQzD$PWj^Å؛MWV/PVt@\$L$/PWt@L$ Q\$SGu)D$ )=|\$=țMu=̛Mhl3ϳWhԗ#hĆ3\ 3H 3~3H 3h3É؃t9 t43H 3~3H 3h3ƒ߃Y=Mu#D$=@uW芏Wru8=؛Mu WVKěM PWQVQJLtW#1ۀ=ܛM$ݛMVPWh#hĆ3jj h#/9D$t$QVP Ƅ fDŽ$.$$PQ[\$4$9|$ t#t$WP軳$ D$Ƅ fDŽ$.$PQ9[$3$$3$ $3$$3$  WVh# fD$L$TTPQËD$L$TTPQrUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPD^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPx^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP|^_[]USWV |$872hdp#j蟢 jyt7D$Phht@j衾 uD$tL3MMM+u Mt$41۽h#WV~ HσG$ 'M1M1MM MM1MMMMM낃w0M4M^[VshQ$ O=4M#t2#D$,MU`‹ud΋[QPVRRPSt$t$VuSB_u$<p$V$Dh:#~=Mu3v,hC#c svhC#P =@Mtsvh#4 E@ %=`u6E %  1QRv4QPv0hJ#h=0Mt:jj hdp#u\uXj\$SSv(hQ$ %=4M#t2#u\uXv(P= MtE(=MtE@E4P^M  Mt =Mt =MtIME!=$#Dt;GOTQph΃%hVx3=HMtM%=@t룍GTPh׬$hVChD$&PV0 t+D"h6<#yM  Mt1D$"P; 80 PVh#hĆ3=MtYD$"P t3H t3~l3H l3 hl3j $8t$SD$"Ph׬$렁$^_[]h"#j;bWVxDtPM PMtC=0Mt@AI t$jj hdp#QPjVtZVhq#Q^_Ã=4M#t{#,MyNjIуRPQWrcRPVh"#jaUSWVD$PPX#tƿD> t3J t3;3~у t l3Ql3Guhl3Q-=TMtXD>t3J t3;3~!у t l3Ql3Gu7hl3QL$D$ ρÃhMT$9lM}`;L$}XD>t3J t3;3~!у t l3Ql3Guhl3Q6t3H t3;3hl3j l3H l3 1D>t3J t3;3~!у t l3Ql3Guhl3Qt3H t3;3hl3j zl3H l3 e^_[]SWV΃=DMt vrh\%c1TVO^_[SWV΃=DMt vh\%1TV^_[Ã=DMtATPqh΃% ÃTQh׬$Í` f w5$ 't3H t3;3hl3j@I/t3H t3;3hl3j*t3H t3;3hl3j=kt3H t3;3hl3j%Dt3H t3w;3ohl3j|!t3H t3g;3_hl3j/1@ál3H l3@l3H l3=֡l3H l3%ál3H l3|밡l3H l3/1ál3H l3*USWVl$(}=(MtE G=PMt=0Mt(DGM1 HMÍ4^69L3} ^_[]{E ;\3~*P5pMk tM \3pMpM4FMt%$Q  Qt $ B$Iu$ L3șƉșD$$t$D$ D$|$1ۋt$=0Mt( pM U tt$ ;4$}Z;D$}El$)št3H t3;3hl3j {l3H l3 MuC;\$rt3H t3~l3H l3 hl3j $D$@D$;D$ ^_[]jXLUSWVt$~=(MtF G=PMt=0Mt(GM1 HMÍ,C L3-9} ^_[][Gșljș|$$.1E  E;|$|6t3H t3~l3H l3 hl3j 1V =0Mt(41;$}D$)át3H t3;3hl3j l3H l3 KuGm=t3H t3~l3H l3 hl3j f^_[]USWV|$=(Mt_ C1ۃ=PMt=0Mt(C=M71F  Ft3H t3;3hl3j,l3H l3, +N,t3Pt3; L3} 0;3(hl3j ;~&l3H l3 "l3H l3 hl3j E1W =0Mt(4_ŋvt3H t3~l3H l3 hl3j ^_[]fSWV|$ MWqt pSP\ t81PWV3 Vh׬$Vgl ^_[h#Wh#jVUSWV$U4(F$$1 |$1 9$)덄$PSUD$P`~ tXǃt-tat$袀 ?tL$T$d$.?T$O$E1 $ ;3r9vL$?T$$$^_[]SWV ΉRQS} 1t4u t|uHthl3PjSt V lj ^_[fUSWV$$31hdp#W} Wg%$ D$D$ h=Y%SV0] mu05UtChPi$WZj 뼃pu D$ 뭃u 3,uk5Uh#jU#D$=@u.$VtPb 9r*thۙ#j8R|WP ty/t AƄ/@L$M$D$S|/uH9tx/@tj/Sޅt@V谧L$rShۙ#41A $'@PVt$ ]Z ٍ$Ct1@$Mg4$ 軵PPh#hĆ3zjMUSWV։π=xMujVugt~VW!t9˶8uR\$@SVK2t{SW=29Wh׬$1ۀ=MVWhZ"< VWh#hN w=|Mu=jWfuWh#H#D$H=@VOd=M/jVfD$@PV0jWlfuD$1Pt$L7-D$2x dp#tV%D$1Pt$\萢1Pt$`VPSt$D$BPh#hĆ3#D$H=u}1PPW t$HhV \$D$MMV"CVh##L1C؍e^_[]ÉVhB#hĆ3 3H 3~3H 3h3譥ÃtH tC 3I 3~3P3h3n 3 tuÃ߉1ۃYM@Vh׬$L'$MSR Mt$|$SPt$  Å11S5Mt$ 9x߉=Mt{\$(t$,l$( \&$$L$$D$ l$ |$T$ fT$l$\$l$T$MRQPVSt$(t$(hV#hĆ3$5M5Mt$ ? Å6|$W\$S+Jt$uVhQ#JS;D$hL$l$JD$pBD$tB D$xBD$|BRWtVh>#Jt$\t$\W ^8tVhL#NJ#D$HD$Ht$\$ \$D$t$Ph׬$JV-tVh3#It$_SV1VI5Mt$4t$ЋD$HPWtVh`#I$Wt肱8-t$Vhm#kI WtV|$Wkt Wh3#H1ۀ=MDVt$SWVP׉bjWP  t$t-h#h#h#h#H1@^_[%tPh#hƚ#h ajWP t$th#h#%tPh#1돸#=Mu##jWVh` &Phq"SKSh׬$Hjî#jVh` &h#hq"WWUSWV8`3t PI`31MMMMMM 3it$L$8'hjV `3iVhB#0jG`3hhV `3MhjVt `3Vhw#0jͳMu31`3Md31t~Mttja`3Ml31@5`3Ml31@DgVh\#0jE`3tMtj`3 HNtQ`3hMP\xCM%= ts=`=@5Mh#j許 譭5Mh#0j膲5`3`3M1HPhm8@5`3謏 1ɅA M-M5 MMˋ 3u HNHN3v$L'= HN=HN>1jSS5`3;!ƒu輬8fM-M5 M a1H 3 3=MGt =}r t~=HNHNq˃u#= HNtPWUVT ~jWUV: tw߿(=HNu HN~~=3|318^_[]111RSWV։ωS7\'F3D$t,t\$W3[4$t$ctjt$Y[gO#1@jt$A[ #1PW0[4$Et$9jSVVLCx^_[h# h#h$#jDVP=`3x=`IN xINt}=Mut=INtD0INHQP~'Q &M1MM$Pj 5INhڛ#50INp 50IN{=MuKhM5`3Fu4#M=u"M  Mu5MM= 3w=TINt3~ jP85`33~jQP `IN xINt4=Mu+50INh#5IN50INz`3=Mu MtP1MM(INt3 `IN xINt'=INtG0INHQP~Q MPj IN(INtZ5INh #VuC50IN ,HN(HN u HNHNjhQP7RPh#V1V50INy5M^USWV= 3l3tĆ3D$W @O+@M DM u1@1ɉ$L$=(IN 3\$5,HN5(HNh3#hSپ<$t$W5,HN5(HNU$hN#RPWh>#hV蛾$VSh#hW}W,PW}tf=PMt]t$5M5Mh3#hV3$VhPMh#hWWʖPWj  3u_5M<$t$WjVs$h$RPWh>#hS蹽$S]Vh#hP蚽(IND$=3OMD$ 3#D$5,HN5(HNVSPU$5HN5HNVSP7HN HN (HN,HN4$t$VPQ覔$hN#RPVh>#hS$S]$QL$Qt$Wt$$h #hP踼$t$VdPVj(  "$PW5INh5#t$te^_[]V~=Mu(=|3~h~V5`3  |3~^V0M1=MuE1jVV5`3xRP5`3A y腤h#0jd 1N^Ã=Muh<#jI&1=Mu5IN5HNhn#j!1HUSWV1|$\$l$WSU?  ~)t^_[]USWV1|$\$l$WSU  ~)t^_[]WV5|3=Mt$t$5`3  ƃu*~3M;5HNtc5HNtUML~ M?5|3x53h͜#j, 1/53h#0j^_USWVP5|3|$l$1ۡ`3$WUt$  ƅ~)tދD$9u0MM!|3MHs-艢8 uc1h#Vh5|3:~\%tS1jPP5`3賄x})RP5`3ڏ yPb8tD8t:8t0Ty:8t 8u |31ء8Eu |3xt 0M1M=0Muh#j腥`tx>(INHt)t h#53h͜#jL 1%hp#jF53hM#0j^_[]USWV1N=4M=|3  3uh؝#j٤M<uM-MsgMM1jWW5`3xXͽuWURP)jWU5`3ׂyQu t#M@M=|3:h#Ff@Phm5`3f x|3h7#j1^_[]USWV \$$|$ l$(1uu5|3M1jVV5`3x\D$ljT$Ӄ=MD$M M9L$ujRP5`3豁x+D$T$EU,=Mu#hk#0j |31N ^_[]USWV~=|3$(~$$~Mt)h#j蔢I1u)1ɍ|$h~W5`3 0|$fGWhm5`3蚀 fD$D$Whm5`3o \$h~S5`3/ $h~S5`3 GfD$D$Whm5`3 |3t1<$uzfD$D$Whm5`3 f $ HN11F$$~jQUR\9ы$ʉD$ ʋ$$~) h=#b1F|?1jPP5`3^xg)y11=3|!h#11Fs1o跜hZ#RjRP5`31yK蓜h#.臜h:#"{hʞ#oh# ch#0jB 1N5|3~^_[]fD$D$ D$Shm5`3j~ yt$hm#t$hգ#0j٠SWV VhINj yÛh#0j袠 jVj y藛h#0jv 1N=4M0M= (INSPhLMQ@ M$ ML$QPhLM\hLMCjuhLM[jhLM^uH=PM/u+-Bu"PMP豅PhQMPMP}8 hl3WVhLMM<x3@ubMM M MQP.t (INP(jhINjd xsZ1e^_[]h#0jՙ USWV (3x&,3kL39|׋yM1II1M1PQÅy19}WDu= 3h#j.hhMOÅy1ۉ9|(3x(,3kLShM3y݅u= 3teh#j迗M1E$sVhMMP6 )؍M1Eh"#ji1IkFL3(INShM#1ɉ^_[]USWV D$(INxGD$M$1F1MSQ291C(INhMhLMP$ (INQu*D$PUhMQ8 Mtu= 3hϦ#j耖t$hMhMy5 $W1CttUtB:x9u= 3tFh#j,WhMQ19uh:#j1H ^_[]h`#thLMQ<t M1h#USWV1C(INPH(INP yj)Ɖ׃=HNt/5 3qtUh#0j4 e=HINt Rrx7t$t4(INP(jhINjX lzbV1ۉ؍e^_[]Ít$\$D$MHw5 (INVPhLMQ@ MD$ ML$ hLMkWehLMduy=LINtShPM t^\IN hINtShPM hLMUjhLMXt@hLMEmMM M MQP=PM/u+?<u"PMPPhQMPMP2 IN INtShPM  `INtp0IN|NPWt$hLM)6Q=\INhIND$L;MD$PMPhPM8INhMt@t=INu Pl= 3t1MHr@tZ tUhLMl'9D$X;MD$\M?uD$PhLM$Ã|$=INut$hLMÅ(INVShLMP@ =INuShLM/!؃=`IN\$C=IN6D$0INHQPQ IN=IND$L;MD$PMMM M MQPDy hLMj=`IN\$^=INQ0INHQPQ D$L;MD$PMD$X;MD$\MOPj IND$uMD$ ML$ QPphMx5 350IN ^MM M MQPhLMji\$=D$L;MD$PMPj XINUSWVj/hPMm1UhPMot>5HMhHMU| /tOGhHMWUhPMhե#jjO1N,K|/t1NuhPMh#jj^_[]SWV=(IN01F (INt9t71h#jێmQHb(INP R=\INt i<(INx t `m#`IN xINt#5INhܤ#50INե INujhLM^t(MM M MQPu1=\INthLMhxuthLMly(INP(ljgSW, xa`IN xINt&=INt50INh#2IN1G*ƃuejhINj ^_[USWV $(INxu d?*1F(INP,(IN@0D$ j=!D$T$=HINjShLM9]jhLMQ$=\INthLM~ghLM+thLM2dM w's1PP5\M $jhLMPƀ=PM/u+4u"PMPxPhQMPMP* =INt4$hLMZ' `INt:0IN|Pt$t$hLMs.PhPM0INMhLMT$t8=`IN=IN0INHQP~dQ c(INL$Qt$LMSPD ƉPS?&=`INtc=INtZ0INHQP~3Q 2Pj .INPhLM%dPj IND$L$ʃ|QP  MMʃ|QPxnhLM*1C@TPhLMZ% 5\Mh#0jhLM8chLM)t (INP4 jhINj =XINtn)11Fe^_[]þLMPV$Vb뙉PhLM$뇃=\INt cxIx(INPHx11@USWV $$h 5INS]/ = u$ /,4ŏ4/t EƄ4/FED$P5IN#D$=@`1Gxv%xmlxd=HINt exRhLM!(ttjhINj Gm'15INh #j 1GĐ ^_[]5INh(#0j҈5INhO#뻸 )D$ )D$$hLM X\IN hINtV1=PM/PMt$PU- ;D$vhPMhq#jN _D$PSELMWT&W^jhLMKt'hLMK`hLM&'VShLMNR xơIN INtD$PhPM@I=`INt50INhPM+INM=PINtEhLMC=\INhIND$D;MD$HMhLM{MHt 1PP5\MX $jhLM#Pt$hLM WhLMD$P;MD$TM7wD$ PhLM;INtk=INtbD$D;MD$HMNhLMhLM^^D$D;MD$HMD$P;MD$TM輀5\Mh#0j蕅PLMWWWhLM!PhLM=`INe=INX0INHQP~ Q Pj 蛞IN D$D;MD$HMUfHNM HNu (IN@ HN=~| h~PhM#thPh~#j蜃1HãHN35My x1HNHN HN HNʉ HN $HNHNM= 3u= HNt4=~| h~Ph#thPhݧ#j1H5M y xHNHN HN$HN1,HN(HNHNM~3HNUSWV=4INth #j艂1I^_[]Ã= HNHN3u HN1IxՋ= HN+=$HN|$\$53UVSW螛)9|11UV$)݃HN|J$HN 3 HN~H5HNP$HN$HN; HNr֋ HN 3 HN$HN1)ȉQPx[HNƉ5$HN 3ȣ HN)=(HN,HN HN1HNHN 31h<#jWV1N=3= 3uhn#jy1,HN(HN535HNZ13~9} G{u'Ph#j~ xI1=,HN=(HN535HN~ HN $HN(HN,HN HN1^_ËD$L$$HN)ʉ$HNQPRuO USWVu ]1D$ D$ D$ HN $HN)ȉ9؉| $HN)։ HNQPVS)ЍT$RPQ 1ID$L$ )(HN ,HN|~ HN$HN)ЅqxUtX HN$HND$9ؿ|‰$HN)ظ|D$L$ 1H1@D$D$e^_[]V1=0HN535HN~# HN $HN(HN HN,HNV1xC=(INt/x&5,HN5(HN535HN~0HN1 4IN1H^V$HN;HNv*5 HN)QjPGv 5$HN53^USWVt$/u/1N=@HNMWh0#js @HN.|$tjh W* V $=DHNDHN_Sh#VPֆ$訩ƅE<$8$S x<Sh#P$艆$[ywo0=INt50IN@$h#Vjs15DHN$: $nQh#0js1N^_[É$kUSWV|$?/tGj/P9ƳUWu/Fj/V9ƅuhW=INt$$W jWy3UWyu%D$ PW)jUPWV/Fj/V91ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~,mWh#0j r$tDP*yl$h۪#0jq$I 1$DHN^_USWVD$Et$$^߅tPylWh#0jpq=INt<$8$W 1 INtt)$($u7=PHNujLHNPPHNLHN!UW 3  3t%1PPL$H$X$T$W$tJSWy!kSWh#0jpW貥$ 1$DHN^_[]WVx|1uA|$ t$t$W t(50IN<6kWh\#0jp1N^_Vt$#D$ PVt%50IN<jVhz#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U= 3t = 3D$PV tmjVh#0jKo_= 3u&D$DL$HL$$Mbl$L‰T$= 3u'D$PL$TL$D$ Mbl$X‰T$WVt6i8Nu} u&WVCuiVh1#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh#jm 1HjW |^_[USWV׉L$]D$PSot6St$thh0wwS tՃ} tL1@_1=LINuTG3D$ 3L$ uKG3D$O 3L$ u9t$h4#jUl 1St$hc#Vj6m1He^_[]ø#D$=@u%h%SZtSC0S } DgShR#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=LINt1A$$3L$ $3$ u*0$3L$,$3T$ uVh2#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $`'5INhW#Xuu=pINtlD$PUuZD$ !=uHhWUv ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUyUt$* 4$UeL$ t uu$UFD$y)Q8=INus<$8$U xZL$ A$Yet$Uha#0j3j1H=INt2<$8$U Uh#Wji1ɡINtt1Ƀ$ !($t($t$$5INh #VjU xN1=IN= 3= 3Uh#Uh#j7h 1OD$PUx=1$ ?#D$ PU1@=INu;L$ ($/ct$h#0jh$ PU1@Pt$6UK 31  3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=LINt މ|^_[]ø#D$=@u5h%WT1EtXW+yĉ#$t Wy50IN4۪#bWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5JNJN JNINL$T$tI AQP DUVP 9t_L$ xZjPUQ0DҋT$0y@oEP Džt<$\$MQVP  D$8+$T$0)+|$$>h#jJe*Oat$8h#?at$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWSpCxjhHHNS y%#ͬ#\$`SV0je^_[Vt$ xFP=XINt.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(V ~H111Ã1T |A9uV$P$(! ǀ$1111틴$(3x$3|$ uUP$( <xLX$3D$8T$3L$4 uF1VVV$(AxE$($\h#S_h#.h#j%c #*_$(h#0jc1N|(^_[]V=pINtTHN=lINtTHN=|INt@THN=XHNuh \HNt01x&=XINtDyh}#jhb1N^WVtHNtP1tHNpHN1NXHNt hHNtqAhHNuj13H 3~3H 3h3OtN;43u1tB \HN9G= |+hHNxx\HN PW1t-\HN8j5THNh\HNp tHN&1^_SWV|$tR?tMj < tSƋ\$W_MH~ </u>ۉ^F=XHNt%dHNp!h#j`1Hhǭ#5XHN5dHN1^_[áhHNt@=TINtlHN=tINu0=DINt'D$$upHNtjP5tHNi WV=XINtB5XHNt;11G~u)uh#jA`6h#hĆ3w vu^_USWV =lHNu%lHN1NtHNutHN}$ $ $L$P4pHNt#HHf w=$|'phq##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p Z pHNqh#0 ph9#p j_e=XINt\@PL$QL$ Qpp p09Bx8pHNjjt$t$t$t$phU#p j[_ tHN1N1 $'LJ$Ƅ  LJ$LJ$=XINtwL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G pHN VqP  pHNVqP 5INh #"K1uhHN@e^_[]fUSWVT\$tl$h=`INP($bT$L$X$1V8$EV<$Gdp#dp#t4$tVjQjRD$Ph#Ss $u2@$%  RPh#Uh#^|$x$h#SsEPD$Ph%Sqs$Hs Uhî#u# Uh\"S;s S)X^_[]Sj USWV@L$E\$CD$PS+{3j9#|#L$QPj@t$V:ue^_[]SWVT|$dT$t$X$hS($WVShˮ#t[d^_[SWVt$F=u1H|$P2t6t)G\$QjPS֫VS<Gu܃^_[Ã^_[ USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VdIN~1F1udINhԮ#j9W^ÐSWVL$D$t$|$UxHNt|HNtt\^_[c}\1KZxHNteSP?ti:tdx:39}j U@3sPVW hVxHN:-u/|HNÈ|HNnxHN|HN`S6h%#3=S6h<#hĆ3m?^_[f1Ã=HNu1á(IN0h#jV HNt"H HNp0h#hĆ3Im5INhW#Cu_sUSWVd|$|j/72INt@l$xINhW#P*cINW#1C,ININD$ D$1D$$jh3h#WUHЃJw$,';t$$@$'UM묡 3t  3TIN 3r 3t c 3P= 3#\$LIN! Uk HN HNM#M%3|IN5UR 3t  3 3\$xINtM 3e,INdINLM 3=lIN.HIN Pt$) * NL$ U HN$LFM 3M 3M 3M 3HNUHNM%$pINq5U[Z 3@K  38U8-u xMD$ =INu ININ 3 3M#`IN 3HN5UWO DININsINd 3UININ?M1@D$ ) 3 L$ ƒ ʺĆ3tl3 30INƒu 9u , l$D$kL3(INHN INq"1$jh83h#WU'/~HЃJS$p'43ƍHw$X'IN뫅!UM 3IN|M%$m\IN@XPINˀC@IN1M#"HIN U@Ƀl~mtKotRpdINSatDeJ1A IN IN 3 3 3" 3IN  3@{peUMSH`IN3 U tj,V Åtj=V tmj | tdAE0H@HN=HNt INs INuhT#j6B1O^_[]hh#h#hh#j B4$} ɋD$L$01/WV5INh#hĆ3=Y t(ο̲#Php$hĆ3Y !uء̆3H ̆3~Ć3H Ć3 hĆ3j [^_SWVPωPQzt4Ƌ$| tC$S5 t'ǍCPVW DG IN IN1^_[USWV$t%t_݊M\tS8uEEh#j@Ej UEƃjSV t3l$hUVPlWUh#j\@S $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=INtZINHVVS4$ Wh#ji? 1H^_[]VV h# IN IN1V4$ Wh#USWV\$tK;tFj tLNjl$1pS+G woD$G95 INt%$INx!h8#j>1NhM#= IN=$IN^_[]WV5 INt;11GFu)uhz#j^>6h#hĆ3U vu^_USWV IN1 l$$=TINKt(=DINt!9t)@tB9uKKt8< INCS7 Dž$h#j=z$uEPUt?NjCt /C;W)C |/uHC C$#h#j2=Ct/C1N^_[]USWV|$LJ$ INtOwCu kPUC |/uPV3) t2[u1=@INO=TIN=@IN 2$=@INtW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=DINtGtlD$@1G8D$@1D$\1GEt$ hI#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhc#j59tNjE|$tDD$@t:$t$PVh#hĆ3ELVh#hĆ30L $t+Et$h PV  1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh/#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7Sg0INĆ3WVVjuD$L$ L$$VjVjuD$L$ L$$VjkVjuD$L$ L$$VjBVjwuD$L$ L$$Vjh#,IN1INININP INt$,NFF FFi~ |$WVj- y|$ujWjz- WVjf- y|$ujWjN- WVj:- y|$ujWj"- WVj- y|$ujWj, TWVj, y|$ujWj, (D$,WVj ,  WVj, 0= 3t3i=)‹1@?9 tR=INt3<$/>3i=)‹1@9 tR IN1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=INujh= IN#t\u#uGW tjxGj jW/I  />3i=)Ë IN,t 98t#@u $jU t!8h $1(Wh#j9- hԻ#h#j!-^_[]USWVP|$1N=INujh= IN#t\u#uGWn tjxGj jW2H />3i=)Ë IN,t 98t#@u $jX t!8h $1(Wh*#j<, hR#h#j$,^_[]USWVt$totij/V\ 1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhv#j+1H^_[]1ju ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjGS CS>tKt^?tYڃCKt6C;C C})VWh4#j*S h#C=INt$INX Vh#jW* 4Vh#ININ1Wh#j** S hW#}VQhۼ#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$Åt>V,FN4A1RU113W1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=INu*jh INuh#j1(1N^USWV IN1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åujv Ël$EP2 $$$KCs{ D$C $C1^_[]Ët$ h 3Py  1$$CHC1FwCE3L SC S8 h#j&1NwUSWVINt"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j~ tx@ LHDh#jY 1^_[]USWVINCD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjl J1ɉHT$, $$$P HN HF F t$1 H;@u IN-INININ-INӉl$T$tQغ/>3i=)‹t01ڋh1 t@IN=INl$T$s}ډD$0! umщjt[IN=IN tIjY t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  hӿ#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=INu*jh=` INuh #j1N^WVINt813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(Է t^t$蘼tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h?#jj ^_[]USWV IN1Kt$/>3i=)‹/uPVc Džj$i tWW0tN$$QVQ4y8~V Q(y,~VIlNF INF5IN3Wh#!Wh#j Vp Vhs#j ^_WV5INt~1FIN=INu~ t v6蚫 3  3tWWvvvv 6踫= 3t v6ά6 V 5INu^_jhÀ=INu1WVL$T$t$ IN11H<>u5Guu%P=INtIN11@^_V|$ |et$>t\jhU#P t !3=!3t#h#j|j !31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#Su3h&#Wu! 3u9INDžu91FWSh#Voh&#h#hI#V WShw#jL1N^_[USWV\$hSb1N|$1h$UW\ O$LJ4$<rD ShJNhIN   PhJNhJN  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQK 7L 1D$ereRPQ ^_[USWV $ $Hw.$' e| Rh'#{=INx1ۃd|RhE#Q1l$ hVUy  $ jdPU$,| $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h #$F1 $F2 jdPVκ fF0 $j j0P  HN HNtHNT$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U  $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U  $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U0  $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0RB  t$ hc#$%$ $LJ$m9rD$ )yQj0U  1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0US  $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhU#W t1H^_jh#Ws u(=INu JNu JNh#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQ Ǎ A/G<rH )UhJNhINo   PhJNhJNG  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPhyEtQQP  ƅ(8$VPByElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu+&-u~t6hx0#VDžu'0k PVhs#jH31FUW`:t5Ë$rt$Vh#j$_Ft1N13t Wt^_[]fVjhj"dxKh@$PJNt)hx0#VJN1u;5JNVe=HINthj"hB#j 1H1^WVPD$$|$t 4INt$xIN `INt"=INthĆ3j $INĆ35INh"W  4$VW Wj # ^_PJNt$L$T$ $RQP 5JN"XSWV|$1N|5JNt,\$OPWS! t;j S1t^_[SWVPD$ $|$t 4IN|$t$xIN `INt"=INthl3j #INĆ35INh"S  4$WS ~V Ph$hĆ3 hĆ3j " ^_[fUSWV} u71hdp#je \$1h̩$WV2 LtPt߃953D$hm#;ƀ8/h^#Vj ush#VX ua$PVttKD$Ph%tt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02VChl3x3@ujhy"jSPhb#hĆ3N jUSWV$$6u0hdp#j 11Chs#VU谚 e~%q~3كrtރvt_x4JNŃV.PtrكRtwftAi$JN(JN뒃Wt6duq JNz0JNl$JN(JNW8JNI,JN;u39|=$JNu 1Ĉ^_[]7D$h j$D$,$S I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h#C\$@JNEHu]j$8u @JNPjtVG t|$u G?KNwę w蹙 W谙  KNu= KNt^_WVt$ KN1&"3Q 8SNH 8SN(S Uh#5"3) u1^_[]Vh`%etauj48SNt$1Pc ơ8SNH 8SN@u1^fWVP5JNPЃ rFF#'ut t- JN]$|'NF믉jWV JNJN F#'jJNKN1D>GF#'uGPJNWVP1 JN8^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5JN^_ÊVF|uܹո ѹ Ǹ É)B$:@BF#'uVPQh# fUSWV|$,t$(S4=JNjLVpt:xIuxNt@jLPj VO1tE@j P<)=JN5JN5JN&1,=JNuƉS^_[]ù#V=JN)u ^5JNQh#*WVdp#|$ |$wL!3 P!3 0SN>t'F 0SNQ0SNN@>vuڋ7 0SNQ0SNtִ @뭅Ĵ+L!3@P5WNVrƉRPhά$% 1 ^_USWV8׉ˋ JNJND$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhΊ"jV/jVt$ ( USWV Ջ\$$St$$tƉ׃=JN%up1҉  ډD$$=JN&uU1ۉ D$JN JNME \$$L$SPy t D$$ ^_[]ù.#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWV Ɖ׉^_[߹##w#wSWVP=WNKNWNQ+Ɖ=WN=!3ttxt>uw&1ۉSPV/ Ɖ9u$8t*r8u+$t@F#' t$@u^_[ù##%USWVPՋ\$St$gƉ׃=JNuKl$JN JNMES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաJNHwSjP ljաJNuND$JN JNN1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THJN JNN&ىWP1Eكra$"ى=JN#ÉJN݅~hJN JN2É׃'1HJN JNNPىWP1 1JN JNNىWPÉJNLJN JNNىWPe$É׍EكwJN|$4t;~l-JNb1A1Ǎt$WShΊ"jV{jV5JN0't1I1@1l$QPhΊ"jUEjU6/" ؉^_[]ùJ#T<#Je#@USWV֋] $t$ơJN JNL$ D$T$uPV֋=JNWw,X''8`''}uPW ֋=JNȃ}tً$VPt$ ֍Gw`'';E Qȉe^_[]fUSWVb!3$D$ h#0=etuD$ j8SN0hKNGVS?SqUf@P`áKN)QPS脭 KN)١8SNpQVPSP$jhI#%ƅ<.u 1~.D0t/ua$Ph%NtGPVNt6$3D$$3 $ u$$3L$3D$ 1e^]Sh̩$t/h̩$޻u8SN8Ltj8SN8j*5KNuj=KN5"3"3f`5KN_"3HQPP"3Q 5"37"3@u1[hq#[0ӛ Ph#Ah#7SWVWWPu2\$V48"u6WMWPtVKNV^_[Åu0= Ph#jKNtjPhm# h#ÐUSWVD$ "3fa1Ƀ|$‰tpыLh$SI$th5#S4u 1t$.4NJ]taM\uNEU\rw$<'\0u!11ЃwxAunjt$>"3HQPP"3Q t$.PN    ȉš"3HQPP7"3Q<$t*"3HQPP"3Q 5"3"3Hu 1^_[]ÁfHh#jfKNuBL$ KNjPV=KNt  KNK15 KN0ppp VPj6 950QNt =!3ujVxV^jpPT$=lKNu lKND$ $1APV KNKNt1It$aVPL$T$ D$$PD$lKNjWVP|$t$D$$4$ WWV׉ΡX"3t L"39ty u hL"3 =0KN`KNuPh"h`"3 =4KNt54KNh"h`"3 t*t$ Wh`"3 x4hv%h`"3xV% Ph׬$h`"3 "3HQPP "3Q h`"3 ^_SWV|$t$\$mSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhG&j h$KN$KN@^18KN@KNDKNHKNWV|$ |t|$wL!3 P!3 0SN>t'F 0SNQ0SNN@>vuڋ7 0SNQ0SNt ʝ @PKN15誝+L!3@PǚơLKNPV PKN^_USWV\$0t$,|$W|5WNjVj j辷=8"3thƉ؃$1t7=!3u.D$0t g $uQVi=8KNu"WojZ=8"3u11EjWu PKND$0u^_[]jUSWVL$,|$(!306̓V脚$'Uw1ۀ=!3_=8KNMjw1ۀ=!31=8KN$=PKNjwH1ۀ=!3=8KN=PKNuQ=TNtJjw1ۀ=!3=8KN=PKNt  u8V1tu PKN1l=TNtUW_j\$0SWh a=TNtWD$,E=TNtt$,WK_=TNtit$,WE\$,SW=TNt6UW=TNtUWyPh_# hL"3k=TNtwww. PKN@jw1=PKNPKN jwa=PKNt PKN1V`V%L$,=VNt =r!3t PKNtu u^_[]PjUSWV@|$T5KND$$wG=*"3tttnVN5WNPg$Pho# Gtj P5"3/ Kȅuh#5"3~l$jUth5KN5KNjA<$t&4$h#5"3)|$PKN\$XKN-KNj wD$ KNu= KNtSwKN5KNj KNu= KNt]<$t&4$h#5"3d@^_[]j5KNUSWV\$;s=*"3{VN5WNPPSho#Fstj V5"3k vh#u h# "3HQPP"3Q 5"3l$KNttIu :}tF1ۃjU}Sl$SPu tuQV;}PKNJu KNu= KNtjsUsVkPKN KNu= KNttJ=*"3tA{t;VN5WNPPh#5"3e^_[]SWV|$DKNjw1=!3t DKN5PKN^_[Ë\$18KNu/? PKNut΅tSw5PKN8KNt"u8GWN=*"3 VNPQZPhw"w "3HQPP"3Q=u"3HQPP"3Q 5"3:juw  Sw5PKN=!3uZ8KNt"u*uO"3HQPP\"3QFPU 1Ո`1t$XtOË$t)"3HQPP"3Qv É΅u$u t(PV5"3 مt ȋN΅uء"3HQPP"3Q 5"3|$ +t$4~jh'We u|$$ƅuf|$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t D$$|$ u$|$<‹$t$t$$t$4V0fD$ fD$D$ f=TNt*fsD$=P t=+ u ft$}u$D$@f%Du D$KNjUrD$,ED$D$tD$L$`2 =z!3u f|$t$Ut$40t t@PKN|$D$D$`t$d"D$,F L$KN= KNtYD$t;=XKNuKN= KNt.t$`5"jt$hL$D$Hs*|$ toD$ t$,vPKN.u D$@1@Ht$,pKN= KNH> $At:ʉ9-ЊQ-t u{yh8‰uD$_}t } ]1HL$|AAA WND$(WN\$l1GSQW =XKNvhQNjXKN1-XKNUD$pPj D$ KNN D$(WN_UUWM $1ɅȉD$PPV1DSN\$|fHSND$ HDSN$LSN1PSNKN WNL$( 4KNL$LWND$D$hP KNu= KNt$jVa7KND$ 5KN|$t&D$1f|$tH 4VN8VN$4KNh t$8HKNH HKN=t$L$QPD HKNKNt$1 D$(WND$D4VND$H8VND$L4KNhDSN艛DSNt$|D$ KN|$Pt j KNu= KNt=8KNu 18KNu3Ft,pxtF VNQjRp ^SWVQ`t1OS jjP> t6>F1"jjP tvb^^_[USWV|$41GGG =!3l$0\$S~KNAjUgjUPLi uAKN= KNt4$1CSt$TSU\$t$$w KNu= KNtgSJ~^_[]h#VPTKNu1PPVPjh!3}t tF$Pm|TKNt.1QQVPjh!3Ht tTKN@=PATH5TKN\ TKN !3 !3^á\KNSVhdp#Õ8SN8uj1^[1ۈ!3!3腏5dKNthB vU658SN VNSSQPVHKNá8KNËD$ 8KNPQ5` KNu= KNth#D$Ph#/th#h#GPh׬$- t*"3HQPP"3Q*"3HQPP"3Q ^_[]ÃPWh#_SWV|$tWȊ Bu%iC)ʾ!)!tKN3tFWP tc6|$tTKNW+PoƉf@@ WP KNu= KNt %1KN^_[KNKNQ P  KNu = KNUSWV$$$j/$kturfEE^VN9tth#V軱t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$K譟8蟟8葟$ u=0!3x $u  \u =0!3y& u $MƋ$1Mtfyu0!3YL$$j$P 1OD$VnGpKNtAPh#|t$t-'5pKNh#|t>/u19}-9j$$PM ƅvvD$ PV`x3D$(!D$ =u8=pKN$Nu$8t8t D$}o$E$\$|$$t$t'5"3jS P$h&VjfEo$T$pƋ$$KN|$ÍD$ uj$HfxT$ ufBuω7 KNu= KNt sׅt"G GfEG EG fEGE fEEĜ^_[]KNT$ Éuj$fxE$ufBj KNtbiV蔌C+L!3PkVjj$t3fxu*SV~n$= KNV$h#SWVP#'1t8|$#'L$8u%tWP諍L$ t us^_[SWVP$'1t3|$$'L$8uWP`L$ t us^_[V$'t%$'jPf@NHu^VtKN 0!3trft fuxB =KNr^USWVP\$=VN1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#xt1<:CG럡0!3y x50!31Ʌx $y $Q50!3^_[]SWVKNtKN>t+fuwWtI ߉?u׃KNr KNt^_[Ã= KNt^_[2WV|$D$ KNjP+@ft*fu vfFGF GF GF KNt^_Ã= KNt^_WV t$D$L$ KNfO !3fOPtGWVU KNt ^_Ã= KNt ^_cjt$itfxupE%1USWVt$4$1E11D$h#$ot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;8SN:6B8SN*1\$ D$}u<$uhr#߃<$u U't']'8uUPujUƃ<$tvh#h#j vbtih#vh#8SN8tc"3HQPP0"3Q 7<$t"Uh#?h#Rh#w8SNH 8SN(|$t PjD$PU1L$#jUHfL$@D$wS$'j/UajUF~<$@0_ Ph<#@<$ulh #]<$uh#D<$u h#7<$t,Uh#)VN\$|$tIGh#>t$8SNH 8SN(nv<$uh3$ 뒡VND$ CjUD$PO PBeK<$u h3$Vh#bt$vt$1^_[]h,#d#ctdp#RPhO#Ph#f1PPt$  5L!3@PcUSWV |$$D$ \$(=!3tKNH KN L!3 KN P!3 0SN1ɉ LN LNH WN@\$$0SNtH 0SN~KNKNfH KNKN+L!3$"cLNLNu&4$$bp LNLNqLNl$4$LN-LN5LNx=tALN0F$]5LN΅ueeKN0SN.4$LNLNt OLNG ^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t@VNt D$"3 DVND$KN+L!3D$?~uЃtRWOT$4$ D$1@D$ wy< 0SNH 0SNKN1=DSN KN; L!31y VT$0>u!y@u=D$D$KN$0SNH 0SNKN=KNutKN+ L!3;L$~axu[0SNHKNk0SNH 0SNAKN@0SNH 0SNKN$ |$D$ЉD$$ 0SNH 0SN KN bT$,H KN$t)Ut$ a[tKN+L!3jPHP T$,>~y=u|$ D$ _RV/ uWN0SNH 0SN~#KN%jaT$,H KN NaT$,H KN$Ut$ ZT$4KN+L!3jPHPT$8 `T$,H KN>0SNH 0SN~KN `T$,H KN8 _WNT1>uO@t*u t  $! QVT$4Y`T$,H KNWN8`T$,H KN$`T$,H KND$$ |$tu^_[]USWVt$0|$(=LNt@VNt$D$"3&j\xNFDVND$1@)D$ D$<$LN_w9gD$(Êxr>jWh &_ 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tjZ $HT$0JB^_[]WVt$ NȊ@>*u [t?uߋ=LNKNLNu(Qk{9PYLNNQPc5LN: LN KNu= KNtQLN9t31Ʌt AuQP"u=LN7v LN6^_Vt$t"LN0vX5LN΅u^V5LNt1KN6P9 5LN KNuۃ= KNt菺1LNLN^USWVt$(PZKN+L!3PYL!3Gtr}t  KvC#:t /tQ t7=!3tAL$,u8 0SNQ0SN[O@랃tPY^_[]Ã=0SNu ][0SNL!38t!P& tx PYu$hI#ljPZYGËD$,tÊB!'$< t< s4< w*0SNH 0SN~KNZH KN0SNH 0SN~KNZH KNGw/u}/uEr4P% USWV,D$DD$l$@}E$u D$EF#'D$D$D%D$ j=UaSD$pD$(|$$|$l$|$t;D$PU!tdáKN+L!3D$$1Ub$t>D$t;t0KN+L!3D$1ue1C}@$uKNKN+L!3D$=!3t-E1<*t&<@t"1ۃ wйs\111O|$1CD$%t$RPUT$1 u=KNL!3D$)ǣKN=0SND$%D$ u!L$ȃ@!"}@u =DSNt1E L$@11 $at$|$Wt$l$UV1 WgD$(D$8 u;1|;u|$ |$y|uCD$ B!'$< u*0SNH 0SN~KNWH KN0SNH 0SN~KN|WH KNL$ CuqCD$ < w*0SNH 0SN~KN3WH KN0SNH 0SN~KN WH KNL$ Cu1CK $Ix$'t 0SNH 0SN~YKN\$$W1C:څu0L$ QV1ۀ>t5KNW'KN$ukcV$\$H KN=KN+=L!3t$ t$(SRWVuKN=L!3KN)=0SNSL1CKN+L!3t$ Pt$ D$ t[1GFtuրut܋ KN KǸtuŠQ1ljOu,^_[]ÉUVh:#=+D$5WNhR#t$#u+HL$IQt$P5WNhm#D$ƃHT$QRP5WNh#ƳUSWVKN+L!3D$KNLND$ LND$$LND$( LND$,5LN=KNl$0UR\$+L!3PQ\$ S$URD$, LND$(LND$ L$$ LNLN5LN=KNk$$ L$1ҍ|$DT$rD$HL$[|$  KNu= KNt8hWt$ y轁8tKNHD$]Et uD$F끋D$H9 0SND$} QST$~ 0SN @N1Ҁ|$tB!' tـ s ـ w 0SN@ 0SN@D$KND$ x PhD$t PT0 D$tP?\KN$uD$+L!3jPt$$ D$KN KNu= KNt^_[]USWV D$4L$@-KN5L!3l$)hPD$0SNH 0SN~KN&RH KN=L!3UPW#D$ PPKN+L!3PO5WNW袛ljӍD$ PPL!3 KNKN) 0SN 0SNjQKNSWhΊ"jPKNxt$GF9Iu|$"tjVU0 KNA KN0SN)0SND$ ^_[]SWVt$1ۃ|$|$áLNt#9xu 9X up2jM LNLNLNLNxpX ^_[WV=LNt$ 95LN~?=LNKN?P- =LN KNu׃= KNtˮLNLNt?9p|KN8P- LN8 KNu= KNt脮 LNu9q~)q$95LN~ LNLNLN5LN^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) &0SNH 0SN~KNdDH KNDSNڃt$$@8)΋=LSN$E1 Øt4t/*0SNH 0SN~KNCH KN0SNH 0SN~$H $ KNQKN CKN $Q$ PKN$j0SNH 0SN~$D$KNM ȨtD$BD$)0SNH 0SN~KND$ D$CH KN$KN L!3T$5'~s1'H KN0SNH 0SN~$H $ KNQKN >KN $Q$ PKN$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G0SNP0SN=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rLN9tH9u \%8/t F%QD$;5LNtF/}tEEGXـxs@<$uokt$.tdǀx .u.uN jWt$ t8tG@u@/UPWV荏5LN= KNtt$:tWE/Q LN߀xruX@8tB@9tD$P5LNx5LN,Ą^_[]ËD$1Ʌt AuQPFWV|$ WY@P8WPj7p LNLN^_USWV\$D$|nOʼnmIWP)|$SUÉps9Zx 7u߅u҉3D$^_[]SWVt$(\$$W*8C KNL!3KNP!30SNLNjs0SNH 0SN~KN9H KNKN+L!3P6jVP W7^_[USWVt$FPhfp#蔪"3HQPPE"3|$Q1ۃ|11E4HWE9uSh#:"3HQPP"3Q|=1C4V"3HQPP讥"3QC9u1^_[]Ðh#bh#X\LNH \LN~`LNH `LN#=~u\LNH \LNUSWVP8!3H \LNt+u y\LNH \LN~xhL"3kh`"3^ dLN18!3~PX`LNhSp {ee8t_8!3xLne8#>WjWl !PjjK  hj#8!3pdLN8!3@1ҋ`LN  `LN@@P t 1+`LN\LN8!3{tXAˋ-dLNM dLN~ @لt`LNأ\LN="3t$5`LND$@5"3D$`LNH `LN0~^_[]ø\LNdLN1dLN\LNh#ДUSWV=8!3w KN^t)kUS~D(< t< u 8"3Hc F`LNF\LNF dLNG $9t V  KNt^_[]Ã= KNt^_[]ѓV \LN1~^Ë8!3r t ~6u1@1z\LN `LNSWV\$t$|$KN 8!3y tj1 8!3I  8!3A$A `LNH \LNH dLNH XtK =`LN5\LN KNt^_[Ã= KNt^_[WV$KNjWƍD$PV>uT#D$ =uD1PPPVD u2jPV] u <$ELF1PPPV}D uZV艌9t:$Ph KNu= KNt3Ā^_Wh#菒V)h;#|VWh!#hVWh#TVt$KNhI VjjVq |$ t8!3H~Q}8!3pxuh/ 8!3A1\LNdLN4!3 KNt^Ã= KNt^J8!3tL$T$9PuHuá\LN 8!3A dLNA`LNA4!3Aj8Q/ 8!3@1ɉH H$H8!3WVt$|$ KN|$t=`LNWrP\LNdLN54!3 KNt^_Ã= KNt^_鄐V58!3KNFx PGFtPg ~ u8!3VJ 8!3H \LNH dLNH `LN@4!3 KNt^Ã= KNt^8!3Vt$ 8!39t LNtPu^hS#2=8!3 LNt-Ã|$t=8!3 LNu(LN~Pc8!3@fWV|$ 9=lPN=0QN@!3t Pjhj">@!3MP@@!3hM P赉5@!3pPNBO9t jjB1VjVjVj ,QN9tQj 1,QNP5@!3^0T' h pPN9tQjL pPNP5@!35@!3@!31Vj2Vj'Vj=lPN@1Vx9tV@!3Fuh#!3^_(]0u& hPh#ލ ]0V& h\0@& hPh#詍@!3;D$u D$@!3hdp#2E8SNSWV=tPNjQEƋPh׬$藟|-1GPh5K$pG;|ۡ"3HQPP"3Q 5@!3tJKNV[V KNu= KNt^_[h#h#u[0$ hPh#VVt$ hdp#C^USWVhdp#C=tPN8SN1FjPlj+xPNi5rO@QPh3#! |,Ph5K$E;|ۡ"3HQPP蝙"3Q 誜W8SN8tH 8SN@(1^_[]h#+h#!USWV\$n;%u(sV8VX8H4#KS84#dS.8 |PNM5xPNAt#~i9:0#I {|PN4#4$D$D$=xPNC1tQ~H$8?uEt$PjuUt$27t 4#tl4#K\$ueZ*t%tS-tU+ED#D!3x+;|PN}#5xPNit c#\$1|$ t5^_[]áD!3t xPNiS#뚽S#SU"USWVxPN)i5rO=D!39u=D!3)|PN~9ut Ku ]t]tu`ǁTtCiu3itit0 5D!3^_[]SWVt$KN~X1tttG9uމjQuW19}q~5@tu ƆH KNt^_[Ã= KNt^_[+5xPNi5rO@Ph;#W+5xPNi5rO@Ph{#kt!Zu忀ރlt puԉпɁu8SNtg8tbPh׬$跍m=!3u =!3u@8SNtA5"3jPvW:8SNH 8SN@ujYW5"3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh3&W诗\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thP#jD$P萗 ] xPN)i5rOC-D!3+9tti-;)t RPh#jl$ U5\$D$PC$t+,D$0h'#jSS\$CŋCt:tBuM ,%Ph,#jQ贖D,ingD,Runn}=tQ l$ ,j SP1 D$xxl$ ?S1Cl$ ō,@)QPh5#0 h%jQ" ݍ,PBWD$PM݃FD$ ݋\$GHO W|H EuݍCWP$u/1M|t؁Ph5K$W N1MM|FGHO WH GHOl$  WH|1GHO WʐH ~T$KW9D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =!3$tCt>5@!3\9t%5@!3MPV$=|PN~y\$t$1=xPNtEt*t t.<$u u/S0=tPNu WE;-|PN| $^_[]tP0 hjPh#*USWVD$4\$,tl$0|$WUS} ƃuP8=VNtKN|PNxPND$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1oxPND$ |PN$iD$ 9T$tcu tQ=0QNt 1=!3uL$,uP9tPtu "3P KNu= KNtt~^_[]Vt$KN9tP\ džƆ1z KNt^Ã= KNt^~WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#5t$ntpu`SND$D$D$t 8SN8D$t(1PPS蘒 EjSڟ==tPNu|$1|PN-8SN~6@ xPND$u}t!AH Et{1jPƅt9u ED$u :u G Eu8SNt Dt111D$uD$|PNL$L$t$D$\$l$|$ xPN@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$|PNC$jU9 L$tc|$tNuJD$1rȋi4hfp#jD$(Pal$D$D$L$D$u U D$\$l$t0~Ot)D$|PNy\$l$D$tUD$tMjPS ?jVDžtjuS =!3u V Ń퀉0^_[]h#5zSh#*zSh#zUSWVP1$1C11h#1it"gu$ڃjt puЉ̉( 8SNt yjPƅt,1txPN)i5rO@Ph.#ЋH$t#tH~1i0 tPh3&荋11G^_[]Ã~1i4ht#U"3HQP~G ;| Z %PG ;| "3Z;|lh#xh#xV1=tPNujt$ St1+^V1=tPNt. |PN~$AxPN1F:uI}^V=!3tO=0QNtFD$t+ xPNi5rOA1ɋ"3u0VQhq#Rʉ^USWV=tPNu65|PN~%=xPNFt WNtPNl$|PN~"5xPNHI}KNtfiP!Ƌ-xPN=|PNiPUV ~ ;uKuU l$hƋ=|PN5xPNi 1҉AJw)׉=|PN KNu= KNtvKNfdž=!31lPN1B|iP KNu= KNtu^_[]USWV \$<|$41HL$AAA UQjQ ƅt#tFjUj4 VSt$@Wl$\$<$D$ 5 ^_[]D0jUj V Ph{#PuUSWVt$$|$ 0QNt!WWN~jVj螫 61-0QNKNPNUU~UVjl -lPNl$t$t%t =!3ttttk0hWjLWjAt uuqmul1VVhe%tOhe%h#QtVjuV5@!3_tTWjzWjzt*=!3t!WjzWjzWjzutPN^_[]B0K hPh#sUSWVt$ l$|$1ۃ=0QNt/t*=!3t!ttSV u5f@..@.^_WVt$ 虭KNNJujVjS 瀾tW5@!3蓴<u%+xPNi5rO9D!3t jVt=tu  ρπtt=ttu j`?u V KNu= KNt5q^_@0 hPh#qSVD$L$ =!3t1ۅ SPj觉 ^[Ët$1҅tހu1=PNu2tPNu) |PN~xPN:tzt Iuh#PN1@SWVt$$1@=PN|$(1@$#$T'Wh#bjvu htT#hV%tjjvjv t1~ h#21@^tjs%;th#h$jvh(%1Wvh#1Wvh#Wvh#jvu htT#xhY#kjvm~ t+u htT#Gh#:jv <u htT#h##Rjvu htT#h#7hw"v h{p#jvh#jvu htT#hh%;h#kFp]h{p#P~tF1SwJhN#.Sw 1> #t#P uh#hv`$vh#v#'1B#1###1#N9tQhfp#jWWSxuF x%Phfp#jVVjv S hE#51^_[h#h#jvUSWVfD$ PN PNl$$1D$Uލ}<$1!# x$']1,$]&~'t!=\tD"t $6\$ \|$ 'UӃ#\$ t #T$Ӊ$Ӄ;$#|$ t #,$ߺt&!}D$ ##(} u,$#$(%)|"qT$t=Ӄu?<'t u9$;u<'_.ֳ",$,D$1 <':'D$t#@ʼnʉ]|t GhJuJы,$ɉ/t t"@I PNPN^_[]WVt$ tG|$t jV~t'hV%hV%jVvu^_ÐUSWV$t PN =PND$P hVNt XVNlVN $=PN1jh'S eP >@Hx@u8/ZD$PVx D$pL$t 1D$tD$p1ɋPN9PNpKNtH1 8t:tGt89=P!3^ 9=P!3~pKN5L!3WPV  >DS#A=0SN jn Ve(: fiDle cDhangD ged߉Vv"3HQPPv"3Q D$pL$t PNPNE;-PN1-PND$PĔ^_[]24fUSWV<1Uj4D$hhh UPj xjH9u 9ÈPNj UL PNj`PNhdp#U9 ha#P!3,$UhPNdt$T|$PKNPN,QN0QNdD$PVWVW=PN Àu{=!3n$hq#KNttQu lKN PKN<$B=!35=0QN(ȃu6,QN0QNhI#'t1Ph~#QPP[V$=!3u!3 PNt N=PNuEt$(Vh#肀t8t$P1TPV$WN="3t =L!3)P!3 KNu= KNt`^_[h#`D$t L!3) P!3L!3j h#j },D$ H!3 L!3H P!3H 0SNH 4SNH4SNËD$KNH 4SNP KNu = KN_Vt$KNH!3;t H!3P FL!3FP!3F 0SN KNt^Ã= KNt^_USWVP!3<kKN-L!35H!34QNt|F9uuH!3PV  H!3H!3+ P!3 0SNL!3=P!34SNtG90uC H!3 L!3H+HH x@WSUP 5L!3=P!3 KNt^_[]Ã= KNt^_[]^h# _D$KNL!3)P!3 KNu = KNh^V5P!3P!30SN5L!3^WV|$ 5P!3+50SNP!3)0SN9|5L!3^_ËD$ L!3) P!3 P!3L!3+D$ȣ0SNUSWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$1 [!3t$Y!3t(81"3uƆ2"3u Z!3@uă^_[V(D$ T$0"39tu#RPh#Kt#1"3t(81"3uƆ2"3u숁2"3^WVt$ ~t)~tP^ uvJ ^_USWV jA 8SNt_y 8-uUD$$8SN1\SNP  8SNy8-@P1F PơDSN)KNDSN=LSN~-HSNFt7 HSN1NLSN1ɋuPSN KN= KN#I1F5DSNP)ƅDSN99SKN DSNLSNlj4$މt$\$)1*C/5LSN9rL$ 9v!\$ۋ4$ P; LSNw4$ 9vQ9wPSN KNu= KNt#HW1 ^_[]h,#vHh#lHh#bHh#XHSWVT$ \SNtstm8u'1z:trrD8uAÀ~:u"9u 8SNQ8SN tf `SN1ɉ \SND58SN>1t6?-u1t+O^8SN-uta58SN1^_[Ph#~GPh#sG|$u1PjPPfKNjw8SN8t PI KNu= KNtF1ËD$Ѓ w#j jP uPSNISNËL$~ND$tH  LSN=ISNu PSNTSNISNhTSNhPSNQpphB#FUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhdp#he#YZ J|$:uUD$8@?jPhe#2Z ^jUhe#Z 1|$D$0)@<Phl#h`"3"W jhe#g1?\$D$01@11T$4*l$Phfp#j UYWhUh#Y D$EEjUt$0oY u0^_[]À|$:uD$8@:Ph#K1L$0L$4UjCfVD$ 8"31qqA1Ʌ hPN20PUSWV8"3@$ u8"3@$EŃCߡ8"3@$'$ 8"3APUj ^á8"31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjjljF j0G5jGt8"3xJjG B u08"3x,u%@F#'t@/@F#'uh#jÀ=!3tjjj 8"3H0+H8O U 8"3p0jR@ 8"3QPI H pGu58"3~ h%vm|$F8"3xujD$ 8"3Hu 8"3H L$ qx0j@8"3HKH K {@;u.8"3x }8"3x|$ T@0GjG 8"3@t(HS u 8"3@8"3x\$\$j 8"3HK @0Cku8"3x ux,uh%pjD@<"31ɉH H 8"3Q0PCAHrAAtejC9t jW\G @:8"3@ u8"3@$EŃ!ߡ8"3@E<$t!t;tj dXÉ{؃^_[]/ uS\$|$8"3X0j&x@ 8"3QPI H X t\$|$D$C 8"3APsVL 8"3jj 5jj,jj#jj jjh%jjjjWV8"3x$G Hs8"3jpW$ uq8"3p(x,u~ 8"3At8 u @A8 @tHA~րxru\tuՀh'#8"3p0+p8j@ 8"3QPI H pG .P-s8"3@F 8"3t1^_jjVt$&9u^jVVL$1F#'tA1B1t AF#'u^uVt$j@ 8"3QPI H p^USWV |$$tD$ D$$D$l$E1$8"3xc 8"3x0$t $jPƃF 8"3QVI N ~ut. 8"3IF#'tAt=t AF#'u1c8"3H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc4!3 8"3A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j8"3 $+H8N~L$NL$$N @0FEPpj/vuG4!3 8"3+A8FF8"3@4 ^_[]jjjjh#L$1F#'tAt=t AF#'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;PN}X;PN~PPNI;-u{tBuG8"3x0+x8j@ 8"3QPI H xF^_[F h#lUSWV|$4!3D$褛=u ?vl$$5L!3P!30SNG$|$ t u g t19uDH $ tC9u?,$ u4!38"3HH }Mt9t u>u:<$ t=u1$)jWP0 |$l$$uS\uN0SNH 0SN'\F蛚 u%0SNH 0SN F4!3#á0SNH 0SNƈF tI=v4!3/=t h' u4!38"3HH 0SNH 0SNf=L!3)FV 8"3x4!3+D$^_[]USWV$$1҉T$ T$$D$(54!38"3r0=@ 't1$|$ fw|$1/fFn D$j8fNL!3 P!3 0SN=D"'u ƒ=0SN$‹nD>  $h'=>'u f|> 0SN4!3Bס8"3=>' f|> SD>fT$ 肘T!uhЃ`]0N,D05,/L>=B!'fu 0SNBn׍MN|$*@01fD T.fTT.fTT.fTDB!'fD1AL$1(ljƒ(M 0SNFD 0SNBvNO|$`@81ɃfD T7fTDD"'DfDfD> ɖ = 0SN\GT$ t$>Hff 0SNT$ Bf|>D>u6t$0 nMn 0SN}f|>  0SNBFfL \ D$$D$f|>tD>t 0SNBf|>u D> 0SNB 0SNB:Ã{t F#' 0SN}E+=L!3 0SNE{|$ðD$ #{w#}cD$ 1@Xftf|>u f|>Iu6v $ߪ nMnD.=>'( 0SN ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD@ 'fD 0SNT$ B1AL$ Y) NjFfL 0SNB)H 4!38"3@8xt hPN hPN$9 Nf|C\:`1" $}f|  0SNT$ BFu6$% Ft$HFfiD$$D$UP`ſ1۹$'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD@ 'fDu6t $ FHF 0SNB^N= t]\t 'u ͑ t =u 4!38"31Ƀxɉ hPN$6 0SNT$ 'uF|>' 0SNF$裔B!'$< u 0SNT$ BT$ 0SN ccet$1  4!38"3x5hPN0F#'ωD$Ѓ }\$fB!'f|t 0SN 0SNB\B!' u 0SNBNf|t 0SNB1@D$v 0SN 0SNB݃"XŃ'K D$0$ƥ nt$T$ Mn 0SNB1@D$t$hPN$4U t` Ń< ?\uJ\ ? \$1HЃ w&Hw ÃHÃéOu \ 0SNvNO|$@81BfD T7fTT7fTT7fTDB!'fD\$ I[L$ ur%=V =0SN D$  $ swF 0SNP?ˀ 0SN@F 0SN x?ɀtw 0SN@ 0SNW?ˀg^ 0SNGJT$ :I,D$SNSND$D$$SN(1zF#'t.0SNH 0SN!LjG F#'u\KЃ w40SNH 0SNLjG ÃЃ D$ u t 0SN׃Zn 0SNH 0SN=Gt/ up}tk0SNJ 0SNi#@ǽh#tE%t@Ń:b D$D$$3'¸U1#, 9u1|$Nf|uf|t Ms@ L!39T$ vNK؃|$F@11fT T3fTT3|3|t3ft1BfTft|>'fq fq ƋT$ \LNH \LN~`LNH `LN ËFD6\$D$$3't13')G 0SNx ?ʀtw 0SNE 0SNO?ʀ 0SNGZ 0SNx?ʀtw 0SNE 0SNO ?ʀtw 0SNG 0SNA?ʀtw 0SNA 0SNH?ˀ; 0SNx?ʀtw 0SNE 0SNO?ʀtw 0SNG 0SNA ?ʀtw 0SNA 0SNH?ʀtw 0SN@ 0SNA?ˀ[" 0SNAD$ ??s0SNH 0SN~2G:0SNH 0SN~$_1:B ܿˆB1>'nD=D"'G=>'tf|cf|.30SNH 0SNk5L!3Gf|uNT$ ؃t 4$t$Kŀ>ts4$OlىT$ )B8"3L$H,L$H $貾8"3pM tΉ$6 Nu8"3xĨ^_[]1HE;PN} ;PN~PN>uxkjy1$&tu>tyu6EBE9E0E"EEEA 肈}8"3h$ Ή$ Nu=tuS$D#$[#4!3 8"3A0$#^$h#K$#?$#3$g#'$~#V 8"3xt@@ ^Ãx t#hPN$)8"3@ @8 4!3H0\LNH \LN~`LNH `LN04ƃ~0:=F $'ǃ t=u럃F~t\u^蘃 4!3@4!3 8"3A0ythPN KhPN$(*;|u0d|8"3@=t*S4$D$D$>'4uۡ8"3@1v u4!38"3HH @1@Q&8"3@-8"3@8"3@&tQ;ub8"3@ |8"3@a8"3@8"3@ 08"3@uÁ\u?蹁 u64!38"3@81Ƀxɉ hPNP&˄jjh_"ʄ cVȋ 8"3y8~0 0SNQ0SN轹@ 8"3Q8rq8^USWV\ӉΡ8"3@D$ 1,$KND$+L!3D$$UP]KN$~Sʼn$S5L!3P薺 l$|$tD$$KN KNu= KNtlw4!3D$-L!3P!30SN8"3x t*hPNP%8"3@ )ǃ[~!\u9ǃ[C tJ$Q u"4!38"3HH s`un=ub\tX`tS4!3 8"3QQ NDt""u$0SNH 0SN~E\E \@ŋ 0SNA0SNٷ@0SNH 0SN趷EL!3@|$t~PŴt$jP D$pŋȅut$ j蚴E8"3xtH@1D$4!3D$j7ǡ4!3D$4t5 8"3At$ D$AExԄ8"3@t$ Ex P!39ًl$蕵 P!39~=L!30SNt1SUW )0SNKNU $ KNt\$= KN\$t 8"3T$ QKNNf|u%Du 0SNQ0SN@Vt$+t$ 0SNQ0SN@~.F0SNB0SNȅɵAJ։ȃՃ\^_[]á8"3L$H0h#W<$t 4$ /8"3@D$KNjPjj jjVtQ讒 N^V 8"3dp#ytA5hPNt7t u(VNVN54!3P5hPN #^USWVt$,|$0l$Uز5P!3ݱ1BW;L!3u(VGSN9w&SNWVSٵ U跲^_[]Áw: t9v$P5SN tãSN$SN랾"#뤾0#USWVT$L$ -KN[Ɗ*"30KND$1|$08"3D$|$ljWtJD$8"3*"3V-KND$0KNKNdp#jU\$t$l$=KN1F50KND$08"3$V\$S zVh@ 'P 8"3A |$t|$t=!3u #@݅u:T$1rIJ$JB *"3VVRL -L!3=8"3D$*"3t$D$KND$0KN؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV SN1t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu SNtu(Mxju PQ.Ex P,IU uF^_[]USWVl$ t$\$|$t|h@VS訏 VS輏Džt9u 9t SH9u95D"3}5D"3^_[]Åy00} PVShe#WHWVSh#USWVt$ |$\$l$j蜭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jH@ SN$SNM|$];PN};PN~PNEu9] uSNtX9X5SNt-pt 9^t6SLF9t SlG SN1tF9Yt? SNtHt 9Y jjSF PkD$($@t 9XjSF1xKNSN  bSN PN9|AQjSEF ǃt;=D"3~=D"3x jjWF j蹫$JBXxp KN|$u= KNt4 uSNt$(WUN mC1O ntuK5SNjSE DžDj8t `8ujjSaE Dž?0茥 PSh# \$t "3t"3|$t "3t"3^_[]j K PSh# 0 SN1tT$9Qt uÉVt$5SNj VD u SN|Qj VD u8FPj VD u$j j VyD ujj VgD t;D"3~D"3^h# WV|$ t;G;SN|.GPSƋG9tVPWwgDw^_WV H"3 A H"31F |71FPWWC y w;D"3~D"3P Dgfff  SN^_USWV$$$~KN 8k$<'n  SNt9i V SNtQt 9j b Y<(O8=!3tNnjUBƍD$PV#D$ =nhh]n$SUAoƅtjV3B!SjV#B $/nhh nhh UYA ƅV;5D"3~5D"3|'u" !39uu-jjWA 9t1jPWV KNuQ= KNtHA1jPWUy v K0蘡 PWVPWA KNt Ā^_[]Ã= KNtĀ^_[]hhh j F PWUh#0* PWh'#R1F5lKNV0 PUhs#m8VA8lKNwj0 PUhP#/USWVP xa|$\$;D"3~D"3oUJ= VUSH 1jSSّ t!t$f@$^_[]h#4$F@1EUjUjUUUjSj Vwt$  S4VD$5SNKNPV]SNVɅ  KNt^Ã= KNt^1=SNSWV5SNt4|$t^tCx Pz?jV6u^_[SWV|$ D"39|ȋt$|9}9| D"39tV'?jjVW 9u^_[W>Sڞ PVh#GWVSN |;PN| pSNt$ Pj V\> y2@8t 68u>SN jjV(> ;D"3~=D"39t Vi>^_Vj 蛣tL$ T$5SN0SNPH^áSNtT$SN9Pt u>P =USWV$|$<\$81D$ $D$1F5U53h#WSbv !1tbh$W趾hE#W蠾uo1h$Wthv}"Wt D$1p@|MD$K}h` &Wνt8D$D$h8#L j5"31CKD$D$u}h[#n v11 t=t8t8t6u TNr1TNXKN KNt^Ã= KNt^mSWVt$u TN1ۃÿSNt6SN8t+KNSPf KNu= KNt SN=TNru^_[*^_[V1=TNu#SN1A:t2>u TNr^WV|$ O0=TNu =XKN1=XKNu0u+t =SNu"=KNtW= VNuN KN]tEQu95"3u V^_5"3t$WVt$ Nfu$VNFNtF t0fu^~KN ?NQP薏F N)NKNvYF FF KNu= KNt V N^_Vt$F t-)t'VfxQPR yNFN F^5"3t$USWVP|$t$j'Vmt~th#Vi<k>t!h'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9="3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Q j'Vot)19<>^_hL"3oh`"3bUSWVD$~@|$l$1SWU$ t 蠽8tF r)~1H^_[]ËD$)D$KNX"3tPl 1X"3P"3 KNu = KNPD$L$ T$$RQP XVPt$t$V tt$ P4$Ul ^h#PD$L$ $QP5"3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+WN+4VNPqq h#jhWNWNSWVP7t9^ uSUv6 t61^_[]ËD$t8SV ƋVN`uVN$5j VN#t#$#t%`^VN㟉VNt$D$$# ^[WV<5KN1$|$PWIt $D$PL$LT$H=KNPQR 5KN$<^_USWVL$T$tHtA|$9t91F#'Írjt/9t+1F#'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U藩VƋ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#WV<5KN0KN$|$jWu"D$LL$H=KN0KNPQ5KN$0KN<^_USWVD$ èu|$=Z!3uÍD$PQW Ƌ@N4KNNt%݁ uF @VSPу F`u vg NFtʁu F11ƒʎ! stځ ʉV~t&uفuN AVSQЃ dVNtPVNuhVNt j} KNuk= KNtb[r2jXxL$H @ $  $#`uWf `u W{f fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=DSNu0@= ~ F1gjt$VNuQG L$<=u58VNH4VN2UjS $81F FF4VNVN~WN5WN KNu= KNt^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ dKNt8Q12<08uF=u =ut j=RF^_[1VVP tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVWN1tr:1҃ЉuWNr׍PƻWNNj+t7Mȃu%EttUЃuEmŃWNr^_[]SWVWN>tLGu% uwa Gu#Wa @tw2Gg;uWNr^_[SWV|$tfh#W'[W9uWh׬$V't*tUj'W<}t8)WPh# h #GhO#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhY$ctUhY$Q>=uD"3HQP~ j( P "3j)n~=uGuthZ#EU"3HQPP"3Q ^_[]USWVPWNuWN hWNT$ t$\$WN1<$?tIOt !T$ ttуt݋ WN9|QP~T$(WN%WNt=t 0SN>:G 0SN:pUSWVD$(01r$11h#At7ptnuO1Gru=t*t8SN8t$jUt$VD$D$^_[]á8SN8H 8SN(tϋ$ЉD$D$D$ P1PU L$ \ =u4)Ftt.L$!H=tFt=t UЧtvtt($t@u7=t $ H 4$VU 8SNH 8SN(e&UQh# 1@D${1 Uh4#9ru Qh#Qh#VNtX1h\#薕Mt(IuNt xuփуVP8SNH 8SNu1^hJ#USWVP\$jPS9 1NjT$@tуu1FKNuaՋOW | uujh'S GuGOu' u w[  $W[ G KNu= KNtc^_[]SWV5WNWN~tFu7jwm54"3v hT!3  v [ ENtuV _ BWPRу G u wZ FGF GFGVZ M^_[ËD$ *ÃuD$jppk 1h`#USWVP1$1E1h#ae~ft&vtxu teuԃe$뺋-8SNEt=$ ˃1$u P~ ƄuWu ƋEu1^_[]fSWVt$|$h%6u"h#tDO1@$'N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h#Mh#CWV|։π9!utNWNtfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPI1>?f u%PVg$1u%#L$1PV#1t1Ʌȃ|^_1@Ow$'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$跸 t$,z19{USWVӉϋuWNfx@$h'$PWG"1ۅD$PV/"r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWx!1ۅD$PV`!$L$$t$<|$@11$;D$D9t$ aZ$PW!1ۅBD$PV ,$3D$ $3L$ $$3L$3D$1 dVWm1ۅTVW]1ۅfVWMVW91ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]Q9-u1tQyt8ytBÄth #QA't1hY jjh'QhY jjh'hl jj hT'RËD$L$  )VL$D$ 2)u AJ)^USWVPףj PV lj躣8t"谣ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#)Vh#USWV׉Qt 9Fup  ^^u9uM1PPu~ōPqPUu~ LH;NuS3R #~^_[]ÐUSWVt$(hdp#jh D$,^H $x?-Ok-u)sstdluu~xwGWOÅu"3DHt'1Ʌ S~كhJ#h3DH\ƃ~ƀtVtVSVh0#jރ $hw&S1Ʌt:SMu+$891V5"3YV:|-$K$8ʉT$h` &W赒1Ʌ9ufمu$1D$\$ $,}%urUXDžl$UW, u.&|u" $4Ph%; 1@D$l$t jW#j D$PU谂 ljӋD$9t-ف8ur1u ٟ8tQ#xdp#UPh# 1@D$\$ $4hk#1@D$F \$ t$Ph#j`KNPPPPh#5"3jxWVPΉj WQɁ 9u=у|=}^_Vhz#jQh#j5"30jWV@hhLNt)j=WithW}>u8Phfp#j@VȵjVh# Vh"3hE" G1$VWh# 4#t%VQh#a j,h#h#M VWh#>L^_=KNt 1\LNdLN`>8"3dSN1xSNSNdSN9SNtj=SNu"3L"3"3`"3"3tPL "3Vj.15PKN =CP@kAQW1^_[SWV|$t$8&'$X%'Vw vVw d_ t"Vst Vw?wN@F1Vw q#w ݋N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u8&'E$%'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tH Ã|$H USWVPu }WNWN"3f`|j%vdm O1@ 0WND$,WN|$@t$(q%v>%L$ h#V<*u C hs#S1N .u{*u{ 1HD$Chs#S1HD$  t$CD$'C`L$&~QF0 $&'. D$׋L$ jj D$tfL$tjWt$QPhWNTFu$p&'WNl$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhWN蠗WNL$ Q0 |$WNH WNT$ l$=WNuM|$L$ jL D$tbL$l$tf|$ L$D$$WN>d\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$WNL$\$L$$X8GWN0WNE ƋL$ cjl |$D$VPt$wWNWNWNWN1  WN WNWt$*|$$WN \$$0XNWNt PD V螅PX4 WN҉D$xF\$wZ$&'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V0XNWNT$t PC T$WNWNt PC T$15WN5WNЉ\$H\tF5WNX])P0tXM\$u/^t-u#F5WN벸^tic\$>T$ j5WNF5WN{ 31:DYt 7GuF5WN\$DF5WNȋ\$+1L$ jlD$t1L$t5WQg0XNL$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hWN PRQt$QP  WNFPN1 WN VjxP艎 7sWNT$t t$L$ t PVRQhWNvMT$L$ t1PRQhWNW.VWhWN1PQ*t$P PQhWN' tWNWNT$z \trB<]*<0tu$4'' ?$''."'#Eu uShi#AWN 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h##WN\),ҋ4$u|$ uWh>#pWN ^_[]WVPWN0tpWN1ɉQPV胬 Nj 3#DQt$c#r& WN+ WNVQP WN1^_SVˡWNH WN u:"3Prp~r0 PW"3Q 밅uWN)"3HQPP "3Q^[SWVPWN0t"WN<'t<"u1B^_[11f݋1ɉQPVon lj+t:<-t6 3DAu)WN+WNVPh#达 WN $ڃ^_[SWVӉQ{ǃArVh#uWNGPVhWN+. D$WNWNƇWN^_[USWVP׉1PPP ,>U{@PUQ x$tG9tCWN+WNVPh#޽WN+WNVPh#耽 WN$^_[]WV9t"΀:t9WN+WN9t\VPh#ZWN+WNPh@#cD08"uD=WN+=WNj"iS PVWh#.RPhd# WN^_USWV\$$8l$}h! j jh''U躚ƅu!h! j jh('U蝚ƅH h]XNuf^?^@P@#uFj PV o8u$8u؃^_[Vh׬$j WVh#jx USWVi fD~NTXN <~Nƒ <~NXXN <~N€ш <~N\XNP @~N`XNdXNhG|##t h##t8ƿ1'#PV}`tG uVh#j $$1ɉh4#SUj P6$0-'hXNkj j5U褍 ƃun8"5TXNXNv Uf\XNWj j5UG ƃ _%xXNj j5U ƃuxm8"G5XXNXNXNpXN1A5U5Uh<#V^tch`#V^K|XNlXNBtXNlXN/\XN#l8"tD5`XN  9u`XNrCjh#5Uh##VhR#5Uh|# 5Uhc#jfu h# dXNt 1ҁ‰XN<~Nփ95\XNu<9XXNu2D~N9TXNu#@~N9 "3t "3lXNxXN=XNu\1ɅQL{h# 3=tXNt)ͅt=|XNut 1jhhXNP41 $yhXNh׬$j&=xXNu1D$(Pt$Gu#D$0=u lXNxXN1N1$ .' $$h"/"t$h#Qh΃%hV衁Vxth@$PV$Ph׬$hXN$^N $=$^N=XNp\NB=hx0#tlt1@$$Phmdt$ hh#h|tWWhJ# $=]Nu ]N = ]Nu  ]N 4$h\N TtXN $$1 uWhPh\N; 1\N\N\N\NtjVh\NN4 h\N\ $RhS|\NhXNVW0 5pXNVWF5 WWl$t$D$ 1ɉHHD$UD$ Pj! Džy#g8#Bjvx߉DžV2x9ujUj 1|$nhx0#$P&<hjh\Nxc ^ WVt $h#hl383H 3~3H 38h3Wljt9 t43H 3~3H 3h3Wƒ߃NyjUj h0#\1\Nl3hXNVW4. 5pXNVWj3 h\Ndtd($Ph׬$$P 1@PujUj' PYPhA##tǍ$PWh%VD$uh"Z$P芟K%jPhgO#QQƃu W"+ V%uWVθm#.'PVWt uVhT#j#G \XNXXNGTXNG`XNO1,~Nt^_^_WV΃=,~N 0~Nt>dXNt49t0`#`#9t<#9t<#QPh#/ 5dXN,~N0~N^_SWV#b3'3'VSh#hĆ3J9#ujsVPjj"P th*#訉1Q1X.'$ =uh|Y jj"t$ &1$4GF"u4$ 1@^WVκb_ u1H3 r1P^_V΀=lXNu6=\XNt^ t41t)Ph\N0h\NhedAV xk^Ã=\XNu^ Jt=xXNt7|XNt.h\NhedAVp th\NhrdAVY t=$^Nuj~rhV#jhg#jUSWVPύAPjh$#hl3}Gw443'hH$PhO#hl3} l3w(h[#Vz} w,hb#Vi} w0hi#VX} w8hp#VG} w4hw#V6} W4O<W8#9tQh#h~#hl3 }dp#OHtQPh#hl3|dp#OJtQPh#hl3|dp#OLtQPh#hl3|dp#ONtQPh#hl3|dp#OPtQPh#hl3b|dp#OTtQPh#hl3B|<$f$1۽al3Pjjh#-wVh#l3P{wVh#l3P{GtmL$01FfyHujhj#!L$0A8u A0A,A8y<uA4A<tK1q(tVh#߄L$,C%# 4#E#jP軄1@$$^_[]jh#蛄L$0Ft1q(t'h#vL$,jh#aL$0F`XN9‰4$sRPh #4 V`>ÈJ9|6{u;[tVPWhE#D$(ffL$(D$ 1ۉa)D$u!)tPt$h#腃L$4 <)ǘ΋I<9vt$h#\$N<.”T$9vt$h#0$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h #ӂ D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ]N ]Nt$(L$QhV  D$ 1h#VtG<$h0#VZ4(1>tYj:W'D$AL$\$h0#S,1tD$h}\&WMtkhM$WMhv#WM\D$Ph#W_4 D$q;`XNef]NujhM&l$!U l$43'1tUP! QF3'r܉1hD$ Pj <$Wh"#ۀD$ D$t$ <$}trÉD$h"U:! t:h"U(! t/h"U! t$UWh`#c F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh#D$ D$\NFʼnD$uf5\Nl$u D$l$l$hk$WKho%WKh#WKh#WvKh#W`K h#WJKh"W4KTh#WKh"#WKh/#WJUh"WJkh3#WJh=#WJhJ#WJhU#WJ<w ~W|$Whi#4~ T1<$\NjD$<$rt$Wh8#~ D$f\N@<$Wh#}`XNf]NjUh\NjUh\N# <$t$ht$0VC~ J21jD$ Pj< D$\N뜉1jD$ Pj D$\Nq1jD$ Pj uuD$\NJ1jD$ Pj uND$\N#1jD$ Pj u'D$\N1jD$ Pj^ tt$W|$Wh#|D$\N1hD$ Pj uD$f\N1hD$ Pj uD$f\Na1hD$ Pj ^D$f\N11hD$ Pj .D$f\N1jD$ Pjc D$\N1jD$ Pj8 D$\N; `XNsr"jW|$Wh#W|$Wh#΍L$$ t$$]N|$8~NL$$ L$(]Nt$8~Nrh0#Vl$}}X.'1ۋ>t.WELt t uPUW Á.'r D$3MDHu D$"91hD$ Pj t4$h"#%zD$ \$"r)Ut$h#z h #yD$1ۋD$0]NND$0]NW0D4(t$|t%h0#V L$1Ҁ<tʉT$D$< w'<$$,.'L$ L$,]N<$tL$$L$ L$,]N|$8~NcL$$t D$|$8~NL$,]N16FL$<$C fF|$8~NL$! L$,]N|$8~Nt8L$$ D$|$8~NtL$,]N11A<$D$ h\N1D$ ȁ(^_[]4$h#1xD$ WVPθWEV\N]Nf]Nh\N f]N=lXNu=xXNu#$}h\NhgdV 1h\NhfdV yQ8t Q8uv$=xXNu(PhmdVn xX5"3hY Sf1=xXNu$h\NhgdV2 y <#1G^_ù+#h#5 뙃="3tt$ t$ t$ 3 )Q1HVD$ t$=\NthPh\N_$ ^D$L$01BVPt,uVh#-t"uVh#Vh׬$VhM#Vh#Lv^h4~Nhmd5"3& USWV8 $RPh h(^NQ׽(~N XNv|Pt$h#u lj D$T$1D$ XƉ 11 ‹l$_N (~N(^N9(^NhWD$P" $;D$dp#=$^Nt =}t=}uЉD$$#=XNtȋ XN=WEVuT$tf9`XNrD$Pftt=XN%4$t$Uh#t D$t=VEW=XN$t=VEW4$t$UVh#^t=XN|4$t$UVhF#:t=$^N$D$PSt$Ut$Vhq#g=XNu $hXNSl3V 5pXNSVI SGSt$VhVWE! $^ND$ L$D$11t4$h#8^_[]USWV T$ $11F1Ń=XN|Uh#*s QPWD$Pt$׺9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=XNtUPhI#dr Ɖ ^_[]Ã=XNtUh#|=XNtUh&#&rċL$T$tPh\N11@Ph#t"j QPk uL8"t1HXXN1Yh#jBPh#7t"j QPUk uK8"t1HTXN1Yh#jSWV։ϋ\$+tXNtItEutXN1tGtB(^N_N(~N9w1(^N 1tth\NQA1@^_[Vhi#j.L$1=\XNT$ PG1ɅɉWV(~N~( WRPh(^NQ (~N9u ^_h#uQVh#jPQVh#jUSWVPӉ΋l$|$uj WVi EuSJ"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h0#V <t#ƍFh0#P运1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh;#Wh#4o1۹8~N؃^_[]ËL$9/up\ND$\$A/jPU u$D$ \ND$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh"#an8~N!Wh#Kn8~N1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#蜒D$$Th#Sut]"H4'W7PWS8 '> uۀ$U-$T14,5'D$XP' tpC"uD$TPhQ#k_$T$끹5#,5'j" $eFMu SQЃ {Sh#_h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$ `Ph3#[^VPhrdA$d t"$D$hR#|/$PQhk#R~$ $u ~ˍ|$@WVg/9t"b&J~PH k$3'1OJH w@$4' t&B(D$ D$$l$ CtGtngtbcB8D$D$l$ct&ɋB(D$(D$,l$(Bt&ɋB(D$8D$<l$8t&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=L~NuHr8jVSWi'D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph?#PhN#P~USWV|$t$t$h"VMS Gw45'h "Ph"V'S GPSh"VSGPSh"VRVjjhQ&GXtVjj h"GXtVjjh"GXtVjjh"Vj _w(h"VR w,h"VrR w0h*"VaR w8h?"VPR w4hU"V?R wu 1<1A71Au01<  $jj@PD$P<D$ Ph׬$GC9u<$u4t3H t3~l3H l3 hl3j 7M1^_[]h#jfUSWV $ $ D$-@1P~NT~NP~NX~N\~NX~N$`~Nd~N`~Nt$ h #USS c~!P$6' h~N˃PtdT]=U?1AJ5Ukl~N뒹 .U`~Nhdp#n h~Nb h~ND$p~NT$:@=P~NlUD$ Tnt uBxou D$ 1Ɉ t~Nh %VLtP~Nhdp#`ءU$j:WkC-X~NtWutmX~NS c$ \Wh~Nth~Nt l~N39$ 1ɉL$tVh$P tj/U u Uh"hAx%h$ UCVǴDžuVDž7h$P' Ƌoh#Wt(h/"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tU)lj?,$u1QhD$PQV_ hx~Nhzd@PQ  tq$ PhedAW7  WE|$ WD8$9",7'uW(N,$h+ h{ 5l~NP Ġ ^_[]h#j^$Ph׬$jzVh!#j=h{"hz"ʍD$ Ph# D$ Ph#jBD$ Ph#롍D$ Ph#땍L$ Q4<7'hC#USWV։ϋl$j Vi U^ CCCOK G^_[] (hT8'Phs#hĆ3DjJ9USWVP׉΋tASeWZ4$4(VS Whk$Vt$ Po@ W É^_[]USWV|$1_h#St$h/"Sth#Su\P~NtoU3st[u=t~Nt .=t~Nt%`~NtoU3<t [u^_[]USWV$D$|$X~Ndp#tW3t CÅushC$t$ uD$ r%D$ p~Nt L$ mt L$ ^$D$ D$h $$ t$hn%hV>$0|$D$4$L$h %Q3F1G@΍K9|,SP Ŋt><-u(GD$tj=Vbt>FD$ GD#th %D$PEu|$1F1B,$֋$$$,$Dh~NtPdp#tH"P$hL# ? xF1Ë$4hw%?C9uj >t2ƅ|$t t$y 4$n tA710h\#|$t t$D 4$9 ^_[]ÍD$jPVn x!L$ȃtuuh#z묁tlP PUh5#K 끉 h~NutD$P$CuW$P$u<1#t#Pv vvh5$hĆ346Ȣ$SWV։ϋY Wss ss҃ Nt~j LuWss ssԅuA N^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ蕨uU PQ40!40<8<8D@D@LHLHTP衧TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@ǦD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7MVw w:V Fww&VFwwVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u ͤS$C EDȉCDu,u(豤S,C(E@ȉC@u4u0蕤S4C0EHȉCHudh$VŋFN8NtbSQP 8Nx N~,=NtffOfGG@ Չn,~$N()ǃ~$N(=N9<$D$hP-N>N,ș)N,)n$F(teh$V$FN8NtbSQP 8NHT$<L=NtAf=Nt4f.<$ ^_[]PNNF,)F$N($fOt@ PN븋D$L$t$ QPQPUSWV$$$ $$$(hY$SV\1j 3 D$SVWUhPD؃r_N95NrPSV Pt7=Ntf%"=@ttl#WQh{%d Wh$T^_[]USWVP|$\$s s@=Ntf9uRNt=xNt=Ntj:D$1PPPs sQs s6ON3C N3K u "3&=Ntf%"=@ttl#Qh$胣s s/)SUh$x xNu =Nt:yj xh$xNthE$Q=xNuh$u=NNt7t;f5PND$Njh$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=Ntf=NtGf"@ttl#Ph$/SVz.=xNt)1=NL L h\$Oh$$p$l tRQf@ NN 1VW "3L$@D$DD$= t$|$ Npt95Ntʋ N5NT$Htt tɉL$LL$QPh$=xNuh$515"3PPPjNN  5"3RPjjt:dN=xNhQ$~ND$L$ NN5N=N tYjj=NHNtt,fI=NtftfI=NtfIfHVW51NN9xNt-j  NN djjQP NN AQP=Ntf%=@5N5N8,$t$R=NN t# Fjj WS袞9ݹÉrFND$P9|$P$d닔$hjj RS` )ˀ0^N9whE$訞hc$Ntf5NN15"3WWWjNN CRP5"3jj_h$hn$1PN1P^_[]Ë$d#N N$tҍt$PtV$lSUQP4$SUfH1G@u5N5NhA#SUu.$l#$pthA#5N5NSUq5N5NH=NNfA=Nfh$PNh$h<1#Jjj5N5ND$DD$( t$\$ VS@@PD$PQVSf@5N5NtfA=NtfA$l$p!fHG5N5Nqf@5N5NSU5SUh$ t$p$ph$ =xNj USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ@N@4 1WjPQWWRS 9=Nf"3 Nff"3=Ntwf"3 Nff#3=Ntjf"3"3f#3=Nt"3ȃ=Nt]D$ Yf"3 Nf"3f"3 Nf#3f"3"3f#3=Nt"37D$ G UV=Nl$$tApQt=NtRPߍA(=Nt1ҋ @NI4-8NteQRP 8Nxtt$V/11jWpJ =N=Ntf=Nf"3@N;x4})}jh"3W =NE @NA49rE =Nt<$fGj \$l$u6_=Ntf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=NtfUVfXW|$$Wf@t$$W=NHNtt,fA=NtftfA=NtfAfH ^_[]UUSWV$$1Q NN9;$$߃9։$PU$T$L1 B(BQ $BjZr1B$J$=Npt$ =Nt ɋ=NNL$xtt tɋ=N5N1L$|1ɅDT t$t RPd5NUVRPy tE{[|$t}SW*ljUVSW<)SWlj_{[ |$t]SWljUVSW)SW轉lj?UVSW)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV N1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =Nt SWو @NL$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =N<$\$T$|$(t$,DpLtL|Dx=NRSTtDp@ND$0X0vvLJRP蹇VFvv襇 RS蔇VFt|tx|$8zD$T$Rl$$D(D,=NtFB\pTt@NB0FN FNDxD$L|׉L$L$؉D(MU =Nt]RQ @NI0VPچU EMhɡ@N@0 ȃ=Nt3ȃ=NEhD,t($@N@0MU EhEhD,=NL$ tL$D$D$=@N,$\$ 1QOP\$  t19}#8@#pLp0l$$ 8NɋD$taVt$P= 8Nx4ƍ$5NpS @N@0fPt$t$ 8Nx5NSp N=Ntf؋Nf"3@NB09}+^jh"3S N@NB0N9rF =NtL$L$ L$ 1YJP|$ uL$ 19}#8@#rL 8NtaPt$t$$ 8Nx=Nt$,|$(DxL|DpLt1҉TxT|FN=@N<$09NQPY)RPFVF^vv/ )RPL$(D,D(D,EM =N\$QP @NI0)RPȃU EEhhȋ5@NN0 )ȃ=Nt^ȋ5@NT)FN^FV )S\$L$4$*5@NV0)EM Ehh )ЋL$Ev8QS PN1Ą^_[]Éjh"3p֕ $Ph*$k=xNthk$K=h>$߻F & @N@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lFNpt =NtɡN=NL$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=Ntf)9F=N\$tAf)=Nt4f=Nt'fL$=NfVT$Rt)f~T$JR>>fD>=Ntq1@1$CD$ƈCCEUL$ q/G9<$u1A=N=N\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=pNt Vt$t$Ut$h$1Ƀȃ^_[]1A=Nt1=N<$\$ HfUSWV $8$4}tE1ɉM4M019 N‹DT 9 NtRP}M$U(E$f M$E$U( u ^_[]%=uLI@N(9‰|ǃ=\Nt<|u=NtFNFh1 tNtD$hVP |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =Nt RP| @NI0VQRPN։D$D$ ЉT$t @N=NQ8k=NL$$tL$D$ =Nt QP | @N#8t@DQL!!IT u‹$8U t#DT tE=Nt!RP{D t(=Nt1҉EU}@U=}@|$PNEM QPQPh$3WWhw$聇h$'uQ{u u @Ny0ƃ=NNt:tMPWz?UUlCD$T$NQt PWz~V ~V ho$4N=NRMT$=NHRPU9L$0ơ@N@0 T$D$=ND$0T$T$4=Nt$$t RP%UMt$t$$=NtȋMD(@N@0T$,‹t$(΃=NNt+tMVRTuVFt$t$ T7KVRTMQ AD$:MQqD$T$AQ!EL$DT=Nt1ҋ @Nq0RP耐 ƋL$ jWSQӃ=ND$ t7~SPt$t$$DzNjT=Nt RPS|$)~SPt$t$$萲=Ntȋ|$1҉\$$ t/f @Nq0RPݏ xËD$L$ L$0|á@N@0 T$ʋL$ȃ=NL$0T$D$t!D$4=Nt)PQSD$ T$8=Nt@ɉL$ D$ =xNt h$X=Nt h5$XhX$X/=xNu h|$WX=xNu h$W3=xNu h$W6=xNu h$W<=tNt=xNu h$WT @N|$Y8֋T$  SP5N5N5N5Nh$Wd,$kdы@N@DWSQP4D$T$iщډWSURjj RPWRPt$t$t$t$t$VD$Ph<$$=pN @N+N NN NN N tQPhr$- =pN-@NKC)s, N-NՋs4HS8\$ ډD$$+ЅN$T$ԅN $ $ډ Љ NNtRQh$u =PNt8h$_5PNtvvh$B 6j T=XNt8h$5XNtvvh$ 6j 15XN5PN5TN95Ntmj8P @N405ĄNh QVZ 5LNVʍ=NtĄNPPҞ5ĄNzȄN=Nt PNj @Ny,t+N1TtRf N @NF;q,rNPf N=Nt =Nth$S8N1=N=xNu h- $S=Nt hT $SGRtgD$Ph\%ju1D$t)L$ jQPh\%h r%dt-=xNu ht $S ^_[]1USWVHND$45@N~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B ؅Nl$9؉|5@N|$0G;~,$LHN4H~KT$މ)1@ ؅N9׋T$9|5@N1҉t$L1F NNNN9S,SދD$4HxL$HD$81ۋjV @Nׁ\Tډ\$tQ!QЃQ SPhNE@N5 N|$ ǾN|$(D$D$T$0كD$9T$0Љl$(V Xj h`NP* D$ D$ {~hq닅t)fQP1>f $AQf $AQ F4D$ D$f9^@ND$@0T$ t$QPVRIʼnׅD$,%1= ̓|$@%=N$T$ L$um=Ntd t^;9иrN $yhtENQ(=Nt=ʋ @N7=pND$ WUt$ Ph7 $D$L$Id5NjRVP{ =pNL$$t$ \$ t(Ƅt$S$PVQhc $7L$<VQjƃ(S$QPRO =N4$t 1FFFh@N\$ T$ D$(x+9‹T$ʋT$ r=\ND$Xt1NPSWU这ʼnFظ|߃\$ <$w4FN<$t LX FuWFsT$ NN$@=NtfL$fAf|$l$$j I hX XNXNT$ =pNt| $=Nt RP9RPh $l=pNgq$ʋT=Nt RP9WURPVh $1($DX=NtPh $ PNh $Eh $frT$ '|$@@u' T$t$SUt$A Nt$D$, F=N=N$@=Ntffu$@=Ntfft}SU{$@=Nt?f=Nt/ȃ=N $ApfAAt$f=Nt $ApfAA $AtfA1ɉ N N N Nl$T\$XNpt4$9 Nt ʡN N$tt4$tʡN N1ɉ$dtX$t $D$LPt$衹=N=Nt=hNu,$$@\=NtȅSUh" $C hA $,p~SUؾ19 Nt1ɉH\H`HdHhHl$f!B=N,$(E\=NtȅƄ$E\=Ntȋ @NI0H111҉,$L$ D$t ߋ @NY8Om\=Nt͋ @N#8߉@DYL!!ÊIT u,$\$lD`Td t<=Nt RP5D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9@NH4 D$|$׉D$|$=Nt݋AQ=Nt-RPG5!Eh=Ntȋt$|$1҉11 ˉl$$WVRPSUhi $uA=xNth $UhW$m|$t;SU蕼ƃ=ND$|t1$=Nt RP4FVPN=NtȉFhܽ$|$jj$$$$SU z $A`Id=NtEQP4 $plph31$D=NtWUPVh $  $AhQl D\$C5@N;^,T$$L$ NN׃ƃ=N5N @N9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-Nt$| ؋T$(tu3D$1 Kl$@؃,Ut$H{L ƋD$9\$(s+l$ UhV $>jSWUt$@hz $hO $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wN NʃǃN=N|$ |:w wh $= =xNh $qjG $D$|$tjVU¾ ؅N<)1CVUh$D$,p p*N NʃǃN=N j O? hp TNtHTN PN9tDy1Y1 t 9u,NN$|$ ,TNPNQ1I1 ы|$ tTN$G0W4L$Aڃ]D$ p ph $J< =xNt)h $*1C+PNh $;h $h1Ct ؃ ^_[]PNjpj"fUSWVP$T$1B@B PNN@Nx,11=Nt>Q:@Nx,$kd1PWSQh $hĆ3N@N1ۃVU聶tzljl$ t$Npt=NtʡN N1ɉT$HtttȉD$LVUz8tD$PWbu(C@N;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$NŅtTM1ًU1 u3VSh$w wNHPUMpXN TN9tmu1 TNͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $@9'h@ $F9hc$eh $ejj聴=NNf@=Nfh $8he$eeU1hPVPVҜ1Bh) $8hc$'et21VWhVWVW莜1 tah $+7PNh $du<tf@=Ntf @f=Ntjjxfh j5pN5`NB^T$1B@B -`NpN  $N$Wt>E6+5`N=pNkdPWVQhu $hĆ3NuF$h $vv 躑 NA1ڍF$h $cvv 6ǃ=NF$ N&jP:*1 NI F NQPQPhSt=NF$ Nt%QjPSh,"$h $>6#PNQjPSh,"$h $36=xNthE$=xN1F$N I1)щN$uh$b-vv *ǃ=NF$ N$Wt jP+)1҉GW1҉GW }hjD$\P =NND$tt7fD$T@jv$(-fD$T@jv$(fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=N$tD$\=NtL$Lu$D$PD$PD$XPyN;,$/PN$W=ȅNvȅN5`N;4$]|$T{$AhjW -N=Ntt0fD$T@js$&&tPfD$T@js$&FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=N$|$TtD$\=NtD$L$|$TtD$\D$PD$PW٧;4$=`N;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h $ss QPTh $(^t~s sqf@fNCKK CQPhA#ss oOCK =pNth $ss QPCKhA#QPss fN PN;<$=`NpN4~^1ۋ/uu q]]8u9rۋ=`N/CK tS  StQP HKX9rjj轄`^_[]PNj&ej藣PhY $/L$D$@, +A,USWV $0 n8$=Nui=Nt`E=NtȅtNE=Nt$;NNs&E=NtjPo@E$F0N4 utEh%P跄)$0 F=NtȍL$A=NAAhh%Q< N NtD$D$L$L$D$h6$v v薉 E=NtfM9v%}EPhP$.w$hB$4[4/E=Nf)=Nf=NfEtf=Nt΋$0 AI 1 h$QP辈 h $Z$0 F=NtȉE$B$PpZEL$fAWQU4 $)fEPUV3 =NtfD$fXWPU3 $0 G0W4w wmfH$XPN$0 =Nt>}t8h$v v贇 h $Yu EBPNF0N411G9 v vGD$@=NtȍL$A=NAAhhA#QC: N N tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=Nt2f)=Nt%ffD$=NffN )fD$1fM$0 A0Q4MT$ tjQkfHD$=NtfPjU D$fEutEhA#P蝀l$L$Aq $0 JR ωtljh$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=pNh$ڃD$=Nt΋D$p@ =NX}$0 ~h$v vڄ Eh $VJPNB$$0 1GPVtXD$T$ F0V4=pNh$ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV/ D$fXSPU/ E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQU-/ $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh $ U4$F0V4=Ntȋ N9Ns5h$juv v݂h%$T4$=NE=Ntȃu}uE=Ntȃtb}u\FN U=Ntʋ4$h,$jRQPX=Nt}Eh $T1 NEtjPgC$0 A4y0?$$0 t=xNG$=NJR u=NtPjVRQ菁h%$cSƋE=NtjP1Ƀ=Nt fN1ہ@€@t f NfGPN4$Crv $0 A4y0AI U=Ntʋ4$h $jRQP褀h%$xRPNzE=NtjP)Ë@ C$0 A4y0AI $QPQPhRcE=Nl$\$tȋM=Nt1퍜$UQUPhScShg$$"Ph]$ %9-xNth$l$\$ h%$zQƃl$\$$0 A4y0| AI KC=NtaEO9tU$0 AI U=Nth$jRQP%GEh $Pu $ PNfO4$E  ^_[]ËM PSh$"ȃ=NtUSWVT pN`N,=Nt>)"=pNkdPWVQh$hĆ3SN}ww cO W $T$ WGO ƀÄ:1=xNt4=Nt+=Nt"uGO 1F9ƺw1 tbQPc8uS=NxJ1v6KNj@ $GD$wOG tQPb8u E;-N|E;-N=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$DNpt =Nt ɡN-NL$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t NN1JQPFafp`N9)T^_[]fUSWVT1ۍT$1B( @Nx,@=Nt;@Np,kd1PVSQhE$hĆ3HN@N N<\$11ۃVU衛VUm`$t$l$ Npt<=Ntϋ NN1҉|$Ltt<8tϋ NN1҉|$PdtX 8Džtɋ$L$HQ$X9'xtCVU誓tV=pNVUhm$^1=NL L tOjh$sXNtuQ1y1 t6 u_VUYdtl=pNtHVUh$7jh$$PxyQ XNP1 jh$D$P CNL$;JWD$ P$~ E$L$|t$$J N`JуRҍ;F0vt$hK$$B=xNt$teVhw$\$D$O4$~?K`O &hc$D=xNy1ɋD$@Bȋ@4ư#sLV5HNH% 5D$ HNNh 5@N5ĄN8 5LN5ĄNQ=NtĄNPP$b5ĄN.>ȄNNtDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$xN]á4NtjЃj k_WV`01Gj0h9'W =8Njj]`0^_SWV{`01GW谼WS]jS]N`0^_[USWV$NN=LN$XPV!=TNu6#$`= t#Vhܻ"oh $)jV/ NR=tN<$8N=xNt hO$Vh_$4xN1NNNȄN1I N NNN ؄N ԄNN US* ƣĄNUSq* ǣ@NUS`* ãNUPJ* DNZRJB$V$SP TNtdu`jV  TNJp^0' PVh)$X^0' PVh<$w 1Ĥ^_[]áNu"$T$TQRjPVDt|$\=N=N1Ae]Džt<$@N\Tu nt1@N!=xNNh$jV NxN NVhq$u1=`N=xN=TN$L$ PQj5NSCuSh$d$$8ffs1$8j h$V~ VSh$ BVh#t-u h$*l@N h P5ĄN6 5LN5ĄN2=NtĄNPP"C5ĄN,ȄN1=pNt@NPh$t@NtZNu6t2=Nu!=xN-$tތ"Ph$41OB xNuh2$@N8< ԅNЅNB,NNJ0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ NlNu@,$\$D$=xNhS$?,$\$`L$(l$85ĄNF4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ N|$T$D$DSh$hx$"e@N1XǀPh P5ĄNo 5LN5ĄNS/95NtĄNPP\@5ĄNfȄN NlN @N=xNth$ Sh#$h$"@NPP.=@N1@L1XP\hhPT hLNW76h 5@N5ĄNI 5LN5ĄN-.95NtĄNPP6?5ĄN@ȄN@N Ph$uh $!ud@N  h P5ĄN 5LN5ĄN-=NtĄNPP>5ĄNȄN@Nh$h*$ ud@Nǀh P5ĄN 5LN5ĄN,=NtĄNPP>5ĄNȄN@N@ @NHHщ8<=xNth)$=xNuh $u_h 5@N5ĄN1 5LN5ĄN&=NtĄNPP75ĄN'ȄNN@ND@RL҉111C QPhd$[ @NHLщ@D=xNth)$"=xNuh $h 5@N5ĄNJ 5LN5ĄN.%=NtĄNPP665ĄN@ȄNN*HHPLщ8<҉@D1ۉN NlN@N1Ƀ,=xNh$1L$ @NL9| 9Ph$@N=xNth)$輘=xNuh*$Ih 5@N5ĄN 5LN5ĄN#=NtĄNPP45ĄNȄNN@h$L$>N@Nǀ,04ǀ(<HHPLщ8<҉@Dh P5ĄN 5LN5ĄN"=NtĄNPP45ĄNȄNN NlNG?@NL-=xNth$:h$7N@NǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5ĄN 5LN5ĄN!=NtĄNPP25ĄNȄNN=Nt}=`Nuth 5@N5ĄNN 5LN5ĄN2!=NtĄNPP:2@Nph5ĄN5N h̄N5N=@NVhE LVjPF G011D$)9|ËLG8 $HLOd t1SRPV5N6t0|$u)h;$h $s1AL$=NtLSVV36 @NA8$HLId t1SRPV5NU=Nt SVV5 =@NG0ŋ $A9ԅN ЅNʃƃVh ؅NVjPE jw,Ny9 NNdN9؃sdNÉhNpNC lNUPlƣ`NUS[\N Vh HNF@N $N=TN N1Ƹ1ҽhWV50N5N|5N= N$N50N=LBALtl=\NHhi$Xh $11IPPQQPV70Nf@50N+6 0NfA4NFȃtvFjPh$ =xNth $=xNuhW$nt1F0Nf@50N5 0NfA4NFf=rmh$=xNth2$a=xNuh$t0fF0Nf@50N,5 0NfA4NFffuzh$=xNth)$=xNuh $tt=11IPPQQPV60Nf@50N4 0NfA4N1Ff9D> <:PVQ D>/|)Ot$L$6DN2DN$!D$h8JDN$ D$tB?JL$h)PRQ,SWVD$t$ N95Nr==N @NjSPV)޹#394v t^_[PVh $CWV|$ wu$9'1XD$@uPw w Ph׬$*=xNth $ mh$t ^_Ph$趽NUSWV$\TM@$ 5uh`h`VP =pNt h $Ol=N1ۃL뀃=Nt\,L$UPQ DPPz$\, NL$L$UPQ |$u $PP@1LDffLD@9u=Nt8PP\NL$UQPB t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h> $(USWV\$t$=~N!ߋ,t9Xt6@u|$t&jZt1ɉH HHXh1^_[]he $VD$ L$5~N#p9tыR9u @^USWVt$|$VW/@N!t7^Fu+11 33 1u{ tNtqt$0|$,\$(l$$T$HNt9PtjRQ HN(Xxp L$ LNt9HtjQ5xN LN(Xxp ^_[]WV @N1!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$<'$1Aȋ$sY9U\:'<8:'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$9'4  <QhP!$h4!$脹D$P`wZL$ D$$:'1B(ɀ!1Rh\!$h4!$SD$H`wPD$T$ $:'1C%   [Qhl!$h4!$衸SD$H`wND$T$ $(:'1C%  [Qhy!$h4!$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW蹳ƅuWh]"j$$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$. 1 Sh"U CPh "U C Ph"U CPh"U CPh"Uu CK,C,Qh"U] C0Ph,"UK $@D$t Ph 1-Uhzd@$<W t1 VhedAW hjU D$ P$4KD$, 9L$ L$9u0$S11:8tx$0ht"Юb$11҉ $ƅ*ŰP踴 j PU ^_[]$0h"j虰USWV81ۍD$4ShPSud 1NtAljSPSWuWn uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS7$1NHD$ D$(%=@= j/Sxr)ك$0PSQh!$hR,D$jPZǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS赏1@$D$hh S| ƅ%D$ PVD$3D$ 3|$$  D$uH$0PS2$8$P$TRPV Vd} D$4@D$1$Vh!$jS"+VjS&| ƅxc1GD$ PhFV  8u;V| Wh!$jS*jjS{ Gy PD$t P<$t t$JM1Ox V| e^_[]D$(%= tn=@u$0Sh!$hP6*S MƉ\$1@$D$:\$ D$ PS謍B$D$jSz }tS"tN$PhF|@V x4D$t PU$$JhF VP$USWVP1hUU= ƉRP)9-Nt1@fCM+PUUSF @N;A0u $ytWVC^_[]Ë\$-|N5NSUqRPX$@ `@Nؔؐh P5ĄN' 5LN5ĄN =NtĄNPP5ĄNȄN[USWVt$(~OholNtUQՉ 1=NL$$t| tWV賠Ɖt$$H$á@N@05NQPWVsUC cMhml=NtUQPՋt$( }@N@0ˉ9Éʉ\$4$rQPUt$4LPDTGlOh|$ wL$,=Ntȋ|$@N1ɉSh"$=xNthQ$Vh$lt$" @NQP#T$1RQQD$P1Aá@N;X0t$~~1Ƀ=NT$DT =N|$t RP辛L$ pL$QSRP莧ǍPFPN$|$1D$D$t1)ÉعF@jP贳D`r9w<$r$l$T1C @<$9uG<$;|$}@NX0l$ot$|$oh\$ىhl PU -l$($|$ t$ t31T$phl WP $@$9|$|$|$(1L$t1ɡ@N@0)ȃ`T$1ۡPNـ#h"$b=xNth)$BTh $ ع`֋,$L$t1ɉȉD$ օt$ tH @Ni0T$,RQUt$> @N;A0l$,} $L$l$l$,@N@0D$Mt$ |1TT1PD$T$ ʃ=Nt RPL$(ωQM D$H 9tet$C9\$t$$h#$ PN4$F4$;t$SD$`1PN0^_[]ËL$ ʋ @Nf9u Sh"$褤D$`,t$$h"$lj @NPhV"$CUSWVT$L$D$0(D$ X=NtSU貗ʼnӉ OD$$@N@09ʼn} t$t$5D$PSUt$< @N;A0 t$~QPSUq$~t$4SUWt$T$LtL$A L$ Q5Nt9RPt$ƉT$ t$1ӋT$1 t<$G RQȖD11 u5\$$9t ;D$t`GPD$ GPWTt RP莖$<$G L$;L$t9ta щʼn$;D$t`1h#$辢^_[]USWV |N$@Nx0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR蝡 PNT$4$1B srl$,$ ȈU1wX=Nt ~N!9GX=NtȋL$,1Ph#$蚡 PNL$ $  h#$y=xNth)$YOh $t$D$OPWTP1GTGP^_[]PN1USWV|$,$t$|N1@$@Nsll$tNtxN L$  ƍD$1PQQVK9 @N;A0-T$zu D$`1]l$z$Ń1EGpD$hڧ D$ Pt$ u&xMt(T$hڧ D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh.#$џ=xNth;$$Mhc#$Et3s ss3st$Vn[E;,$uPN&%t#Ph"$0jUSWV0\$T|$HOX=Nt1D$,D$(D$$D$ D$D$PL$Qs tPst$OGN҉L$D$td$PQDÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ:C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h&$@'h%$hH&$h h$$Ph'&$O4$V0Vh%$h%$h h%$h%$hWVt$ F,t@UNth&$R@F,P1~,>d9~8uv0^_h%$h&$h h$$D$x,u@Pt P迤鷤h'%$h%$h h$$WV΋I01t*N8~2IN8tPQP PlN0G;~4vɃ~8u^_h%$h%$h, h$$Oh%$h%$h2 USWVEH1Bx,T$1hwM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS腣e^_[]h(%$h@%$hF h$$rUSWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hm&$h&$hK h$$bUSWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h(%$hS%$h` hi%$hS%$ha h$$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h(%$h%$hq hi%$h%$hs h$$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hm&$hZ&$h~ h$$FfUSWV\$$|$ l$t$UNt5NSWUh&$T USWV5N 1^_[]USWV\$$|$ l$t$UNt5NSWUh('$ USWV5N1^_[]V=tNthX'$Œ2j5XNHtah'$腌h $+tSXNxL~61 TN s"@Pt4h'$t TNXNF;pL|^5XNvjwXNt'x,tPXNPXNáXNt x,tt$t$t$t$P1WVt$|$ VW=NdtX=Nts,@N`uau33 u1@1^_WV pNt1 TN @N1!`u/aʀs2hlpx1Ph'$ԊPh($h $gJh'$蹊@N ǀdƀah P5ĄNې 5LN5ĄN=NtĄNPP5ĄNѰȄN@N!1111QWRPjhXNhh,($h $艶lh'$ۉ@N ǀdh P5ĄN 5LN5ĄN=NtĄNPP5ĄNȄN @NdPs+aʀu Ph($Phf($h $蟵hN($@Nǀdƀah P5ĄN 5LN5ĄN=NtĄNPP 5ĄNȄN^_jUSWV1L$ AL$HAL$@AL$<L$ L'L$A L'AL'AL']u }h($SVh ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uh<'jBƉe^_[]Ãu953ujhL'D$Pf u1PPD$Pju953t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQRPt$8t$@t$8t$@WT4u2h>)$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Phfp#hVnD$@w ww7VPh)$S  1h*)$+h|)$W fUSWV1L$(AL$$t$@L$ D$ }] h*$WS: aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 93u~]#D1غ$Phzd@ tN|$$tOh<'jt$ Õt$@跕1Oe^_[]h<'j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SqjPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q ɚ H @AQ@A$Q @QHALh0$Svh0$h0$USWVP\$|$tus$g" $"$jdotQ1@PVSjPt$8t$8W E1u>4$hU3$W VuSh3$W4$h63$W 1H^_[]UWV} uOʃU|RQPh1$VUJPRlx& $T$W1ٹ|$5Uh91$ 5Uh"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhL'VKA 1OujV5UqMuW?,VQ>~IhI1$Qp1$VQ7 t1Ph[1$Q= 1O^_SWVP|$1N?u\j S5U? 8u1u/|$8u 5Uh"W ^_[WV|$1N?t5Uh1t^_h3$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5U у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5UEjxL$T$$$jST$ RL$Q tXS?$$ىډWT$$jD$ PST$R虣 t)t$h4$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,ijjhL't$=$ tjVt$=$ jQV$Ѓ $V I iTh j$U$  V tZs0wht1$V1t^_[]1;BB ,FjhL'P< 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0h1$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1Ph1$Q= 1HUSWVt$|$ t)l$\$$jWUS3 tWUSh1$1h1$VD*l$(\$$jWUS tWUSh2$V1H^_[]Ã|jWUS[11USWV\$1s3h %5U|6 t^1WlA'tuWh82$t$ 1NtA'pA' Ch %j 6 Džu^_[]WV|$ xA'lA'WhT2$nu^_USWV t$@\$ bt(t?qt0PSD$PD$,PuNulD$Pu?D$9=3uHD$|$|YutJL$T$xupt 81ϋX1 t$@uhDI'jƉe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WtCD$@PWjhL'D$LPt tXj$t$t$ pD$0T$,WL$T$4t9_t0uhA=$uSh2$W \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQ*L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZhq=$P%1D$Bhq=$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh=$u51fUSWVPM(,|$8O] D$1h=$uS; sujsWVVuutqD$931t$$uӽ1Ne^_[]ÉD$H@ D$ juVTjV;H A D$ $Y$jV  jV tuhJ>$u1D$3D$3L$ u41D$Bha>$u-hD/$h(>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhL'V tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$th>$S菿 0+T$x|$yRt$h>$udh>$D$t$th?$S511A $1A;L$0D$4D$,L$ |L$Vt$VjS@L$)΋T$׋jp jRQWVS 6 $p q h  yq @N F$FV0~4j\V϶FSܹ H @AQ@Q A$Pƃ׃q0y4QLAHS%?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu01ha?$h"?$SJhC?$SfUSWV0u1L$ L$AL$AD$] }D$h?$VS5 a~bt1iugD$ PW*u5D$PWD$PWut3NT$T${lhj\&Q1D$|$|HW_t;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 93uD$L$ t!T$ T$thlI'je^_[]t$t$ QPt$WߐUSWV}u 1ۍD$D$X܎ND$h?$WV<4 V~Hw'$I'؃AtH`Łˠ뽃W h܎NuyhJ'j4돍D$Puqx pD$PuWJ?71L$ L$ {=܎NhJB#Et#L$<1QWh WWj WP L$<99t3z3=u1H$Qhht@P2s u$܎Nu@L$wJ'܎Ns t953juVuu hA$ D$|$|But3L$L$T$xupt83|$H1 @uًt$uWt9wWuVhA$ue 1HhJ'j(e^_[]V  @$h q% PJ h-$  @$P1 h,B$D$ @$tD$ @$u |$  L$ L$ك@L$0فL$(|$w7Pt$V跧w wE V蟧t3H t3;3hl3j &l3H l3 t3H t3|$;3hl3j l3H l3 GtOPh@$O1w7w & t3H t3l3H l3 hO#D$O1w7w IƋWMhD$@Pt$0w t t$D$P}w 0T$уL$, ܎N1҉L$$9L$,hl3j ȫt$<|$ Wh׬$PV|$Whfp#P$WWV~uhhM&VW7 Vhdp#|$Wh$@$蟥D$xu2hNhfp#h$VVhdp#Wh3@$b3$Vhdp#Wh3@$HD$Phfp#hVIVdp#VWhD@$VWhS@$  D$4E$ȋ|$gw t$0j dp#QRPjt$LV xVhY$軤E$gw |$4dp#dp#t$t(%VRPQh_@$w Mt+WhD$@PSw M tPhg@$Dt3H t3t$~l3H l3 hl3j 輩|$G8jm$CQj$PJ$?Pdp#PVhm@$ԣdp#PVh}@$ G0O4 tQPh$P:Ph'B$m|$t$ ދD$$ʍ RAt$Qhdp#Ph@$Ut3H t3~l3H l3 hl3j ѨGHt$sG 8-uXG $1҉QQ$$Phfp#hD$HPD$r> E+u(ljށD$D$Mj@$PVw tP"yL$9wȉD$WMj@$PVw tPxL$9wȉD$u|$D$ ?L$>G CVhA$8E$A$PSw71P E$J5$PSw w1P \$|$tD> 1@D$,$t$|$@u  jhWVƉE ك@T$dt$`wQj hdp#|$Wt$PVQ x'D$`D$t$ \$\,$A$t$ tnՒ"tA$Vt$ P|$pWl$pU}l$9~?r1D$@$t@$Vt$ L$( P蠕D$D$D^_[]WVtfy8tH8|$jmWj$QÞh@$jBƉjWPJ t VjB$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj hdp#UPjS yD$4$T$dWRVhA$菔;tSh$|j 蒓P^_[]fUSWVDt$`l$\\$XT$1 L'A L'AL'AL'B0B$` hB$VU] k)Hw]r$uStJPSTu7HsutPD$PSH uh$J'jXD^_[]1Hu߅tjhL'D$P t9-3uPh/D$PS觷벃luhj\&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhB$SW= a~bt)iuRt7D$PV""uUt$D$PV螺tD$PV蟳uh8J'j<e^_[]Ãluhj\&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=3d1t$t$PPt$VqUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H NH N@N NhN1NFNFNFNF^Vt$|$uD$ hN0 NFDNF@NF<NF8^fUSWV$$$E#h"WV ou-U953 1O$QhF$D$P- $~ƋFHt$ $M'訂 ^ hShg&PD$5 xþ1${_ WhB$PI- Ph"V0 CPhF$V0 CPhF$V0 uCPhF$V0 ZCPh}\&V0 ?CPhG$Vh0 $CPhG$VM0  CPhG$V20 CPh)G$V0 C Ph7G$V/ C PhFG$V/ CPhSG$V/ <$u蠬 $lVt$;7 WGU $ɿt$ D$tQhF$P& D$Ph}+$t$& rp~ m whqG$P/ fG8Phfp#h\$SfShzG$V1 4GPZPh")$VI- VhF$螫 $ D$$$Fo~ 1C OƉShB$V* )Whfp#hD$PD$Ph}\&V(1 Whfp#hD$PaD$PhzG$V0 wwh q%V&0 wwh1$V 0 w$w h#V/ l(jm$Pj$W$t$Ph$V^0 ,Vt$艱 C$$L$ AA H94$hG$t$ i$ t$hF$t$L$ t$ v8t$D t$^ hE#U^h@$UڇPVl3tkS[`h0M'j<V haG$$@1ORt$μ 1O4$ 6hl3VV1*Uh*$$衔 Vt$| ^_[]ÅtVb hF$h6H$h hF$hG$hhG$hG$hhhF$rdfUSWV]} E#D$D$ hG$SW iu5UtFumD$ D$9=3uUj]$,(fYǃD$T$ЃD$,jS腺t%D$t6hG$hDM'j葞jSQ D$ tjS9tD$t h+;$w@hE#V[G$tQ "hF$P )j$Pc hF$V hqG$D$ P jhPJd D$0Ph")$t$# D$0$L$ 11t$ L$ D$PhzG$t$, bD$\Pt$ tpt$hXH$SF 1O1PVι 0hG$hH$SV訹 h=H$St$艹 ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhFG$S $PhSG$S t$(\ Åt$(膸 $fǀU1PPPEDE!ƒ[u$t$ ;$4t$8 D$t$η fËt$01 |$lD$Ph}\&S% D$lPt$SD$PhzG$SL% D$|Pt$$Ph q%S `$Ph1$S B$Ph#Si $D$Ph$S$ tj$$Pt$ 菄 D$DPhB$S D$D9M$ $ȃhL$pQP4 t$j Åt$蔶 U$61QQPUC!ƒ~t$ M$$VP 9U]$|$$D$jRPB!ƒ=M$$VPP 9E$1SP|$W~\ GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$thhdp#W WhJ$XtjvhJ$h$LU UhgJ$+tD$tPhqJ$tjL ZjNh jl$ UZW jvU, F QPD$0PW. Uhji W8= tpD$4 D$,L$0 L$( $;jljhJ$isT$0L$4 tH)Љ|M1KZ8/$;kZ81$;tyhJ$UjhJ$sPh%rhJ$rL$(D$, t )|1hJ$rWh%r$;|$tv vSj q6D$1P@ ^_[]hI$hI$ h}\$h7(&j USWV $ShpN'U, ǾO'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT$3qL1ATAPAXkiA\J$A`i AdJ$Ah!i AlJ$ApQQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph#V |$V V (C 1Љً(L$I$1 sD$PfD$D$ t2t$ ^ {uWvIu{u C $\$uohL$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ ! E0t!t+M4S9rQSP! 0t,hM$ MHtU4uL9rRQPS! t$|$t%u@uhV)0 tIM81tSul|$tDEM9rQWP! u@u`V/ u@yu@u`V/ teEptUt$8ЃtEu8uXV/ t, ^_[]hL$hK$AhL$hI$5hL$hL$)u\u\h.M$udShL$j wlh׬$j? fUSWVt$o` 1tvt$a t[S tCP l Vt$d tPUW?e uW貝 S 1S W3` ^_[]USWVu]PhL$S t$f1j?1Nt}ǍD$ Ph"$S- td\$ t\hjD$PH jS\$S ShiW. t$E L$Uf jQhL$Pj je^_[]PPh"$t$ u1$YVPt$ t$t$V tPh"$Vl u1$^USWVt$t$a t Nj\$ Pu| 9vJ? J1N*Ƌl$Wu| VPU* )SjUF ^_[]USWVt$t$a t?Nj\$ P{ 9s9Ƌl$W| VPU )SjUF TJ GJ?1N^_[]UPh&&u t$ J1H]USWV@uPh5M$V ] hM$V:` tP]{ |$ P\$$ShiV\@ |$ jSy PhM$u b V蕚 ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPJy t!PhM$Sa V: 1He^_[]hq%hM$hh>M$^BWV|$$hM$W:_ t;P+z u1VMz jPV VhiWQ? t^_hM$hM$jVh>M$AhM$j V(Nh$3V V 0NhKbV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhM$hV1>tVh+N$n`V7FߋD$t$j7QPhM$hV>tVh@N$)`V7F߁^UVuPhHU$V t3$L$ AQhiV= u hOU$1e^]hq%hCU$hhO$_@UVuPhU$V t3$L$ AQhiVe= u hU$1e^]hq%hU$hhO$?UWV}W#ƉPh~$W' tZt4$P<tW@PV4v tGPhU$u ^ t>V_1e^_]hq%hU$hhO$M?hT$hU$hU$ hU$hU$j h.U$t$ \ tPhU$t$5^ HhC&h U$hhO$>WVPt$|$D$PVW tKD$tUhL$W[ tPhL$V] H^_hC&hU$hhO$z>hU$hL$j9 hL$j SWV$hQ$S2[ t]P%v GAsdWt^WPhQ$StNpxPhiS3; u?V1YD1HĐ^_[hV$hV$h1V$jL hnQ$jp USWV 1CCj7Shxi PE& uhT$?,$PuhT$#Ɖl$D$Shxi W& u hT$j $L$9~D$~*1t j \[Sh׬$.\G;|$|j :[Vj7SUSWVH\Z'D$@XZ'D$1H^_[hU$hU$j haQ$j USWV8}D$PhO$WY u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j S3n t$PhzR$VV D$S! |$Oe^_[]hq%hTT$hfhO$E7USWVuPhO$V tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]hq%h8U$h0hO$6UVuPhO$V t,jt$V 4 1u"hT$h׬$ <1He^]WVPt$V't&ǍD$Pt$V> u Wh{Q$j PeLD$L$AËD$L$AËD$L$AËD$L$AËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$H@)3 )31SV\$ Sh)3 uCЃ r"CrCr ;01H^[h)3+H?r ]; ؈)31ыL$t xN1ÍAЃ r)Aw AwÉ;1HUSWV1t$ D$hVP7 )3xNt8u^xNǁ|NNNNNNNNNNNNN@wh)3R&uhS$0h)39&uh T$ht)3 &u h8T$jL $5)3tvh$3%61NNN(3tt)3$h)3$U ƃV B~>CNNF v/FwD$Q'NAu"h]O$^$P'Nxu>Wu4D$P1VhVVj V5U ĔN9t$:*ƀxNl `C Lvms)3(3u$&3NNrNND$P1VhVVj V5U N9t$taYN>NONCatTl5$&3+wtz(39t)3 &3$ÿ%3؉$(33 N$u =NuB=N=N=Nu|t =Nu =Nuftu^NuS$ttH)ŋ$L$ T$ RQL$QWPU%uH u&h2"hnO$,5Uh.%j t$PD$P & u hO$D$t,DtVPyDžuh2"hO$JW WtS)uh2"hK$Wuh2"hI$)3t H9t@h2"hO$$@ t%VWЃ$WjEhP$h2"h*hO$ /USWV4,G uhHV$hnO$j Ƹ)3jmPdp#dp#tV$jL)3PtV$USWhNV$hĆ3wP)3t VSm#V$udp#WWWWWQWhW$hĆ31P$V jDV )31tT$q9t Iu^WVΉhjW0 D$PheU$V tZh%%VJ tQPe L$PyRPQ WhiV* u hpU$Ĕ^_hC&h]U$hhO$i-WV hzR$QGJ t;P8e  u1WZe j PW  Whui V^* t ^_h^T$hQT$hihO$,hT$j h*Q$~1ÃD$ 1ɉJJJ JJ BRhiP) t1haQ$ja $1ɉJJRhiP) u 1ĐhnQ$j" Qh)3'USWV΅t R8F ND GD 0($D$P!\$D$1t$$tsV($sD$tVP $Vh"$W trC=ND$uCt\=NuCuM=NuCt>=NuLhj$V- VhiWn( t!$uۋt$$4u=Nt ~ j MIhl3sWt& )3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhQ$h$VVUhBR$fI jl$U$V Vhit$ t$,$t!Ph`R$IVhOR$L,$jt$VZ Vh~it$x t$tPhkR$Hj Gꍄ$P$$ j:QPhR$h$P$t'$UhS$NHUE}uj:$$hR$h$P$t'$UhS$GUJE}u-)34$tVWUmuj|$W$V  $$ DŽ$@Vhit$V u$ h&S$hG1@Pl$U%jWl$0U 1@D$81D$ u6hmY$V> u$hX$V> uh]Z$V> tD̔N ȔN=ДN!lj=̔NhjS^$ {Sh7iV t Đ^_[hX$j> Vt$V胴Ph׬$@tVtPhX$r@t$V5t%L$ PQhAx%N@ V %uߋD$=rPhX$ @^USWV$WW1ɃtQÉ1 jVU Uh8i(S<  D$ sjPsQƉD$$Uh8i(S :t$ڲPhY$L?hV%t$D$;D$t(h$$?hV%t$ ej))>j >\$#|$hgZ$>1A\'9xu H uhM&>t$(hjV" Vhi$ St$<\$8hgZ$[>zX$mZ'Qt8u 9A uVhqZ$#> VhX$K1#X4hdp#hAx%= j =jmtz D$ ~[11ۋ!9uIuU0PhY$=h4Y$=h=Y$4j <D$ 1AC9|M rVļ^_[]P%ohI$$hX$hK$h"hY$ hX$hX$j衾 VjmuԔNhXVV2^hHY$jh hĆ3jjHhZ$eUVuU OPhY$V t!#̔N $ ̔N1e^]hq%hY$hhvY$USWV(ӉQtohY$U9 t̔NH1 Rh8i(U u B#8uIjhY$S t)D$̔Nt(^_[]hI$VhZ$j hZ$hY$hY$j8 SWVt$T$;h%V;9 t\Ƌ̔NPVT VT PWt+Ɖ߁PWyt2 É̔N11H^_[hN%h%Z$hhvY$h.Z$WV֋|$ QsVWPh6Z$jA WVPt$T$thmY$Vt8 tkPS VZS PWt>ƉPV5̔N( ǣȔNV%1u ̔N$h(#Z1H^_hN%hNZ$hhvY$WVPt$T$hX$V7 tbPR VR PWhtIƉPV5̔N耰 ǣДNV}1u! ̔N$h(# 1H^_USWVt$T$1h]Z$V17 thƋ-̔NPLR VR PWt6ƉPWt>V ݉-̔N11H^_[]hN%hZZ$h2hvY$hd-$fSWV|$ t 1H>t$|$\$jZ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VO tE$$PwCt/$F ~G F1C 6 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPw Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} y"WVJ t/t$ L$Ps(,tD$$F ^C F1/ USWVuD$ tV} ]CtP7d4 tEC tP7N4 u/D$ Ph&&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V t|$,$h %W<D$w&tD$1{tj/t$TtAL$L$4yyyyy D$AAD$ PQt$ t$ DtsË|$D$4t'u#D$XPt$`D$4D$4D$ PD$8Pt$ t$ ÅuD$ x'1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP7 t9t1ۉD$=r7"11HD$$P|$1OL$L$D$L$T$PQRhZ$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P&NjD$fVSP{ sD$ t P& 4$WJ W\<4$uM S]s {te|$t^t$Vt$t_@PWI WtNVsE02 ߉Vuj ۉt3EF ^C F1Vt$hZ$hZ$hZ$hU$ hZ$hU$j] WVt$tV r1H^_V t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'o<$t@1@>Y.1-t Pqh 1GG GG)1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7, t+{0t>-uUsBt>Vs2t)u@ 31H^_[]Ís s(CtP7{, uCtP7e, t1@뿋C$1$\'4v6 !6 P[P  v6, tMtk $t$ 4$UQ$t^hb$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhz`$jՙ 1Hx^_[]hb$ha$j{ WV0t$<|$jWh]$V萴t8W t7HfJBRhiV t!10^_hia$hVa$Whta$j h]$j+ SWVNh+3VSNh+3W@VgW^ Nh(V3(Nh~W0NhSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!h{b$E$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=Nt PfD$(WhiU t$b$f|$*ub$=Nt P|$fG WhiU t2D$*=) Phb$k=Nt hb$SfD$(IWhiU> t2D$*=) Phb$=Nt hb$1Shi8U |$Dhb$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh b$j uVhb$811t j,FDLxPtT h b$v<u h $j $PhiU tDhb$$t$hb$ hT#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRA Phb$$=tPhc$j $=tPhb$^_[]PhQb$j hĆ3jhh c$;ÃD$1ɉJJ JJ fBRhiPm t1h]$j 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hz`$j菓 USWV,$@$PhiV tr$A jjj": xgljj2 xi$-hSW` xB$/uE$0uf$Ciu.h]$藐1H h^$肐h"^$vWa 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$h%h^$h^$h>`$h]$h^$QL$4QhW^$[(D$f($-D$](E!L$:!PS E P< $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 8Nt 8NE9NtIAtcAtCAtPA tSA@tBAyAAT$h8NUWt$PVt$D$VPRRh^$,l$ }"E!Ê<)\<$]'=N`Cs|$[VPWl$Ph^$h_$|#<*<0<2=N<$^$<t^$sQh׬$/B#1L;dp#y_$QRPh:# G %9u<]K%C=Ph^$h׬$ =NS<$CPh'_$ KPh,_$| K s k t?L$D$F3_$PWhAx%B  N%܋L$D$(Mu} L$D$D$F8_$PtPtPuv_$I_$ i_$"QPhAx%  N%D$ŋL$D$(ȉ</=N%<C<$,^' `$=NCPh^$=NCKSRQPh^$h _$ C~@sFNuQPh _$  IRQPh_$ Muj> l$ L=N?CPh^$ (sh^$h׬$f =N<$CPh'_$D KPh,_$. Ck tAt$D$x3_$\PVhAx%  O%܋D$t$)E}twt$D$p8_$ttuv_$I_$ i_$"QPhAx%~  N%D$<t$)ƃl$ rPh=_$@ j>V <$€_$$^'_$rQ=PuJC<u;h^$h׬$ =NyCKQPh_$  ]=NPȹ^$6<"<o`$_$ `$`$!`$)`$1`$9`$C`$H`$Q`$Z`$a`$h^$h׬$=N<$CPh_$1D3 dp#t_$T3 ׃l3 URWPQa'h_$uj>l$ ^_[]ø wb'ø"øSwb'ø"VPt$ D$Ph`$V tD$P^hq%h`$hh`$VPt$ D$Phb$V蚣 tD$P^hq%h`$hh`$WVt$(|$WhiV tgD$Pha$V2 t7D$D$WhiV 1uha$Ѓ1H^_hq%h a$hh`$+h`$j fUSWV8蠘 y hc$肃hz%j y hc$djhd$ t\L$jQPK4 D$tPhe$ jhd$荛  D-31 VPh  VPUSWQRPh`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSjLQ |$www wwVWj VWj V6S S-S WS D$ @ )T$VVQRWP<1I9u }8tމ5XN D-3tщ1@8^_[]hf$Kj jj舙 he$蛙 u8e$jV觙 te$jhs$he$Vhq"hK%j j USWV`~ZD$=XNtIt@ƍD$H@ L$1jQRRjP>ut$Vh[e$< 1t$HFFF FF1G>\$SVjM l$ UVW> ƅZD-31OjUj*1 t:9uB$=hd$jVP  8uh D-39tttn1VSj VD$$Pj D-3vhd$@jjj0 1VSj[ VU6hd$1=D-3u$=|$ u'1VSj# VWj `^_[]Ét҃t̓ u1Ht$8F FFVN Phe$u1c$WVK td$D$8x xx8WPVM q"{jhd$h&#ݺ K%SW~ Whid$jBVSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á\NH \Nt$Vt$V"Phc$ijAVAD-3VPD$$Ht5t$ I?rf$ !P$Ѕuσ^PD$L$ $QPjڮ 諮XWV1N=XNtED$@ L$1҉RRQWjP萫t4$ h6e$^_VQeO jhb'6M jV M tP]pt^Vhe$>jVhe$)j PD$L$ $QPj ɭXPD$L$ $QPj٭ 読jV@XÐUSWV$$D$D$D$,H1H$11D$hf$WS΅ f~/P w`1A$b'5UY D$u[FtR=5UD$,D$낃gU8#u(@j L$ QP | $D$8LUPz@$)U8#u)@j L$ QP{ D$D$8UL$QP j D$ P5Ux{ D$D$8c1Fj D$ P5UA{ $D$85Uh9f$83<=`Nu-dN~q5`N1ۋtVPuJVh׬$FtPhg$FtPhh$uj -dNC 9|?,u)É\$(k <D$j D$P Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u {8tz`Xt$7`Nu `N-dNCPVt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP j |$tt$ VUW  UWbJ B8C|$$8D$@PWZtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUWT #|$$tS9u$UWI RWK $D$utSPWKK uWhf$hv1ļ^_[]Ë 3DQuc 8tD$(PWh#b u8u$(QD$,PQhi$bj9USWV ˁD$Pj VL$ Qhi$#+t$1c'Gt6t =lNt#$t#FwPhAx% G!Ņt G UwF N" UxF0N=ԖNucЖNgu\53)uOht|$0W_ t$,tWD$(0t$(^_[]h5"jO Bhm$jYO SWVP׉Ήj SQN 9u ~^_[WVhn$j#O 莳h p$ho$ho$ho$hSo$Ph9o$hĆ35 jfWVt$|$ VW自 t$?/tWh*"`VhC"R^_Wh"jN fD$Htu L$fHQhp$jtN SWVP\$$CxP Cjjp`X 1Ox\ƉC@HtuMKfHjPjjVppV& ujt$ t$ VXlj^_[Qhp$jM WVt$F1GyiD$ PWQ 9ujt$ t$ v| 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAAȖNBȖNʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RShPQhWt5v%NɅuNɅt(QhKp$h;p$0 hH1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w2߱0,{PhTp$h5# 轱H1HD$pȁ^USWVt$\$l$ |$$英WUSVt$$1N|I; ȖNu=OɃu3_˅t( B8;0Shp$h`p$Ɖ^_[]VD$L$ T$r؉1Jf^USWV D$jIlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$D蒰8jH|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3j=H)9}hT݃D$,|%L$,9QPhp$hp$路<1H ^_[]fUSWVd$xj[Vh NY j@Vzt4$Fj:V贐A $$|1D$hhhhh hh(K H|$WPhϟ$V襢tPPVhp$ #CD$D$ @4$D$ UhD$PX D$,$Uj$lS V藞9rȉ$`WVS趁 jD$PW$lPjt$hD$(P t.2,$AuU=ԖNuLD$D$ 1@D$ $t)ɋ,$t;|$ hp$v1ܖN$N,$ ؖND$ @tL$L$fQP$|BD ND$ HJ@BBNuNȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5U53\$ \$(\&\$$} ]D$,D$D$D$D$ D$hp$WSN H$p'P5UR 3$L$T$,JjuhLp'5U>P\>뇉=Ujh&q$W t5jh+q$W tZPWnR $T$D$0PW"D$0t 8D$ D$(JD$0PWO"D$0t 8D$ vD$$c5\&$T$$MA QD$5UD$o5UD$1@D$Q5UtD$ 1@D$353)h4uT }WtD$0PWy%|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5Uh q$h5" 5Uh0q$j;D Wh r$PWhq$Whr$ PWh_r$jC WhJq$?Phr$hĆ3 j腹SWV$t$$$$\$VPWS$H$HTj S7Vhq"W D$@t$hgq$t$t$htq$ t$ t$ hq$ t$Ft0hq$jt$hq$ t$@t0hq$ojt$ hq$Z t$ hq$I1$^_[Vh[q$jB WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRh9r$L%uUD$ L$$L$D$l$&\$ D$L$ |$D$ fD$l$|$l$D$T$]hFr$jB WVPt$jWV@ 9u9t x^_Vt$he"jA Vt$V?t@^h#V^Vt$VDt@^h&%V|^WVPt$jWV? 9t9u x^_Vhw"jA WVt$|$ VW賜 t$?/tWh*"VhC"~^_Wh"j@ fWV1t$|$ ɉ @4u6ȉXȉX\ȉ\ȉU6566 PQ40540<85<8D@5D@LH5LHTPa5TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40440<84<8D@4D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7 4Vw w3V Fww3VFww3VF^_USWV\$l$EffEffCEffCEffCu u3S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu2SCuu2SCu$u 2S$C EDȉCDu,u(q2S,C(E@ȉC@u4u0U2S4C0EHȉCHuhs$.e=N<$=UhV0%W芊uNG=U1L#PPjPPgd/31@D$ U1"PPjPP4NpU1Sy$PPhPhNP<U1t$PPhPj ̗N =U=Nj:W!cEj/Wc2?}NU1Ht$,u$Vt$S1KS\$W|$P< ԗNЗNr3DH,WD$h"$WhX&WՈNW NN1xz$PPhPj l/3,N 3DHWD$<$Nhrt$3=d/3_=NtVht${5Uhdt$k5Uhs$[ht$Qh5"jW0 WhNt$:WhH|$/D$=Nu1=N@N$1󫍄$BNA+L$Nt1ۃ$ 1D$9|Pt$t$ )̓}4$>@t$ \$ NNɋ|$ N=N ԗN5ЗNσ|,@σ|1ҿ9  N9|щ Nt$ |$7ƍD$0jPR .hؗNhu$N=NtNNt&hQhv$g NNt=|hPh2w$> =Nu1=N1@N=ȗNu NȗN=h/3,=Nt#jhw$hw$hvw$۴N=ėNu=d/3NėNt$t$ t$0SWt$t 9t W3 t S% =NO$PD$tEX)tƃh*s$STj U2Phw$jd$ P諥S; j j j h\%> ܛN$NЗNApQtN@jxQP$Ph*s$K< yʍ0賝Vhw$jd$ P$\ $|$8j"2U$P1 $PSHu/jZ$P$dPj~ u$<mfsjWVI 9uD$8(%PMVP$Phw$!hv$|$t$/dev3ؗN ܗN/ ѹݗNtؗNL$4~t$0 @$jWh"} u ƃrt$Wt$8VB~\GWV/~It$ Ɖ\$0Ë$H$|$Nt$ L$u DN$dT$dž,<tx(=Ndž dž,dž(Ɔ l/3p/3u(jh|$=N-5Nu"jh|$̞=N,5N NN0NF4Qt$Qh}$蓞=Nw,5NF4Ht$PhF}$h=NS,5NF4 N9}"QPhr}$9 =N+,5NF0=)hPh}$  =N+5NF0=|)hPh}$ٝ =N+5NF0N49}QPh}$譝 =N+NN;N|QUUUU)ʹ3333!!сis{09\~\{0\\5NsXș9}%CX=N~Qh1~$NsX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hI~$=N**N{4$=N11F9tA uPh$j# $Kd=ԗN5ЗN u։<8=d/3[ WVh~$d =N)N<$C4$8=N`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPRpNjs8ƒPVRW螞)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh~$=N'̗Ntm NyxH1҉$q1ҋ8$$)$<$$1C$I8$ ȗN=N_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W-n1C1 t׉Ë$$QPV$$V9s($$$VmÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPjË$Ë$ʃQPRSA)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQij$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh~$z =N NB$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d/3$_|HL!ʉG41SSjhjPS]NN NI4QSPs NH N N NP44Q5Nщ N`@#HL 9| Hh h/3H< NHX ėNH\ NPTXH fǀ$%=NO4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d/35O _(HLJ$N$$$t!LJ^F=N$$߬$$ڌ$`&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$$ N$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$B$趌=NO0 9| IУN N=Nu\Tu))У N1VVjhjPV NuN9 N N5 NjPo =NGԗN ЗN1ظ|(RQh|$ =NԗN ЗN5N5N~ ș)dہ|4t'GuȹC=NtL1$PP$$5NV1=NVhZN N1u;1$VhjVu&  =N5Nh`VWNE =NtWV35Nx\NhhPm 1@$=Nhր$*=N|o5NN,I\Tt~!NȃN׊Nd1 t1WPhA$RRy$z39u1H$Whht@P9S PPftu!ѡNt $ Q$=Nu$|&NH,$$DŽ$%$ NI,$1$ DŽ$1hl3AN$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h $薹=NY Nj5N k 5NFU $F +$^N$~J`^p=d/3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=NuFh$ NlK`ڍOȃ$ډFd;v&h$ӷ=NN5NF $11ہ~U uv`щSAN$~!ـ1@ NIl N5NF=d/3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5NN uҋNB8H!tk)D4NB8)Nj5N$9sE)ȉـ1B~U uv`5NF$CHu͋NB8$؋N9ȉ$J`~U uv`щSN$~!ـ1@ NIl N5NF=d/3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45N;Vs2р1@~U uv`5NF$BɋN$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$NH NV$P V PV~x; Nup=NtNs4PP NN@NKd15Ns4NN Nq4jPc N5N{0 9 NPVQ: =NtN5NP5N Ny0N$ryxtG$\%TuCl$AP$ NOu$ց\TtQ!QЃyId t15N5N3 5N\TG~8^xN`1?9' N+$~0lj$Ɖ$)ى$=N$ %GlN N9wߋ$9w$N$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=N} $H$$$~A=N2$=|j.a|扄$dp#tV% Nׁ\TtQ!QЃYId t1RP$Vh$|$$;$$|W=N9NH,t =N $$ DŽ$j c{DŽ$CN;X,/$~ j 5{=N $hjPq_ d/3 N+ɋMt@U@f$$hM$lCɋuM@EfDŽ$As$hL5$ld/3fDŽ$13tt/3$_ lj$DŽ$NH4$ $ H5ND@VL!! $`Nd8&s4fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t/3@ lj$DŽ$ NH4$ $l$h  5ND@~L!! $߉$Nd t1$Sv4$j2N@0p9w Au1H$$DŽ$1$$tcq2ǡNN@05NV$SQP$h$l Nɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=NCX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$PZ N\T$$i$$ $$$$DŽ$H0$$_$ N@$D$@L!! $`n$hW0$l$  NId$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h N@$D$ @L!! $$m$7/$$h$lNHd t1$S6j$$V N$ȔȐG$11F$t =N$$=N40=d/30w4w+_1N$`SWP. $PjSW =Nt$W蔴=NtNǀ\8 N=Nx\hhP6W NQPIWV=NtN Nq4PP 5NHLNd t15Nv4t5N95NvG=NtNp4VV谸 5NN@N=NOd1Vw45 N5N:N@4P5N!e^_[]ÿWjVV 1=NVW\hA#prBh$>j&ij%}ij(viܛNj eij^ij'WijPih$Lh$Bj5ij.ij'ij ijijij ijijhjhj hUSWV=Nua΋\$=NtNܛNSt$P 4׋ NUPSt$$5N 9u^_[]X0!PWVhv$0qj$VhUSWV"=N΅ NuNH4H N N =N;ЗNԗNN;}FWh ,t'1I!;HtG#P;Pt;H uV9R_1ڍ_5NP=NWh De^_[]USWV΋L$l$=Nt=NteUjQOSp׋ NSPUt$$5Np 9t?V0! PWVhP$}oj"fNܛNUPQ ^_[]SI`wD$$s'1C:Qh$hĆ3q .  [SWV1ۃ=N։ SjQHR =d/3@fF F)f ^_[USWV Ӊϋ5NF Nd t15NG=NtN5NPP NyU +y/\$|$y1U =N1=U L$D$uq`|$ G`Ӊ $u щw*l$$s'р4l$skPh$hĆ3o =NND$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ ho$h$訞11҉ ^_[]ÉՁ|$U u L$I` L$w$t'ʉـ1@BPh$hĆ3o 8ʍ 6ʍ   1$5N$~3%)1@ NIl 5NNK=NOd$sC=d/3CNdЋT$ t1҉t$VQPRA{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRoL$|$ щT$ՉD$ȋL$D$VW|$RP6oыt$ʋL$Vt$QRP@$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45N;F8|$}X1Bσ) NyU uI`1@5N;F8|$|=NtNVPPV 5NF Nd t15NUSWV$΋=NG Od t15N=NtN5NPP軮 NxU t)h$讚=N(NxU ‹l$(H $t@\$=NtN5NPP9 =NG Od t15NwNNHC, $9r%UQh&$g =NVN $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5NWN\TudNjpxt$0t$ h.$<=NWVV1L(ɉL(@ u1LXɉLX@ul$Njpxt$0t$ .$,;=NtrUV軪1tttpTtDpC u1~Cu) y% $D l$hVUo  W% $D9Pl$NT$5Np0^_[]j\j \WV։σ=d/3ȃ@PQR  =Nt'ȉGffF=d/3u GffF^_fUSWV$8tW ƅuWh]"jW $$<$4D$Phd@U tj1OLVhedAU=. F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$a 1 Sh"UQ CPh "U C Ph"U CPh"U CPh"U CK,C,Qh"U C0Ph,"U $@D$t P 1-Uhzd@$<W- t1 VhedAW, hjUF D$ P$4D$, 9L$L$9u0$S11:*J8tx$0ht"b$11҉ $ƅ*ŰPj PU ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW貲 uMU D$t$$$Q1e^_[]fWVt$|$ VW> t$?/tWh*"nVhC"n^_Wh"j fUSWV|$$\$(SWt$(t$())jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP{E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVJD 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^ $PU^ st$hlv$ _ƍD$ jPѼ uh@Nhu$t$/dev3@N DN/ ѹENt@NL$$t$ @$jWh"G0 u ƅrt$(Wt$(V0GPV0|$t$( Ɖl$ ŋ$HD$D$t$ $xL$,QPjVh@Nuh@Nht'=,Nu$,Nu hu$D$@N$l$8$Vj$u Vhv$ ,N9|Pt$t$谤 )σ}4$ N-NuU-NuY59t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ4N5LNHN33t$ƺQ=dND$hND$ pNPND$hNlN1 pN5tND$8xN|NNSNNNN5NNNN[NnGfNfNN 33fN\$H$SW蔜 93rWhNΙ 5 N|$t"V&YjVhN> 1ШNHNNNND$N LN+ \N 1҃r1I15hN~σRVPW5LNH19w+5hN|$OL$)9r΅u Nf5N5N5hNVxNYVjP01 GD$AD$ 11L$\$hN\NtnNtHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& hN@Nt N hN@ xN1HxNL2 xND1\$;|$thN)áxNf\0 xND1 pNu\$fT1 xNT1fD1L$ G;|$tD$ N|$11t$TNXN=$N~i N i{5NQ5h$|=$N|(L$ hN \N1PQhA$PPtID$$z39u1H|$LWhht@P: PPftu!ыt$$NtL$QT$=(NuL$L$D$ 1D$L$ 11T$hl3&=Nt$tXNtOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5NhN1\N 5ND$ hhHNP$ 5LNdNP5xNVt$ =hN=\N `N15,Nǡ|N)؉1t$ P =LNWjhN, dNH9|$u_LN5hN \N)ʍZ9s1GрNB9r)NVhP(, t$ 1Ƀr!11ƃNCω 9rωp 9ǿs"ˀNCI 9rޡxNL$  `N1ҸNPt$ 5pNVjNPt+ N LNL$)QhPS+ u1N@ uxNL$ D `N1ҾNVt$# 5LNjV* =pNtb1=lNt 133lNF;5lNrxNL$ D `N1hN5LN G;=pNr=$Nt$|\tX=NteNt\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=(N|$T$T$|ʉj.yEt$몸dp#|$|$tV% hN \NjQt$,Ph$ FT$;D$_=$N* dNt=(Nu&D$ D$D$j D1hA#E~ j D=(Nd=N1N$hjV( fF쀁=fFD$8FFF fF5LN ׉؉t$ ֍$fBt N$,F܉VDF81 L$ F4D$4z `N1CL$ =LNWD$(\WD$S5hNtPjt$0' N 9`L$97|$0N\NL$,ʋL$(T$dN1GL$ T$D$ ND$hND$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP& L$ D$1t$V `N1CL$ \$N hN=LNt$,9sD$()QjP4& t$UL$ D$41ҋt$(VW'V0$Yj=NtNt 637363@1=LNà r t$hhjV% fFAR:fFLNÉFD$8FFF `NfFfFV LNAFmlj\$r*D$p1ۋ LN1zC9uߊ `N1hN5LN5LNf583|$D$1ۉt$ 83x1ɉt$)r򍀅NRQP$ Wh83NV 83ND$ fN `N1Vt$ \9\$t5LN83D$ CiL$T 1VhVD$pP# 95NtNt334353fD$TA8fD$V33ƉD$XD$8D$\D$`D$d fD$lfD$n `N1@D$pAD$| `N1hN5LNiL$Tj fN1ۃ=\N 5N<hhHNW' 5LNdNP5xNV  5\N `N15,Nơ|N)؉1WP5|N5N薡e^_[]h$h$ $h$P>h$Ph$hZ$Vhl$Rh$PRh$hVh$hVh$RVh@$Wh{$VPh$h$vjVWt$h$gh$`h$Yh$Rh$KRQh$B$1@$'h$hυ$"h$h$h$h$$ h$hg$jY USWVpN=NtrNtKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(hNЃNt N hNЃ^_[]SWV=(Nu0׉΋ ,N\$QPSt$ 5DNБ 9u^_[WVh$hu$j袾 USWV=(N΁ Ou=\N1 LN O,N11;8N-)~"1OLOPh#)G9uj .(s*D$<jPj j5O7 y hj${t'D$jPj j5O y h$POt'jhOj j5O y h$ 5ܶO 5OPhOh$W(jh93hh5O y"93 93=h$jh93hh5OC hjT 151A xVWhOh^$0 hW$hĆ3|P1B PP@|P`PPdPPhPPP P uCءhP0PdP,P `P (PP PP ؉+`PdPD$HT$Ll$HP+hPD$8D$85x&v?|$ D$ fD$l$\$4l$ D$4Ӊ PPԙ&whO PPTP PPXPPʚ; PP6eĉP11ۋTPPPD$T$ ؋XPdPD$`PD$hPD$5PL$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05x&ԙ&t$v PP5P=XP|$(t$(|$D$ fD$ l$ \$,l$|$,=Pʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5P P=POt 1AOy7O O9}(LPi-@=B'LO@9uLPe^_[]h$hN$j訡 USWVhpPj жO|&\$Du{'-pPxPD$hD$h5x&\$Dݜ$݄$h`Pjn u{(-`PhPD$dD$d5x&݄$\$D|P;OD$DP P t]+ `PdP$$߬$P+hPD$\D$\5x&ܙ&s=PuZOtQP P t5+ `PdPL$xD$|l$xP+hPD$XD$X5x&wD$DD$DPO &w١dP `P t>+ PP$$߬$hP+PD$`D$`5x&D$Dw\$8O$fDŽ$jhPh<$$D$ Ot$؉T$΍T$(jt$F$y'hӍ$΍T$(jt$Jh$~΍T$(jt$bF$x'h$΍T$(jt$$Fft$NfQPh&$ ΍T$(jt$؉t$hA$΍T$(jt$^؉t$hY$v΍T$(jt$z0FT_hr$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h$΍T$(jt$؉t$h$΍T$(jt$d؉t$h$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h$)΍T$(jt$-؉t$h)$h$Ph$L$lL$AQ D$iPh$h$ h$h؏$Nh4Ph$}t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظy$L$dT$C;ĸPu#PhȸPQD$XyL$$ D$LĸPPQhȸPI T$Ҹy$u1Gz$T$P~L$r |$ rIt3H t3~l3H l3 hl3j (  }T$A{^N2D$ˀ) h$uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$Yhc$C9 |$ sSt3H t3~l3H l3 hl3j   }KF߉Ήs(T$hk$L$T$؅t%t3H t3~l3H l3 1I hl3j hl3EءP;O*؅tءO!^L$AQ T$Q=P P t+)|$L$p|$tl$pP)ЉD$PD$P5x&PPPP93v93PvP\$CfK% Pf!t P PT$ .KfKf PD$ 8P@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J8P@)t2(uK $POt1 $Ph}$ $P O PVhӋ$  Pha$h$h $h-$AfPhJ$ho$h$h$h$hΎ$h$h$h $h$wh5$mhO$c $Ph$V1BD$D$pf93@)f~\OtSωL$!ȹT$V!RPt$ h$T$ D$,Ot1RT$D$fxf593OruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BOC9D$=O ؉T$5O|$7LO)RQP,s GD$9L$~D$8:LOuG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5O)LOt$>RQPh-$cO;O}0u h$CPh$1Cы\$1B\$D$\$D$T$jh=$j| 1AhN"WV8P~bPP t3Qt3; 3hl3j.CP l3Ql3.H Pby`)PP t3Qt3; 3hl3jP l3Ql3H P|tN=Pt4t3H t3~l3H l3 hl3j uPPhl3hĆ3`PPdPPhPP8^_jj1A1=PPwUSWV׉E\$1AMO]E uWVh$ t h$ Sh$ Ot5@D$ &\$D$$Ō$ OfyuhĆ3je^_[]UVh1AtD$O$ӌ$U |PD$$$@ PD$$ $+  PtD$$$ |Pt9+ P} $0$!L$LD$L \&D$Ht$H\$$S$ $  PO PL$DD$D=P@|-P& 93 P\$,D$(\$ D$\$D$\$D$$f$ OP P t5+ PPL$XD$\l$XP+PD$@D$@5x&P P t7+ (P,PL$PD$Tl$PP+0PD$L> QPha$lOtkD>L> QPh$F|>uGD>OufPh$"L> ffPQh$ ^_[WVOu8jjV; t'86z PWhɑ$hh4P"6U Ph׬$hh4P^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h$8$t$t$ t$SPhё$ UPh$ t$t$t$ h$rt$v Ph $Xt$ \ PhY$>r0G9s'GPh#| KG9r߃$^_[]fUSWVƀ8-uFh1#Vu \Ph1#V1u `PT$,11CD$D$h$Rt$0͎ Hw؉$Dy'\$̃duE뻁뱀=\Pt\랉\$떁댁낃u1 31;L$(uj1L$ 1ɉT$Љ $PL$Au $APNJD$t2ڋL$ PWHb Wf uމ$DuY|$uji Džuu Pv`$t8=\PuIj Vh1#´ Wh($T1FVvPh׬$V3 SUU h1#=`PMj Vh1#l Wh5$Ve \$dp#ۉ"i$VWS  jjVWS\$uDQ 1GWWWjWjWjWVWj VWR u hk$j聄 jjR ux$8jFF uP j3F j jR t)qtOQ F j jpR u$8t1Aj jh1## ukWhZ$jh$9t$U\T ˔$Q^V0WWQ Ԕ$tdp#V色PShAx%WE SWhG$j諲AVv&=\Pudp#VPh$hĆ3EjfD$tPh$Mh{'Ph$hĆ3jUSWVPu } h{'WV臊 cR~5StET P͍Hw4$y'|P벃LxPP둃ftTdL pPtPePVPGP8tP) 3ȋP=Ptjjhe%O PND$ jjj"蝋 PjL$$Qh@hPN u h%,Pi )ލ<S H $y'=tPt1Aj D$<1CPSiD$D$ PSRD$D$$PS;D$D$(PS$D$ D$,PS D$D$0PSD$D$4PSߎD$8|$ |$z |$o |$ d |$Y |$N F PD$8gtj5P5P rD$ D$dp#D$D$dp#_;-PSHt.H$1ۃ=PuWhA$h%$h%  >hw&S g =Puh$h$h%  1CPFLCSS H3 VT$W$y' \$@1ɍP$z'P1A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12P#PL$L$# 1AD$ PD$@PD$ D$<+PR D$ Pj$P;3P;3P;3 PP׋t$#D$ PjPd$zT$ ED$ L$TL$@JL$CP";3-L$#d$d$d$L$׋t$P:P@.P"PP P\$ PPP t Pt P1SSP L$Y\=tPj$)/jD$D$ D$dp#D$dp#PL$9a|$u qP Pta|$  ‰4 D$=PT$tD$1@D$ 1ۉD$0hxShP atgcuL$P PPP@P,PP$P@PP P 8PtJt$(~A|t1Pt|$ ObTPPtPt$ tH@WVhP蔂 P=Pt=Pu,$PtMD$tH@Vt$ W@ =Pt=PuL$9$PtDD$(tIAVPW =Pt=PuL$(G${PtDD$,tIAVPW褁 =Pt=PuL$,U$.PtDD$4tIAVPWW =Pt=PuL$4f$P tDD$0tIAVPW  =Pt=PuL$0s$P)f=P=PtP=PuG=Pt4t3H t3~l3H l3 hl3j P1=pPIWhP5PLD u+O87tEt)7|$t+u-Ԛ$/9|$Ph$!ǚ$|$$ PQPhט$83u=Pt"1ۃ8=P1ۀ?D$[%8t$Qt$ h̿%D$8tGPh$|$ ـu(=PuD$$po Ph$Qt5j ad|P xP P PPWVa 1t7tuԚ$ǚ$$ W}Ph<#t$ |t$$pt$(dt$,Xt$0Lt$4@t$84e^_[]jh7(&jt Sh#B#h\$ h~$h$jt WV93t#|$ 93WPEtFu93F^_USWV,׉1l$u5PV5PD D$ VPUhPWSS|$G"ww Gw\$VVSVjW臠D$t2Px1PPSVjWNl$=Pt'h$$=Ptt$ h˜$ 1|$94D$=PtCхL$% D$@Pt Ky9=pPCx$CD$CPS5P? u87t 9D$=Pu{=Pt i5|Pjt$ P$P*$tH@$5|PP|P$Phh%"9V{Et7tuԚ$ǚ$$ P,Phט$1G,^_[]Ph$h$ h"h$jq USWV0=PAuF8,r!4{'h"Ph($ aPhS$PhY$F<5$z'vvvh$F|$(QPhB|'RWl3PWXch${F(|'QPSPW謁l3PWch$@F QPSPWvl3PWbV xdvvhv$ V!}'t|'~ d}'tF\$(RPQhS hl3S~bV e^_[]FPh$Ffh~$F hdp#Phb$S F|$(QPh|'hW肀hl3WaVƘFPh$FHfw6$8{'h$ch$Ph$Ph$6h$'h$ h̙$h "h${1H9vhݜ$B-NT$(PQR FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPh$D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$Xh$^PSVh$hl3肛^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV*+D$  PGh1PPWSjV|$dt$ \$h$D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9;3tE;3P{y$L$t h$h=$QQhD%PPh$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPE#PPh$l t3H t3~l3H l3 hl3j T$h9t$v h$L^_[]h$ jh$j}a D$t'T$tt h$h=$QQhD%PPh$ ËD$t%u7$%tu'$PhA$$1$Ph#RUSWV|$<\$8D$4t$0~u/jU{ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR~"Ph׬$PWh# ^_[]USWV|$4t$0=PuMPhhPjt P'j.hPڐt@hPhPo t"^tCt0Wv`rhhie%hPo ^_[]1w)ȉPjQ1 SVUD fEu jU^z WUu&VhPSh_$hhPP^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhPSh$hhPP[SWV$L$4D$1G@~'t$"tZ@:t9rD$PhW$,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vt@hPPpu7ut$G ie%hVhPm P^_[VD$L$ 1Ҁ0QRRhhPVP thhw%hP P^Au yuyt$Qtu ȃP诱 Q觯 APh$hhP PSWVD$PQ4$RP4$RPƄRP.r|I1AFL$ tWWVWh'2 u;D$ D$ P[TWWVD$Ph'2 tt$dĨ ^_[]hV%t$ p, tԉ1|$l$Vh$PVSH`Ht$t$Wh|dD$P4 \$tN1D$;D$ 2i9t$sVt$^t!ʼnD$t$Wh|dt$ ul$$WhedAPǖ f$a$>ukSt$h"hg%h$WƄ$tP5O$ {$t胲$QPW $Kà9Éu|$$P) 1hV%j* Å~A1ۉh"PYujVh"hAx%h$WƄ$|$tP\O$ {$t誱$QPW C;\$ mU^b|$l$|$$PUSWV 4 ujD$$D$<$sh$Vmthj%V[3hUF Ƅ$hj%s#ut s hj%Vtt s h$Vt P~V PD$ h$VutHáPth$P蘣(j,S}tZ SPU,PD$PU,xD$!=`ÉUh׬$LI STDž?tG<$tSWUhß$h̿%h$VeV+ tEUhӟ$Zh$?Uh$h%h$P15PtD$<~viǠPM WPj >[  tVu |hhPSqtGtYukD$.}"D$4ѡ$sh$ 7 h$ 1# D$@B}"D$4ߡ$6D$8}"D$4ء$}D$J5$D$4dp#}D$HVٝD$$}} L$3\$ uut$|$,Gރ1һ 1ɉL$T$V萝9r؋V\$Ӊڋ\$ˉOƠÃÀ|$Ht$D$8t4L$$\$ D$<D$PD$8 D$L D$ωQPWRۛ T9|1 1ɾɚ;9ƾ֋t$|9Ƌt$L$$9\$ D$8}|$$h$h$h}"Wh $Wh}"|$hWVQh$Ph$4D$<D$PL$,5AD$dD$hD$D$D$D$ 1߃}t u9wNL$,@D$(_ wt$|$p \$D$؋\$T$ \$t$Tt$|$l|$d$L$h|$3D$}L$ jj hdp#RQjD$sP; eD$L$T jj hdp#QPjD$[P 3L$<ȋt$l拼$t$Pjj hdp#VPj$P T$vD$\$)؉ jj hdp#QPjR |$pGL$[Qt$(Pt$DhL$@$ۄ$D$$ڴ$ \&G(D$$\$$D$D$tD$$L$D$ L$kL$D$$V$(D$(L$,\L$,D$(|$pK\$p{L$ D$$D$` t$PVRQ躘Pt$dWt$Dh!$kD$T$T L$L$T|$`WQRPu$L$<ȋt$l拜$t$Pt$`t$XVP=D$lt$\$)؉ t$`t$XQP$ۄ$$ڴ$ \&O(L$$\$L$tL$L$ L$D$$D$$D$$,$n(L$,D$(ǠI\$ }t$D$L$ |$HT$Cjj hdp#PQjR0 ZD$  |$[jj hdp#PVjW ,WD$GPhs$ }(|$HD$ L$ T$[jj hdp#PQjR D$L$ T$Cjj hdp#PQjRf \$d؋L$6 &$UV誗 tJD$PUt>D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hf$h$Sr\$ =PuD$m$D$ P$Pظ 8\$t$Php$8PPU uUh׬$81@$~#QhL$91@$\$$$Ĕ ^_[]$Ph׬$j: ǞPh{$hĆ3臻 j USWV L$P$T$t-P*jhP. PšP$T$1i E$48t!u6$t$PnT$ uF$t$PRT$ tEM<ǃ hu$J71 ^_[]ËD$ t 0P$4$݋D$ t 0P$$ؾPPhhP63 uhPh׬$j.9 fVD$t.})zh2Qh$5$P  zQT%V%%'PQhAx%5$P߹#u5$PhL$* zQ^ËD$ H^WVθ%'PVt)uVhE$5$Po  zQSGt8tPwhڣ$j wh$Xuj wh2QH GTQXQ^_WVD$ t;5XQD$=P 4Pu P';pt8@uVh$jr7 @u=ȂQthȂQPhڣ$赀 Ph$襀u5XQ=P^_Ã|$t $y zQÃ|$t %X zQÃ|$t $r7 zQÃ|$uhQh$5$P  zQÃ|$uhQh$5$P躷 ձ zQÃ|$uh\Qh>$5$P艷 褱 zQSWV$$DŽ$HH$pyƋ$ ƒtS!=yQ$t${$atσ=zQ =zQ PSj $;rtr1Auu($$hd$PQ te$P$$ho$PQm t8$(1;BQPVW7V9J> zQ^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hh"zQtrʄt<$1ۊzQt8tCu 9s!zQB+$=FFu4$D$|$ 1 2zQ$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ 2~Q<$؉D$2~Q$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5$PhX$"<$?uhVW@ x^_[]USWV0$Du%$H$Dh$PQT y1E- Qhj(UhP t$H4$=TPI1VV$P Í|$0;=P= Q$H5zQ5zQ5zQs =yQ$t$9ƒ=PRPSQGy= QuE= Pt<PP$Hct QP  QVV$P Å 4$j Q zQ0^_[]Ã$D|Ã=Pt=P;1 T$󫋄$HRjh4 |$D$=Pʉǃ= Q$H[L$05zQ5zQj =yQ$t$9Ã=PVPRQw= Qu9= Pt05PP$H1t Q5PG=P-= Q$H$HL$05zQ5zQj ƃ=yQ$t$$H9=PPVRQv= Qu_= PtV=PP$H1t Q=P$$H4h$ʷD$P E;$Dnj= Pt#$P@=u1Hjh<1#P jhP WV= Qt@= Pt75P=9QP9Q15P=9Qu  Q^_USWV1@=PS=9QFϻt$ͅtUSh$5$Pc5$Pbt$PhVh3xd3L$DH?u zQt$j QĄ^_[]5$Pjj/h$VUSWV $ u{$$hx0#wtrƉj h%S4 yQ yQ@$t$l$ jhUVx!|$ toSjWj@b!Vy wh#$5$P  zQ ^_[]Ã|$T#t~"Ã|$t!hY$hN$h>$5$PҤ11H zQWVt$D$ tu51>#t5PRPh|$QP#5$Pjj6hE$QP1 zQ^_h$hPt$t$  zQh$hPt$t$ zQWVD$ tZ}UuZt$~h~"WxKtOhT#WfKtBWy7vhĦ$5$P? Z1H_1=4P1@14P 0P1ҾT#t~" щ 0PPVhަ$5$P1=4P zQ^_ËD$uD$L$h$PQ tvD$ph4$gu<= zQu0=Pt5$Ph $D$ph3$fgu+QQQ> zQVD$ L$ zQt u]H dPHQ"tsP3 t8[=Q$Pt5hQhL$P裞  zQ(^鳘Vh;$#Pjj$he$oOVs2^ËD$tIDuD$L$ho$PQK t$D$ph$GfuQ0 zQSWVD$-uD$L$h$PQ  1G= Qhj輴WhP8 t D$1VVt$@ ǀ?tx= QtyD$thWh$teu Q= QuB= Pt9=PPD$bt Q=P  QVVt$ DžaSj׳ Q zQ^_[ËD$uD$L$h$PQ tmD$_D$L$h$PQx tI|$BD$ph$mdu8D$ph$TduQÃt8 zQUSWVt$ |$.E1ۈ$5$Pjj,h$K% u v1.贔 zQ^_[] zQUSWV D$ #D$$L$ h$PQS L$ ȃ#D$$L$ hd$PQ) D$ L$$|<$DhE#t$ipt3$8|t+4$$H$$ 3D$$h $0pD$1E- Qhj臰UhP t D$$\t$= Q1D$ H9=P@$t`%$9t$t#$T$$VVP4t$Q܀ Qu?= Pt6PPD$$" QtA QPE_t$j覯 Q$9t4$,衒 zQ ^_[]SWV$tKjjQtK~Ss 9uWj(1uh$$+1H zQ^_[þV Fujjۮh#0 K%tj/V] t@hQW& =4Pt85$PV$PHQP~ Q Pj i|j5yQhgO#WV  jWV Vh$ zQj蝋SWVPD$D$t&D$t$hK$PV r zQ^_[ËD$phT$^u|$h\$ tD$x|$Whg$^WkPjW3w uP|$ho$ t D$x |$Why$;^WjPjWv 1ۃuM|$ Àu*D$p Vhy$]VjPjVv P5$Ph$D$ zQ=Qt =Qu&=Qt#hQh$5$PE  zQ5$Pjj%h$#FËD$ zQ-=Qu=Qt#hQh̨$5$Pܔ  zQ5$Pjj$he$EËD$uD$L$h$PQ蘺 teD$ph$\u<= zQu0=Pt5$Ph$sD$ph$S\uQ< zQËD$uD$L$h$PQ teD$phM$[u<= zQu0=Pt5$Ph"$D$phL$[uQ蒍 zQËD$t8uD$L$hT$PQQ tD$L$QPhdp# B zQUSWVh$V! $|F$$h1Gh4V" 9}hhV%Vn" G9$uVh׬$Zu jLTQ^_[]ËD$t8uD$L$hi$PQ\ tD$L$QPh$ M zQËD$thuD$L$hd-$PQ tHD$:D$L$ho$PQ t$|$D$pph$Y Ãt͋ zQVD$t$5PPu h$Y%萋 zQD$ ph$rY5P^VD$HrV zQ>5PPuh$*YD$ ph$Y5P^VD$t$5PPu hʩ$X%؊ zQD$ phϩ$X5P^Ã|$u|$t蝊 zQÃ=Pt 1PP)jg=Pt 1PP j„|$u|$tD zQÃ=Pthש$%X釽V1VVcVuVPD$ D$t}uD$p* zQh$W+t+hE%W+t h$W+u7 1CvݻttHPuLPhz1H!LPP5HPh'$5$P"1 zQ^_[VD$ L$ zQʃuCuDh$P(t$Dh($$t$t $t|$@t$t$@ЃD$;Pt|$tt$1D$L$dC.$`7.$s.$tg.|$Htt$HD$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=Pt;P襡D$HL$H+PtD$Ej/t$L7 t@Pt$DhO$t$HYD$t$IPL$D|$D$81yQyQyQyQ$$9Pt1$Pt$%u$\$` yQyQ|$pyyQ$hx0#t$L蒸D$|$t$A$QP2u5$8$<$$$\$` yQyQyQ yQt+t$޷j5yQ5yQP7Y=PtPt$Hhֱ$5$Pup yQyQ tQPh$5$POp5$Ph<1#l 1O$=LPYLP1O$8|$pu5 D$TQhu$9zPht$hW = Q|$Lu:|$LD$puuh$t$Hh*$[uh$}D$LyQ$|$LD$L8|$dD$t$h$}8P莞$$WC$<h %Vor1A$<$ǀ?tvj:W4 t=@j $QPr ~޻t?$9u3;$u*W:C9$<r$)PWR t/h %VqDžm1Ft$Hh$1$t P!$$u |$p$$yQ yQt$Lt Vh$t$dKt|$dj%Wt Wh.$1$GGG fGd$P$xPW# $u2$t'8t"$tJ?t1h\%WCtVhn$sw$7(2WDŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB PJBB D$$PRW$8rD t ]P0RtD$$Z$$Pf-j j WhSvvL3 t%h"PS j "PW =Pt+D$$xt!~$t$WSP5$Pkv jvO Åx`=Pu~PvvS-x)$P$P$Phdp# ykS 1KW$Phƴ$ Nȉޅɍ$P_B PW$4h$uh1N=PtJ$t$uP$$t$uPљ$P~R$QWhs$@tNu1h@h$hP tP059Qދ$tPDŽ$$t4W>PjWJ $tPDŽ$$t4WJ>PjW^J $tPwDŽ$D$$t PA |$D$$h;j($#tu'VSW补 t߉$ȉ)u$$P9=yQ=P$T$LP$9=P}#Ή5$P$Pq$PHQP;H~-Q#PΡP9=P}Pj#?\Ћ$$L$T $|$`t)։>ډ׋$$|$lP‹$4$8$ PˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qdj$P$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5lP5pP" h#5pP-M|$`=$@$Dt$hl#KhE#t$-D$8|jjj m$D$@h@$P D$@|$@DŽ$%yQ yQ m!ڃt9}M#$H5yQyQ$$!;$$=Pt5$Pjj h_$)D$TLD$@l3x=yQ=PP PƒP9}%$PHQP ;HQ#$PHQP<Q 8tB$ڋ$!t yQ5yQ1ϋ$H1 D$h`%P h@$t$UD$@|$@tDŽ$@ t$oD$@Ph$h$Vh$O9"pP)PSh˲$fhݲ$%Pt$Hhm$jykh$h$$^bhr$^L$D$ D$8t$4D$ D$0D$D$,T$1@މPj YWt$nthD$Wjbt$@q $=@ $#$1V$WE$$$$$$t$@Ѓt$@Wt$ u.5$P$P P艊PhQ$V^S P=P| jjyQx& yQ PyQP; yQD1PP1\$  yQ yQPL$T$ T$8t$4\$0r\$ P1tt$h$5$PR L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Wh${\D$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#T7tt$hз$5$PQ T$d|$?D$TD$L$ L$8t$4\$0ËD$D$,T$1@hM$[D$L$ L$8t$4\$0h$[D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hn$$Z$D$8$D$4$D$0t$,$$1@މt$$h$ZD$L$ L$8\$4q$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$0USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q t}D$V~ƉD$j@PPt%L$L$4,P@P~ƉD$j:V@Px~D$ t$D$0|$j$jPW4 D$4t 8D$t{8tvD$ t8tj;P thN$PhV$Wlh^$WVVWh$X Vhذ$X1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh\%V @L$ǃuC=PtaD$t$uI$t>th$V 1Ʌ $t}th$U1ɉL$<=,P=Pt 1PPѼ=,P%0|$DhPW |$L$D$L$D$ tD$ D$$=PPL$QPp=PPt=ut$8t$8t$ D$Pj3D$T$"tQPh$V "D$Pj觓<$l$,|$u'j/VtG1|$t>tFhhQ&l$LU l$t$1l$ -QD$Pj9-Q*x1l$,1Kd}Z<$t3$DSVW; Sh\%W SUW <$hh%t$LV t$l$D$ D$<4uT5PP=P$t$hP|$LW |$D$Pj5PPuj/Uo t@ʼnD$ D$$=PtAD$Pj?>uP= zQuDhĆ3jhh$))1D$PjT8 zQ1ۃcÍL$%L$0d؁D^_[]1Ehf$ TPh$h$jf USWV օ\$ |$$jh$Q l$t=jh$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CS:yS\$$UP { uG<$WxC Uxj@V|$$tZ{ u ,Pw@PwƋ_j:SJt@PwG_Ot[uUnj]U $tYÊ@t<:uL)SUV Vf,$}:1j:VtEt$t$Vh̳$1ۋ\$ t3tHj PUK }t $9ut=s fCt$t$Uh$QCC tWt_ukPKUVh$yQ t$t$Vh$aQ\$ n1HJ3P(udp#U8vC{u{ ]%t\%PvC1 ^_[]h$jI WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj_\= Pt<(Ph$jdViA~ $PIu1IPVQՐ jhtPX VdPj[= Pt<@(Ph4$jdVA~ $PIu1IPVQl jhtPW V΋tPFtPFFtPF^WV΋AtPF~t,WPjW1% FtPNF^_SWV׉΋j:S#tDSsP蔄tj%StSh$Vz SSh$V` G tu)GfPu G=tPh $V+ h#V^_[USWVP։ϋ\$l$ =P\$0l$uE5u@=@Pu7$PHQP~ Q Pj =5$PD$x u@uhD$5$PhPti K=PthPhY$5$P 5$Ppjh@hPh3'tEt W=9QkP0t&ƅu'$D$5$PPh /$~ t&$=Pt9Qj 6Wb P8P059QV =9Qt'~t!$PHQP;H~Q~ > Pj hj h*j ^_Ã= Pt$PHQP~Q fPj fV5Pu<FA\t"uAt""tFAQt FAAtF5yQ 9Q;$yQ 9Q1tu yQyQyQ^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4 'RSt$DhA$QP yQyQȃPPD$u݄$|9s0;T$ D$r$|$\$|?؍<)hc$؍<)hV$QP; N+yQ yQT$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jhlP VD$ B J1rrJVRVQ{ $^Ã0D$4L$8T$ 1ɉJJJ JJQRPp x$1H0VW0jF0^USWVh=Pu=Pu }t$XjVx+xQ~=|QN+ Qy@BD$HT$Ll$HL$$D$$5l&P PЃ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иdp#ti#|$d5yQPRQh~$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQdp#ri#+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ QHQP~ Q P^ʍHr̃t"1QHQP~ Q P\t"u5QHQP~ QPֲQGduQ1G QHQP~ Q P舲[~#\uEQHQP~%Q'H wr? t:,u3P>t%QGdzh$ 1NQ=Qiie%T'hQP覲tu :v2USWVՉhQQtDj.V1ۅt6UPІu&)WhQV;m u1ۀQ1C^_[]SWVD$=Pt5 Qh.$5$Pn nD$t$h[$PV` uA PPtPt$~Vt. P9PQ  zQ^_[Pv蔘t=Pt"=Pt5Phv$5$P 1G=P Sh%h2Qi =TQ=XQSh$hQui =QShp&hQ\i =ĂQSh<"h\QCi =|QSh:&hȂQ*i Q=P1PPv hY$jX WVPhP裮ơ$P?snt$h$P ƆP P?)PRQh35 x?t$|$ 9Q1; P ^_Phz$J ^h$t$h\$5$P7 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=,PtDt Wlh$.$t Vlhz$PD$D$ L$PQRSm:4$uu|$l$ hP$PtQShA$PGShP$P6 D$WjPUh3tU5hPsƉ$t=Pt`V觬S蜬<WFWt$Pf Wh,i$Vng WSVcg $t Pk4$VhT$覟uD$uqh\$8 t66h0#t$h\$5$P; zQkt$VD$VҫPjV D$Phg$Ƌ|$W襫PjW蹷 u{D$ u?ho$8 tt$VD$ V]PjVq D$ 8Phy$蚞Ƌ|$ W'PjW; 1ۃD$  ˀuPhy$Vu_4$Q1F=TPuRP,=P$QShs$aOuhm$! 1$tPi$|$t.WWPjWk D$tPiD$|$ t&W!PjW5 D$ t PQid^_[]h@h$hP#d P059QWhhQ' uQQQV5P=4Pu Ph$Ӝt>h$hhQPb r1ɀgQ.)hhQPh$5$Pdjh$hhQe tfjh7h$hhQe tN=TPQtQj h$hdQ4 uh5$Ph$E S=TPQtQTQj h$h2Qb th2Qh$5$P 1HQQQQQQ Phƭ$1Ƀu 1A Qu ǀ Qu Q P5P^Vt$t3DH@tNFuh$V}tQjh$VXd tDh$V}t9h%V}t.h$V}u'QQQ QQ^áhQt PӦ1hQPQQ=,Pu ,PPPPQt P!fQ=TPtPPj= Pt#$P@=u1Hjh<1#PE jhlP WV?0jk=PtphQt1@=u1HjP{ 5hQͥhQPx#jPO 5PA PP|$ j%=PtDhQt1@=u1HjP 5hQFhQP1yQP8u A0^_Wh'$jOO D$tPXt h0$j-O hV$jQO USWVt$ \$l$|$WSUE tU| u;HDO 1 t$ t$fO gK9uX 3I 3~3P3h3~ 3 tuÅt$g t^_[]Vt$VSt^Vh$jVN hhQ臬 tQUSWV= QPt`=PtW$twQPhhQ j hQ~QtJQ1P&QQtNjwtQQt$h5PV]] |0/thh\%V^ hh$V] V5$$P  PL$PyQ$-P1yQP$ t1=TPPGt*@$1SSQPVh$y`%u8 zQd$$r tdQ$ t1=TPPfD$P$yQ-Phx0#VQVQt2$75QfQVh$|I h$- 1^_[]USWV,=Pt8l$@11 SjhU tUh$ ",^_[]<$tދD$0S ,^_[]WVP5P=4Pu P|$=Qtft$h"$+uqj hdQ{@j WP\  =3LO@1 5$Pjj(h$|ru= zQu=Qu Q1HtJ=4PuA5$PhdQx< $PHQP~ Q Pj /1H‰5P^_USWV45P=4Pu P\$L= zQ=Q!t$HhS$+j hhQzt|$j.hhQzthhQ@hQ4$uYhQ519 jQ1f u>hhQh_$5$P@ fiQ20hiQh$5$P iQt$1 UžVh$U a D$(V!у $ P5$Pjj(h*$zu= zQu=Qu Qtj=4Pua5$PhdQ~: $PHQP~ Q 0Pj 5# 4PtUh$5$P 4$|$5P= zQ1Hƒ4^_[]t$h$j2hQOqtQh$jvG USWV\$l$jWish#WYsUh$S_ Džu&Uh5$S_ DžuUhO$St_ Vjs^_[]SWVQ5P=4Pu P= zQhm#+Qu_j hdQwtL8tGx"uAHt.1Ҁ"ux"u"@QZHt@r1ӍQ5P= zQ^_[SWV$h$VfV VQ h%P͝1Fta\$SW訡 t?|$/uH$VݛPVSМ 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhw&Pg ƅu 4$ 1$^USWVHu\$ $Cj j ShWuu L t "hVWM j VSM `P]t/M I9Nt vuvvSvz jjS ƃPjS \$fD$= W|<ǍWh$腅tI=e^_[]h"+PD$L$ $QP-=DQu DQXPD$L$ $QP|-jUSWV׉ˀ=LQu h$t t$LQjjjS*q!ƒt7jPS tuh $Tl$h $11PUVWh%$%؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph4$jV0L0L0D0.Vh;$hl3 Wh*#b^_[]PD$L$ $QPw =DQu DQXUSWVpT$hL$lh@,}h),D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0Ry/T$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$'1@ɽ9jD$0P襊Ń|$<T$1D$ D$,8@D$,O|$01PPD$(P T$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0C<\  Cj$jGٍ$'j  1$'t$'1T$JAjD$ $$ _EQED$$hED$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$XQ$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PV@Ǎ$$ D$ VVD$PVY@94$=31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$XQL$ QhPN XQ11 |$ 1 $R/?t1BuڋD$8L$ Qj P?  Ǎ$Pj t$> ŃuuD$ L$ }D$HPQ4xWt$ P`O $(4$hUt$P>O L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[zj $( PS? z8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =hQ hh V EKpCDH@uٺ>$&G=hQ GK4CDH@uٺH$KfCDH@uٺU$GQC t _DH@uo%ƋD$pWh@1҉ϊ@usFCDH@u\.tDH@*Bh<jh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVRƍ$ jhU uG1,XQt!9}uEpV imjU XQxt$p@ XQ>GWVt$F1EjhhTQ Å%|$څ,h$|$th$zPQ PQ11#|$698^_[]Ë$@Shm$SWV׉HЃ s%j SV G3^_[Ã.$tJ+ueFɃ/t\uRFjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ VN< uF9QsQ^_[]VP Ph$' USWVP׉΋$1m~ w]$8' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x B3B3[>u)jH1҉P5B3 B35ojH@B38 B3>u+ j5PQhl3[u tQP{hy"j9 tjPPhl$hĆ33j{USWV\$|$t$ xQ1EtB5|QWV QQ5|QD[1QQHt8hx0#p|Q QI QKph1T#jhQ_rfQ"Q ...QQQ@Q xQ =QuQ8#uxnu pQ  QW1 t,E-Q@J}xQQR)ʉ1ɉQ9‹\$kQ1m1 QQQu>#u~nu pQt|Q1B C1ɾ8f Q@Q1ɋ\$uQ\$t1A ^_[]ÉfQh׬$j USWV|QuN Q19u:=`QuQ33Q^$ķQl3ȷQy"Q1NHQPPYQ=3PX=̷QtC̷QS輢S5Q th̷Q5QF o̷Q=̻QtMķQt=l3tPXVķQ5Qh̻Q ̻QȷQ=QtQQ Q@QQ=`QQPKrf|$`Q8t0W5Q̷QV W5`QV =<W5Q$V W5Q$U V Z U PWVh`$Wh̻Qg~9h̻QķQ޻t=l3t PVh@$h̻Q萂ķQrH9tt$t$P ķQH9tȋL$!QP ȷQ̻Q=dQuQQķQl3ȷQy"hx0#PQ5Qh׬$ tQQ$@1Q5QP6 5QhQhQ ƅttbQ|0 uNt$@ $@ $QV5QPQ1@|^_[]5Qh׬$j| 5Qh#hH$h2$5Qh($j# h$h$ =̻Quh$ h̻Qjth$벡Q@ u:HQP~ QPUt5QP 1=`Qt dQt SWVQX1t^hx0#3t&Nj@HOW~ VjVWQPQ1FT$1Q=Q1ۉ__ WjWSQPPT$t tCsBtt$u Q;HrQxt$tQ1BtȉÅQJA7$'=ؿQ5ԿQ$=пQFPj W2 @) ԿQQPW= PQҾ5=Q QR҉Y = 5Qh(v"5ķQ8z u 1Pjh<1#пQS1P5Q5Q)1Pjh<1#QS1P5ԿQ5пQS!1Pjh<1#пQS1PS =ؿQ T$пQ=ԿQGPj S1 ƅ ܿQD$4)أԿQܿQ 5QQ9aQj5Q5QhпQj5ԿQ5пQhQ 4 5ķQr  T$пQԿQD$<=ķQl3=B311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5B3r5ķQjjhR%)5ķQj$ 5ķQj 1-R L$ tKQ!D$ ;B3r5ķQjjhR%(15ķQWjS(t$ tsQytejPhІ'/ tQF;B3r5ķQjjhR%P(1І'):$Ph6$5ķQ*w Z;B3r5ķQjjhR%(1t$ D$13PhB$5ķQv F9ut$ t$L$)4B3F9r5ķQjjhR%'5ķQj$v 5ķQj f ķQ@ @9  ֡pQ ؿQu55ķQ5ԿQj5пQ7'=ܿQt5ķQj  j jhпQE ؿQ5 =ؿQ( 5ķQ5ԿQj5пQ&=ܿQt5ķQj 蝂 볋5QQ9Q+пQT$JQQT$ut Q;P ԿQT$IQD=ؿQyBu%hh r& F 5ԿQ5пQP ;ԿQ} jh<1#ra  [ T$=Qujjhdp#hQ ؿQD$0ԿQD$,пQD$(ܿQQQпQQܿQL$(t$, Q5QL$0 QQ QQ=ؿQ_ ԿQQZ=39пQ @ пQ ԿQ9r Q֍Q@PQ!Q5Q G;=QvķQ@ @u1QQ ^_[]Ë5ȷQwN8thNQPVh5#jo PQtxt@ x{t1ɋjjhdp#hQ^WV|$t$ 9tfF{t.wt8suOFHtQN u>F@+6vFt P uF6^_ËFp vh׬$j USWV ՉL$$Q QщT$Љ$ 3QE]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 4Q9r7 4QP50Q0Q Q$Q$Q0D$SPt$V it}ŋ4$L$]\4$L$t&uE\4Q9r+4QP50Qƣ0Q Q5$QF1C4$$Q$Q\$D$ 4Q9ȋ$r+ 4QQ50Q0Q Q$Q ^_[]USWV`}$111D$hH$u W uu5U>ut0GtgU;uU$8u 3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h %Si t+8ttDGhO$j 1E L$3 th%4 u3h׬$j tD$PW/ uhv$ۃ|$ tt$д uh$뼅tt$ uh$렋Cu/h#T K%tjh$VVx VeSPa QVh$ MHPh$hĆ3 e jYUVQ6t@t $e^]Vh$j WVP։UI1ɉQPW V?t$8t-I1H^_I8"u #Ft1fUSWV\$t:{u4P3ƋD$pVqtD$0pV Cf{~a11C403t?L$qP+t+{|7u!473L$1qP D7EC9|^_[]Vt$FtKP F tvPv 菐F v vrF^USWVP1k<jP3~4jP3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<jP3jP3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùyGy8z)z{ {hĆ3jjCh$tjUV1=PQ`cgt*Ejjj " V\ VÒ5T蕷TQ5T袷XQj5T@\QjP`Qt#1ɺXP3A<.uPQ1 1@^USWV D$0f 9\QZ `Q,I fEE!f ufE(Mt!U1f~ t @9ufE,$jtqE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAhĆ3jh W@$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$$'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLe=m$ 5T5T1QQPSut$V5Ts5T5s1U)19}1ۋ$p$)ŊEt9}1< ˊEE5T6hi$1VV5T诔UVj5T蝔Vj5T|% 5T5TpB= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hĆ3je bxu+=TQ TQσqt$VqVTV軅5TIhĆ3j|e ,$,$fUuE 9|)BfUhĆ3jBe ,$T$4xut EfEuGza|1x(| E9}ED ufMhĆ3jd !}Eu)uE t uPu9f;}]D; jtaD; tt$4UЃF4; ~ttt$4WZuzE tuPGu E uuE`Q,Et)uE t uPu<EtPEEf~3M1tRoMEGЃ9|׋E4t t$4UЃu=EE tP&E ^_[]`t$5XQt$t$h$hĆ3UZT`$@ t$St$t$ t$UPh$'.` $A It$U5TQt$SQPhr$hĆ3U$jJUSWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$p`tS;tNt$Cj S)؃ QSVWD$p t G}uo $ $l$Atl$|$qKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufthJ$VSw|$Gu1PPw|$ GL$G)VQw w ^_[]D$L$`Q fAËL$1x9 \Q~`QUSWVl$0.\Q9}=`QDP5`QǍ PjQ 3 =`Qۉ\Qt @tFjR hRhyRh|#Rqh= Rc== Rftp[ Rt=[ Rt h i2hZ!R%hzR1=`"RP ^Ã@.tgzPjjfËD$wL$$d' h#R/ú h|R" hRhyR h|#R jg1ËD$wL$$x'hR/ú5pR!hzR1=`"RP Ã@.tgzPjjhËD$wL$$'hR#ú hRhyR h|#RJ Ã@.tgzPjjoËD$wL$$'h R;ú h#R. h{R" hRhyR h|#R Ã@.tgzPjjpDËD$wL$$' h{R#ú hRhyR h|#R` h0xVD$ t$$'1=R)R  hR5hRqhRc=RftpRt=Rt h [2hR%D$$05RdP~^hPVD$ t$$'1=)R)$R QhRh'Rz='Rftp'Rt='Rt h Ih(R<5)R3d$hzR1=`"RP^XD$L$ttu* h#Rh0+R h|RCWVL$D$t$ $'1Ƀ)lj oh0+Rb8Q8hU%P?!t*t!h O8 W^_hËD$L$ttu*h Rh0+R h#R;Vt$ hNN As'T$fzufJvPh{z%huhhY^ËD$L$Q1Ɂ~t't%u'f!tKu1Af fffHËD$Ik@ltH@1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH1@ËD$Ik@ltH 1@ËD$Ik@ltH1@01R41U71hH$ɧ 1@j791hX$諧 1袼1QjR1hPPQQj jh  1øR1hPPQQj jh  1øyR1hPPQQj jhk 1ø|#R1jPPQQj jhJ 1ø= R1jPPQQj jh) [ R1Á== Rftpthh[ Rhdp#h![ R1hPPQQj jjd 1WVZ!R1hVVPPj jh =Z!Rt#1GWVh$ WVh$ h$ h$֡ 1^_øzR1hPPQQj jhE 1hֶ`"R1QjH1ËD$@1@SWV|$YRW~PVht$S^_[ø#R1hPPQQj jh  1ø|R1hPPQQj jh  1øR1hPPQQj jh l 1øyR1hPPQQj jhH 1ø|#R1jPPQQj jh' 1QjG1ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@pRXi%1@pR r%1@øR1jPPQQj jjet 1øzR1hPPQQj jhP 1h`"R1ËD$1@øR1jPPQQj jje 1øR1hPPQQj jh  1øyR1hPPQQj jh 1ø|#R1jPPQQj jh 1ËD$1@ËD$1@ø R1jPPQQj jjel 1ø#R1jPPQQj jjqN 1ø{R1hPPQQj jh * 1øR1hPPQQj jh  1øyR1hPPQQj jh 1ø|#R1jPPQQj jh 1ËD$1@ø{R1j-lQE3\Jك@to@uwt uDZ@t< ty< =Qu =QtI5dQ贄tj 5dQ (=Quj 5dQ(pQtQQQ?=Qu"5dQLtj 5dQ'j 5dQ'1QQpQtQQ Qf)tQ1ۈD$upQC5dQǃt$L$4 5dQ,9Ƌt$|25dQVUUU9}j 5dQ&|$uCj 5dQ&KVW5dQj E߃ @ ȢpQtQ=QuW5dQt7j 5dQn&%5lQ5dQHfQQpQtQ5dQ{ ^_[]t$Ph׬$VPt$D$ L$ $PVP31A4$^hdp#t$t$t$t$USWVP|$ \$$l$(t$5dQDpQtQD$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWj5dQf1ɉV,$E|$@t[D$@8tRD$u:hY%5dQdt$@5dQdh#5dQdWt$Dt$й hv%5dQ]d4$r5dQ貀D$ 5dQ5dQ0‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5dQJd5dQ謀th%US5dQd/)PS5dQn 5dQ耞5dQbÃ~0L$ZD$  3譧 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP' QtRD$(υ~] $9I\$)RPQү KOuLuH|$@tAt$t$D|$W WhĆ3j4 D$z19Dzf tN;L$$} 3DXuhĆ3j4  $9A)RPQ! $8GED$t+)j Pt$5dQ!L$pQtQD$t8ʋL$ u|$@t$;D$@u  $L$t$t$P 4$0^_[]hdp#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5dQO}5dQ}$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQ!Źt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PktC@j PUuL$$)݃} 9WUQS5dQӕƅ|$ mV5ƅtV5T 4$5dQ/PW35dQZPWV1PPW> W蕙D$E|$ GWUPS5dQ3Pŋ=dQVPW=dQV@ZPWfV5dQpQtQ#WUt$ ShX%5dQ辻1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWVԕVPW"UPPWwP^_[]hdp#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP 1B4$SWV]^_[]hdp#t$t$t$t$USWVP|$ \$$l$(t$5dQpQtQD$,$VAUP14$SWt$(^_[]hdp#t$VPt$D$ L$ $PVP91ɉ4$ ^V5dQ-x5dQ]x^fUSWV $$$ R15`"R5#RpRXi%5h"RWCRWVP ('Ft(=RtvvP臰 vhRFB>vuɸ)RR\"Rp"Rt"Rh%( D$|$ h6Y%SUŧ e~o~1pKrtCGDR붃fg5Uhx0#V-!PhW+ \$h0#WL D jPh# t \$Sh|$WX+ u4 OZ%('WPWV詀 t }u몋}tE$th0#SK <=u͍4@h0#PnK FhR]%V荭 04$VW輮 HRht"Rhp"RhAY%5U bS$$$ FmUD$/c5WhW]%~u#D$=uD$h|$d}:hm]%3 t61WҪ t@ < uFrW6y 1W)y jhG1$h$ Au5T(uǃ5T5u1FVVPW蓊R:$tb5p"R5t"R5RhvګVjVjhj5T6ƒhhPR}D$D$@VCljD$ V4D$1Åj2PߥL$t|$ o u*t$ %n ut$ [%n j|rjU`tc1L$ <:B ɭ@9u1PPPPPjPPj jUVPb4t(jt$W-WA11V贰|$ t$~14蛰4萰C9uW肰Vyj tPjjVhH#Q ^Rjl"Rj"R1V٘  _9j9֋$| hfu臸t==Rt jL jj$M2Q1 ^_[]Ét$ h11GQWPO Ph#hĆ3b VfW=hĆ3jj,h Y%8j袹hĆ3VjhGY%VV1FhĆ3VhEh[%V|UWVV詗 hI#輳 Pӯ |[,%=tRt>VPh]%W 5tR5tRtR=Rt>V赙Ph$]%WE 5R5RR=QuhĆ3jjh;]%e^_]Ã=Rtád"Rtt$PI j^jWhI#譲 tP t h\%诮 Zjh w hjUSWVB L$Qm{  P Ń j h[%Uy ~ uF t$|$ Ww# WfD/UWs Wj\ŋ>7P#tn,$n ;nu:FUWt^FPvަtFljFn ~D$P誠4$蜠UV S ŅSur ^_[]ËD$L$I41@USWV1t$RjV1t$t$ t$t$4$jJVP;=RPt$Vj ն>hj]jYjJ{jVuf5VWVujj^4?15R Nj)RVPX~Bjhy)RjPWyjhx=RVVu%)Rǀ$jhxup_)RPh׬$jX j臒tO)R)tTPCu2PKu#PuajhxP.^_[]Ë$l$ D$jPtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14UtG9uV聨fVsfSWV1t$t$t$ t$t$4$5RjgV蓐jr4PVf8 )R$*tKuKt!Pуt)R$P)RL$$Q裘 tXD$t$VSVSx)VOu]%u]%t*V貘^_[À)ujhcsu Vt5T1WW5T 5TE5TׇSj 89;xhj_jZj讀]jVJ]%]%}跅'USWVο$WQSN Wh]%S WSU2 Wh%U S1tGUxt0VVVVVVVVVVVh"hu41PP/t US^_[]SWV$SQV蠠 Sh]%VQ SVW脠 Sh%W5 Wt VW^_[WV1t$t$t$ t$t$4$5RjXV脍tkjo4PV[5xG)R*tD$$tL$PQΕt$VfLtV^_ÉWj ?t1hj`PP}~u{豃fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW_ L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04茜 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW 5tRt@WgPh]%V  5tRI5tRKtRsh`%h]%- tRt*W Ph]%V  5tR.5R0itPhU#hAx%j[1e^_]Ph]%hĆ3@  jUWVV =Rt>Vr1Ph$]%VO 5RR5RT5Rwh@$hT^%: Rt81hd^%WV Pho^%W 5R$!0nPh^%hAx%j[1e^_]V1hhPhPjjPj jjhe3h谸4xjP航V蜹^hĆ3jjh]%tRtPjjh]%޻jd SWVD$x1|$tRtR PS1; P=PVh5#WC^_[USWV$$$L$$QPhV$hx0#V94 $D$W蒍1K4$螞 1G9r6|$  WU-ŋ$(\5F4$D ÃugD$ PV-iuH|$dhx0#V $t:|$G=tRtVh^%h^%P1 1KS1D5$$t 4$@8 4$futRtVh^%h%^%P1ۉ؁Ĉ^_[]Uʜ$$$1Kg USWVu ED$l|$(PVW7  ED$8D$1ۉΊ<'t  j Fj'V3u Vljt$ t$PS D$ t$ )VPh"L$Q6 h^%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/Wb tWi É@/ W}i É|$PD$S ND$+D$D$ .t Vt$W tSʒ Džu]D$T$L$;ȉD$Pt$ 'SD$L$Wt$t$ h^%P5 뒋D$L$T$;t RxS` |$\$$hV%S1 G|$\$1\$L$<t$0Vhht@W fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=TjP|$ W~ 5Tz:5Tj5T l5Tr:zTD$D$(D$$1WSYD$ L$VWSPQB1N|$p$ RhRhptt$$ =e3\$he3hbtt$( us=e3ujjh0&j1P he3hf@t$${ =e3t0e3he3hbtt$(R ^%\$e3tRt P薺Rt P臃£d"R1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5RL$@EL$D$D$9}MD$hpP85NVt|$u9Mx{;5TtVUjP|$ۋ|$t h<1#Z8hPD8t3H 3~3#h39Nj|$tsj? *;5Tt V+|$ t E%u15T-5Tj5T_est$(諒twP虒uW臒D$td$8u-e^_[]D$t$ h^%j3} Vh8^%P 1S=L 1FV1L Sjhe%!K VS t$L $ D$pL$|PSt$(謳 t$ 0ntRt*t$h^%P 5tRtRRt*t$h#Pr 5RRhQ&D$ 0u.h _%D$ put$v t$e s hzREt8tP2N u%t$V6_ 6h"_%`y jL$1Ph_%@y USWV։5T1@P5T&c5Tx@qh1PSUt6 ,JhP)5JhPS1CS96 IWh׬$֒nJh8%4FPUvp5TQ@)VUPRQ5TgltcjPFt05T߻PV5Tg1PV-1PPV0 VGp^_[]hĆ3Sj+h^%+S fUSWV-1@=Q$hd%Pjq hb~D$1D$ $ $?$Vj9;%VWQ PWt$  VW6 G|$d%|'3D$WPWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P FD$ |$$ ))Ƅt$贍$襍8 }? jS ƃ $NfF'Ju1ҹhvRRRRQRRQjSD$DPju触4D$D$D$ D$ jt3D$ Pt$YD$ p Q )) hPhQ談 14'jVhQP t1GuD$(Vhe%j@$SZ 1PPD$0PD$XPSZ t|$Lub4'hQhAx%h.jj"D$L1QD$PPQQSY She%gt1=Qsu=Qlu3 QDH$D$$Ph\% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvJh1Wt$TV j!W|$0W iW&]hh}f%QChQPPjI=Q hQPPhh`%hIg% MPhf%jo hf%WohFf%Wohf%Wsohf%WeohQhf%WRo =Qt!hQhf%W6o $9hf%Wohf%W ohg%WnWh=b%jnhQhg%h DŽ$hQVVj~j ha%VU Qdefa1ȋ Qult1 j h{g%hQU Qmanu1ȋ Qual1 Q1 Qnone1 Q tlf=Q tb=Qt`hQhQhg%jtChQhg%Sj~$$OQQhhbg%HOh#fhQhbg%hog%hL [ 8 Qhd_%D$ Pj3 ~ht$ hQ蕂 t$薇j hQzth_%D$ Pj ~ht$ h*RE t$Fj h*R*t=*Rt Qh_`%D$ Pj ~ht$ hQ t$=Qu:h`%D$ Pj@ ~ht$ hQ袁 t$裆j hQ臢t=Qt QhhQ{u=Qt QD$1@$" hQS$W VQPPjxVQPPjw SWdt%Q|$$|$ t |$ujQPPjyE|$t jQPPjz^hQ9 =Qu=ca%=r!ƒna%tya%=ujQhQ: jQPPj{hQPPj}Qu4D$D$Pj_|$uh*RPPj|x=*RD]$D]$t*R=Qa%tQ=QtQ|$ti=QD]$D]$tQ=QD]$tQ=QtQSVWQRhQPhQhQh"h,$L=QD]$D]$tQ=QtQWVQRhQPhQhQh"h|(jjjx xP= Qa%Ph׬$hB hIb}<hQhg%hSn S"jrjQ$H1WWV$Ph e%P t( ;$P$Tshe%jPbt^DŽ$ 1WWV$Ph=e%P ? ;$0$4&hQe%jPh>auq5l"R1H t$t$^1t$ɜt$?ha%j<$t$jsQ1@$F=*Rh@$ha%J ha%jgt$(Vj V mPhb%ha%Wf=QthQh#b%Wf =*Rth*Rh.b%Wf 1h=b%VfV覣W=Q5|$tk1hQhQhQhBb%VuQjhbb%W hWWVjFj jh BltNjjSPs8 |$ =QQhQhQhQhb%jDŽ$ch DŽ$attaDŽ$n/slDŽ$/sbihQSyG |$$hV%W D$Lt$t$L8thV%W ut$LD$LPV =QtQVPV |$ u/=Qt&hb%V"hQhb%V |$ t1A&hhc%h1Ʌ Qj¡Qe^_[]hQhQhb%jttRtPjj"hd%1FhĆ3Vjhd%V 5tRth蔺VP\ h}hĆ3P[ jK USWVL$,!ij u!D$@tP jPhQ|y L$,%ij u!D$@tP jPhQDy jPPs ƍ\$1 jhQS y Sh8i(V V7 ulD$P[hPhQx W[t;Ƹ=Y$QSPU^y SVUSy W[Ƹ %uցļ^_[]VPhQhe%Pj<1#Vt$!E VjE tfjhf%V u;h f%VK u&hf%V9 ujhf%V襾 u"h<1#jD ƅu4$|^Ét t t@hVhQw SWVt$hVruT|$tMƄ$j.VYt#GSVhQ;w SWhQ hVhQw ^_[SWVQSļhQ赼hShQv =QtO)~!Q.uQPhQ贒t(QVh%WWw VhQWHw ^_[ËD$w'ødp#USWV$VhU%Ƚu $1퍌$Uh"c%W :HUUW f@$|$$jh)c%P 9tx/uG/$N~/vt$jh)c%Pa dp#w'1҅‰)ˍL$$QSRPh1c%hUG ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<x#R|x1ɀ=zR/zRQPh΃%hhR^ 1^ËL$1Bh$RWVt$=Qu jG7Wj ~u1@lx#R@5\"Rߵ1ɀ=zR/zR΃%QPVWhx"R 譵1ɀ=zR/zRQPVWhR 1^_Vt$V{dЉh@R$^WV D$PhR u:$nfsu-VhRhx"R.s VhyRhRs tWj t1F?t[h|Rh#Rh>c%jPu>#Rqc%hRVWhx"R hyRVWhR 1 ^_SWV=Qh+VQu(h}%\u9hQhzc%V=*Rt ha%;=Qt hIg%%|$hQhc%hW h@$WUƅƳWPhc%j\h$V\=QthQhc%V[ h=b%j[QuGnWPhc%j[=QtDhQhQhQhc%V[=QtChd% UhQh"d%hQhQhc%VX[h=b%jI[h`%hc%WȲPhc%j[ f%SW [hFf%WZSWZ=QthQhaf%WZ hQhyf%WZ =QtPhQhY$WZ hQh#WZ W覵h=b%jvZhc%ZuhQhd%S=Qth9d%ShQhMd%St V?j%^_[USWV։ϸjPPi tCËl$hjWg ojhQWto WVSY Sn. 1H^_[]USWV$΋$PhU%訶u tWdp#Vz^l$PSU xR<$u|#RPVUWh/f%hC1Ʌȁ^_[]ÿ+f%fT$L$t$q"u/Átu*s$Ãt6u8h6h/u uhw%!w'hhݮV D$L$FFhxV~ ȃ ^SWVP1ۉSSWSjh'4t{4$^b1ۅtjSSWPjh' tEhV%V: t&|$\$PS׃thV%j`: uVr Vsr1ۉ؃^_[USWV h%'\$|$jSPL ƅt Eu$wS7m wh`%7m G^_[]WV'|$u't%|$ jWQL t u1^_ËL$e34USWV1td։σSFPSW9 t u6P1PhPPj D$PUD D$t΀8uɃ<$uð1^_[]ËL$f3w4USWVl$\$1}$hnW6S]tOD$SWPHDWWRt.ljFt(V$'Eh%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQX $V1VPD 95RD$40$X@hP@tt$45T6Oh3$n 5T19r Rɉt$ =1MD$Ni8D$$11t=i8,4h"RtǍXUSN݉|$|$l$$R)RƀyH1ۉLPTXVUQ4i )R" .hQPi VUh R i ,)RL$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP7)R$()1HD,048Ƃ(1 R<5RZh"R|$c[ RP$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً RɋD$L$ӾV Wdp#QSPSl$GUq )R$H@ VWdp#RPQSD$BP? tRt% )RQUHDRhqh%P =)R$0 ơ)R$pL$*QUPVWjj:WD$ D$D$ PjvD$ t.-RL$QP5)R u<5)Rh`JS$Pdž$l$)R()8 R h"RVYRVjP: L$ D$@D$9 RyuƇy$u4P4 44S$똋D$)R$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$'D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4'El$L$),$|4xfDŽ4DŽ4'T4E,$DB8t$ 9zt$D$tj$Dx[fDŽDŽ'D4B=ND$?Pr1D$ +D$D$$|$y+DxYfDŽDŽ'D4B1hPPPPjPPjjR$PjZ4$1K|$$8h׬$j7 D$Wt$sD$tvl4u^u3h1PPPPQPPQjt$,$Pjـ4ÃtCD$WSrD$lxS襁1H$^_[]1M4$臁$<t4u/h芢hPh^f3a )RtRtPjjh j%y1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#tdp#$j%\$t7ȉL$7 T$wXXi%D$ r%D$$؊'dp#$uht$$PV j%Pt$hj%t=uD7L7qQPhj%uv`$$#dD#t $D$ As% $T$h\%RT$ D$L$ 1@D$hk%˜T$ri%D$L$ h\%R蒝uD7#t$$D7dp#@tCk%dp#yHk%dp#tPk%T$(dp#tWk%T$ |$$dp#t`k%L$,dp#tgk%dp#tsk% dp#t{k%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hk%t$D?@غRPhj%t$l?ClE;F{Pp\$CPW SYt$0|$4hi脕L$0QjP. Ps8WYtVhj%t$> SY=Ru#D$@R@@hxPihk%\$ S>hk%S>hk%S>=RthRhk%Sj> $ 1|$@VVPWh n%& ;wdp#r#t#Qhk%S> hl%Ih$l%<h*l%/=Rt h3l%h:l% 1h=b%W=S֘Wze^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ ċ'hCl%U Ueuhri%hCl%U U>FjVQ1Ktljt$"hRl%LG$G r%G w"Ghdl%KG ${$ r%C(s4C8ċ'hvl%KC<{@ r%CDsP$sTċ'ShCl%U UstlShl%U "UPKF$F^ FShl%U Fċ'UKF $F$^(F48ihri%hCl%UF Utlri%Whl%U% "UJF$F~ ^Whl%U Fċ'UJF $F$~(^48+4$iƷm۶|$9ŐPR1Khi%#tzhx#tiD$hx#Pj ȖWl$UVt$t$U6vUOu4$eU)RPh׬$hÑ 1PP}#)R)t5Ph%hU 鋔$ 1$ 91AP^uDFl9Ɖr:)RPh׬$h 1PP"評69ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhchm%hl%hhl% L$T$jt$oËL$T$jt$XWV׉κ r%jujWʤhdp#Vhw0# ^_VQ1ɾ 9r^^VD$QtU@8xtlIuAH1FVVjjhhQ0QRx tjhQjVP tQ^À=QtjhQj/P QUSWV 1WWjP &iP3BSPj O t$ =á3D$x1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tE`R|$$t.jVj7O t 3L$Nj4$D$/devG4$D$M[1O4$1O1VQ ^_[]USWVPD$tPpP11OFtFh\%Pٓt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T)m%w6m%Ph#"h΃%V ^_[]Vt$D$QPLt(D$t%t!hN hPQWdD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5h"R.@ujP4ID$1҅D$t 9tL$BuT$ЋT$P]1hPPhkh?jjAPjQQh f3w h4WPZw `OM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hPuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPGD$1҅ӅtwU謐t\P,40Ut5L${|$P3>$tL$ST$Dځ8Nut/$E t$MЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WEŅjWE{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ D$$@$;E tL$ A;L$tI1۸hSSh7Shj e^_[]fL$19bUSWVP\$1ɸ't't'tэ Q'ƆQBu14QB9uQju Qj|u$Qjmu(Qj^u,QjOu$0Q5$QVNzË- QU=z9w߉5(QV$z9w-,QU z9w߉4$Vy9w1Vhdp#hn%PP 4Q^_[]}V|V$#V@1 ȃ|^V|V$o#V3$1 ȃ|^V|V$<#V1 ȃ|^Uu1@Gx#R" tzR΃%VPWShx"R sVPWShR 1^_[USWV |$ faa@D$$1Cdp#=#Rthq%j#RVrPWhAx%hvD$PUAD$hR5pRht%j訙x#RsW "xRu|#RQWhzRVt$D$PWh"t%SR$'D$D$ =mdt2VhRhx"R/ VhyRhRn/ 1$hVS1 t$t$t$D$ @QjVVA ~;Ƹ PVc-D$i jQP e9]D$|$hLWw3o ~#u4h@QhRG 21jioRލ$PQHf@'tJu1SSSSSjSSjjUVjlL4jmtoPV>VMkt@QPhR蟩 u`~*=#Rt!hq%jU1#RPjn)D$Wj3>\$tt21ۅ1C؁ļ^_[]h_t%hMt%h0hs%|USWV|1ۀ=Rt}hRht%jŕ ue#Rt%΃%x"RhRVWSU' hyRVWShR VU#N@1 É؃|^_[]ËD$L$I1@Ã=#Rthq%j(#RVt$ D$t PmVj<m5R~^USWVPWj<1F?tih Rh#RhNo%j讔uL#R{Rt%oo%hRVWSUhx"R hyRVWSUhR 1^_[]SWVPVj@<>u1@;{Rqo%hRVWShx"R褘 hyRVWShR菘 1^_[ù1@t QIt1ùtAQt 1ùD$QAuQËD$QSWVhFlhy1$hWV| g3WSChWWh*Wj654QWjWPVW8I4SP;V)Jİ^_[USWV|$1i/t\1tWQtI1r rr2O0u&1q1ur1ۃ0݃SOr @뜃|$tB OBBP^_[]USWV|$D$L$BJ 0uQ=0Q1۾M&-(QB0t#1urFQtu0Q9u'Cϸ(Q9t0Q$Qt Q0 5,Q|$Q jVPhn%W2^_[]WV|$t$ Nt tuhxo%kxo%o%2t\%jjPWV^_USWV|$=x#Rt hzRdk;WNWxRu|#Rl$}QWVh>f%hU處 1PPv ơx#Rt3Ѓ_PUux#D$=uh$$$t+R$Pjۋ$t{uho%jpt}WUho%hXz=x#Ruh<&3So$t+RhXhSjPz jPW,V,jUho%h܏ Vv- Vj,tP$t+RUh׬$hh jj7h5R 1@|^_[]Ã=x#RtZ=`"RtQUho%jR ?=Qu6QhrgSjP jPV+CQ1$x +RmVt$h()%VmtVx"Rt RR^t$2xRu|#RUSWVt$,VkD$j$t$VGto1\$l$t$GSVhVVj UPX L$Vtu(;D$0s"L$44vkL$|$)L$OGj$WFDžuD$@P Džj$t$0kF|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V N 1D$44U膠 D$44j$D$D$ j$SEŅm<$t$ >tV\$S9 V`j$|$);\$u ^_[]hs%hs%hC hs%sSV5g31/t.T$ g39u9t Qt q/u^[V1ɍt$QQPVhp% y1t1^USWV|$(1$PPWVhp% $D$(1PPWVhp%X Z$LF1^d$Pj%3$>$̋'hhd8%Udhght%zdhgUddW5RD$h譙jU5R_ 2'PPRqhVjU5R96VPht PVW 虙WD$ PSt$5R;_ 5R}:5R?Sjhu%? j D$ PU Uh%1c D$(SSWVhp% $j h%6fMuQ1A tCjV' u4Vht%"1ɉtjV' uVhu%j辉 D$(SSWVhp% u$~hp%jT肉ȁĐ^_[]1USWVhht%RtPjjh1p%B1$+R +R+R+R+R+RQg3/u D$8g3ڃ9tQu@+RQ/uD$/u. +R+R19hiaj g31@|$>ZQM +RL$ +RL$j5T5Tک5T=#Rthq%j#R$+R +R6P5+RhEp%jaax#RWj /D$ttRN1ҋ0t1t /u oBrgQuƃQ$+R1QuAuVD$u,D$ +RD$+R1@Q$+R^/ +RF+R +RQR5+R5$+R5+RPhLp%h_ jj.P_5RI]1QtvhYp%h茆u>h-F_t$FVja.~thp%jIhp%j:hp%j+1GQQthq%jh\%_L$QPu{h*q%_$QPuYD$3$L$3$ t?h/q%hNq%Kft!hXq%jlhNq%hq%aM1=#Rthq%j6#R]$1L$VVPQhp%j }t|$ thp%jTՄjSe^_[]1F]VD$FVj,F^SWVPD$$h`%hq%yat@Ƌ|$]1Phr%S9 4$WV VDah=b%S^_[USWV-j3ta1Fj3t&U7Hd1tUh׬$h ] 111Fo u1tjh1@1^_[]Vh)r%]t$hPV" hhQV x(QƀQhv"e0o.PVWhEs%hĆ3f ls%^_WVt$ 0OpOGt$>FFVjF^_SWV=g3/t/t$g3GtPVeVt /u?É^_[USWVj$t$ /1ۅtKƉ|$\$FUShSSj WV  $Vtu;D$ rj$Vp/ƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUh tMƅtPt$V7 SNVUP tP׃SV^_[]VPT$ D$t$4$]VPv ^À=QuaQgq"+Rs%4/Rs% +R6D$0/RG$(+R&q"8/RSWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW $L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWUO uD5<w |5L Ku1PPD$P+ )ƍD$Phd@V? |$D$|PhedAV? Vf$1 GaD$P$,hpt%t$V~ 1PPV[ $C]su PUhhQt$Ct.QCD001 Q1 u=QtZF9|4$ja$,h+~%$0uf} EPP& jOhQD$4P ( D${O1ɳ$$uƒrL+1Ht$,D04$Mt$$,h+~%u| EVPhɑ$P| EtE @E w-G$9@  V؁^_[]1D$L$I@PQwʀuQAuQ Q1USWV$$1$hWV0W E jShWWh*Wh54QWj jPVW#4SPqV$1Ĭ^_[]ËD$1ɋ0t1urQA1ËD$1ɋ0t1urQA1USWV ։D$ $E1$ & D$$ ,$D$t%z $bEu%u!u%D$$t%u%uIu%rE\$$0+R \$\$$&KHD$\$$)|$= R=#R=0+R$ <$D$D$mu%T,<$ q|$4$D$ 0+RD$΃%y |$D$ RD$#RD$u%=Qu$xD$1Ƀ o3\$j3C|$D$$$8%D\$$( {|$!<$D$0+RD$j3 =o3dp#|$l$ D$D$Tu%$jljl$4$} K=Qu $wD$|$D$$.$8%[C\$$'H|$u1=#R=|R=0+R$ <$D$D$mu%*<$ t|$4$D$ 0+RD$΃%x |$D$ |RD$#RD$u%$iuLl$ t$<$D$x%i$ \$<$D$Lx%ei$ l$4$v| > ^_[]Á=m3ftp]+f%=m3PFSWV|$tyQGO4VS HtRV t{Sz5QQVhQ5Qh^%hSCm jShk2#C* fGj3~"PptVV1^_[ËD$ QƁQ QfH QfH1SWVt$QQV~)S4:Q FQFQF1^_[ËD$L$01FfSWV1ۉShPS$ #tD$$P7 t V'T8VT81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSW6t/S$SPW6VAy S81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=R1SWt$ t$L$ T$HAD$T$SWt$ t$.AD$ ׋Rt$ t$(v%L$\PSWt$t$,t$RPPQRi $R1WSt$t$@D$T$WSVt$@É֋=Rt$Ht$HO$PWVSt$t$v%PPPQh $VD$`Pjhq1@USWV u C(D$|$8hjWqM wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0Q^J<$L$ PP@ǾH'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ،'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$t~܋\$;;tlHu\$klT$<ư\8L$A$0;N @4$v>D$F@ F5l"R6pe^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|p94$ukGllPwGX FPvt~C $i)ىQRP 1D7D77rfD7 D7 p4$~Efn'  V)RQP fNfF V7^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A YOu\$ QfA |$tArfAAp 1AA tAfAAr A wrAvfAAw) 91jEVVhzhwhrjJVjVQPhQ4C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch\%P,uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0o%ƋEp_%PVjWQUDƃu4UtU'ƃuEtDjUуƃu:C(C,SP{,1s$BC$10s$'C$s(C(1ۅÉ؃^_[]h)v%hv%hlhu%2USWVt$ kFllPv/Nj\$FFi )tkllklPRQ# ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ Y{l$ }$Ffs$fCEfC S5USى1M1^_[]WV$|$hWP t,1HhWWPjjPh, WP1^_USWV)Rt$ 1$V/} Vk$T$GD$ pjVJD$D$ 1ɺ<t$zt5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vhv%D$DPn D$8D$ D$8t$XjVt$(1IQjFj QP D$89D$ t PV$P  |$YtZV蔇 MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV@ )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q> ơR}] aVt$ |t$p؉e^_[]USWV D$ 8t$8L$j QPϡ $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQP.VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋R1щT$1)΋EM M1WRQPaljT$1Pt$uuF)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hA$jV6 C `L$rL$DPhqv%uL$DPhvv%jQ6 D$D---D$D$sRCjO@ SjPb ƋEx tjP SjPA 1jQ SjP% ÍD$ tSWVhv%P2i SVhv%P i V$WSRD$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hA$j$Pr5 t"?tt$ Whv%D$LPRh D$@D$ D$@|$tjWt$`1IQjFj QP< D$@;D$ t P!$PW{{ t|$uuxD$t HL>@D> >jhU> wE%rhD ԑ$uR1jPPPhhPj jjj%VjM4x!t$PWV1@^_[]hv%hv%hhu% WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ h'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS- t$]EkfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuB=RtVhx%j 5RuK^_rPRtdp#WvFhVjP> Ph#hĆ3Q- tRtVh#P9- V=j! WVt$ |$PRtdp#WQ PVh x%j\$^_tËD$PPUSWV$PRPRtdp#$VQ$UPV脻 Ttdp#SWt|$UPW] WVhx%j#^_[]USWV$PRPRtdp#$VQ$UPV tdp#SW|$UPW̺ jV u 1$uWVh#x%j #^_[]WVt$|$ ZPRtdp#WQuVP+ ^_USWV\$SǃPˮtOƋl$GWSP( PRtdp#SQUt$ h/x%jj"tV R5R1^_[]áRt8tPRtdp#QhFx%j " u5R蚾RUSWV=Rtt$oVUt?t]oVUu1PRtdp#UQhVx%j!u%R;=Rt؉W1^_[]USWVt$|$=RtAj4j áRCUWP詸 CUVP蛸 R^_[]É^_[]SWV׍$jhPjQAx8ƉhjS)  jWS= Sh{dЀV V5w^_[V=Ru|R5RtTRPRtdp#FPQhVx%j: VӼ뽋RNV,V趼5RuR^SWVt$|$\$TPRtdp#SQoPh׬$WV^_[SWV|$t$PRtdp#VQ3WPM1ۅVhhx%jW ^_[t$h@t$ht$h}t$hk1Ʌt$h@P1Ʌt$h51Ʌ1=RfVhd1ɍT$QQPRhx% t4BIOS3L$T$1 tUEFI3T$t$ u ȅRh^ÁP; j覊USWV41D$D$D$ )R()$tv $D$RD$ L$,1$ 1D$kT,0 Ut$G|$ T;|$,D$u1VjVQFlǡ)RHVjHDVVQ?)R$wOʃD$$&;DHDH1PPL$8QPjh0p3xt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjvu t1@t=Rt@u.1}hju tEx y%rtry%t`y%M u@=Uu,>t'D$ L$)R;\M`|ˀuK(Ѓt tu tPjdjWiƍD$(PV$1 $$QPVi $VPj9$ul$`=u]tP$PS $5fǃU'ViWh׬$hy%B uQe^_[]SWV0\$@1҉1 F FFF =RtjP4D$VjRRS3<^_[USWV)R(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hy%jt1e^]USWV8=REM 0~klP1ĨËE E8؃lklQSPǡ ߾')R$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C|%l WV1^_[WV1|$hVW hWVhd?t[he裂#R`$jjC#Rz%tz%WPQhWhz%h  1^_z1hX$n1hhz%hUSWVu|$\h jW t 1Hp3D$D$ Fw$'贂,+R\p3CzPc:^j荋 T$D$D$P PhЎ'j;0RP ;0Rpp3$ Rt P~At5hs|%h$ Rj 9"t?h|%D$Pj PPhi|%h$ Rj$ Rp3D$Pt$h|%D$PjgtRt+L$L$QD$Pt$ h}%t$ D$D$P^D$t$蛡|$s p3>p39;FKhRhRhW0R% 8p31ɋFtu:w߅t$1G GGF G D$ 0AD$ 5T1VV5T 5T%5T跁D$\hLVVhhj&jFVjVWPV4ƍD$PVVe^_[]Rh6jP0xVGuhK`USWV|$L$D$pƋ}%|$t*}%SVPUW蝣^_[]USWV`5T軀1WW5T 5T5T荀D$$USWV D$ =4 Ru RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSB F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h~%h{~%heh0~%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$`1Ru }`1RD$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$ 'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth|1Ot1L$D1 L$8ɋT$]t"9tjQP賍 T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(`1Ru *{`1RD$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh|11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ轋 |$ƄE C ^_[]WVt$ hjPS ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut~%1^_[]Ãt ux(tthԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVψ >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD l$(Ph%U h@$U [Ɖ$Uh%jCr D$Ph%V0r wXw\w`h"%VrPwdh9%VqwThJ%Vq f1ۍ{aE48'WuWuWhU%Vq E< t<uEMPWQWhm%Vq$<IR%9|<1#PVaqC9z1h=b%W>qVV D$PD$Pt$\$4Sh%h|%W+Su1(^_[]hV%h>%hBhn%h>%h1h%h>%h h%h>%hh%h>%hh0~%aUSWVhjr{1O1ۍD$ShPS$4Ն9+ōF,PhedAUɽ l$$4$0$($<$8у|1҉$$~ F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$蒮t98t4 .jPL$Q衄 D 9D$ u D$4$,$F n$9Љ} 1F$F )ЃF n$,$G9t$AC$$h%jP r=t31>t9>u 9>t0uk9uVΈVƈOV辈UB1@19$,|;ЃV聈t$xB؁^_[]USWVHD$1PuRhji;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dT'u{ FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hV%h%jg6hn%h%jh(h%h%jih%h%jj h%h%jkh0~%6D$T$ L$DrRQP ËD$Djt$ Pl USWVl$j/U趷 1NtbNj\$)CDWPUi uHD/t(t+t!u GF "u^_[USWVPӉ΃=4 Rui"sv<, R X1R\1Rtx(9w4Ju1AQP~ã\1RX1RH X1Rk4+$1 4+VhK&jR 1D+ <+ htpVPh!%jW 1D+'<+(D+($D+,t+0^_[]V΃=4 Run, R) 1t(@"uX1Rt \1R9t 4Hu1^USWV|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=`1Ru h`1R~V19|(1@@89|~@w1A^_[USWVP=h1R|$(L$111=T'"\$uӀt0t u@ tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hT't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV,khhT'h R辡  Rlt R11Kj%mƃwD'DtGCuޅtH=d1RPlh1Rt)1ɀ<t 'AuV8}^_[1V d1Rt(h1R1t ҡh1R d1RF9rh1RP|^fUSWVPt$x1hg4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hAx%jQQWRjjh%,1^_[]USWVhu}WWPHD$T$)RL1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv)R@u ǀ@>1t$(F F>D$,Vt$蔄|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W0D$0F;trԋL$4T$B9rwPt/|$4r!1FD$0PV/F;t$4rD$0=0D$pD$6D$vҳD$  dp#1ۺL$#PWVSh0RQw t$kPWdp#PShPVQ )RVL$'Qt$t$t$ t$PPhHd$h8%)R$0%$)R$pFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C CfCC=d1RrC fC*C, G1ۍD$(hvSSSSSSSjjWPh 48Pۏ@,lat$VWʁWސFuQ1K5 R9vt P'vt$虐5 R v1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h%hҁ%hyh%誷USWV$(E]0ƋEpljl$E@ t Pdp#PWVSjhY1U5R|$ ww褬v%t$R5RRPSQV U5Rw$w nl$45RRPSPU G\$skhHSjPjA PVlL Rj!h %Vi V h@%L$5RPRUQ1 hΧ$5RP@%PUS h裧PSD$PhA%hh R 1҃9QL RA \߉$4YPWh @$j$W hWh RCg Nw@EƆL R Ft3N$t.1@ƄL R-H9s Nr,L R$EBL$ ;QU RVhS%Wf VhL RWf h8%~İ^_[]USWVX] E81hdp#PPPPhX%PP 9_ vSL$QSWPL t@D$ tWD$8uN Ruh RD$9H*hdp#Vh @$Epn+D$8u RPt QPVW҃R1VSt$t$蚩D$$VSt$t$聩L$8QRPt$ t$hX%EpmD$V9p1h$YQVu WPTtY$UtOwGD$VP:)vVQj PC W@ )Q$YQP@d H LCF;puD$VPh׬$Epl e^_[]USWVLt$`T$d\$1*kvs0C41GPjhq3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP4ōt$ VPsU݂SVh~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5 Rh|$. RL$`ʉAfAD$ 1Ƀx fJ1O Sg1L^_[]USWVpU t$01^F4jj`1AǾ,'D$ǃ@|'SPHD$ $)RL1OًP|T$|$`1 |$0jP4D$DD$ R|$ 9ϋ$|$1HPPVt$t$WRQjD$PWh;%j/1EWhQ%j> hW$h0%W蝕$hPSS D$PS$u"h[%WgPSh;%j蹻1Ehd%觕hPW/S Whx%j芻 0l$Shd%hn%jit D$"%PV$SPWR hz%V;%1PWQUh%V蠔SPWR h%V臔PW;%PUٺ"%PVgPh%U軺 ahi%VBPh%j蕺 ;h%~hPWR h%VPWh;%jRh!%;hPWQ h"%V轓1BP$h%V螓Ph%j h%ړhPWbQ h%V\ƻ$r3Wh΃%hU, 1tVUh;%j{uŃ|$tjh,F$$Ą ^_[]USWV ։Q# 1Ht L$ L$$WwM $f} r= jh%U, u&USh΃%D$PT uh#= WM Ņu>L$4t&t u$Ut$ t$ hŃ%jit$TWJ $ ^_[]USWVՉfD$/D$jh% D$5蔑t&苑8t聑SPh΃%hU} VSUkO 991j/UF t5ÍD$9tK9vH8/t@P6U CߍD$ PW= D$%= h$PW  FƄ$/u&蠐$QPhAx%hU蕻 /h$PUzN hh%UbN e=@uW]T x*|$VW$P.N 9r>£?跣0|$Wk W 蚣01Ĉ^_[]hU t}/u }$$tcD$UeWZƁ`|$tVh\%U/N 9=VWUN 9%|$W x(WE 7Ȣ>1F1S订0jh+L j聲 SWVύD$ PQ1xVD$)tOjW x@ljj PW  W  u $=rɁ uƉĜ^_[USWV hljPhW@j8 \$hjS  jhԃ%, D$ƍD$ PhW@V t$1hUS辝 ,$'tWPDu- RD$C E,$ !u1L$PPPPh jPPjjj!Qhi4t$t%j蕌t$VW[Wj6VL  ^_[]VD$@t(L$ 4@Ɯ'VhW1 F R1@^ËD$ RfHь RtPPQQQh%j/USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj Z>D$48T$y:D$ػ˺{$L$~D$<P t3dp#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$dp#t$DRQPhM%jVt D$ T$Bj5RQPdp#t%t$DQRPhM%jV0 D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5Rt$hAx%jt$hVD$XP1WWjjj0 ,R|$4D$0)RL$QW<W,D$DPVA{ljӍD$DPV|$߉څu D$$H؋Pٸ"D$<ho%t$Ž|$,] {t+[1h\%S薎t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#&Pt$hAx%jt$hVD$XP1PPjjj0藐,j D$DPV D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWu )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5RPQ5|$ RPhA$jW ;RCV蜄SjP jPPh RC VH(^_[WVt$ 5T^5T)~$uFjPAF$1O~(1h RQQh.hhRjFj WjPv$h Ra4F(x;F,VPSv(bv$0HF(F$~,v$HF$1^_USWV4ˋA@Pjq$赔 C{$t%K0 u G  fG lJu<'fG G5GG G,q!G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QP3`+{$4^_[]V$j)Nv811Fu >tlIut5t.j+ j,L$PVh%jPQT 'u tEj,j+L$jPPQ+A h<1#菂j*辁L$QjP<3 h8%hj-藁t$R5RPhɑ$jFVҭ j.rh<'PVhT%hh R読 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5RRQ߄L$RPhm$jQ1 G<(\(|(Pu#]j#赀L$>PSWhv%j&Q%j5RSW耄L$t$>QRPhM%j&Vͬ $F|(,u)|$hhUPhs%j(W蚬 <$1e<(Ou*?D(Ltۍt$hPWhp%t$t(Tt(PPWhɑ$j(V5 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%vGt 4$C|$|$upd^_[]1؍L$>PWhi%j&Q蜫  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h~t$PWhp%j(V 4$h~VjP lj|$D(dph~PVhx%j(Wɪ *USWV)R$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá)RH1WjHDWWQZơ)R$1$ )R@u <@TX uDHXT=RtLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wdp#WRPPQ^1ҍD$*W Qdp#QRhQP1D$$W Qdp#Q1Qh0QP &)ߋ)R0|D$p|L$$QL$.QL$QPt$SPW, )R0{Njp{L$$QL$.QL$QPWSSj'*- h8%r0{|$pp{G$DŽ$$T$0<$tT$@BfBB#ffJ B #BfJB#B fJ*B,#=d1Rr~(uB0fB:B<#@1L$0hvWWWWWWWjjPQhqX4t8PFX@,la$PS2JSFY$X(؃u )RTXK$('V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP+D$0VPo+VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h\%P~T$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5)RN t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u! L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh\%D$ Pvt5ho%t$ uu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0R)ދR\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$苗 L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A5l"R 1Fh%h%h]h%rL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4NS tt<1^_[USWVGD$5h"Rl|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1p1R9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX'AL$D$~@ 1ø11OT$LhvQQQQjj PWWSRh&249tBƍ|$WP$V3x#9}Rk<4LE1UЍe^_[]USWV1p1RT$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$= +Rt*==R11M<t9\@u 9DDMHEr=+RtO=RD$PP1ipt$1t9 :ut$P9t:,@uލEpr=0/R`=RJ<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@=RD WVu)y8u.q$t"y8uqxu Hu^hU#hQ%hm h%YD$x8u@hU#hQ%hm h%YV R; )RtDh"Rt99t‹9u€h"R2t h"R^WV΋$tRttyu)h"R9tЋ9uh"R0u1H|$5h"R,1C1҉T TTCD sk<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D s$kuh>91T$5PWW1ۈ\$5$4$4?GL$5Ph%hQe <$o@}t$VU$<S8 VhV%S) 1C8Ou111$H4$8 8tsuV4v8)ω$4VRQWh%hSe M1T$5SPP$@PGG t$5Ph%hVd }AI $4jj hdp#QPjSSVh%Wuh+t5$4Wh$S WVS Wh(%S uD$ L$ $4jj hdp#QPjW膙$4WPh%V$4w$hK&Vm |$$4wh*`7WjP ƋMjs,s(D$AP-VfuhN7Ph׬$V$ Euh=uhV61T$5PWWWT$5j SX-4^_[]ËD$@ RUSWVR=h"Rtp1NxtZ$tIP$xt.jVVQtPu wƇxu=+R00|$1ip=RPi=Rt(hu%jW'b h@$Wf t$Wh%jJ =Rt(t(l$t( h%V'h%V0==R\$t$| |(P$Pp D tWL$tN1FVVV1Wh$,WQPRx =R T :<$VVt$j1WjQt$RD$ Px $Ph#Vg ==R,MQhʉ%VI0==R\$| |(P$PQo D tYL$tP1FVVV1Wh$,WQPRx =R<T $VVL$j1VjWt$RD$ Px $Ph#V ==R,MOl$ t/$t/ t/t/h؉%Vgh%VYh=b%1VGW_8 VF=Rt(|$Wh %h1[\$t$uq =Rt)Ph %h[uK=Rt(h5%hZ u,=Rt(hH%hZ u =RD(Fp= +R11=RPt4=Rt(tiD$Pt>Sh%hP$\$ =R$DL$4L$0=R0|]t$VDPh%WiP =R( ( PQVh%W>Pt$\$ CCa5=R.> >,>(>$> D$)Pt>Sh؋%hO$$(t$,t$(r tRt P~R1`tRtWWh#%CtbWh%hĆ3W tRt8Wh%PW tR1Ntjh9%PW ^_[]1N=8/Rtt$h%jPN SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ )RV;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$$ytPhptYWtDžtFE tWPV u WVNjVSn E t VPV{1HPPSw ƃxR0^_[]hU#hQ%hm h%4USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4\'jP8 D$$tI 1PD$PPVVjjU D$Pۊ x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP" 踯Qkd)Qh%VG ^_USWV$h_M|$hPW $$$̖'{ha  VPh%{hbvvPh%W[hc1~,t[hd1~0W[heǃ4Vuh_jV0FT~Ph\#hW< shf[hi*1~`{hg vXPh%WF\~Ph%hW9< shhmFd~Phfp#hW< shjHFh~Phfp#hW; shk#Fl~Ph\#hW; shldWPh%V/[hmJ1~pP3PWh%S9^_[]USWV$@1N R$qT$' 1jWWVVjjhn|Gl=Ol)R,1۹oWS<S1,G,10G041jWWVVjjhp 1`G`rX"s\td uhD$4hfp#QP<: 1PD$PPVVjjU4 D$P2 x1pGp1^_[]1wwVt$F~|F Pt1@1FF^SWVT$1ۉZBr 1Bl@ZpOQkd)Qh%VC ^_[V|$5RRPhM%VW7 D$$VPWSSjjt$ RL$YSuu ut$QVƃ| ы|$ыT$ ʋMQe^_[]V~ tAw x11u L$^_VD$VPM1>u L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%hv%hh%SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$<Ruhe<Rs1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IO sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWW &Ow$$$h'@21^_[Ã!t*Wp1@<QWPV rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph̍%QB) D$D$uPhӍ%jt1ۉ؁^_[]E@USWVx$ 8RU $=(+R$D$d D$`t$0ShQ%jPW Shc%D$dPjSjDjǻ<1#St$`~Sjt~D$0D$XD$(D$HD$D$D$4D$ D$L1D$$D$TD$PD$8D$<D$DD$@|$\$D$y1$D$ D$D$1h0#VP% -À8tt<L$D$j jSJ lj$hA$S L$ ٹL$ L$Xuj jS D$D$(|$t#D$(^j jS D$ T$G|$,|$,D$D$(|$y|$ythhV%W褰 hSW蕰 |$,E1Wt$4j WSn lj$ teD$ʉ $tTD$ D$tJjh7A$$S tOjhEA$S߀ tdjh(A$Sˀ tp|$uh<1#j|D$0wT$ ׋ $L$BD$DT$@|$<|$TL$P+|$T$D$P|$D$4|$\$|$ $D$D$$j h'$P* hj$ۍL$ytȍJ@j`PQT$(k L$( $A0y,D$A8D$ A4D$Hu6|$d\$t/ȃt$`P L$$uD$H\$ȋT$Lt D$ D$8D$ L$L|$ظD$$D$Xh<1#jzD$0T|$\$JD$ D$8D$<D$DD$@D$D$41D$$D$(D$ G,D$8G D$tPv0W߅uv^_[h%h%hh% D$ph%j iSWV=,R54Rt^s蕭3苭tE#$t$j(PVG 4$I_u9ht|$0VPhɑ$jxW WVV &t Ĩ^_ho0&h_%hh% USWVσ=,Ru hy 1t0?t+,Rt!-4RE WP tt/|$thh %S !hvS u4$$$$$St$h%jw^_[]SWVD$Qt$Rhӎ%Pj\h<1#t$l$jh'Pl uWh<1#jvl$tAt$h0#W 8tjt$2h<1#j5l$ut$O1ۉ؃^_[USWVӉ΋|$|$tBh%S h%S~ h%Sh h %SR h%S< h%S& h%S \$h#S ǀ?t()$'WP uE F@j`WV -j(Wܾ tj)P˾ t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3hfp#WUn WUUjUxQ H>wѻPD$x0hfp#SU6 SUUjU@Q H=wˉ)RDD$H1Ƀ|1M1҉$PVRUs 1Q\$ SRPa 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á@Rtr.@RVt$ @Ru X. @R19vFt=NP>Rwu1w>RjR^ËD$Hs-s '.hU#h%hhu% Vt$ =@Ru-(t;u2L$ rȃs'$tu`R1 jR}R^WVP|$t$=@RuJ-j PV/ =v1t-h t >Rt4>R^_Ë $9u։^_-= WRtWRù^-D$1ËL$T$t$ hD6.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF VhA-^USWVT$,D$4L$(t$0|$<\$8]}uM EUhK-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Why,^_USWVP} uD$PhDg,D$PhI,1\$}UM;t;Gs} Sh%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWw L$D$ T$VQPRt$Vhٌ%h$PP $L1QhPjVx`WhydP D$V Q|$t;jWS \$;MU}h%hԐ%h hu% 1e^_[]RSQ蹑 Shh%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVS )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H>R)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV2 )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt RL$)1҉B=w Aɉuu1H%|$11N1D$D$ wBtR)1@w r҉utH>R)1@w r҉ut$>R)1@w Wu=u1HMD$|nu D$|$ D$‰T$vT$;T$ t$|@9t$t$}4M Qt$q 9׋D$o1HMA6r*1Hu#1T$ɺ )ʉu M19V|ȍT$4M It$pL$jP}wPV%U t$p1;rB t$D$4D$D$8D$<B>R)Aw r҉ut$tQ>R)1҉Bw qɉut$t)>R)1ɉAw PuKExD$1D$ 1VQPW蟼 L$ )NjD$ 9|1ωD$<|$8t$L$@T$DD$ t$19ι})D$ t$@D$D|$7¾L$8uSW,&D$8@t+4t 9tQt$PZ 47L$4h2jjP萞 D$4M{t 9CJuD&1T$8L$SUݼ @$\Cǃ1:k0hWV D$4WhPW$XxD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(:tÉ|$Uk#D$0jPUQt$(t:1 Ⱦu#\$,hPt$  W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P{n P讞D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhj@rtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x Pi2tn{ C K$;}sL$4QjSPL t_D$HtW>R)1ɉAw Puu2S"j@jP fdžUSw1ۉ؁4^_[]h=%h0%hhu% USWV4D$L D$PhjpƋl$X\$T|$Hl'Wk F|11Kn^؃N$F Fdž?džjh>US蔶 @džPWgst%D$ D$D$D$F114^_[]h=%hw%hhu% USWVhED$$11@D$RVhK&j S [Ћp'Cԉ0CC DR@RP>R5DRu^_[øw,RXs"ÍurtuÁu ø1@V΃=@Ru)1w>Rt >R^É^USWVΉ<>RD>RQhK&j U >Rht<VPh!%j(S k[CC4DRP>R@R5DR^_[]USWV $q011ۉt$tS9tzE|$ t&1ɀ8>@,19Q輣vPWc D$vP6b 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([R)1KCw pu9r1K1iQi Ŀ9<uT$$tF l"R <+t$<$wW _A t&L$ ɋT$DŽ BSDDŽ NetB4^_[]USWV qQq Q$A Y01$L$1튄+th;$tt tЉ^_[h_%hC%hxhu%} USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]USWV0$H$D715R5R5RD$D$ D$1D$h%WUP pu URe~ft$lt*zD$ƒbtCeubD$벡UD$ ChjVV5Uh%3RRzVhVV5Uh($n3D$Vu=39}4D$$D$l$ t%1PPU D$yUh׬$IL$ tHt$(Uh%V) hx0#6*uRh%fD$0Pt$ #D$8=$$ RRjÍt$0ShV u UPVُ UjD$0ȏ RRSy hϓ%t$(g\1|$P]y h%G y h%vuWjt$\1St$\4$t$%Sh #PPDt1h %t$t$\4$t$5$R5 R(Rl3|$tĆ3,Rz3t҆3=l$u1HL$(Qhht@P. PtL$* 0Rt$Juh%lʼnPu\yhy%TbF D$ yh0%@$uBL$$4jP[4$t$V6=6hE%jEPhj W j|$WUt$; x>tq1.SPt$  y 19u2 R$R)u 8t1FVhW%1FVShe%VDt$D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u  8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj  U6YL$ɋD$tP袹 V< Pę hdp#PVh%hĆ3 jq V jV裦 jRM VP ^Ð=`r3u `r3,R@=u1HP1;`r3USWV}uCjhHRT HRXRLR\RPR`R8R pr r11ݜ$D$8d|$<) 4Ġ'RSt$DhA$QPY  RRȃ||=$R R݄$|=s4;T$D$r(|$$\$ ؍4)hc$؍4)hV$QPź ƃ}u 4)h<1#QP蟺 ơ,R@=u1H$VQP  e^_[]+8R  Vs 9u 7߉^_[]WVt$ht$D t"t$t$P V! 1H^_Ã|P$ t$L$4T$8P11H|USWV\$ tol$}Wj Qr t A)WjVr t:)1ɉ}  t uFt t #t;uu111"~ #t\uAu $ u t QA^_[]Á Ph\%Ot $  USWV}t]M t Cu(1N41CC{uSjߏ 1VQSL )re^_[]ÐWVt$ Fv Kv jNtHN V~tbOtHON t wMWMNjOtHON  t wLWL~u^_LUSWV$$$$1ɍt$t1G$)ljƉ>umFOKu$t$1VQ$Ppu%h%Wڜ 8tМ 8#u$SjVIp tGtV $1E48FB$)Ex t$7@[h%h%,V h%h%? 7h%h%FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh}jPGuh)%h#%\VÉhPKt4VhjP5Guh)%h#%V1H^_[USWVp $$$!19L$PVW1Hl$Uϊ ƃU VD$PWq tb$UmtM$Ttt $TPU$ t$jWl tu)$j4'WU9 1Hp^_[]Ë$j-UPZD D$L$PjD$L$PjSVt$ t P닆t>PvGdžW1ۃ1ۋt9P+Gdž t^[V V 1u 19^SWVlT$|$$VPC1Nt/ǍD$P迈 PSW t Wl^_[USWVӉjh0jU ǃt{jjjV艔 L$ FG#tdp#|G#tŃk%dp#dp#t c%؉dp#t%|$udp#SQRPhs%jhV; ^_[]USWV$=~贗 71Ha~B11ۋ$4V豇 <(Gs@ ,PVQj C$9u1$WQ; ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u) jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$Pi ^GNON1wOWh=Pw cBvEVE1H^_[SWV$uSh%h7%&Q $%~GuG$O1@G$GD$GD$ JPRv | tOt;HO6莕 8 耕 89h%h%hPNF G8~ ~u3FVh=jv ;Auh%h#%Pt6hWv , t%uhÕ%OPWVu  s V^_[WVp׉$ftPhS%h7%O jL$PQW  jjPt PjW\ tnjjWJ t\PjW6 tHD$|PWV t2Ph=jp @u6hS%h#%N"hS%NW3 hS%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jW7BjW,B5^_WVPt$4%@5@u^t8tW%V$%8Vh-j%B#45@ubV,>jjP,K5 u h%K,;dž,sh%[KjB3 t1t3u5$09$ ˪$1Ph[%J 9$ ˪$1PWhW%J^_WVt$ hD#OK8r4@84^_6t8t uh%W蟲j;A^_WVD$  uzuq0x t-@ h%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uh!%ID$n D$SPU6Yt,Ǎۉ,$t1j@SP 9 SUhH%JI SUh6%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pp| w_ǍCWt$P_ ;)QjPV hu%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQh%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYh%Q{~PtVFDtt NLtM{#tq%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h&%@jjAVB u h&%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC PhN%>G$C$G>C>>l$ tك**PWQdW IWtsDtZƃx t@ Wh %A>Wh?%k>1Bj FNt*HN+膃  h7%t>1KtJV @1I 1KGOWtQWVl$ GT$tIO9tA tBShd%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhh$ 1GOtHONG PtFA*uUGGtIO9tA tBG|tOxD@UUP# *WQjj0>[V/t?t$VtS? t@VS@ h%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/[ 7 Vh%h5#B:T$1|$`F(f9t(~ tωӍV QPRh%9ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$IP\$Sh6%:9 <PUt$W"PShS%9T$ V>t*4$QVQ H^_[]USWV(|$H\$@?hp%Wp )h%Wo t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkb3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtUl t|$>@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp g D$VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4S)g tE9uD$ 9t9~ ux<$hp%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uhe%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/Xh%Se hp%Se l$$hWUo jaDž0ט%dr31K$ 8@DjWP9u1,1@PP8u1Ajj uD$$l$ D$D$ $\%t%Uh'P$V ?u$\uYM'4tQ6uD$럍Hv H w?$'U$Tw$'D$ ٝ%D$[D$PxGD$ %D$2 $\ $$$$`"!5Ug $`D$ %D$D$ ҝ%1@D$x ˀFD$93t$ZSX-$`q-$$h$d3)$|$t$$V|1UUUV;Å$U$SjVFދ$hM%6 D$93Vt$(VC31UU4V^;/$$Pjl$4UAF@h%Ǻ 1h%$\u($\uh%芺 $XL$9 3%ދ$HS_ 6G#|$tdp#|G#|$l$$th%QSh7%j+U迆 $\$h\'hŘ% h%˹ 1dp#PPPh7%j+l$8Uh  $X$\$X 3|$tD$$9tD$tnUY C$X$\ڃt@  u% 艌$\$X@l$$$h\%uh2"hQ%0)k"$jj @k UhIjh4'$o!$!|$tYUHr?Pt$h%S( |$WVImm 8$U蓧 $X$\$X$\3T$QR$4A $$Xh2"h^%l$$4D$t<t.<unh~%p D@U uDh`%H LHU[T hm%& TPU5{ $K[l (Sh"N' h2"hm% h2"h%,'$l$$$Zu UMuh2"h/%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t PI[ $$Uw$U(UH$;dr3t P$\P@1uh@%%$\t3$Pt'jjQP) uh2"hN%%$H'$`hl3B< $$\$S ^_[]Ë$r,u'3Qj$4J $u*$X1PQQ$ $$[@u hҙ%$$VU h%&$$X0 $\$X$\UhPjj$t'UhPj$$[h2"h%h2"h%Vh%#U Uh:Lj2j$rh#h 8th2"h"%#$Xh L${oZ~h 8 L$X$\$\l$$hhI% u!3h 8thI%h2"hX%# hhf%X u!g 8thf%h2"hX%" UtUh2"hv%Uh%^"1$Xr;$\@ щ$X$\UitePh2"h%b"KD$Pjh0j1@  B|h0#%UPh%1" 贪$X$\҃ ׁ u$X$\r>1r3$L$QPU $X$\7%r 3$dp#dp#tA% tH%WQRh/& UY#0t$$1:D$OhPVu hb%!VhkMj$$uh2"h#% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x u%~%$4P; C$$|$9|-h))&D$L$$PPM ƅUQh%e$\D$L$$PQl$$UhyLj$\$puh2"h#%I$$h2"h%h3%&h2"hO%h2"hn%h2"h%%l$$t׃z Ruh$\h%PHD$$P$Zhۛ%stRj$tKl$$UhyLj$\$9t3'$\h2"hȚ%h2"hӚ%h2"h#%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$R Ph%V$X8uDu4$\@h%PED$$Pl$$+ɍl$$t#%@tD$$Ph-Qj$t$D$(P4$01ۅ~ tVh$jj$vP_ WVjhe%ft*VP5uVh|%W9he%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQ u!h%hN%S j^_[]Ã~+ajjj5 ˃phŝ%h%h% 1m>h%h%h%W <Ph%>h%h%h% 111dh%hϝ%h% @+X1BWDP h%h%h% 11G18 4 ى48rPyWehޝ%h֝%h%L t0LvPh%-Vt$VvtVhKjdjQ^jQ^Vt$V;tQPh:% 1@1Pd^WVPt$D$uPh%h7% jP, tuIh%h8uM,z ,dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS) F>)^_[USWV$lt pvh{%PW; t=wM$lDU 8th{%h׬$h$u)h%h{%hh% $$l~>1ɀhL QSP ƍl$hUPt$ UTE =wfD @PUhh{%Wudh%h(%htI{>tA,$fEC(ffEEK*S>RQP ( C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht h%8~>t$fF(ffCCN*V>RQP' F>4)mC Phգ%$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0S 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@kNt3yu%ytzy~ ~yNхuFiPv`v\1PPvXjD$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR u$pv3Wh׬$t$ pv3C (1ND^_[]áhv3ËD$hv3@PW iv3F SVt$  hjhhr3hĆ3hv3 s1fà B jSP  tdC V1H1@^[ fVt$tYVV8VgV1jVB VzQ6v|`^W^SVt$ V葆1Kt=jhj t!jhj 1ۃۉ^[ Vt$t'PYЫdžtP貫dž^D$t$t$t$d$ SWV$hjW1> C jPWB Whi$ 1NtF$$T$ !fD$f9t hWhi# t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv (A 7 A V1H11ɅtH $BD<IG9uލ|$$ ^ F>L$j%' F>PWV uF>*PWV 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0觘 VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV: Fjŋ$@V $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP/ tًv\$~;1$D$0Pt/ tF9u19D$$"$8ЃD$P1~11TjT$4R4 t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVhd%t$ 0|$w$H;D$t$\hjKlj$w jD$4PVU CG$C D$ jt$ VU0 C yQPD$|P D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0, R`~/1djT$4R4 F;`|ӰD$|$0WQt$\yWh% $_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQw $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh%oW$7t)|$ jVW w_ jVS rv8 1N^_[]j:S t/@1UQhQQj QP  G8mt)8 (G8GjSPm O t 3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VPf <$ O4G4SWV$WjS3 F jPS WSh~iz tD$Đ^_[USWVP>!D lR hR hRlRh%FlR hR $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD h%j,jHt ǃL h%j,jgPt ǃT h%t$$Wh'V D$9rh%h%[H$|$ 7D$PWݒD$t$h0#D$PQ ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$S! J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0h%h5# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h0#D$PO ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hNJ$U! h%Uo! h#UY! $D1)h%U-! 1Ʌ<$t$VG H9t- t u!H\Ht$9u1@$D$$<jPSm 1Ʌ $1@D$S$@tXtT$@Sg $1B*$Dt,t($DS; $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$s `Dd<t A`Nh%<$Dt&u"t$ $<V- 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$Uh' tu;uHUh'%l'D$uuUh#t$$t$$Pt't$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(3|$$t)`#L$# $ 1CƋl$ \$18%s%Sh'Pt$t$Xh¨%j|$XYt$1VWjWWWWt$tͪ L$P9>t$Xhި%%|$Xt$1VWjWWWWt$t航 L$P9>ut$Xhl%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP4# fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$tz L$P9>gt$Xh%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\Wa  j,D$Pt$X=h%V h%V Nh$Vv Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh#W t$P^hSU&W -h%W h%W Wh%D$PD$PzD$Xt$P jP#h%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\W Ê@tC< t< u CCu1j h٩%W j h%Wh 0jh%WP ojh%W8 ejh%W  Mjh%W 5jh%W jh;%W KjhD%W jhN%W j hb%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjP 'L$ r L$rL$ T$t$XV%1I $j/V uD$|$P jP L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;dr3t P 11j|$\WtdƉD$"V[ jWt>the%V  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb h%b|$XD$Pn<a't$X1 <PD$P/|$Xh#|$\W  t$1VWjWWWWP L$P9>t$Xh%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/P0 1|$Pt@j/P tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 h*%|$Xmj,|$\Wl 9ƀx-9l$Ps%ƅ |$1WShSjSSt$tq ,9h8%{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP   L$ j / % < t< nGG|$X{t$P$t$X˻ $ hl%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU n 8ut$Xh%t$Xh'%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vhު%pD$PR |$XG D$P2 D$P" |$X6t$Ph%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV 9+aVh%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t論 L$P9>t$Xh%Rhѭ% %Pb|$Xh%T Ct$Xh{%Wh à \$S ƅ|$PPh%SVv*  j Vflj/t$\F G1|$P# 1 t NOGN|$XC1j:W t4A|$1WVhVVVVQ 97Xh% j=Wt FD$, h% @1 t  H@Wh%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQ HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh'%ZT$P   Vh:%)D$,hl% h9%aƆ }h% D$Pǀ`h^%f 1H$Ta Vh%%rN D1DDD DD.u h%  12D$,1hW$W>hٴ%W(1h߫%W(hB$Wh:"Wh-%Wh%Wh%Wh|#W7 h´%Wvb h#W`X l$h%|$WBX hg%|$W(l$ hn%W f ht%t$W h|%t$k h%t$ h%t$ h"t$ h%t$s h%t$Z h%t$A h%t$( h%t$t h`%t$b hX%t$P hǴ%t$> hд%t$, h(#t$ t$hG%t  t KC  t KCWhΪ%Ɔ  gt$Pq1pƅhih8%ottC< t< Cuh%GDžhl%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉h%W t-h%W thx[%Wr t hv%WP t@Ch!&V6 th|%V$ D$P@ tsFH t t@@1 t  H@ttC< t< Cuh%ƅhhA%sF< < F1$SUjY tUh%t1C CC"$f8l$1USjxSjSSW $D9]$ƃWho%- # t KCƆ L$P1SnF D$ PVL  ^ 7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hF9#1E1؄t  H@hǫ%%1H$$<^_[]ËD$PǀǍ0PVj1V Zha%F -{L< < Ch!%11_Ho@@V ыD$ * * hl%2 C]{/< t< tCCB؄t  H@h% yt$1VWjWjDWWSb L$P9>OShS%L$ 1SK 1I $ԉljUSWVL$D$ T$114É> GE9u1D$P$tj~>$ 1W4L$ Q3 9s: $T$э A@)E9uы,$t&h %he%h hç% 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P迕 T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$Pi T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋR覟 j=P1 ,$|$D$ V 1ۉ\$t?t9D$ 1j=S )9uWVS D$\EuVͪ4$ t5ƍEjPt$ ] 4DL$h%Uh%h% |$$t#4$裞 tzSAD$hL%t D$tHTNPR3hj%h%hhL%6 WVt$ t)1WWV袶 tL$@Tt8QVW ^_Vt$t$Ƙ^h%h%hdhL% SWV1SSQ9 t&WVIW荢SSV Džu^_[WV|$ t^ǘ1PPW tPWh蹑ƅthjV ^_h%觭1h%h%huhL% D$t L$tHThj%hŮ%hh%hŮ%hhL% Vt$t61tpT^h%hή%hhL% WVt$D$ L$zVPJ9tV 1^_ËD$HTt1Pt$ h%hծ%hhL% USWV\$tF+1PPUw t.jVUe 9^TuVUtVWu^_[]SWV D$4toHTty9|$0uPLjPW t<Ƌ\$8PWSh%j WC VNV ^_[hj%h%h h%h%hh%h%hhL% USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t EtuHt4t uxjh'Pb  /1h%h<%hhư%K D$tEHt;tu&xÃxu x uxux /1h%hJ%hhư% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=pRuD1FFFF FFGFpRSVrVW_uPpRމ^_[]Åt 1u19[:Rt1h%hY%hhư% he%hY%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=pRu+pRW9u!pR? /1N^_[]h%h}%hnhư% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ_ ^_[h%h%hh˱%h%hhư% USWV|$t$)Ã|UhV t(ٸFx)PjVT ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQk8 ^_[CPh$WV 1t߉h&h%h{h%h%h|hư% D$tL$tf Hh%hױ%hh?'&hױ%hhư% VD$t&L$ t/fqPp QPI H^h%h%hh?'&h%hhư%; fVNJ$̪'Ph%b u^USWVD$t$V%1Ij0V5&1|$/ooo WV&5P't-1C 4'I?r (   DE9u֋-X't/11C T'I?r   DF9uWt$V% 1ɉt$\T$\RVQ2P諌V$t 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP tbL$1tHh^%h:%hM8| /IG?uWG9rD$^_[]hJ%h:%hh% USWVl$t$|$t1ۅu>t7NLq%t^&M{#tÉS1ۃ1Ct:tVtXtShr%t؉8txt@HtPt؉CjVat.Vt!thz%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t 1NA~0jh%W uW( W G9rhl3 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%;S$t^DžtnjSW%  8th%h#z9h%k1HzSlt$h%h5#? tG11CGt0WD ؃uh%h%?Ņu1 ^_[]Ë$t|$u%tPWh;%h$% =mQPWh;%hI%論KUSWV֊B D$L$$t W  *QPxNjD$$4$7@uMh&#i%tQh%W  Ph%Wb |$t$h%W= $D$ D$h%%$Ub t$hr%UH  Uw |(6hz%U 1,h%S hM{#S 'hq%S h%U h^&U h*%U h%U~ 1ED$D$AtG~DtAD$D$D$D$D$D$sjSȉD$4D$, ED$D$KD$D$D$D$$1D$D$D$1D$|$t<$ Ph3%W u4'h@%W W$7$@|$L$ uPD$@tEL$qPt$h%WA%D$ |$t4$h%W詰 |$tJ$t=8t44$t%D$pHpDt$h%Wj|$t4$WND$ t7t1Ph׬$W D$ 0uW W舳ǀ|$WD$(P D$ U#t%PhL%W; $HL%t_$M&tRh]%W Y$pHhj%W <$@PPhv%W $p$h%W 4$覞Ph%W ${Pt;CQt$(stPhhV tVh%WC t$Ph%W tt$7@#ǀ\$(h'SG$t0ti~ tVt"PSo9uvh%!h%1OĨ^_[]1D$D$h%W? t1VVS͗ t]VVS輗 9thV%h׬$W {ET Ph׬$W ]jUSr ŅuVSWV .h%$V (h%%V h%V hM{#V h[#V h^&$ hq%$ h%$n %tt|$"D$<u D$xuZ|$t4$euD|$"D$<u D$xDu*|$tjt$u%U#(U#U#D$ U#U#t%Uh%W_ Vhdz%WG 4$?%tPhҳ%W u$0?%t@ $ t1tV>%u vuPh%W #V@th%W|$"D$<uPD$@tEL$q Pt$h%W;%D$ W|$"D$<PD$@LAL$qPPt$h%WXUSWVl$t2E1Ft/׉˃PWh%StEu11N^_[]fUSWV\$l$|$ttUPWa{ 1tk<.tgh#W tUh$W tCj hT%W t/tj.W tUWu 1t^_[]D=|Vt$ 'Bءt3H t3;3hl3j l3H l3 Fut$t3H t3;3hl3j t l3H l3 Fsh_% FshW% FshB$o F sh9"Y Ff%m%s%{%% %@uwxn%rh"r]%rR% rG%r<%r1%r&f{#r%r%Q F shƴ%v F shϴ%` FthV$L Fshش%6 Fs h,% t3H t3~l3H l3 hl3j hl3ߟ ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVhz%hQ%h%US 1N@t+9w');@MQP'At9w :)߉hz%hQ%h%US~ ^_[]USWVD$<Pp t$ $h#V ]NjD$@HD$?1jh%W׽ ujh%W u|$D$4Njt$0tNF tA.t;\$SPL D$P1U1HPUUUUS+O 9l$u9t[,OuD$,Njt$(\$Sv t-D$P1U1HPUUUUSN 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#Vh Dž4$z14$z\ 1H^_[]4$z; USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ V "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DH \\$ $2f\\ $$$T$$$O$sZ/t uP~ tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1 T$$t4<$t s%|$$u1F 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Vo 18! 1H(D$ %t%L$QSPWVQ Ą^_[]USWVt$HD$DD$L$UjS軶 C@G jPSd fC $4CCD V$4P蜍 UShipr C O*W>RQPe UShip;  1N^_[]WVPRQ赆 ~u~uF $uG*SVP tu 1^_[]fD$fx(t1ËL$ D$fx(uD$轢 V1ËL$ D$fx(u D$菢 V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWSb |$jjJ`Ƌ$(@h@h %V ljFuJ1ۍl$Sh%j U% h@U' FuC覡 8tǍ\$($PhqB@Wу f<$f|$ jUSK ShlBW蓃 txD$PhpBWu tZ$$VЃuBD$PhfB@vC t(D$FP?F u+ h!%[Ft P% VP1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ Ws FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP ^USWV L$@T$*@h t$ Vhv%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P臐PVhJ%S'1I/ދ$0$4Wj$@U t|$r $,84$HPP$0Vh[%W说SyGPVhm%W芴$0$4|$WjU $,t|$w1Ћ $ Q荏PVh%$4'$4#]S[PVh%$4T$ }ltE$u?ClhPhhWzWVh%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhfVt$$@$@$L0 >}k|$`$0PJDL$L$QWhfPt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhfSt$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ Vc t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$j  ] V1(^_[]ËL$DtD$L$tPVQb D$ƅu SWVD$ L$tT$$w .11t$|$X+9s轎 "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`iF`^SWVjh0jJK 1NǍ\$PSPhWntrjSjjWnt]jSh@hWntBD$$1ɉ $L$ L$L$D$fD$DtD$jPWd t W^_[USWVt$+VjU=Chu,$t#tVhPjJ=^  r%s%PSh%RPShͷ%G 1Bh ^_[]WV΋tF>rD&| GTt tB9tt9BTtI䋆tÀ~>r QVh%F ^_ËD$$PL$1Bh: SWVt$tgw]Vhja<^ w$3PSh%E GLhK ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGHc%_0wF SPh%?E _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%D w$贄w(3<PSVh%pDG0GH8% w$sPVh?%@D G0GH\%c1HG8G4 w$:PVhk%D 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( X&|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ X&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pw0PVh&%B w$w0PVh&%Bt$6u$HujGtGht:?J%tPQ%I%%GHPu萪j19c@O;Au<t G%?uC%GH0ts]Shw4Q 8Sh%w8P7Shx&w0P7C w8w4PhW%A 1HG8G4]@uPD$u>C wiVPh%]A wwhV3uVh%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;th%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hջ%h˻%hh%~ SWVt$^ Sh%L?G0+G8PSh%> VhKj%51Gh^%WFiP7 Wh %>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3VhLjP"/uh_%h#%=^_[]h_%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(h^%hR%h h%{ PPV&5 tSE EdP $PEt]U$uu hQ)]CF Ph%c<6u%EHPVQ Vh%< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$hQ)VD$tF9tAtIdtI;u D$ th^%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V>< 'C'C'n w$zPUhi%: y1WVVWU0Vh8SU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLih D$ɀwȈGGV*QRP4P T$  |$t t?t`t[\$XSjDnD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$Pg PL$|$)9 OGPSQJ ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSPH \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Ph%/t$=$]tVSt$Dj`%e^_[]Á G AQSPG ǃL$G)ˁ+),PjWp ,1OD$0@hX|$ 1|$CD$PjwǃSt$P\G G D$G D$ GGDCff_f_1ۉT$SfGEh诹 fGG@D$ffGScf f_ t$WhD$wK*PQt$ u)C Pt$h%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Px\džx|tP>dž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`h迱 ƍG 4$D$,$5&D$\$$%&Wh?Vj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GH%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWh[jPh2%h#%$sY EX>@P UB( A J*R>RQP<  ]rts4 t*Mq @T$hRQPPV]hi%2C>t2Mq M*T$hRPQPV]h%O# PjdZ1wLw !w wL$u]rruG XixiF SPh%" D$h$PS61Rh2%*#@uB3EpCP t: @ NH M plYhB%"u Vh>%"h%""3=u1HL$h$QP t=w:F h%Ph%c" w=g 1Ƀ8tmF SPh5#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQP?: h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$n_PVh%; M+1C$wGKV*PRQ0 T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9D$ %t$t$t$ V%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$P+' 6Vhj|$XtVh[Pjh[j|$ GPG $9OsP4$L$ A t=|$ $OQt$PK& G@Vjj*hL% D$ @\$ sCCCC C KCK1{ {%%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$hȾ%RC \$ t$t;ED$PLP $,uzh% $,tKPA Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$K4$teSPh"Vt$Wh%t$(C "ۋD$t$0% P7K4$L$ t/PUVt$Wh%QSPh"t$Wh%t$$$PUt$ Whȿ%Q h% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWP# +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$JPVh% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Phտ% v 1F FFL^rL$h[ËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F Ph%lOhGL^_D$ȅtȰ (1SWV\$C r{M 1H4t${GPhVI ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh'|$,WEdx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVP  VVP  ƍF8Pauv3TV[hVP SWVG| WD$,P\WjVP  ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0SS  tzVS`~xF| uF|EhtF|FXMdQPeV$a9tVTVGS1PP\$0S  ƅu\$ C$t$|h'D$P1PPV  ƍC D$~gV_Vn8U_B1PP$Q  9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j SWV|$G O QPh%# WjkƃuAD 81t7D 8t-D 8t#wD 8tG h%Ph5#\ GtO9KuS ;W t u^_[ËK StQSP Svt9_duGhGdh?'&h%hh%W= Vt$u.jt @h%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGh%1lj$gL$$\$ G Gw u= Ʌt ѹ )QPh5%jVY D$h @$L$tu"D$$0@=PSVUh%WjtGt $AG8y-)B 8th%h#%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQh5% 2C(K,QPVWutAhAd @ 8u0t0t 9Ft!6u WhV%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$} . PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&_? GO? 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ uZ9L$( Ʌt ѹ )QPh5%jWU ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]hq%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yrN= t$ $ q>YtiDD$ \$fl$Ӌl$ hg%WU( < 8th%h}%t$@s"j@{Dž@7z D>tSPjjS> t'O N ONWVHHN@LF |a7 VUSWVD$1tW8tQ\$l$G@tjUP u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y z6 V1H^[ÍQF*v.q Au41USWVL$,Afw\l$ tmu11D$ D$8E`1ۋD$ $t*EMHMT$4tbD$0jPWV P~uE$E E0Et o*Sh`'U耠 Shh'Ui TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUf# V # 1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPSm t=m<$hj.PSj.y 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p" 4$U" 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPU訝 tKd(1tD$ @`C`|$u%CdtC KhQt$(PhI%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$ 1H1^_[]SWV\${C KhQPWƋD$džZuC4PN4V8@F%Wz&Džt tFpGxtE PW6EPSzGSPq6Ed@u u G8 V OtG8h(PH6G9X@UP06 fUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhB%0 PU^GD$C,9r|$t"w 7hB%l0 PW(G,Nu^_[]SWV$j:h0j 1N1D$ D$D$D$D$D$ D$D$jSj j)WH|$4tb$jSj$j)W!tc$jSj%j)WtGD$@$jSh@hWtD$j Pjj:Wt W$^_[ËL$t,t9JuƂQhjjËD$t!  9Au񀹊tƁD$ 4'USWVt$8\$l$G jUP t ?u8G Oz%uH|&RQPhm%7YOkjV&u=t&9tO;Hut倸u܃xdt w^_[]USWV@T$8Xt_X^;4$txxH^;{Hwdt tRt t@xdt)t(X` 4'n` ;4'~<~du πtϋ6ut$p׉H~^X0vڋ$tVH$JL$H^_[]SWV΋hjS. sCh0uClCt@t9puu t؋HlO Pnu 8t h%Đ^_[Vt$jjV t^F Ph%VhVQ ^USWVD$1t;t5l$t$D$9Ctu{xtUVW u?1^_[]USWVD$1t08t*\$l$wxtSUV u 6?u1^_[]USWVl$E81t'\$t$9ouVu?u1^_[]SWVYx1t2׊D${ t8CuC jWP D$tuމ^_[USWVPl$tS}6`VWDžEɉ<$t%11G9iu jFمu1Q1<$ttu7@t'P[zLJ^_[]WVL$ 1@t!9Jtrxt~d8t61^_SL$t*t$\$ 9Juu tzduu1[ËD$t9 t3T$9Au$uuq`ty@u u1ðUSWVHu D$Pj1@MD$9st$FVh%j |$0Wu' CPD$(Ph%W~/sXsTD$,Ph%W\/t$t$D$,Ph%W8/sCtPD$(Ph%W/Rt$S`dp#dp#y##\$dp#@t5$dp# tC}% t%Qp'SVP|$8Wh%uV. \$sdWh%V.Ct"1VvQG,C;r拀Lt&H1VEQG,C;LrKPD$xL_)L$D$@D$ $@sߋL$wHL1t9t F,9u9u*D$ 1t9t F,9u9ttT$ B D$GsVPhBQt$ D$8Pu2H j \$sxt=1Fd!ȃu&~ t GFhPWD$,Ph%u,t6u1@u M1He^_[]WVD$L$t8T$ t$r p9v 1:T$829|$ tt$$ 9t,Ju>t^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h% GdD$ D$1xG O4SQPl t $tsOdtYG %t%%OhQRPh%"Wjz[u!& 81t 8t h!% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPh1%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhQj苹D$ t;t$(hF%j6hz%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  shz%V*^_[USWV] D$@Cxt$rj.VL$0Qj] |$,wVhq%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPh%h%9e^_[]T$rRQPh%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPhp% RQh0% \RhS%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVP L$  uhj议ËD$CNC KFCF CCj.L$vQP, Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h#%|$$HL$Xxp jP$P D$<t$hq%|$rst$h:%$p΁Vt$ h%t$$蚻$x|$D$ƀt$hO%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$hX%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h%e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h%%t$TD$u%D$6jϬD$@`L@O|$ut$h#%誵몋sLߋD$,9CPut$,t$Vv VqGPD$$t$,әGLtbt$,Vt$P0 wPD$(À|$$*"D$$ h%s|$$/W̩!t$4q t$h}%Etk,΋D$9t ,JutVt$4q t$h %U|$u/j |$u$jt$ut$h%Դt$[t$4t$t$h-%葴|$$tL$11BL$jOD$(D$$UWV}u WYhC? ƍG 4$D$,$5&D$\$$%脳WhֱVj覩e^_]WVt$ VhW辩VhֱW觩VhW萩^_SWV|$G Ph/%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWPV tF F^_[hM%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%RL$jQJ^ u h%許$BHJAWhjj G Ph]%۰WhWh iSh%,Yjt7UhmjP*@h%h#%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhk%ï t#@uUhC%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%賮j봋4$VUh%Ю Wj`Du! 81t 8t hq%L$o@G WQSRPUitDD$GdՃGdD$ j.PUjcI t'OQPh5%j.V h%z)hh9  Wh^Pj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWn uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuhz%Phz%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h7%藬 jSW=Y tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh% PUb D$C,9r|$t"w 7h%p PW, ,Nu^_[]WVt$ tqwgVhڹjW1GGG G XGt,^_# Vh:%h5# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUjD \$wWh%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVRj t0 D$ PSh&%̨ ^_[]h%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PShF%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%觧$ WShf%8 F PSh%y t){4t#D$} t*tu Vh% Vh%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]E9%f'9t Qf9Au<< <\$H $'|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p Vh % D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPh%D$`$T$BWhW˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Sh1%P o1@GGG,G o$ t?t/ShS%h5#Vhj jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPShjPAh%h#%$1ۋ6<$tD$D$$t;F SPh% D$$hPS6$Ch%舜Jh%"3=u1HL$$hQPI Ã37@$:VL$QRP,$ \$\$TSjjy D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F PhL%КT$E|$wD贏S(GDtL$$SQP舳 _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u2 8tn 8tdD$ Ph%h5#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh%讙t/Vhj j`1Wh%h5#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$J4$hV%h5#_ `%1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 tP%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5Edž ^_[]É. ^_[]L$1jSWV|$Whj׌txWhS豌WhS蚌WhS背WhSlws^_[SWVt${Du ?~ Whi%P͓ 1@1ɉKCCS(C|S KtHd sHdit x<t^_[Wh%h5#諕 ^_[ønL$x<tBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O WhjPuh!%h#%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vh1%P(# D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hdWt$$t$$t$PD$\0 t0L$ D$ PQhdVt$$t$$t$PD$\0g D$ L$)1H) t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$Զ'-   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $ 'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ PhK%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%S D$P4 uOt$ pffBfBpɋ<$tXQlRG ڃ p7t$ffBfB<$tD$WVPR ڃ L$t3D$fffBt$tVWRω̣ ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPM |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPdtKWUPy D=l$_D$ fǀ< 1fw ط')hj%R|$QhV%j W D$l$ f9<t1}~ QWh~%P(}t$sf<] fu.Wh%~(Ex(Et(Ep(El6tjsuD$0^_[]USWV΃|$$w Vh%~1H׋ 1ۉt$$S1ItU $]h]d]`\$,Džu\$Sjƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh7%&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh%f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%t|},WVh%} ^_[]V΋Qhjr1ɉHH@@ @ @$vt ^D Vh"%h5#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHthV%VP6'uVjjq-wx9DthZ%Vku Vhc%|{^_É1j9VދL$t1Bh`%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1Z%8WjjpD$$PjE<$w$D'8uJ%=ǃ8X%8u+]%8ud%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h %y ؋?ut$u {`<$uhs`t$ h/%y 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%q:fD$D$D$PjUVD$0T$4)̓w!躶 t$h%qfjPD$DP D$LȉD$LD$PȋL$LD$P9v)m t$Pt$Pt$h%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%o褴 t$hX%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhk%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph6%Ent}u^_[]8Vf6!^_[]SWV΋y WhO%0n 1CCCC CC$Gth^_[Whu%h5#0n ^_[Vt$F Ph%2n1B^L$hVt$?N Qh5%Pk 1B^_L$}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀL/艈L/f$HC;,T^_[]SWVt$Vh,jvb1CC C XCC~ ;u Wh%5l Wh%ktg^_[Wh%h5#l ^_[ËL$gVt$VhgjaF Ph%k1B^]Vt$?N Qhe%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%h7% k tjS0 tD$ WSVn h%j`^_[]ËL$VVt$?N Qh%%Ph Vhj?`1^L$.L$@h%P1|$L$8jQj*j)5Tu h%TrN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5T1y h%QTt+DŽ$j$Pj&j)5TuK1ۃ|$$xv3D$,tD$t3S?Tuh%h%ƣRR|$$tF1FFFFF  F)F.N,RR9rF t$ƃ|$t.t$]L$Aut$h-%+xv3D$,|$,tF)F/xv3F T@;DŽ$jjjC y hH%TTTTTTTTĂTfT'uTȂT|$tjt$ j.j)VV=xv3ujhTVu yPh%UPhxv3Pj)VuY=xv3tjhxv3j j)Vth%$PhTV yh%hS%hp%VD$ |v3 | h%)$jPhh5TQt$8jVj$j)5T2y h%%6 jVj%j)5T y hB%5 TH H r8r |v30 s~|9~ h%@t$jVhh5Tq~y h%jVhh5TH~h%d8|v3PQh`%Ƶ TЃ1۹xTPSSQVRhTxTt"Qh{%y TЃPSSPVPhT_t"Vt$0tWNuZVj荙 Vj肙 1T TL$?V1FhĆ3Vhh%h V USWVX T4Tt91ɉ R R1GH 4T xTDTf T r+rm ]1sqRRYRRTRTRTRTR RR t1R TTR RfR|v3UfR Tff RfR=Tu"t$@jV~F ȣRFȣR|v3xRT|R1L$@A ARY RRPhxR5T ƅx9t&y h%*2 VS5Th%ղ TuWhv3W 0TXT,TTT(TPT% 6Ph_% |$ "h%h% h$h-$L$$ 'j.$Pt$ jF$Q4'h6%ThQ%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"PUu $@D$@|$ Phdp#hAx%˝ t$ 9|$ohk%h^%褝 D$$$T$ $@WjWh$b}&P[ Ft h,%H t3H t3~l3H l3 hl3j )L$|$$t1 q΃j.PL$Qjuj.h"$P@. $Phw%苜 |$u"tVhV%q  hJ%b t3H t3~l3H l3 hl3j ޡ t$GNjL$+{h%ihv`$ Tt$Nh$ٛ Ntu%b}&P赛 1L$1΄u j,贚 D$H%x%%sVQg D$9D$t$uKj,o h%B D$4L$:D$tHj,F D$4WPh% $D$4D$ uj, h% t3H t3;3hl3j)q nl3H l3)hk%hv`$蘚 T؋ t3Qt3~ l3Ql3 hl3j  Tz|$h ot$dc~)/F1#ty1h}%n2td3h% ^ F N t$~WRQPh#%辙 \$S=ƅx*VhH%蝙 'h%莙 N hV%t D$@Phi%^ ~`1St$=t:j.$WPj2uj.h"W* WSh% Shr% C9u\$,t$ |$d|$h19wƉ΅hl3Q (M\TT$p1Ʌu9Q趏 V&jV| # VPTj芏 5Th%G 54Th%4 5\Th%! `TtPh% 4TtI \T9~h0$ 0D$D$L$d$ \& \$$S$踗 t3H t3~l3H l3 hl3j 4 \TTtz`T$$hT|-pTv3HT$\$\$\$ \$$% $hl3O hl3O USWV $$919gՉ $t$ $;8t$hh%$,( =&GШu+$ ؃?9?)9K9si 3LA B$sxv%PQhV =hV$,`( =GC~ 9r9$$ul&hh%$,V( =wDG$8:$ t-؍L$VSthV$,' 1 ^_[]USWVP։1|$4$u9|.HPhF%$ %wS$'W )1@1sC9uÅu.PhK&Д t$߉E1 `^_[]USWV4)ȃ'h%{ :։ϋ ˉ hT%2ˉ $Wf_oUSRQt$Ph7% Gl$j.UPjuj.h"U% UhY%ܓ Gj.UPjuj.h"UW% _U()|c؉<+<'ueh%0<9#<,uth%p '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5Tt$PV;hD$$HL$L$ 1x1PPPW^Y jh@PJ 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$TD$PVPL$@D$D$ 1 G|$<$D$=v3$TD$j=hQ&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hQ&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP9 SVU. |$|$t$ "+Hj=hQ&P Ņt$,]r 04$Q"r 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4l "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H k dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=Tu t11jNtT1TTt Pq1@hx0#hn%k T1USWV1=TMT$ l$(L$DžD$5ThhT裐  |$t$5#j hT}5 D$Th5#V߈TtUP[ uTWV辈TWV诈t7j L$QP; x#L$9uT;D$ D$uL$us T8 TAPQ~ PQZ  T tuQhhT衏  |$uT1^_[]TTT1Ҋ+~,u"1t$L$t' t" t΅tAL$=ЮTuЮT t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=Tu#TTtPW Tt T1^TTtPW TVtJT$1Aj<ƃ=Tu#TTtPqW Tt T1^t Tt D$T1@1USWV D$,L$(l$$~ )$1H$`t T1A\$9|ωL$ tgp9tX tt$ PX t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$TTtPPV TD$,L$$ ^_[]f11f11Ã=ԮTu /t(خT11hhTPjNtخT1 TԮTt P蹎1@hx0#hy%賁 ԮT1USWVT$1= T+\$0L$ D$D$|$(D$5ԮTt$8S l$,D$ D$D$t$j S0 \$1 h5#VE|$tt$(PW u~5#WVEWVt^j L$QPr xJL$9uAE;D$ D$<u/h5#V襃tj L$QP1 x L$9t[ ԮT8 ԮTAPQ~ PQU  ԮT tuQt$8S越 E h"#VEth"#Vwh"#Vah5#VׂEHh5#V辂E /h5#V襂E$j:t$ / 1@|$ u T1^_[]WV=ԮTu et3t$|$ 11t$t$Wj1tЉ^_1@PPhhThخTt$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=Tu+ TԮTtPL$R L$ԮTD$$tˉ01C؃^_[ TԮTtPBR ԮTPPhhThخTt$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=Tu+ TԮTtPL$Q L$ԮTD$$tˉ01C؃^_[t Tt D$T1@1fUSWV\$l$t$VQ PVWN UuQ PUW: SaQ PSW& t$ VIQ PVW ^_[]WV t$uRt>DžtA=Tt ^_Épxj Ph" ؀=Tu1F1=Tt` 1맋5v3_ dp#QQh%Pփ] USWV1ۀ= Tt ؁^_[]Q` D$ |$GSSPhTjW&u T $T (Tr1H,Tdp#1ۃt2u3hWh% D5T~ȍQ2w$'1TPAu 0T?$D$-v3] h>#L$Qh%PՃ2Tv3@3Tv3 ,TI9@v3 ,TI9@TTT4T0Ty1Tp2Tgv3 ,TA9~WHv3O3TFv3|t%ƍC!t2)É$)t*TL$ T$)PD$p xPhpTs=2T=4TWjD$hpj Ph" 5v3NV dp#QQh%5v35V dp#QQh%PփT 111{PZDWhVS ESWV 1L$ |$ ru\95lTs(>tGǀ=2Tu.;=TrN;=TrDT DžtVjWS =Tt^V 1ހ=Tt& ^_[À=Tu1Ffu]pxj Ph"M 뺋5v3T dp#QQh'%PփR NUSWV|$4t$0Ë lT9s&\T9 8Ս1ʅ/TT99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95T95TH_ŋ \T!9r؅ 8T9s9s_(T 8!9t.M9wI9rEPT8! v3!9u!=2T=4TTRf ʼn9rPVU'  8!!ōD$p pTPVL$D$PVt$8+`TPt$jUV袽thŋ$L$Ai QhpT0=2T=4Tu=TS 1=TtM^_[]t$hpTO=T1GDu3t몍D$0xhj Ph" 5v3Q dp#QQhT%PփO 9U7)SjZP)MPjS O :9/ $)QjZP)PjSN tƉ111USWVˡ\T!9ta)‹ ,Th t u9=,$)<l u=2TOE$)ÍFu\wl'xD$X pTPW PW=2TN VT5Tw(' w'1É;GsG1B TGHO;Mu9}tAtDEWP[5u%E9tt9sMxt MPQs}-E $ut=2TtGV^_[]ÃWU, VjZSL vjZv L VjZSL V t$=Ttt ^É01ɉHHj Ph"I ҋL$SWVȋ\T!9t+)֋ ,T| u 9t%)D @A QhpT @D^_[USWV=3Tt^_[]þdp#VVVh%v3Vh<1#h"h%v3q%=0Tu`%%=2Tue&C}%=1Tuv&RQPh%v37&=Tu%"=Tu1#]%=Tu5L$!%=4Tu$VRQPv3v3$ T|$gfff̉ҍ4މ劄1s#GO wһdp#<1#SUWh$%T$t$|$f4SUWh+%v3v3$ LTGgfff̉ҍ<߉劄9s#FN whdp#h<1#Vh:%T$v3$ 8T|$gfff̉ҍ4މ劄1s#GO whdp#h<1#WhI%T$v3$ XT|$gfff̉ҍ4މ劄1s#GO wҸdp#PPWhZ%T$v3$ v3|$gfff̉ҍ4މ劄1s#GO wҾdp#Vh$ $Whg%T$VVVhl%v3USWV΃=TtPt \T3!1PjǡXT \T!)ȉ9r1UjT9tEuótP-(T!1PPjhjUP t(TtT=T=T-T1ۉ^_[]V΃?T ; Tv$1uTƉ T^USWVPDT@THT 0trƃh'PF,=$T=@T4$t|n011FEEh'POـEEC@T(9r:5v3I dp#QQh%Pփ=0TT11DT9s[ $,0EEh'Ps+@TCLT]ǡDT@T(9rHT9$sj,Ѓ0EEh'PX8T @Ts DT)ÉE;ǡDT@THT(9r$^_[]F L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ$TD$lTD$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV99uP];TFjWV* *1ۡTt  T8TH@; Tv@jTH@ T 3H XTHPhThXT9rWV u=> j@S0 -v3X= h<1#Sh%PՃ=0T9=XTu]Tt  T6TH@; Tv@u,TH@ Tt=XTp xPhT@^_[]9Tu)TT: fv3øv3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á3D$t$PdWVL$T$ ‹q~y ;q~ t 1~9 QPZ ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'W- tF u1^_ËD$t w$'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ dp#dp#tƀ>tv%9 0DPWVha&hĆ3;U ^_Ð1|$w L$t9tøv3f|$3%G#tdp#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PS `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ PK4 t F;'tm'D$ 'D$P'1FthPt$$V& V' Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-47 01H^_[]Ë' r ,$H't u‰,$H'X'<$t9rPQt$3 1t/<$t9v6 |fL$5%9 (v3fL$J%9 Ԩ(v3føÃD$L$L$ L$D$Vt$ t$VhĆ3U hĐ"VGt"6 0kPh$hĆ3dQ Ć3Vj D^V ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP tX4 0 O4 1$^ÐWV|$ W4$'& tFu1 ^_D$ftL$Q'1USWV$п$$ u V#  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#N4$Y(}111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$TL$L$ tU |$$1Ĥ^_[]USWVt$~X>3܃ V$p' j F H @(N]_?[\;^r~uFFTTC><% ^q{t|~F~F ;^r~uFTFF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFTF^9րրw t$rI{i9s <$=3]D_\,<$t~uF FTTAu~uF TF>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF TNPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF TF"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF TFЉL<$USWV t$ ^h.\u/;nr~uFFTTEMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFTFF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFTFωωD$$xt~uF T.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF TN$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF TFVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFTF~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uTF4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ荹 F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA TQ^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FTFUSWV\$1=39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh 31҃9v1B 33Dh1҃9v)1BuG TG^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFTTT^_Ã~uFTNUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFTF1^_[]É؉D$n%,'t$t$U u U t/uՃt~uFG롋$USWV 1=39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq\ tF^~uF TF1^_[USWVP1N׉$1+t{`tswsK$D'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ y ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$t'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4v L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ vT ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V虶 @wj/Vɑ 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhT,Tø%Vt$1Ʌ1t э^fffffffVYT$,ws,^ÐUSWV[l$,D$(u1T$|$;D$ T$$75,/PW~ E! PWf %/PWN ) PW6 t1 PW" |$D$ tH /PW < PWѫ /PW蹫 iD PW衫 tL PW荫 |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1t9r 胼$ t+$ $$ FhPWYa D$D$D$j1҉$ xfD$4D$d諶 /$$ AfAfIZQPRhWrt$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ V訢hPW` j:W D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVPt Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.rqPh$P$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R ` RQPUh$P$$,$ 9sL$4rqPh$P_$j$,$o9sD$l6$,$/9s狄$ @rPQh$P$$,$9s狄$ @<hh,$9suF9snF9siF9x|$B$ yv ,$9s%NM9D?<$ @<L$|IF t$xjhQPRt$Ph$P$$,$9sL$tWrQPh$P$$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ | ,$$ |$jj Rjjt$,$ 衑$,$$$49s獃k ,$$ g ,$QPh$P$$9s獃n ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HPn pRQt$Uh$PD$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$Po,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@T l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PlXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$PV`$,$$_9sjjjhRt$,$ k$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$FW PQhW/1ɃD$D$ D$1 6 fffUSWV`[t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r  l$8D$UPj/ tCL$HD$ QPVǦ t2V t+jPj 1ɃىK'| (jD$LPVm e (l$8Z 0jUj F 0`^_[]fffffUSWV< [åD$yXXD$/Xty$/dev jPet=ƍD$4PhFtHV+ V@t|$4l$8$<D$ oD$ $<T$${PhQRV=D$ t@D$D$D$RD$ p L$T$ t$F 9t$D$0l$WzE?tD$pD$ jjRS tkD$tQt$PD$P ut$D$PuPLujjD$P  k6k 8[ P iŋ$\ $X $T $P :)tt$ P$` tVjQ4v 1tWhgtQ- < ^_[]ÐSV[:L$t$ t$ t$ PQft+Y? ƃt;u"t$ 4$:01D$L$4$ ^[fffffffX0ÐX!ÐXoƀ!ÐSV[M0tP! ǃ0蛣 !Rǃ!^[ÐSWV[0tvtEuG 9ujjj0 !ƒt#0C SPQVP 1ua 0U 04$N^_[#䐐S[î[ÐS[Ît$[ÐUSWV[`u }ʞ D$<$輞 t$u$$D$P6ut=k<T$JL$|D$x$L$x$PQr$$$Pt$/rlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $449u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$( D$@j PW4 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։ݓ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ|g|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR莰ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6@W8G4jjdv6q jjdRPWPGLjh'v6q W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,5 L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[L$0tEׁ,u$C t+t9u11ՉL$!։1^_[]ÐUSWV[k|$GtB#l$%t$P8t!G t7t9uӾ^_[]ÐUSWV[HtC#l$D t$P7t!G t7t9uӾ^_[]ÐUSWV[ËؗtC#l$ԗ t$P67t!G t7t9uӾ^_[]ÐUSWV[t$0t$,@ Ǎ VP‰t$D$(%D$1퍃,D$ <$l$0tg|$ !RPw6tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR_ PUW >&t1<$W^_[]fUSWV[ۤt$D$hEt'1PV5t%D=u1 !uVPj D$@ 8^_[]ÐUSWV[X|$ D$hEt$1PW 5t%D5u !^_[]ËD$@ 40tMgn D$jPt$V0 ŋD$18tx5n r"u## !uB"tt$ !a&4$WPjуHWPjSV[-t$ vv V^[ÐUSWV[D$,8tD$,1퐐8@uj HƋ|$(W F$"jUF D$ D$,F> D$Pt$1}nu1ɀ}ouL$D$j=U7 tǃ|$D$,t1PU2tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jGŅ8 !t 4$TVK1^_[]ÍUPjUSWV[5$4$,k 0?jPUf uj:U6 djPU= tKt$}/3t$UhV jVPU"[ P t$UD$PlW|$ jjWjjVp1mt$ jjWPjV@1t$/bD$PVǍ,D$t$jDžjt$WL[ uj$4$4jWMtƍD$Phzd@VCL VQD$(Pt$[ uP$0>$0VPW FD$ GL$ jjQPjR(0tqVUW RXi 0M$0XBi 0jk3i 8uj/UvJŃt$ $0UWg h 0EQPWH 111h 0M$0P$4 11,$j$4V$4WjUPPWzt$t8HPQF&Lh 0j$0P$4 1,$D$PU h 0^_[]Í,$UPVWL1g (WP$8$8V#fffffffS[D$D$ $L$T$jjPQjR.yD$[fffffS[ûD$D$ >$L$T$jjPQjR-yD$[ÐS[[D$D$ ?$L$T$jjPQjRQ-yD$[ÐS[$L$jjPQRyD$[fffffYT$$u|d$ÐS[~t$uSWV[\|$Wt$t$ 9re ?WVPj$^_[ÐSWV[ |$Wt$t$ 9rae ?WVPj$^_[ÐSV[ýt$  ƅuPj$^[ÐSV[}t$t$ ƅuPj$^[ÐSWV[<|$Wƅtu*WPj$ ^_[ÐUSWV[l$|$UW ƅttuDUWPj$^_[]ÐSWV[ì|$Wt$ ƅtukWPj$ ^_[ÐUSWV[[l$|$UWt$M tc 0UWPj$^_[]ÐSWV[ |$t$WCƅuWPj$ ^_[ÐSVP[̘D$L$T$$RQP ƃuPj$^[ÐSV[}t$t$t$Ѭ ƃuPj$^[USWVP[:Pt$0t$0t$0t$0t$0jt$4]? Ɖ׋,$t1zb (t$,t$,t$,t$,t$,t$,Pj$ ^_[]ÐUSWVP[úPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1a (!t$,t$,t$,t$,t$,t$,Pj$ ^_[]fX?L$"wÍpffffffUSWVHXD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjx~D$ |$4R|$D$811|$<,L$4L$0GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjjp\$Pʅ~D$ |$\$0VRD$ PjjpT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjjo1҅l$D\$0WRD$ PjjoT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjmD$ u|$,L$ t@;L$s3$ >"\$0V L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[njt$t$t$t$t$8[fS[>L$T$ Pt$t$t$[ÐUSWV[|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuUS 8uF7t$ t$Pt$t$@t$xjt$ 0 [ÐS[xjt$t$t [ÐSV[w0t$t$V|) tD$~ L$u  PQV ^[ÐSV[}wt$ t$t$V ) tD$~ L$u  PQV ^[ÐSV[w0t$t$V( tjt$Vh ^[ÐSV[vt$ t$t$Vp( tjt$V ^[ÐUSWV [xvt$4@|$[D$t4L$ ʁtPD@t1t ʁPH^Ë6u吐S[Zt$0[ÐUSWV _ǨZD$ T$$сtHD@ t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jP/Z1 ^_[]ø񐐐WVZ½YD$ t9pH@?t;:u@D ^_øS[^Yt$0[ÐUSWV0[(Y|$D:D$Hx,pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|utt EGDǃ!<ǃ!^ǃ!vǃ!#ǃ!:ǃ!'ǃ!#ǃ!#ǃ!#ǃ!-ǃ!-ǃ!_ǃ!|ǃ !oǃ!-ǃ!-ǃ !<ǃ!>ǃ!*ǃ!!ǃ!f2Ot^t8tjtfx(!؋tvQjPW 14!QTpQTtQTxT|=u^_[]ÐVYN14!T$tpqttqtxqt|1=u^ÐUSWVP[M0!l$j+}GG(ujj1QP upPj j3"aQP&ej>!j<!j^8!jv`!j#!j:X!j' !j#H!j#p!j#x!j-h!j-X!j_H(!j|8!jo(!jp!jr!jy!jz@!j{h!j|!j}!ǃ!!ǃ!+ǃ!!ǃ!,ǃ8!!ǃ!-ǃ`!!ǃ!.ǃ!%ǃ!0ǃ0!%ǃ!`ǃX!%ǃ!aǃ !ǃ!fǃH!ǃ!gǃp!%ǃ!hǃ!&ǃ!iǃ!%ǃ!jǃ!%ǃ!kǃ! %ǃ!lǃ8!%ǃ!mǃ`!<%ǃ!nǃ!%ǃ!qǃ!#ǃ!oǃ(!#ǃ!sǃP!%ǃ!tǃx!$%ǃ!uǃ!4%ǃ!vǃ!,%ǃ!wǃ!%ǃ!xǃ!ǃ !~ǃ!#ǃ!pǃ!#ǃ!rǃ!d"ǃ !yǃ@!e"ǃ!zǃh!ǃ!{ǃ!`"ǃ!|ǃ!ǃ!}2NthtBt'zx0!*!ϋtuQjPVp(!,!꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX{H(!l$+4+ع x( PPu^_[]fffffffXHL$fǀ(!ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[Gt$0[ÐUSWV@[ØG|$TED$G8$u!O9OuO9Ou 9u_uWEt W|$XE3t:\10{Eǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3d/1j ‰PD$<x-.D$8|$AG $tJt PwW W~"G @t; 8u1E3t%\10uEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u*E2$t L$Xu$ L$Xt$AsiSV[=D0t$t$V tt$Vj^[ÐSV[Ct$ t$t$V tt$V^[ÐUSWVL$[äC|$0D$(T$ 2D$ED$4D$D$(!ftW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ(!ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4(!ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ(!D$4PjjjC 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$ 1|$0f(!4)Ɖ4fǃ(!ff9t |$ u |$ t)Q)Rk* t$VUF @f|$tg&D$@ 4444H44L$ 4QjPt$`e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f(!f1jD$` `4rփփ19‰4 4f(!fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f(!f1Pjj!Qi jS[n<t$j[ffS[N<0t$ [ÐUSWV$[<|$u2t P:Q2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQUY|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(PptjjP ,GTPFtjjPŝ GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PjD$$<$$u$P HuǐuU3 PD$$鐐<$$u$}P# Huǐul$Ut$V:VU$|$~"14/;>|V^_[ÐUSWV[3fǃƈ2L$ȉT$ D$D$ D$t$%fG D!9H!t%fG t~t-@!19H!f3t 1[ÐS[3t1[ÐSV[ý3t13tj2222a3d3ǁ222Pt3jP ^[ÐSV[3t13tj2222a3d3ǁ2,Pt3jPL ^[ÐSV[}8th3tA3tG22o3,Qt3jQ­ ^[ÐSV[|$ 3t13tw2|$t%22o3 22o3,Pt3jP ^[øSV[-8th3t3tG22o3,Qt3jQr ^[ÐSWV[Üt$6Ƭ 3t3G\88 r 3Wy3udž311WjPv讳2HvWjP2HvWjP|F@:t2HvWj<PUdž3^_[ÐS[Þ[ÐX3ÐS[^041[ÐS[.13t)PtЁ3QP [ÐS[13t+PtЁ3QjP\ [ÐX3u1Ês3ÐX_3u1Êu3ÐX/3tD$s31ÐX 3t L$u31ÐX L$31fffffffSWV [É D$ D$D$$ t$VWj ? XD$D$D$ $jWj> jjC@jVj>,^_[ÐUSWV[ 13PtЁ3QP蜳 !u!j3 ƃ!!~:Pjj $;!u!jPj 1!}t&jEHjjQpp@|t0QjP@ Et"@:t@0Qj8 @0Uj @UjX p踧 jjjpǀ3Qt43PjQ ^_[]ÐUSWV[ 3!ulPj !ƃ!!uRLD$D$D$ D$D$D$!L$PQj ǃ!@HtȍL$Qhht@P tBL$t9D$t0\9 t ǁ39tǀ3\(8$9hu9xt WUPwK 9hu9xt WUPZK Qt43PQ It3PjW $6@$0d^_[]ÐS[ !ulPj !ƃ![ÐS[!u!jm ƃ![ÐSV[ê@HtȉQhht@PC t!$tL$t\!Hwtǀ3^[t$ЃS[ !uOL$D$D$D$ D$D$!PQj5 ǃ![ÐS[Û!~:Pjj $;!u!jPj 1![ÐS[>3t[ËPtЁ3QP [S[Qt3PjQx [ÐS[ÞQt43PQj [ÐS[^^[ffffffSV[=|$ ta@|$t|u7x1t-0QjPM 3p 1^[þfffffffUSWV[ëT$2tt6usRRt1u8]RuARt'20PjRz pM ^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%20PjQ p訠 ^[fUSWVP[Zt$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,D$w,Pj<[ø[ÐSWV[t$t@|$FX32@@TtPVWvX01^_[S[Þt3tt$P[ø[ÐS[^t3tt$ t$ P? [ø[ÐS[t3tt$Pc[ø[ÐS[t3tt$ t$ P [ø[ÐS[Þt3tt$P[ø[ÐS[^t&3tL$ t$Qt$P&[ø[ÐSV[ 0t\Ɔ43t)2Fpt9PVPV袾(3tP蝊3V^[ÐS[Ît3tL$jQP [ø[ÐXO1t T$~93|4 RDÐS[t3t PgV[ø[ÐS[D$t3t P+V[ø[ÐS[Ît3tPUt^[ø[ÐUSWV[K0Ɔ43t)2FttrPVVPVܼa3tR3~>11;3}:tt3PT^_[]ÐS[ÎT$t$t$ [ÐUSWV[X93|$0t$,T$ $upXMDH@utl$4D$ Ug 鐐t$ D$PL$ QD$ Px)t$`tL$9D$)<9u AT$)RUft( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[8D$ $4VjPj.tSʼnt$U`ƅtMD$ $t$UD$PVtT$t$$V Vq^_[]ÐUSWV[|$3t P 3~/11퐐440p0;3|4p,3ǃ,wwLJ3j0ji4tW2Ht<@xX3~3PL72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448o0;3|4o^_[]ÐUSWVXxt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([(4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wa 1Ґ$t$V|$(WD$0Pt$$XŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V许 $4D$)Džu |$ $tR1VT$ 蚏 4$)tWj Ve T$L$ (^_[]ÐUSWV`[x14t `΋43t42NzRЃPWVrPVhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WY PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQNj$D(PD$$L$ ;47&ffffUSWV[{|$$D$hjjUH t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[|$$2t$0~Ƌl$r:D$0Z~D$49~uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$Uc 1^_[]ÐWVYmD$T$ t$w4  p@^_fffSWV[ t$V~~tyы9uv0fv,f9p9p 9pt PݦlfVcf1^_[v4Rf9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PeffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[þ|$ uT$[ø[ÐS[Î|$uT$ L$[ø[ÐSWV[\|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVXt9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[T$R[S[L$T$ 6[ÐS[îT$[S[ÎL$T$ [ÐSWV[lt$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[t$|$tCGX2@TtgAWFW=@x8tg@ 1^_[ÐUSWV[{΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vdt"G8tt V1t$׋NX2#N@N@Rz8t N@^_[]øSWV[΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[t$8V蟛 PVW ^_[ÐSWV[L$|$t$x"1t%<t9u W9 PWVN ^_[ÐSWV[|t$|$W PWV ^_[ÐSWV[LL$|$0x1t!<t9u W詚 PWV ^_[ÐSWV[0t$t$V苑 t|$WY PWVn ^_[SWV[Üt$t$t$V? t(L$ |$x#1t&<t9uW PWV ^_[SWV[,t$t$t$Vϐ t|$W蝙 PWV ^_[ÐSWV[0t$t$V{ t$L$|$x1t"<t9uW" PWV7 ^_[USWV[e$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PixNjT$u$^_[]$USWV[U$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$$PgL|$Ll$Pt$VD$XL$D$ D$|$LG@D$GXpX);OTu%G8 uD$P .G9|ƅp|$Wt$P薸ouAt$L;NTxF8 |$P#$VV _PftUl$PE|$Lt$L$X L$T;GTG8 $Wr D$TDl$Py T$T$L$XD$\pt81$j?L$\LT$J HB 9uЋM t$LF(T$XQ;}I ;T$T$~D$XPP2VD$Xt$$щy194T$l$ 9ŋ|$L~cl$ D$TO,WDx77fD7Pu|fD$ EHD7ELfD7D$XT$щy1뎋l$PʋM G(T$ЋI;}t$$D$\pdxL$ GL$X+9D$ ~D$T;GTuZG8 uHEL$X)VD$T|$PD$X $WJ M D$XG(Ћq;}D$XG9}Tދ$GDVw|Re[GHFGLfFfFD$XG9|MW(‹I ;~G$Pt$ t$\6WD$X;GTtO,pED$O(T$X @;}F t$PmeF L$\Af W@ %uыWH ȅtL$ ‰VfND$\@D$rGD$11$j<#L$\L pE 9|$uӋD$HD$X|$ |hD$ p}$$@D$\@GE!ȉGGfGFfD$X~GtPSdG맋|$LG9El$ l$9}dG,L$T 4p$f~y9GDfFVw|cGHFGLfF;o|G(L$P I ;~$Ut$ D$\0WL$T ;OTl$Pu3G8 $48u D$XW1GO(UR ; ~ G$Pt$ t$\6WD$X;GTtO,EOW(у@ $W18^_[]ÃO, MO,L$X 4pUSWV[$F$$$$A11ɉFXhXș)Չl$$;FTu0F8 u*$1D$F9|ȉD$|$FD$FD$1|$H0L$ D$FN,D$1 $l$ ^UT$1 |$HT$(D$$D$ jD$$Pt$t$$D$,P$$)~"D$HPVUD$P[xNjT$u<$D$;D$$|$H.V $͋tp $E;FTu;F8 HV`$E$σEN,1 $n@ƉׁuQ ^$H($$P; } $P ; ~ $$xD$ t$H$ u$$fd $xHt |$$B9u$R1^_[]øfffffffYOt0 I8t u tHAøÐYD$t0 I8t u tHAøÐX tPtaAøÐXoL$tPtaAøffffX/t1HX2I(t u tHAøÐD$t1HX2I(t u tHAøÐXt @@øÐD$t @@øffS[Njt$ [ÐUSWV[(|$tyG8 tsl$ 1tiWD$W$jwPW| UW4$t$W| 98uj z48uG^_[]ÐS[~t$02[ÐVXNtT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVXtL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐXoHt t1ÐX?Ht t1ÐS[t$0[ÐUSWVZ|$(QL$,C@D$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prqe _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|XHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqp[d ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|VtG9|델Kwl$9\$}!GPjVW`9uGt PW1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[N0[ÐUSWV[(|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ¾L$1~t$ ~9J$u9r ^ÐUSWV[{D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77>1^_[]ÐUSWVP[t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [Øt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV$1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[=T$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQDE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[۰l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[xt$D1Sl$HGL$0[ÐSWV[t$t}19pHt.1F:tVtFxvvv vP}u- F9u" Q+Vy1҉VI+N y1ɉNA^_[øS[~L$1qqq qj [ÐUSWV\XHD$4|AX1xrT$D$AQ8L$$T$tD$$ $l$p|$t\$|Aq;D$9DD$@T$tt BH8@A8࿉A8j#E8E8 A8E8A8 T$!ؘD$H9"׉ЉT$(9UD$p$|$8׉|$D҉T$G:uo~G,D$ 1fу9~ƋD$ 4t',$E,D$G+E݋\$t$C,W+S&륿\^_[]ÐUSWV Y|$4t}\$\$0$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p!F!fFV!!k!!fN! 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp0QjP-ɋ$Rd0PjQQ f~$~gD$@u]D$$t$Fh2u&@9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $0jQ Btdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9!!!$Pq|\$I!BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;!u!D$PD$1r.1!$Ph V\$ ǀw !$PQRX\$ D$@!L$P!D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 0UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄!$h QP \$ ŀ=rv4l$G!$h WP; E$h Wl$ P \$ w荋!$PQw D$PGD$H$Qjt$HVP訂\$l$,KD$@, /D$H$QjVPf\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $0$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 0UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a0QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$0WjPA D$l$|$ l$ t$L$$0VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$0t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$0$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$0QjP%? L$$jQVjU\$bHD$ $jjt$RVh$0t$@$WjH>\$ uL$L$ T$9Q|$0$VjP_>\$ |$4l$l$,@$VjL->\$ ut$PQhtR> $A USWV [xzD$41\$t$LL$H\$DT$@|$oD$ L$QPQfPQfPPq [ÐUSWV[n|$t$O tR1ȋHvDžtYujtpG@v1ɉDžu1X1tRiQduG .1t(@yQ4u^_[]SV[-nD$ tpPu^[ÐUSWVP[mD$H~D$@1L$I$9}Z~L$I,$ i19}ƋM tyQTuD$@Ń^_[]ffffffUSWVD$T$t/L$u+1t 1%t 1^_[]ÉӃ1 9t<1lj1D1ǁt%1ƐUSWVL$2T$119:lj1zlj1zlj1zlj1zlj1zlj1zlj1B؉ǁt %1z 5É1_É1_É1GÁt%11^_[]fffSV[]kD$ L$T$t$ MIIlttt$ jQh+ j D$uǃD!USWV$T$ [gL!P!D!H!D$PBpL$ t$tIT$$`$,D$8 $<t$u;@!} t$Ћl$)$t$@@9 9<$ PjQ0) @xH!H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$ Pjt$( ǃD!D$H!;@!;T$ 9<$L!toT!j Ptwx)P!@lt QjP%( FL!t3T!j P)wx)P!j |j mH!H!ǃD!1;@!T!$ l$*ǃD!H!;@!H!@@ltWjPV' P!yAL!t`j t$LvxP!)ȉP!}u D$8o@@lU8 LQj `uD!;Hlt htðuu냹tt u1ÐX/^@ xÐUSWV [^AP8p|$hD\Alt huu |t$r/ǃ|!4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|<|!fp">fr"@t"ǃt!ǃx!21CdD$L$ /jt$ZD$L$ T$R29t9tT$|! FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p |!p0!0 |!0(9uD$t4$L!L |!Lq1tt  ^_[]ÃttِUSWVP[:YL$9 ft$9|$ 9l2uCUw$-4$t$skw|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXW2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYV|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[{UL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZ¼TL$x?9J\~2D$t$|$ Irftf>vf1^_[S[^Tǃ<ǃ@9t%|!DŽp"DŽt"t!t|!1[ÐUSWV[ST$L$l2uI~w-ssw!ff fff<f>ǃ@>t*|!f0p"f0r"DŽ0t"t!t|!1^_[]ÐXRh2ÐUSWVP[Rt$x!t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[ÜPl2tu6@t!|$0QjP (!G@f@d^_[ÐX/Pf@dffSWV[ PD$ yOQW~ ;O~ t Q WP8W^_[ÐSWV[ÜO|$D$OQW~ ;O~ t Q WPH8W^_[ÐSWV[Hjt$t$D [ÐS[Ht$ t$ 0 [ÐUSWVX[G|$lt$p1 6xŅt$t$lFPD$]L$tvt$ D$p@L$F>ʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$`( $ș)l$T$ $L$$$D$w;x)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$ڿ7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Pjx‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ {T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K,Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K,Й~ ƃQWT$H ^_[]ÐSWV[=|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[Þ<!!jt$t$t$P1[ÐSV[]<!!jVjt$PJ1^[fSWVP[<|$t!t9t QD$PL$QjPWeL$N|$kK)l$kK) $;$i)lPUt;y t0q$t~fuUvu1 q p^_[]ÐUSWV[H:D$$L$t@1D$D$>D$PL$QjPWdL$kL|$kC)l$kC) 7%;7%i? )PUt7q tAy$t+nuUwu Ay^_[]USWV[(9D$(L$1҄t@1D$D$8>D$D$P~L$QjPVcl$-?L|$ ) i)ʼn) i)kz%{z%lj*SiŠ)ǍPD$Pt1D$H<tzp t:h$D$t}suPuYD$uދ} مt3l$,t+Et$WP=(uVaEЃ^_[]ÐS[Þ7t$ t$t$ [ÐUSWVH[h7t$\lD$P謠ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPU aL$ȿNt$kK)kK) $3$i)lPUL$D$$pED$j=UxtƉH$$D$<$|$WL$QjPW `L$Ƚ-?Lt$) i)) i)Kz%sz%Ɖ*SiŠ)ƍPW6D$5tcL$f <$|$W?L$QjPWN_L$ȽkLt$kC)kC) 7%37%i? )PWtD$EE!D$DW $$D$iVPU-PUPUPU cPUt PUtr PUtePUtXA4PU}u^O1<5.' D$URNj$tP@ 1L$;D$v==wL$L$Qt$賦L$uD$ 9D$ tf, UQ",$t'UW"|$BU4+1t$ 1 t]|$uf, FM $QP"4$>  $LD=uVQ!V $4D$ H^_[]1|$t4$51USWV[61h苚WT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGLM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$t 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV],2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[k*1l$E<%uEpuEπ r?уstlu~;|$~,|$ts릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[í)L$ T$D$$Pj [ÐUSWVXu)$1h ։ͅu4$!u'$h襒!5 @0t$E4}0u"$hmE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjPV l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,GE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $+ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $-$t"A$|t+H$D+$1$uՋ$1ڃV$.!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,誘RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$j1L$ ʀŸw Dʀ¿~4r$&1ۋu0M4A9s E,u,߃$Vu,ʓrE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,覒tRE,}0M4$V$0Pt$QE4E,M4},$}1^_[]ÐSP[T$ D$$1Pj= [ÐS[ît$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[mT$ D$$1Pj [ffffX?L$DÐUSWV[|$(t$ l$uĽPƅ>l$$uj[hj؏L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4@9Pk1D$tGuP|$(ox |$(tF|$(mV|$(Phht@UV t$t$tL$t RB(JDtRKbPtjjP~ IA(VbPtjjPo~ IA1t^_[]ÍPjVSVP[T$L$D$tRQPVƋ$t P.^[fUSWV[{t$|$t$jt0ʼnVU*|$T$VŸPt$Wt~Pt$@tkPt$)t[Pt$tK Pt$t;Pt$uA1 @VK^_[]ÐUSWV T$L$[ǃ!P̗Ņt'}/u{L$$ t$  "P萗/P܆PVkuU謆DžjWWW9tpL$v u\D$ VP$tIT$ L$$ Pt$ V`'u1V='*P莖$|$ $~:s1퐐Nt:t됐tÍMwUPW) D, L$$ t$ [tuiPޕtG8T$ PQhR~)T$ L$$ t$ $Et$ $:uw1퐐Ot:t됐tÍMwUPV) D, L$$ t$ [tu$ $ȁ ^_[]Í!!USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%膈\$L$ A ZAthhP+jj!LG(hhP|$ Gt\$h(jP|$ "\$jh|$ G9ouG)o\$UD$p|$ Go\$UVPX W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjPe ~ gC C$ދ\$PgF$ދ\$PL~ F$D$\$jWkF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$VST t6u0,1(Vr9ſuUt$VT ^_[]fffUSWV [Ø D$48H L$@ 1퐐/t <,tEPvUWP! .,v3l$4uWEED$\$cD$}D$|$j|WȢtD$4@ T$L$ tp17t<,t\$RT$D$PutDl$VWQ& Ut$P 1<$WNjt$D$Pl$8uAEW|$WV謩 W谅D$D$D$ Džt$莅\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0,\$<u3D$u'\$Ut\$8C k$K($fC K(K(|$T$ t$4ePl>p1\$91\$-4$K\$qPlD$PD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q躂 ^_[]USWV[øD$t uyp}|$ 1퐐/t <,tQL$$Pqt2ƃ$UWP 4$t$P  1^_[]ÐUSWV[|$ t$FN,9vtU6"|uCu;Uqt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[Z|$ l$WPWuLt}D$x@ȃǃtVot$ UT)Lstƃntfuă뿐1ɋT$z H&D$8l$|$ u)1|$WuPt$D/WprWuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[+|$ t$FN,9vtU6Rtu]uUUOitHnNT$l$f,Ninf|FFWRP臝 ~F 1^_[]ÐSWV[|t$FNy9vtW6suCu;Wht.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|U)D$tL$j|Ut L$U踸=rUPt$P 10^_[]ËD$tP肸L$ =r"D$t+P^L$=rQUPt$T^jjPptt$ $@ 1D5t <,tFPfD$4 VUP D5$(L$tSD$HtJ11t <,tFP`f Vt$P辚 D5$h|$t+D$Ht"t$j $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0i$@,t'<$O 1҃ ҃f91wуu蠿<$O G$1҉L$‹O(Q9T$0RD$p 1i$D$t$HjjjPjfWjQKVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[ê|$!$!ftGt @1@WG(f!hwU` =wb,ŝ!Ƅ!|)ƋtVPU_ 9vD|ŃƋGtVPU_ 9s D|ŃE$^_[]ÐSV[ít$ tavdvtdvidv ^dv$Sdv,HdV?d19!uǃ!^[ÐX/!@ÐY!@upUSWV[$(E$$4D$$0j:WtjQP0 t0V$0Wk NjE;$^_[]Ãhu 1LtMpuTt6xu\txdf$O:t @t@uS4$l$w$D$j@UP] <:t$EF<:uEl$4$D$D$OtuHPchPqc`MǃHlD$O3/$$,PQhW t" ǃt SjUHfH7L(jl/hl]Pc^]PPetj/V荒t|$u/$jPRQV0'/T$ĩ$jPRWUQVVPj%KSV[Mt$ j:V|tjQP轡 tt$Va1^[ÐVYT$փ1uLt^1h^USWVH[øt$dl$`L$\D$Dȃ=Luh<$yL$VPj@Q3T$tLT 9 $ƅtID$\WUh ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\hLDŽhDŽL $;D$Du ЃH^_[]PUSWVT[X|$pL$ll$hD$P=Luh $t$ uL$WPj@Qt$t$ T$Ijj wD$Wt$L $t$j N9<$u-;D$PuyL$T^_[]WQU ;L$PtNThML>DŽhDŽL谭;D$Pu T^_[]pOUSWVD[L$`T$dt$X}|$@uMLu ht9ƀRQt$dPj@W tRQt$dVn M;L$@uD^_[]NSWV[L|$=ujLu htVw;/}tL!hLDŽhDŽLW^_[ÐUSWVP[èD$hT$dML$LL$pL$t$lуucLu htOz=m8@tW=mP/T$ vPQj@R x. VPRԍ bk<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$lh 4()uT$ff׺r$σߺfDfu,$tу$$1#E;D$Lu^P^_[]Ët$dheLVDŽhDŽLȩ,$1,$KS[D$u&Lu hti-[P[ÐS[D$u&Lu ht-[t$ Pb[ÐSV[mt$ j:V6ttjQPݙ tt$V#袨-^[ÐSWV[ |$t$j:VstjQPx tWhV WhV ^_[SP[íD$ L$ $L$ƒu&Lu ht-Qt$P [ÐS[>D$uLu ht1[P蔃[ÐSV[t$ j:VrtjQP] tt$V""-^[ÐUSWV׉[ÄRjj D$UWt$L  t$j 19tG4$hLDŽhDŽLw^_[]ÐUSWVL[D$D$H1,<jUhK u} t @u D<@u^h]LNDŽhDŽLD$;D$HL^_[]Íl$ E< us{Ui8|$jWh  u|$ u}FuhLDŽhDŽLIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<: 0"D$t$DRL$D 0"A @`? 19<$$0"D$D@ @`ƒ?91#0"D$D@ @`Ń?+9"0"D$D@ D$@|$`D$?;|$  ՋL$!0" <$‹D$Dp%0"D$L$ D1 <@4$T$<`Ń?|$_u+19QL$ T$D $L @`ʃ?|$_u19 l$ D$L(D$<_D$$D @`Ń?+19 ՋL$ T$D |$_$D @`ƒ?9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$80"VRPQT$T$L$ t$ ?3|$D/? D/ ?D/D$/T$T$L$ t$ ?3D/? D/ ?D/D$D/D$L$ < L/ ?L/ D/D/ 0"<$<$r?USWV[$D$$! ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"ǃL0"ǃH0"ǃD0"ǃ@0"@@0"Tg3g4t2tkƷ< sԃ1@tt@0"tlj瀍 ;!1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ@0"ǃD0"ǃH0"ǃL0"ǃP0"ǃT0"ǃX0"ǃ\0"ǃ`0"ǃd0"ǃh0"ǃl0"ǃp0"ǃt0"ǃx0"ǃ|0"Ug|$| t!qtAD>1tBD>׹@@0"TgD,|t.tkŷ< s݃1@tt@0"tр‍  "1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ|0"ǃx0"ǃt0"ǃp0"ǃl0"ǃh0"ǃd0"ǃ`0"ǃ\0"ǃX0"ǃT0"ǃP0"ǃL0"ǃH0"ǃD0"ǃ@0"Ug|$| t!qtAD>1tBD>׸@@0"TgD|$t=2t$Fi%I<<fw1@tt@0"tlj瀍 ; "1ttD~tG0"h  fABg w~4ABg w~4ABg w~4ABg w~4ABg w~4Ag wʼn41 @tt@0"tlj瀍 ; "1ttD~t=h$Qg$A@0"g$B@0"$u1 @tt@0"tlj瀍 ; ("1ttD~t⍃hC0"0pQPQPQuW0"D$pV0"D$lU0"D$hT0"D$dS0"D$`R0"D$\Q0"D$XP0"D$TO0"D$PN0"D$LM0"D$HL0"D$DK0"D$@J0"D$<I0"D$8H0"D$4G0"D$0F0"D$,E0"D$(D0"D$$C0"D$ B0"D$A0"D$@0"D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف|hр3ʉрUɀʈǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"ǃ0"΀0"D$0"D$x0"D$t0"D$p0"D$l0" ʋD$h0" ыD$d0"D$`0"D$\0" D$X0" D$T0"D$P0"D$L0" D$H0" D$D0"D$@0" ʋD$<0"D$80"D$40" D$00" D$,0"D$(0" ΋D$$0"D$ 0"D$0" ω D$0" ɋD$0" ? ? ։? T$ځ "$T$ 1o0"u0"E0" Qu0" ƃu %?? lj%?  $T$ @D$Xƃ!$ ΃!! ! $!J΃ ! ! ! $!J΃ ! ! ! $!J΃ ! ! ! $!J΃ ! ! " $"J΃ " " " $"J΃ " " " $"J΃ " " " $"""}G"4$l$T$ L$ Ń4 "x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]#.USWV(]ŸD$<X%UUUUʁUUUՍ4P᪪ "$"x " "x  " $" x " " x  " $"x " "x  " $"UUUU " "$؃ "$"x " "x  " $" x " " x  " $"x " "x  " $"T$H ݠ"l$ ݤ",1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y"$$"D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 "3 "3 "3 !"3<$t$3~3 "3 ""3 "3 #"3 "3 $"3 "3 %"3 "3 &"3 "3 '"1#t$t$D$|$811t$3= "$3= "$3= "$3= !"$3= "t$$3= ""$$1L$t$|$l$3l>l$|$l$ 3 "3 #"D$35 "35 $"35 "35 %"3 "3 &"3 "3 '"D$t$D$D$$7֋T$ Bl$l$l$$xl$  ("$("$x (" ("x  )" $)"$x )" )"x  *" $*"$x *" *"x = +" =$+"$x +" +"x  ," $,"ȃx ," ,"x  -" $-"x -" -"x  ." $."x ." ."x 5 /" 5$/"x /" /"D$@P1(^_[]ÐS[ D$1ɐȊt tT Tt t t4 uP1[ÐSV[ÊD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[ÀMD$$D$DD$@D$9\$6D$L$T$@jjPQjRNKqD$HPj &ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWF D$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPtD$0Pjt\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjptt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]#USWVd[U$|D$<$`0"hjD$@PI DŽ$@D$V=%$@8$u H$@D$$@UV,ljD$P]qt;uH WPsWPruD$WPrD$UV蹟ljD$$jPWq D$,u:|$$@PW#x$@L$,UV_D$l$0 t$\$UV?D$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V,1$xUm$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-[PQRc_h$DUt$@VJP j jW hjU} hj$Pf D$@hjPR D$<;$`u`d^_[]D$RWOD$tT$@PQhR譓l$ $ fffffSV[ÝD$ h`rƉP)Ɖ^[ÐUSWV[Xl$0ojD$PUl thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,]kōv2"4$t$L$QWPjbVt2"L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V2"2"2" 2" jQPR ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQP ;2"2"2" 2" jQPS ;2"2"2" 2" jQP  Ƅ;2"jjt$ ^_[]fffffUSWVD[È|$\w x2t$`tD$@jPVT NjD$@9t8txD^_[]x8"u tr׶D$ɶD$ 軶D$D$諶D$<D$8wD$X$2a$WQjP艏0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[Þjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Njjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[îjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[Xl$hUEƉD$ D$PljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$4D$ tKWV(tD(1t$t$ wUnT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[Øt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[þjt$t$t$@[ÐS[Îjt$t$t$[ÐS[^jt$t$t$[ÐS[.jt$ [ÐS[jt$ h[ÐS[jt$ H[ÐUSWV[ȇt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX/L$Q##wÍ#ÐUSWV [|$(l$$t$ D$4q?D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[^D$ hPt$K [ÐS[.ht$t$! [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[ÝD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[øWD$pML$LjPt$lv D$h|$df$D$VL$)L$D$PVW D$ |$$v=D$t$.D$lp8L$ QjjVV|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>VnV|$)Ƌ $PD$2PL$Q+  $ $,t=D$D$lp(t$ jjt$>VV|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VV;|$)v#Ƌ $PD$2PL$QU sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7L$R)уtuÐWVt$  r!̐cw^_fffffSWV[Qt$|$G@hjP \{j@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[N$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjVw h$$VVhVU< hV1;$u Ą^_[]輹USWV [HMl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_K$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX${L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQe $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]ffffffVT$tz tz$t Jt9t^þqwA BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBB,A tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[9|$ G$xom9}dMST$ x0} $-$tуM8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGG,H tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[;8D$81|$ 8l$tsEE tl}$t|hju(Ѓ twNjt$hjP }/G8G4?VUtGWu(U$E4-|E E(}$uM$v1^_[]ÐS[N7t$t$jt$[ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ř6$D$l'~ '~$x'^m'93e'KS'|$~ L"T$4"|$4ߍC??u @?@?D$V^G<$G@D$GD$,4D$\GpD$L$D$D$D$ GXD$XGtD$TD$PG\D$`$@D$dD$ T$D$\$(\$8|$T$l$$#~B E L$  $ɋ\$#Qt$>L$ y#t$V$t$ӋL$ uL$ Z $#T$2t$Y $#T$B$T$\$ËD$ T$ L$ $\$L$ \$5B$L$ |$ $"L$L$ X\$T$T$ ōA|$"ˋ|$WET$WK"|$WET$OY|$T$",$L$AL$\$Ël$$L$5\$ ـl$ $!T$2t$s "$T$rt$ލKw,!$T$rt$ލK T$$ L$ Q$W!T$2t$Y $!T$B$T$\$ÃD$ T$ J`BlL$9ȋ $\$ S $L$L\$ ׺)¹)t3L$|$l$$\$;D$rZL $ӋT$(CDL$4L$4T$(CH?L$ B JD$|$ \$ $Qt$>L$ AY $t$~D$ H@ $t$~D$ H ҋ|$t$V$t$ӃD$ J \$ D$L$ $\$VL$)L$  FlFF?1D$ |$L$FdVhD$H‰T$@9VPNX֋$D$t$|$;D$ r؉,$ыt$t$)ЃJL$ 9ȋ $s0t$>t$|$l$$;D$ rЉ $ыt$)ЅaL$TYrt$D$ |$`JL$ 9s(t$>t$|$;D$ r؉,$ыt$ t$)Ѓ1҉D$ |$l$$;D$@A΃t!|$T,_1fT}9u)ދ|$D$rfTXtfTXvfTXxsfTXzupl$D$D$ $L$L$#|$|$l$$\$;$r;L$$b%$FD$Q?\$,$͉ $Ct$ʿ $#|${H|$)t$$ډ|$D$ |$$D$L?L$(D$8)ȋZH)v;J0v'tx%/D$4)؉ӋRD׋L$(+B4)v B,)B8)B8ΉӋRD9֋L$(w9w)SD|$t,1L$4899uL$4T$)\$L$(|$ra1L$401\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$4\$L$(+L$L$(ڃ{Dt$L$ KL$H?$ 3\$Gl$$$$T$$ً$T$\$ZuKL$ \$;$L$ \$T$D$$L$T$$$T$L$9D$BDBB?D$ $D$C?BDt\Ӌ$9wD$(9w΅Vt$t$fL}tT$;D$ $|$$b\$ w\$ { $T$L$L$ڋl$덉\$ $FL$Q?T$ B$t $L$t3B t-f\$hD$hjPD$40isL$$T$ \$,$6?11ۅL$ L$L$ $D$Ӊ\$D$PL$ ,$A|$ˋ|$WET$WKf|$WET$O|$T$}L$AL$\$Él$$T$D$wL$ApATA\AdDAtt$Pt$dt$TqhPj<D$ k 0%FL$Q?T$ T$t$$|$$T$tmuez(uB(jjjq L$,fD$hL$hjQPqT$ L$,L$5?D$D$ rL$ J$tA0\$t i{=B $t$$D$ T$b t$$L$ |$$L$(T$8)VL$Q L$tJtF\$L$4)ыD$x@t RQPpRQP`x L$AF0I L$\$tT$zt 1D$ L$(L$8D$T$#;JB1D$ L$(L$8D$L$O?zL$|$  $Qt$>L$ As~$t$~D$ Hw`&$t$~D$ Hw7ҋ|$t$V$t$ӃD$ t$$D$ t$$L$ |$$T$1D$3;Z *\$%FL$Q? \$%FL$Q?D$(D$8 L$l$$|$T$\$$B$tXBL$t/B t)\$hD$hjPD$40nL$$T$ \$,7?11ۋ$\$ $D$$\$\$Ӄs3\$|$A$L$AL$\$ D$D$$T$\$B$tT$ʉHP T$Bt0B t*D$fD$hD$hjPD$40mT$ L$,B8?B1۹D$D$$u"$B$L$ t@L$D$\$ $D$$\$ \$ӍPs3|$ \$D $D$PD$؋\$T$D$ T$$ZDJ$tY1D$uD$ L$>B L$t,f\$hD$hjPD$40lL$$T$ \$,1D$ 9?D$BBD $9wƅыz$tL$ \$YsCҋ|$_ t$V,$t$\$ӋL$ $l$$T$ t$$ً|$$l$$T$\$B u11ՉډˋL$, 9uY11ɉ|$L$ \$J$t A,A0jjj i L$,F0L$??T$ \$ T$T$FL$Q?|$ D$ D$G?$T$- D$H?<$L$(D$4F ND$$FD$BL$ #|$0D$D9rщD$0L$ oD$0t$,$ʋD$ ȈL$@D$Dɉ\$fD$<ȃ|$D$?D$D$ zjjjlT$ L$,F0D$??|$dzt+\$ ـD$\$ L$N?D$ L$ \$w: $`D$ D$ $L$L$L$ ӋT$L$؃BL$ t>tCuH\$t$L$\$ T$BG?$u8D$A?D$D?h$FD$Q?D$L$L$ \$L$ L$ *$T$B$T$D$؃ X$$D$ '$$NL$Q?D$|$ڋ t$$$NL$Q?D$ |$T$ x~|$$D$ ЋL$щL$$D$ D$ l$$|$T$UD$ L$<͉l$$D$ D$ l$$D$ ȉʋL$щL$$D$ D$ |$$$D$ |$$\$$ыL$щL$:D$ $D$ D$)D$ $L$@ˉ\$$D$ D$ l$$|$$T$d$D$ D$ |$$T$l$$=ًD$ 1\$P?L$D$ t$$D$ D$ l$$$T$|$L$ \D$4F D$(FD$$FD$B?t ^>?u(jjjRb t$WPDb ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[h L$(D$y y$Q9 $JsD$(xu$z@VS?t$u$plL$( $BS?zUP4)r*9w $с4JPMT)с4JT$Mp) 4Bpt$tu0u8V辤T$ r8W1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXUD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$t+D$PtD$ff|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,t‰ЉT$P9rD$L$hT$Z)|$)|$L|$|$@)|$)|$D|$|$H)|$)|$d|$ |$\)m|$")^|$X|$$|$<)G|$&)8|$8|$(|$`)!|$*)|$ |$,|$4))$D$0t L$0 $fD$nf\$pL$LfT$rD$@fL$tL$DfD$vD$HfL$xL$dfD$zD$\fL$|L$XfD$~D$<f$L$8f$D$`f$L$ f$D$4f$f$$t-1upt!LEtTLlzf|Ll$fQ$L$D$<D$TD$8D$4 ك19tTEt|Tl_f\Tl$$fzTEt|Tl_f\Tl$P$f~뤸|$ 0D$<D$*L$4D$8D$TD$0>|$ D$0D$<D$L$4nD$8D$TL$(D$TD$8D$4D$<D$0FD$`ʋ$D$XD$@D$D1T$\D$ D$d|$T$PL$@t$HЋ\$D)؉$$L$@?? u)D$(F%L$(b%É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃdžl$l$T$ y_V8Vt\$U%FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+`D$T$t01tI ^_Átփ*tWVZ­t$ t=~ t7~$t1Nt*91u&q~ǃ8wDT$1t ^_Át*tUSWV _8L$ y y$q9NQǃ8|$(|$$N9l$(4$Jى\$!4$f ؉\$V_AL$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8 D$(t wNjT$,x9L$u*@$D$ @$;L$t (9z4&G,OL WDqL$ $t$ 1fj94$J)r=* jU L$T$4}Gl+G\Gt0GDOLfDHɃQjP8 1)t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$sT$,n$1 fti9,$tQTi)rftiTi)rftiTi)rftiTi)r뢋T$,LJL$IG|1USWV[ø|$$ $w9>NQǃ8wHl$(e tWt?t u(t#IO5t*t#F(n(~taV<NG9wͅt2Uvw } o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj4 G0FqoUO;,$Eo9wŅt0UD$pw | o $ho)o)hu $AA~Nl$(9jjj, G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0% G0F FEh1҃ҍ,j1҃ҍB9 l$(@G; FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoUk8,$Eo9wŅt0UD$pw 5y o $ho)o)hu $AA~5 Nl$("ԑFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQx F NFy,t)vNPQw0# G0$F oUw7l$Eo9wŅt2UD$pw @x o D$ho)o)hu L$AA~> l$+,$V 19> $ $F@F N $UPQwL$ nnFx,t)vNUQw0*# G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0" G0oU\6,$Eo9wŅt0UD$pw &w o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0" G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0! G0oUC5,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0 G0FgFx,FH;N v[oUj4,$Eo9wŅt0UD$pw 4u o $ho)o)hu $AA~41O0Vhn G1NVjnjjj% G0FqoU3,$Eo9wŅt0UD$pw t o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(V~tu"~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQV54 $FlF\iU^2l$E$ыj9wŅUD$pq s $i D$hi)i)hL$AAxl$(Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV2 $FlF\iUH0l$E$ыj9wŅ(UD$pq q $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVwuF(uaV;/~l$(džMN\hF8`jjjV,uFFDNLfDHɃQjP dž~tuFlF\džoU-MG9wͅt3Urw T$ nT$ o joG)G)juJJl$(1NG0NVjnG1NVjnG2NVjnG3NVjnGNVjnG NVjnG NVjnG NVjneF(1^_[]øV$nUV$*FVjn G0NVjn$NVjnoUx,,$Eo9wŅt0UD$pw Bm o $ho)o)hu $AAF~؉F1~;l$(HN\F81Vl)jRPV- $FlF\iU+l$E$ыj9wŅt5UD$pq l $i D$hi)i)hu L$AAxl$(~1Vl)jRPV- $FlF\iU:+l$E$ыj9wŅt5UD$pq k $i D$hi)i)hu L$AAxl$(1F(WVZt$ tR~ tL~$tFNt?91u;q~ǃ8w3`D$T$t$|$A|1^_Át΃*tUSWVP_JL$ ƃ9r\$ ƃΉ9ƹrt{ t{$t st9t9wʸrЃ^_[]Ë^kǃ8w6D $~1tGt&u81Ƀ~l<+*t΁uċ^ۉts{tt{q^0nPu1u,A ȉ9QN9w u$/,뛿kt }muk$t }mu{,f^S[Þt$ t$ 6[ÐUSWVXx$l$,]M U,T$9wL$t$0KL$]|$*{T$)Ul+U\KT$ щʁr9w׉;|$|$s,…ր<4T$9&11 ‹$T$RjjU&EMTEMtЋMUD MUd unUJ'E~9wDžt)$Wuv h ~ }~)~)}uEEL$ tFD$9l$,w΋EM8M\$VQp g Ep )ppu\D$)l$,D$t$0|MQ $P+Ex )xxWD$t$+sM,9U~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUuElE\~WGn9wŅ$Uwv ^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUuuElE\~WGn9wŅt)$Uwv n] n on)n)ouGGD$8xt1$^_[]ÐUSWVXH$l$(l$(ElEtEx}tw0$Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQU>mAlA\uVgF}9wDžt)$Wvu 5Y } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu W } ~})})~uFFD$(xy1)Ћ$jPQU+mAlA\uVTF}9wDžt)$Wvu "W } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X϶PÐUSWV^ƨL$4t;T$8\$0Ӄs3I͉у1&Ӊi913PƒT$4zR13PƒT$4zR13Pƒl$4M1ʉ3PxT$  1ϋL$ 3PÃ1ؐ\=13P\=13P9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3P3P3.P3P $3QP3P3P3P $3AP3P3P3PD$ $3A P3P3P3P|$D$ $3AP3P3PЉ3P|$|$ $L$l$11D$D$33P3P3P3P3W13P3P3P3P3G13P3P3PȋT$3P3W 1‰3P3P3P\$3P3_1ˋT$ )3P3P3PÉ3PϐÉ13PW13PW13PW13PW13PW13PW1Љ3PO13PRЃ^_[]ÐS[^t$t$t$ [ÐUSWVX(D$L$ \$  $),$9߿ʼnˉ$sRt҉L$P1ځ 1Յt1Qu1^_[]ÐUSWVXXD$L$ \$  $),$9߿ʼnˉ$sRt҉L$P1ځ 1Յt1Qu1^_[]ÐSWVL$t9T$t$1ہ 1ޅt1_u11^_[ÐUSWVX8D$T$(\$$ й$+,$9޾É$sMt։T$P1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]ÐUSWVX(D$T$(\$$ й$+,$9޾É$sMt։T$P1փށ 1t1эpu뎅ɽt9t$ |$1ځ 1ׅt1Uu11^_[]fUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[þt$t$t$ [ÐUSWV[ËD$ x_|$l$jhPt$(;T݉Ⱥqi)Ǎ)w B4vv 4v ^_[]ÐUSWV[ûD$ x_|$l$jhPt$(kS݉Ⱥqi)Ǎ)w B4vv 4v ^_[]fffffXÐÐXT$J r ,ù)ы,ÐS[~D$D$ P[ÐS[Nt$ '![ffX/L$ T $ h, | 0 |8 fǁǁǁ &fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_NjT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXHD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV[N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$PЬP` Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tk |OWrw ~OWrwfLJLJ^_[]11fTfEf6f 'uUSWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YrL$ 1 fщ;)t)T$l$L$ 1Ы\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +ȱ)9~P fHpnh1pXkh (f  fыt$r t$t$ Щ|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +<)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>Ыfr Щ f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[,t$xƅt|$7V?G sO ^_[ÐSV[݄t$ )tt$PV?F1$O O^[ÐUSWV[Èt$ԯtLƋ|$$l$ $P>D$PWU1 1uN(Vu N(^_[]ÐUSWV[|$GtE/D(U8]wUzt#V譡=yarau D$0VSN1^_[]ÐUSWV[{|$GtE/D(U\wUt#V-=tcidu D$0VӞM1^_[]ÐUSWV[L$A1t3)D(U6\NjD$pUtt D$82M0^_[]ÐUSWV[Ûl$M1tMuD1V[uVt(WJ=yarauD$8L W1^_[]ÐUSWV[+l$M1tMuD1Ve[uVt(Wڟ=tciduD$8UL W{1^_[]ÐSWV[ùPt$ t$ n. t6D$t7<$D8WZt$W!tD$ 01KK^_[SWV[9Pt$ t$ - tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"KKVq9K^_[ÐSWV[ÙPt$ t$ N- tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"JVћJ^_[ÐS[L$T$ jt$t$ [ÐUSWV[QƋl$$P;:D$PUWW, tgVfD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6I 4I8Vu 댅t D$ 01oI^_[]ÐS[~L$T$ htcidt$t$ [ffSV[Ý~t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[K~t$t$#_P=loobul$VEloob^_[]ÐSVP[}D$Pt&Pt$t$` D$VbD$1^[ÐSVP[Ü}t$t$Vt$t$` D$VD$1^[ÐSV[M}t$t$t$!^VP8^[ÐSV[}t$t$t$]VP9^[ÐSV[|t$t$t$]VPg9^[ÐSV[ý|t$t$t$]VP9^[ÐSV[Í|t$t$t$a]VP':^[ÐSV[]|t$t$t$1]VP7:^[ÐSV[-|t$t$t$]VP:^[ÐSV[{t$t$t$\VP:^[ÐSV[{t$t$t$\VPW;^[ÐSV[Ý{t$t$t$q\VP;^[ÐSV[m{t$t$t$A\VP;^[ÐSV[={t$t$t$\VP<^[ÐSV[ {t$t$t$[VPw<^[ÐSV[zt$t$t$[VP<^[ÐSV[ízt$t$t$[VP<^[ÐSV[}zt$t$t$Q[VP<^[ÐSV[Mzt$t$t$![VP=^[ÐSV[zt$t$t$ZVPg=^[ÐSV[yt$t$t$ZVP=^[ÐSV[ýyt$t$t$ZVP=^[ÐSVP[ÌyD$QP0t&Pt$t$\ D$VD$1^[ÐSVP[,yD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[xD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[lxD$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[ xt$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[ìwD$QP.t&Pt$t$Z D$VD$1^[ÐSVP[LwD$QP.t&Pt$t$IZ D$V輒D$1^[ÐSVP[vD$QP0.t&Pt$t$Y D$V\D$1^[ÐSVP[ÌvD$QP-t&Pt$t$Y D$VD$1^[ÐSVP[,vt$t$t-t&Pt$t$-Y D$V蠑D$1^[ÐSVP[uD$jP.t&Pt$t$X D$V@D$1^[ÐSVP[luD$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[ ujt$.t&Pt$t$X D$V肐D$1^[ÐSVP[ütjt$-t&Pt$t$W D$V2D$1^[ÐSVP[ltt$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[ tjt$-t&Pt$t$W D$V肏D$1^[ÐSVP[üsD$jP,t&Pt$t$V D$V0D$1^[ÐSVP[\sD$jPT,t&Pt$t$]V D$VЎD$1^[ÐSVP[rjt$+t&Pt$t$U D$VrD$1^[ÐSVP[ìrt$t$+t&Pt$t$U D$V D$1^[ÐSV[Mrt$t$%SP=gntsuVj!t L$1^[ÐSVP[qt$Ht&Pt$t$U D$VtD$1^[ÐSVP[ìqt$t&Pt$t$T D$V$D$1^[ÐSWV[\qt$t$4RP)=atadu,VImt|$L$tVl1^_[ÐSVP[pt$t$tkt&Pt$t$S D$V`D$1^[ÐSVP[Ìpt$t$jt&Pt$t$S D$VD$1^[ÐUSWV[+pt$t$QP=gntsu?VŃUTt$UPVi t D$8 W1^_[]ÐSV[íot$t$PPz=gntsuVt L$1^[ÐSVP[\ot$t&Pt$t$aR D$VԊD$1^[ÐSVP[ ot$xt&Pt$t$R D$V脊D$1^[fUSWV[ûnt$t${P舌=loobul$VbtEloob^_[]ÐSVP[\nD$Pvst&Pt$t${ D$V҉D$1^[ÐSVP[ nt$t$Vt$t$k{ D$V莉D$1^[ÐSVP[ümD$Prt"Pt$|D$V6D$1^[ÐSVP[lmt$t Vt$|D$VD$1^[ÐSV[-mt$t$t$zVP(^[ÐSV[lt$t$t$yVP(^[ÐSV[lt$t$t$yVPG)^[ÐSV[Ýlt$t$t$yVP)^[ÐSV[mlt$t$t$QyVP*^[ÐSV[=lt$t$t$!yVP*^[ÐSV[ lt$t$t$xVPw*^[ÐSV[kt$t$t$xVP*^[ÐSV[íkt$t$t$xVP7+^[ÐSV[}kt$t$t$axVP+^[ÐSV[Mkt$t$t$1xVP+^[ÐSV[kt$t$t$xVP+^[ÐSV[jt$t$t$wVPW,^[ÐSV[ýjt$t$t$wVP,^[ÐSV[Íjt$t$t$qwVP,^[ÐSV[]jt$t$t$AwVP,^[ÐSV[-jt$t$t$wVP,^[ÐSV[it$t$t$vVPG-^[ÐSV[it$t$t$vVP-^[ÐSV[Ýit$t$t$vVP-^[ÐSVP[liD$QP t&Pt$t$v D$V܄D$1^[ÐSVP[ iD$QPP t"Pt$xD$V耄D$1^[ÐSVP[ìhD$QPt&Pt$t$u D$VD$1^[ÐSVP[LhD$QPt"Pt$]wD$VD$1^[ÐSVP[gD$QP1t&Pt$t$:u D$V]D$1^[ÐSVP[ÌgD$QPt"Pt$vD$VD$1^[SVP[JD$ @tt$P~[Í'y')&PQjtR SWV[ID$0Fu904"W~tW 6L4"VPJWFuFt PwVn1^_[ÐUSWV[kID$t$x t4hjWV m tUVjt WV$n1PVo^_[]ÐSV[HL$T$ 9t9r 1;q u4rpЅtItRP1^[ffUS[ÕHEM L$$D$e[]ÐUSWV [VHPQh\4"Wyx4"l$UVtPvcWM ^_[]Ét$W6j FthʼnPUc|$GEOM,$EVW|$Wt(PbV̀4$_p1l,$UW<9uVM(''PQhMR0 US[%GEM L$$D$e[]ÐUS[FEM L$$D$^e[]ÐUS[åFEM L$$D$e[]ÐSV[mFt$ 1t9u Va^[ËD$@$ÐWVY-FT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ~EL$1t91t^1^ËAQ^ÐVZ>EL$1t91t^1^ËAQ^ÐVZDL$1t91t^1^ËAQ^ÐVZ¾DL$1t91t^1^ËAQ^ÐSVPY|DD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYCD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY\CD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYBD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y?BD$t9u@H@ty1ËT$ BÐSVPYAD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYlAD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY@D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYL@D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y?D$t9u@H@ty1ËT$ BÐSVPY|?D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY>D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYm>D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY >D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX=T$t9uBJBuy1ËT$JÐSVYm=D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY =D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY;D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX;T$t9uBJBuy1ËT$JÐS[^;D$t9u L$ t9t1[QP*Y[ÐVY;D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY:D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY~:D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY.:D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [9u t1D$D$ D$~N~(DN+t 0tV-usD$WPv% T$ D$1ɿ98"yxuD$j\D$WPvK% T$ D$D$9T$rF=8"u<3WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[.8\4"jP5qx4"PQ_1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ 7D$0x4"VPVӰ1^[ÐUSWV [6t$4NswD$8t}(@ta@uppQj WWjUVEZ tWVWWt UVI[1 ^_[]Í1(('PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[þ5PQq\4"Pn[ÐS[~5\4"Pn[fD$w sÐS[.5D$ ;D$uPt$t$k{ [1[ÐUSWV[4D$ t$tPkD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPy 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í(((PQhR3USWV ](2D$ \$$p1}<"$N<\u< $1ۃރSTH$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ )((PQhR USWV0[-$Du wj0*11<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w,$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉pU)D$[)D$Ews 搐<<}jt$W) tfjt$W tSj)jPW E $AEtLt@<-Eu<-u}>u$h\t u94$ޣ10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$URD$m$hōd)D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[Þ&jt$ [ÐUSWV[u&$j$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjUYtjVU_^ |$t'jjjhjt$P角|$t-$U~jWU^ WUkTVUkCS[>%jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[#j@%ƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[Y#t3Pjbtjj@蕌DžuU Oj@z1t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[è"t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[Z |$oU[1tIp9u?$jjJt,< HWs;~$9uG~tL$7PUrV`0bUSWV ։L$[Ò|$ *?u-wG"}MG]jjWU -o)jPwwt,ut$$ujPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'ujPWX t4jjWG t#t1t$$U. ^_[]Ím-K-t)PQhRS[þPt$ [ÐS[Îjt$t$T; [ÐS[^Pt$ [ÐUSWV[+t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct( *)t)PQhjRwQ^GP5LWI1^_[]É.))t)PQhhR(0)t)PQhyR x*)t)PQhRS[L$A4tPQ4I,Dt*Pa,[Í**t)PQhRx**t)PQhRnUSWV,[XD$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jjтtt$ < At$DVL$*L$ql$$9.|$FWUP j~nDžt!PW> Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Umt^Ut$D$PJ U;1$D$jmt"WPt$ED$E E^_[]ÐZL$1t 9tËA ÐZL$1t 9tËAÐSV[íT$ t19 uL$t r ;t$v1^[ËR1ttVRQC ᐐUSWVP[JD$1t 9t ^_[]ËHh t( $tDUtlt؉Ut$P֠ ąt.--PQhR*.--PQhRZŸL$1t 9tËAÐS[nD$t9u L$ t9t1[QP: [ÐSV[-L$ t 9t1^[ËT$19Q ut$tRVqNH ֐USWV [t$(>t~(t  ^_[]ËFMjQvPgt҃~$tD$jPv p ʼn$u 8"tD$N N$9u8"t=h.Q.-PQhR'1jPj N,$Ujj7ǍFPD$PU tcD$;$uZFejPV tD|$u Wz1,$jjƅt-PVF~n W]zt WKzD$$0USWV[Hy1D$4$G=w ՍjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[mD$0FuFt P6xV-x1^[ÐUSWV[(l$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í1(t.-PQjtRzSV[mL$t$ 9t8V 1;Q u.FtRqPA 1uyu"^[Í..-PQhR..-PQhRؾffffSV[PQ6|$ u4"4"V^[ÐSV[}t$ 1t9u V^[YOD$t 9t1ÀxÐYD$t 9t1ÀxÐS[D$t9u L$ t9t1[QP[ÐSWV[ìt$~uo~(tijPvvMt4"!jPvv*t14"|$PQf5V7^_[ÍA/*/.PQhRSV[4"VPƃ4"4"VPƃ4"1^[Ð1ÐS[ÞD$L$ yt0@QP`[ÐVZ^L$1t91u T$ t92t^19^ffffSWV[j@taƅtEPWV4>jP2F,F0F4F8F<^_[ÐUSWVP[èt3Pjjtrj@`DžuUXqWj@`1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tvP9uloU1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[ê*։ $|$?uwG8]u<GcjjWr tCF jPwwt,t1LjjPUt$t1U^_[]Í_2B2/PQhRRS[pPt$ þ[ÐS[îjt$t$t [ÐS[~pPt$ [ÐUSWV[Kt$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%e040/PQjmR迯QeGP}&We1^_[]É.E040/PQjkRs040/PQj|RWS[ND$H4tH4[Í00/PQhRUSWV[D$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jj]tAD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð1(F43PQhRŠSWV[üt$~ t 1j Vt ;~ r^_[ÐSWV[||$t$t0t*PVtuj Vm^_[1SWV[t$F|$uLPVujVm1^_[Í1(j43PQh$RSWV[t$F|$uEPVtiu]jV}1^_[Í1(43PQhERUSWV[ t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í1(43PQhdR補USWVP[ÚD$1ɅQh Dt$7jA1Ƀ#hA$GGG wtHt$WՃj W=tjW$$<4PWtiu千a5PQWq tDj Wt5D$h VPW`tj WZ7,QW#Q $ȃ^_[]ÐUSWV [$($$WtEP舑x=ŋ$$t$t`?t[Wet.H|/t+1]$,9/;9sfD$ .t$ VH r̠?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ 8t$h t U 8ܟ8VAO̟8$ ^_[]É,$9tG9t iy/t)rD$ UWPr D, ,$S[jt$t$ [ÐS[Þjt$ [ÐfffffD$ǀǀÐUSWV[KT$$L$ |$l$t$u2j=tUhxL$ H L$$H*s3uFˉ,|\T ^_[]155}5PQjAR螗55}5PQjBR肗USWV[{T$t]D$ |$L$tKutUtMtM L$$tEULL1Ht t L t L |$$t L2 ^_[]Í-66}5PQjZR蘖ffffUSWV[ÈD$8t|$4D$0u`HL$HL$HL$H L$H L$H $x p PHbl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Xt$@|$[fffffS[t$t$jt$t$t$8>[fS[t$t$jt$t$t$(>[fYXZQ̀QQrS[ót[fffffffS[Ît$t$t$t$[ffffS[^t$t$t$r? [ffffffS[.1;D$[ÐS[1;D$I[S[88t j衏1[ÐS[î88t jq1[ÐS[~88t jA1[ÐS[N88t j1[ÐS[88t j1[ÐS[88t j豎1[ÐS[þ88t j聎1[ÐS[Î88t jQ1[ÐS[^88t j!1[ÐS[.88t j1[ÐUSWVX4"?) R44"ѐ>t1 @u~1ɍ4">t 9u#;T$t$9[ÐS[88t j-[ÐS[jLS[88t j葋1[ÐL$1;L$Ð1ÐffffffSWVP[{|$t$t<$PhvtV"o^_[Í6L6PQj;R߆fffffSVP[t$t1Phwt@Vn $tЅy^[Í66PQj;RkfffSWVP[ë|$t$t3tRtu$F$=<76PQj:Ru$PhtVm ^_[ffffffSV[ t$ tjh^t Vm ^[ÍS77PQj8RzffSWV[üt$|$t w(w$1^_[Í{P7\7PQj7R-ffffSWV[lt$|$t w(1^_[Í{P77PQj7RfffffSWV[t$|$t w$1^_[Í{P+87PQj7R萄fffffSV[Ϳt$ t$&ff g#F F^[Í{Ps888PQj;R*ffSV[mt$ tF(^[Í{P8~8PQj7RfSV[-t$ tF$^[Í{P98PQj7R訃fSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[>7"Pt$t$j [fffffSWV[ t$T$(с wdp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[Í#J9׍9PQj9R[USWV [Øt$ ejVy<$A1jt$V= Ƌ4}<|$l#D$,D$ltBL$4$t$$Uw u͋$|=uU<C9l$}q)t"uDur;MDMDMD MD9uA1 ^_[]Íin9R9PQj>RwffffUSWV[$ÑL$(soL$,l)L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$L$(W;t$0QUjRV/3?Utq0$l$TW;jP141ɅjWjjWj聂 jUjt }|$T l$TjVt$ T u'8t$jWj jUj jD$pPjC $ȁ^_[]S[^L$T$ hPt$ [ÐUSWV(T$ ["L$<\$%t$@|$t;D$<|$"v+f1t$ \$VP]n\$u<+t<-t D$1 1ҊD$L$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj=S[ίL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Ät3T$8tOl$@to:VPt$DR*::w:PQhRs멍::Սw:PQhRs뉍::w:PQhRsT$HkXODH@uyD$ j PW $T$x8"u,x"x03BUPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ);WVPQt$H蛎11҃^_[]Ë$T$|$(9ыl$,};|$09Njl$4}6;UWRPVQt$Tt$TD 맋L$8fffYOi mNA90 %ÐXL$ ffffUSWV0X$t$DL$H|$PL$%1|$L$WD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$G T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ 1$cp0^_[]Ë$;;T;PQhR^j$;;T;PQhR4jL$XUSWV0Xh$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU@ T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$Ub1$i0^_[]Ë$;;T;PQhRcL$XffUSWV<[l$X|$Tb D$\}  |$T  D$u D$4tǃǃT$PT$$9L$$pT$,mT$0\$|$ <$D$(\$ǃ|$ l$XL$1L$uHD$4;L$$D$T4>-u FD$,t$0E<+<-~L$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VgRD$\(pD$D$ 1T$ $ $.T$tf\$QURS uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:DRQP" \$+L$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:t]RQP蠆 1L$\|1uD1 <-t<+::BtD8tD$X8:tRPA?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP莅1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8pD8t}:tѻ4$P $E<-t<+u:}:1<: :<<;PQh_R-Yw(<<;PQh`RYD$l]#<<;PQhaRX|$T;<8<;PQhRX(<8<;PQhRX=PQj4RJQŐSV[Ít$ tjjjV/^[Í>=PQjARPfffSWV[<|$t$t1hPWV/^_[Í]>'>PQj6RPfffSV[݋t$ tjjjjVܐt^[Í>>d>PQj0RDPfffffffS[~t$j t$t$P[fffffUSWV[Kt$|$tBjW/~G0t ujW0^_[]Í>>PQj/RO띐USWV[ˊt$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H T1^_[]ÐUSWV[Hj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$vtPQj;RjLu*?"?֍>PQjD$D$D$ t$5x9<~(d@|@P>FFHQNF )PQj,,^[ÐXσL$x9<~(Íd@Í|@fffffffUSWV8[ÈL$Xl$Pt$LD$4ut |$Tu%AVP?KAVPr?qAVPZ?AVPB?AVP*?AVP?AVP>BVP>;BVP>tZBVP>fBVP>XBVP>JBVPj>9BVPR>BVP:>q*CVP">`WCVP >O` t9uuh/l$t'j2pU0 AQP { t@@@PQhRPEL$h@F@@@PQhRE l$rPQj2UbU:ƋD$XtPUt$\ ;D$4u 8^_[]YffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[~|$t$t2F)F31uF FF^_[ÍCCCPQjYRGC뭐SWV[Ì~|$t$tg~uP\$wGN QtCDCPQhR.B~uр~|$^[ÐSV[M}t$ t ~t/FCDCPQhRA~uN .wu^[ÐSV[|t$ t41~t^[ÊV u.wL$~9|ԍC3DCPQhR'A먐SV[m|t$ t~t0^[ÍCHDCPQhR@~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[{|$t$t@1u6T$L$9w"QjVRB FfFF^_[ÍC^DCPQh.R@뜐SWV[L{t$t>~u/L$Fy |y|9IL |F1^_[ÍCnDCPQhMR?랐USWV[zt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍD}DCPQhhRQ>D}DCPQhiR'>SV[]yt$ t"~uDNu;V9r1-CDCPQhR=~t^[ÐSV[xt$ t31~u(NuV9rT$x 9v ^[ÍCDCPQhR8=fSV[}xt$ 9y ^[ÍEEDPQjTR<אUSWV[+xt$|$t.l$tGMϸwG)o >1^_[]ÍC*EDPQjbRz<뱍=E*EDPQjcRY<또USWV Xw$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ=D$0 28t p׾$VPU 7+D$p)t5u+VQA$RjP= 7D$)smH1 ^_[]Ë$CKE֍DPQhR:D$4$`EKE֍DPQhR:g$nE΍KEDPQhRa:D$a$[FL$GFՍDPQhR+:L$USWV[Xul$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQy; D$ }+$x)t6u,WQARjP,; l$}<$)s8O^_[]ÍCE֍DPQhR8nE͍EDPQhR8렍[FL$GFՍDPQhRv8L$;SWV[ìst$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9CEDPQhRz76EEDPQhRP7)뒐SWV[Ìrt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1CEDPQhWR76EEDPQhXR 6VL$t"T$ tփuQ^ÐUSWVP[ q|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP 7 D$$L$(l$0O}^_[]ÍEE$DPQhR4T$L$8D$4VUFEՍDPQhRo4\SWV[ìo|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[,ot$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [n|$$D$(t9D$ L$,ň̍;FL$1FL$D $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[ mt$|$D$VPt$  ^_[ffffffS[ljjt$t$t$t$[ffS[Þljt$ t$ t$ t$ t$ t$ [ÐUSWV[UlD$$$$$ $$$f'kt$pPQj VMD$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6)t&6P(UPVQ[ D$@t%7"hPV $0$$ڥ>PQ#tO9xuJP$ $$6`L$U$$$t$ (D$;$?Ĕ^_[]ÍFFxFPQjiR.$FFxFPQjjR.$FFxFPQjkR.FxFPQjlRs.ƍF IxFPQhzRJ.D$F IxFPQh{R.D$(ƍ IxFPQh|R-zI$T$@PhQRW<$D$Pjjj:tD$PjjjxkD$Exit$蓜t t$ 胜jjW&| t$ IIWPQX I1I I@IPQt$ jt$xjjy IIIPQej 1t$›ujjx*jt$~xt$莛t$ 肛y IRIu^$puS*P$0#uP$$#u6$@$8jA0$ IbIpQRj/VtDžtwjPQ ĩ$t$u5ggj$$2$PQWV ^j$$1$PWVf8W;j/Vtsoj$PQV, IrIVPQ j+/USWVh[eE$dL$$|$$t$.D$LD$PD$TD$HL$8D$HQPj l$$D$ HD$$D$ D$l$%=HPymjuD$PQ Džx|$ ]$$juD$P D$jPRrt$t$X4$PjVDVPVWn V9a|$(fD$,t$t$0fD$4F-D$(jjP肕 ~ D$64-8HPpjPWؓ $l$$|VPVW诓 $VPVW葓 $VPVWs t$XjVW裔 u2|$X;jVW臔 u+jVj5 |$X uL$1P'<$$0|tHPt$D$PD$dPVl VA$(D$a<t<jjD$`Pjjt$(D$xPbuD$XP%=HP"Ql$<$7HPQV誔l$W蝔D$8jPjg E;$d-h^_[]ÍHP$먋D$p*0 PVQRFl$yH HxFPQhR$;F HxFPQhR$#ǍF HxFPQhR_$F HxFPQhR6$ HxFPQhR$S[N_jt$ t$ t$ t$ t$ t$ [ÐUSWVH[_D$D|$\,|$dND$l|$hfl$tt$`fƍ'kt$$PQj V@D$D$D$D$D$ l$D$ D$L$PQVt$h6^t#6PUPVQnN Tl$p $At"8"hPV D$\0t$\ $Ut$pt$pt$p4$s;D$DH^_[]ÍFFxFPQhRK"|$dFFxFPQhR"ƍFFxFPQhR!oFxFPQhR!XoSV[\t$ tjjV` ^[ÍFFxFPQhRk!̐S[î\jt$t$ [ÐUSWV[u\$E$$$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ ǸxVtuTfD$D$PWL,$D$f$%/,$$ffD$UD$PW  yQ%80uN$=uW%#,z%,$(Wߎg%(,$WƎ,$M;$u2Ĉ^_[]ÍFFxFPQh REHUSWV$[xZl$@t$8|$DD$ D$D$D$D$D$D$D$ L$PQRVuT<$t6t$t4$$$WPVE@)$$PhQR$莿K$@l$$hp V iGhPVq Y3D$$p C$p 0m$puPV=tbōD$ PV聝x\#D$=uXUTL$ QP&xED$$t $;Au=D$G0=OrG1CGGG9"U+WBt$Vl$E;$ļ^_[]$$$$U똍JG>GxFPQhR ƍ"G>GxFPQhRq0G>GxFPQhRY[USWV[UD$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[eU$D$$D$hP1$S$k$$UhhWDD$ D$$GƄ4$$$UhhWDj W[t$X8D$1$0U t u뜐44 w$D|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&P$@|$L$ t$֋$^D$PjL$Q$&P覶D$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP+JtD$Hɋ$@tD$$L$Q$jP荵؅$U$ 1$$׋$$Pu\~$P$' 1u7Yu,N$P$ t/t u $Uhh$$WA@11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύGGxFPQhR^0GGxFPQhR7n"GGxFPQhRV賻USWV[HOD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[];USWV4Չ[ND$$0qƃ9"9"Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/u9"IPRQjl14$ D$;$0u4ȁ4^_[]ÍJGIxFPQhRh^USWV0։[L$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$P uo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1P; E;$,ue0^_[]ÍJG~IxFPQhR$TI~IxFPQhRx肷fUSWV[K|$,D$(/D$wl$GQjP G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=ȼ݋t$|$<$$t$&$$1 $+L$ r#J΍JIPQj`R1D$,H$$t$,F $)ʃr#7JJIPQj}R F$)N)!r s.^_[]ÍKGJIPQjCR ]JJ׍IPQhRa 몐USWV [ØHt$ ~Nƃ,>"V҉$t`L$FшT$?r?鍋="$j@UPQP\$+="~t0|$>L$:$u ="uL$>͍ >T$1ҍ,>"-9si$:GU;L$s>t 9sE.9r9s34$Gh9s맋 $,>"9s$=" ^_[]fffffUSWV[;Gt$|$lUl8PPWVGUL^_[]fSWV[Ft$ W!PPV- W^_[ffffUSWV[ØFt$tLD$F$V~nF->"PUWRt$t$QjV&($^_[]ÍJzJPQj3R 듐USWV[F|$,L$T$ |$l$捃JUWRQL$QVPt$H 1uA$L$?>"?>"@>"L$A>"L$ B>"L$C>"L$D>"^_[]ÍJzJPQjBR [USWVH[8El$`D$ D$D|$\SrE$MUu}mJUWVRQt$PjD$JP&$$u KPQ+jjjjP&qƍ0V\jjjjWpƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV'${D$L$ D$D$D$?D$D$@D$D$AD$H>"ffffffUSWV[>t$,l$(D$tjuj!TƅtRUP8K1 F LFuF ;D$u6^_[]1ꍃKKOKPQj4Rur辩USWVp[E=$E$l D$P1Ahh@Vo 1lj,$t$\hVWo Ņ~UVD$ POA 50Wp%0,$xj$uj!ƅth$\L$QPI1\F LFuF E;$lu5p^_[]1㍃KKOKPQjNRGUSWVl[;$D$h$U?$$U@ uj!ƅtXD$XUPH1LXF LFuF ;D$hu2l^_[]1ꍃKKOKPQjhRJQS[:t$ t$ [ÐS[:t$ t$ [ÐSV[í:KM>"jPVm D$ jVPjZ^[fD$ȉty!fUSWV[8:t$0l$,D$tjuj)tƅtRUP1 F LFuF(;D$u6^_[]1ꍃK LKPQjFR?urޥUSWV[e9$ $$P'h@Vl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$k ƅ~.V$P$P |) u84$l8|$$uj)fƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1ؤãS[^7jjjjt$t$[ÐUSWVt[(7$D$p$U$$U= uj)9ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃKLKPQhRG螢fffffffUSWV\[(6|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍLLLPQhRLLLPQhR$HffffUSWV["t$0l$,D$tjuj)ƅtRUP1 F LFuF(;D$u6^_[]1ꍃK MLPQjFRur~USWV["$ $$Ph@VT1$|$$ $ u#D$P|$WrP|$`l$d$$ʃ|&jQPt$ I|=P$Pt$S ƅ~.V$P$P` |) uS84$TA8|$$uj)ƅ~$$QP1F LFuF(4$W T|$;$u^_[]1xcS[jjjjt$t$[ÐUSWVt[$D$p$U$$U uj)وƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃKMLPQhRG>fffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Êt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP謻 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [Ø|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWr ;D$u ^_[]sfffffL$$Yai qyD$A(tQS[hRjj#9 [1ÐT$D$ Zbj rz $z(t RPS[jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÃRjj>8 [1ÐT$D$ Zbj rz $RPS[>jRj7 [Xt@ffffffSP[ D$ L$T$$RQPo[fffS[jjt$jT7[fffffffS[îjt$t$jb|[ÐS[~ht$t$j/|[fffffUSWV [Ht$ D$D$$|$jjUVjW61D$D$ $jjUPjWD$D$$jjUPjWȕD$D$$jjUWjP菕u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR1u ^_[]ÃtOw OsҍHinWM$MPQj"hVt$ t N81^_[ffUSWVh[ó} `B"uj'N\`B"D$PjI`B"L$@B1lj1L$ED$$1Mt$ƉqD$Pjxx`B"L$@B1lj1L$EHD$$1t$ƋEp jPwu(`B"L$@B1lj14$e^_[]ÍMMPQjHR%`B"USWV[Xl$zjPUw u @t tQUuMjPUPw t 1^_[]ÍujPV+w DžtjPVw 1uú!?E1u<-ut<+uXMDHt$}D$j PWb L$9e9$YQH}+t؍ ߃/Љ(!ffffVZL$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[it$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVZ ^_[fffffffSWVP[ût$tBdB"PQhRjx>L$ $dB")QVWRdB"PQhR(dB"dJ"t@dJ"^_[fffUSWV[ t$D$D$I@t NQw Xى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]ÍNNMPQjbRUSWVX[øD$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í.N'NMPQhtRSWV[Y|$t$t5$D$ WVjjjPS1Ƀىȃ^_[ÍinNHNPQj:R衶ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tDP) ukt4)puD$(8rl$ ugPt$Yŋ$t$b0?uD$8tDP(W.i4$&#t$#袹01UPt$ŋD$G6"oD$ G hJ"hJ"D$8tDP(G^_[]ÍNNPQhRPNNPQhR&T$(#l)soÑW;jUPQRVjeUSWV׉L$["2jeVj+Vt-1|$WjPj%eyFu<$|$1jrV聙tP` $UW`ft1jVu%07\!wQ!ٷ01^_[]ÐUSWV׉[7hJ"tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[Øt$0l$$AT$0818D$8tDP%gt/D$08rL$ ubPt$ŋ$t$]耶0D$8tDP9%We4$t$A01UPt$葢ŋD$G6oD$ G hJ"hJ"D$8tDP$G^_[]ÍNNPQhRNNPQhRůt$,|$(T$0VWU jUSWV[t$8$8tDP#hJ"t9ut>mt9uu+$8tDP#h1V蟤EuhJ"$8tDPy#|$jWu ƃu 膴8tUctt$^_[]ÍNNNPQhRvfffffffUSWVH[èD$`|$\t$$UVPWLtUVt$aǃu.ֳ8ujD~;$} VPaǍD$9tLV cA$jD$P2\t&UPt$hW L{D$$oH^_[]Éƍ(OONPQj>RafffUSWV4[ØD$\l$HSt$XoL$`upt uJu.t덻<tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ tpbL$ Vb 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$ɟŃ|$jt$ RU謟|$tUjt$ RP蕟|$t>jt$ RP~l$t%jt$ RPetjt$ RPPT$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQ臞щ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP1Ɖр|$ul$э~O4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0p0ŞL$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$pL$,T$$ QO4$Qt$(V0WRUt$hm$[4$|$2jjdQUыT$,t$$r~O4$Rt$(QPVt$dVt$d 9wijt$ QR脜щ9|$}T$ 4$T$\jt$ QROщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\ijt$ QR輛D$ ы4$T$\B:.6OPQj8R辦D$lsO.6OPQj9R薦mfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í_PύOOPQhR}>USWV։[ñ$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ| D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í_POOPQhR謡[OOOPQhR股4OOOPQhR[USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVAuD$t @ t$?D$ h |$t$($iPXt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPA)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtP(Ot$FPOF^_[]ÍOOOPQhR襙USWVYT$tht$1BtBظkw+XtրztЃːt *u1^_[]ÐUSWV։[T]F,F tv蚞FUPSHl$~D$uNtQjP葚D$ L$$t$ F1퐐fPOPQhRuOPOPQhRKZ׉GP$ORQhpP!D$SWV[L|$t$tt676^_[Í# OPQhDR貖uʍP OPQhER茖릐USWV[D$$ $ $#$;df1fMHftf/t;$sXfyٺҐ$f/u*;$s!fE/Hf/tfu /fE<$91 GtALGt1LGt!LGt=u1B @uD$$PQXD$$PQR$1z$B t;$NQV$rrE/.f}/D$%=@=K1 GtfLGtVLGtFLGt6=u $$$VPV$+yB @uD$$PQD$$PQR($u,#D$=@u;$s#E/$B$PL$ ;$Ĉ^_[]ÍPPOPQhlR $PPOPQhmR_PPOPQhnRҒ$OPOPQhoR衒$n$t=tsAuE @u1$P4-$hPQ> E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YO4POPQhERM lt$10蔐D$/ Njt$$E @D$uPPUu G8t E u;$6Ĥ^_[]ÉNjt$몍PUPOPQhR$$PUPOPQhR|_PUPOPQhRӉ$c[PUPOPQhR襉OOUPOPQhR~7O4POPQhERWL$ OoPOPQh/R,L$0USWV[VT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍in΍OPQhRІyP΍OPQhR襆T$8P΍OPQhRsT$8ffUSWV[å$$c$$tu1D$$tŋD$3l$ vh@PD$(D$$D$ iL$L$\QPgtYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPzPWuk uhR)D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$PjPv u|$1D$Wt$0Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$PjPD$p =jPD$p D$ |$t$ztG$`L$tZPjPq@jPD$p /1ҋ$tPjPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8݄< „Y1D$ D$l$t)蠄D$D$\PjuU |$~8|$ $%|$tHQjPu> |$t&?D$u|$"8|$ $tt$Dtu V\t$jl$ U 1$u U63;$uEČ^_[]Ë|$|$[|PPPPQj_R}yQ%S[jhjt$t$t$[ÐSWV[üpJ"t-tJ"jhjVPt$$t8lJ"0jF3tJ"lJ"tP!pJ"u^_[ffUSWV[;|$|J"jjj |J"l$J"tUQxJ"ӟ |J"t]1i xJ"9J"wHt Q1 J"W!xJ"t$UWPx |J"u 1T$ Ɖ^_[]ÍBQ6QPPQjt$:.ƃJ"[fffffffUSWV8[u }D$D$L$$ԿjjPQjRFtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍQQRQPQjERy*QQRQPQjFRyffffUSWV [شQP3pt\ƀ8tUT$D$j PV tŋT$t|zt)QVP襤1ɿpkP&wA4@ܿʹ&/up@9~ $QjP,$QVPT$t$$D$ t RJ"RUPjQaL$ t>J" ^_[]ffSV[]J"u*ǃJ"uPV|J"ttJ"VP1^[ÐSV[ǃJ"J"tP9uPVJ"uVP 1^[ÐUSWV [u$ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"ǃJ"J"J"hhUD$ 1Ʌ$t$q N" PPQt$$q L$ jQPt$ q xNt$ PV$Vt" SPVVu 1  (O"Vwj:Pt$E^ t(O"l$i0UPt$v tL$N"UPt$v t D$O"UPt$gv t D$N" UPt$Dv t D$O"D$ PVt$o dt$ 8mPVirh{PVGrFPV/r9PVr,{PVqPVq PVqPVqPVqPVq$PVoq*PVWq+PV?q/PV'qYjPVqPVp.PVpHPVpcPVp5PVp cPVp;PVgpu qPVOpeX1DQXVVJUVt$s tD$1fN"5lptx|inRRPQjhR6Zme{P)SRPQhRY6.&)fN"t$ UPt$@r tD$ O"N"O" UPt$r tD$ O"O" O"UPt$q ftL$fO"FUPt$q ftL$fO"ӿUPt$q 1tL$fO"UPt$^q tL$fO"qUPt$4q tL$ O" UPt$ q tt$$O"UPt$p tL$\O"UPt$p tt$`O"fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&dO"aD$ `|$4$L$ qL$%L$)L$-L$1L$ L$5D$ PWt$p tD$ UD$,Pt$o tD$FUD$0Pt$o 1ɃtL$Nt+D$PD$4Pt$o t D$1vF UD$(Pt$o tD$ 1L$ F L$ D$ PD$(Pt$iL$ L$ t$L$ R1PQwkt0EuዃX 1DJtVut$F t$ H L$ L$ l$|$4]{P΍)SRPQhRUSD$ fZO"fD$4dxD$6D$50UWt$Mn 1tL$,O"D$51UWt$$n tL$0O"D$52UWt$m tL$4O"D$53UWt$m tL$8O"D$54UWt$m tt$jS1SPQj1RO̐T$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[ԉt[Ḯ̀rS[ôt[ḭ̀rS[Ôt[̀ffff̀ffff/̀ffff^̀rS[Dt[̀rS[$t[Ḥ̀rS[t[<̀rS[t[̀rS[Ĉt[ḇ̀rS[ät[̀rS[Ät[ḓ̀rS[dt[̀rS[Dt[`̀rS[$t[R̀rS[t[2̀rS[t[ḩ̀rS[ćt[P̀rS[ät[ḷ̀rS[Ät[Ḷ̀rS[dt[ḉ̀rS[Dt[̀rS[$t[Ḛ̀rS[t[̀rS[t[Ḩ̀rS[Ćt[1̀rS[ät[Ḍ̀rS[Ät[òrS[dt[ìrS[Dt[l̀rS[$t[t̀rS[t[s̀rS[t[r̀rS[ąt[p̀rS[ät[j̀rS[Ät[m̀rS[dt[̀rS[Dt[Z̀rS[$t[ ̀rS[t[!̀rS[t[S[΄t[ᐐ*̀r׋L$Q1fffffỲrJ!QS[~t[fffffS[^^KSV[=dX"tFlX" Pj?tslX"4+hX"4tX"pX"R! ^[ËhX"HlX" jjjhjPj1tȉdX"uj$Pj jLS[~D$lX");dX"t PF[à QP[ÐS[>jPNxX"uPj[ffffS[hPt$t$t$ [ÐUSWV@[uD$4$8M D$(D$0D$D$,\$<1UB|$D$D$ ^D$L$$RAt$yXDP@t$T$%7D$D$ OL$ۀU|$$ɋuL$ |$$1룐|$$|$ODH@uT$ EHhL$8D$D$8W;Pt$W ]D$xW;Pt$W^ FD$xW;Pt$W6 [D$x W^;Pt$W GD$xW6;Pt$W D$xW;Pt$W rD$xW:Pt$W bD$xW:Pt$Wn AD$x W:Pt$WF  D$x$Wn:Pt$W D$x(WF:Pt$W D$x,W:Pt$W 1D$D$\$T$ EHL$D$D$8W9Pt$Wo D$xW9Pt$WG %D$xWo9Pt$W :D$x WG9Pt$W &D$xW9Pt$W hD$xW8Pt$W QD$xW8Pt$W :1D$D$\$D$рD$ G H:D$/D$(҃ 46"T$(T$ Ѓ 9|$z D$|$GDA@ut$D$  N:D$/D$ 4 "T$T$ Ѓ |$ODH@u|$$t$ |$$D$D$L$:|$P|$Ѐ 7 O:D$/D$ 4d"T$T$ Ѓ dL$ pSKL$ yS|$ODHut$D$  N:D$/D$ 4<"T$T$ Ѓ +ot$D$  N:D$/D$ 4>"T$T$W ЃU >S|$D$ O:D$/D$  46"T$ T$ЃEt$ʀD$l AЍ~Ƀ 'w~N0rv:sqɍAAЍ~  'wNN0rF9wAɍAAЍ~  'wN0r9wɍAЃ='v1lMAD$ L$oEL$|$D$ O:D$/D$  4d"T$ T$Ѓt$T$ ʀD$ T$ w~AЍ~Ƀ nwVN0rN:sIɍAAЍ~  n0 N0T$ r9wɍAЃHmv1MAL$8t$D$ ;N:D$/D$ 4"T$T$Ѓ4|$Ѐ O:D$/D$ 4 "T$T$Ѓt$ʀD$ F:D$/D$  4 "T$T$ЃT$ ED$V1Pt$V D$V1D$Pt$VT 1ɿT$ ]D$IEt$1 \ЉD$8D$<Nt$ʀЀ ws119º !ɺ D$T$ы\$;L$ |FD$8t$ j\$SjWP S\$SjWP <\$D$ 0V!'D$PWV AD$ p\$V&D$PWV \$L$8|$D$L$8DHtXD$8\$P\$t?uF \$jPF$F(\$W\$|$y|$zn1 \$TiUB$J(-1 UB )iJ$\$hB(1UB \$1+1|$r$L$ B(D$t$D$L$ȃШ UJQi)1uB,i)\fиwi)\f1uN Vk4ȃ UD$(D$(uBL$D$JL$Bk<kQ)D$$kd)|$$< i)ƍv4A A$I2Ѝ4))΋|$(7$I7u э)ȃT$0 ))L$ȃFL$Ш<L$JQiҐL$)1uB,i)\fwi)\f1=‹E@k4<3ʃ;D} Ur+3(BD$BJL$tRu΋JQi)1uB,i)\fиwi)\f1UJk4JȃB Jkʁkʁk4QkdkiҐсk I4HH$I2ȍ )ȍ 0uNʉ)ʉVD$4;$8uD$e^_[]Ë\$ ffffffUSWV[Øft$,D$(yX"H9ttkHw d|$T$ H w ,ŀ,$HP x(@D$US =*SfF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эTQPUt$Wt$$t$t$(R|$,WVfG,9s1=SlQUt$ WRt$t$$P|$(WV5G(9r1T/8^_[]ÐS[.eyX"Pt$ s[ÐS,[dPt$UTTPQjIRH&USWV[Ëal$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[at$$|$(9jVPƿgLjVt$,# t$(<D$l$,L$ t-|$,RUT$rT$t .l$(RRl$(T$tX$|$  tQpT$ <$EFt PUF tT~tE1t(04F t((%F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]Í@9VVPQjKR[?eBV9VVPQjMR0?efffffffSWV[\Vt$W葏X"PVpWx^_[ÐSV[VVVX"PpV>^[ÐSWV[UWX"X"PQpW^_[fffffUSWV[ËUt$l$Vv]Vt$Z^1u<$Vt$2^DžtpU7t]wtуUPYt u막t$~utQ^_[]É1ԍinV[VPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsV2WVPQhR8W2W֍VPQhRUSWV [JL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$uc:t)2GWVPQhR_' ^_[]Ël$ u렍΍GWVPQhR΍GWVPQhR S[It$t$jt$ [ÐS[Hjt$jt$[ÐS[þHjt$t$t$[fffffUSWV[ËH Y"|$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉ$Y"uj(yƉDl$U̠twn$Nj 0Q輼 18Y"utjh=ܺʼn Y"0ƃ8Y"LȠtMjу$Y"@1t*n$FUQj PA)|$z^_[]Ë$Y")USWV[G(Y"|$i)Njtt+~%L$9N$ut1Ƀ|$tΉ,Y"uj( ƉDl$UԠtwn$Nj 0QL 1@Y"utjhlʼn(Y"0ƃ@Y"LРtMjу,Y"@1t*n$FUQj P'|$z^_[]Ë,Y")USWVP[êEl$U(Nj0Y"$tOs;1҉v3i=)Nj$,tu~EPt$t0$Y"tuR:Ƞt!jу$Y"tiE$S$Y"uj(蚭ŋ$,tIEj |$WP WؠtE@E$L$1E^_[]t$ؠt@ϐUSWVP[úCl$U8Nj4Y"$tOs;1҉vDY"ljhy4Y"$uƃDY"D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0,Y"tuR:Рt!jу,Y"tiE$S,Y"uj(誫ŋ$,tIEj |$WP WܠtE@E$L$1E^_[]t$ܠt@ϐUSWV[At$|$ tЋ Y"t61=tDtPTǃ Y"D$L$ƃ8Y"0Y"t?1=tDtPǃ0Y"D$L$ƃ/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[<t$tD$tdPV$xaa1ɐ΍,?UQt&UP$y.w8"tV^ 1^_[]ffffUSWV[K<t$VLY"P膥HY"ƃPY"X tj~V:u^tVtDi@u\uRDQ@u말:u~u'HY"t PSǃHY"ǃLY"1 ^_[]ÐUSWV[+;|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í:\\PQhR ]\\\PQhR6USWVP[*:|$t$t#l$ t?tajUjW^_[]Í:\\PQhR빍\\\PQhR]uin\\PQhR7xUSWVP[e9$L$d$p$l 2L$|$$h\$T$8u{HY"tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lhӡ$p $L$1xjjjU |$ `x]PQhl$XUjjjh@Ujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$in]\PQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP*T$ )ʼnl$‰$L$\$(l$$|$ t t$it$,D$l$ tEF4$=hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$q؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUէ5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP辠 Wt$DU谠 t$$t$ t$0 /L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PU|$u(U薬!|$ |$L$1|$04$N0rLY"P諛KHY"P"LY" L$ <$14$$lyD$0P||$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xWšt_WVPǞ UUx~1L$ ȉŋD$8L$D$8B\$W |$ t$dUUf |$;$LP^_[]60WH\L$\Ս\PQhR9L$,8l]L$\Ս\PQhRꋴ$tL$,\L$|$\Ս\PQh R|$L$,inL$|$\Ս\PQh R$|$L$,Ń|$ \$t t$c4$荩in]\PQhR,$|in~]\PQhR$|Y\$U"|$ t\$t$c\$t$0dX.L$ÐSWV[.t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í:]\PQhR}in]\PQhRVSWV[ .|$t$tGtiTY"tP1ǃTY"ǃXY"ƃPY"ƃ\Y"WV^_[Í:]\PQhR?u\]\PQhRpS[^-TY"tPǃTY"ǃXY"ƃPY"ƃ\Y"1[ÐUSWV[-$,E$$$(XY"uXY"ȋTY"u!uQ0TY"HY"t%1PY"TY"PQA4t $D$uz1TY"VgMVVǃTY"XY"HXY"@MuQP"TY"u<X1DN@u:t#t \Y"<|\\Y"HY"PY"$ƃPY"l$L$L$ $Dt\uUTY"3uًTY"t:tuT$ T$V@tfV3ǃTY"ǃXY"ƃPY"ƃ\Y"l$=ǃXY"ƃPY"ƃ\Y"D$:l$VǃTY"l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5TY"tP9ǃTY"ǃXY"ƃPY"ƃ\Y"GV ǃTY"ǃXY"ƃPY"ƃ\Y"ǃXY"ƃPY"ƃ\Y"1E;$^_[]À|\u ƃ\Y"ƃ\Y"C%]\PQhR$<E\%]\PQhR$<8USWV _(T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdhXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWbƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPUښtL$(U$WV ^_[]Í:/]֍\$PQhR|$\/]֍\$PQhR|$|$(S׉/]֍\$PQhRv|$&:\֍\$PQhRA$\\֍\PQhRUSWVYH%T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdt]ƃdNJD$$ƹdEt#<:tu)FdPW芘u`)nu N$UWYt1L$$8$8]M]\PQh`R$W话^_[]Í:M]֋$\$PQh"R9L$V\M]֋$\$PQh#RL$|$$&׉M]֋$\$PQh$RL$:\֋$\$PQhR$\\֍\PQhR]USWV[Û"l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPڼ F(N8D} '~wF^ FPE^ uWv$aR )tƒN ~?:V|@uH)ƒVԋ^ W;FF$BBQWP uvvQ K~?:uFV;~t^ a ^ Q8u^ DF,;8u e^_[]Ë^ S[Î0t$t$ [ffUSWV [Q} F FEFUVzRu)ʃԉF:FJFx9u0Ru}P N ;Nue^_[]fUSWV0[ãD$(}PQX`Y"t$M L$ML$f|$ L$T$|$QRj WPDuOt$ rF|$j WPxb u0O L$FD$D$ PjL$Q 79_t$} urd]"tgM9uWM % ]UQPR}Wuj19r"y";L$(`Y"|jjPC PMD$t$L$ WLt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\ uEPVu腏 ;EsD$t$W;KL$%D$"T$ ;UwRPuF 1ɋt$;D$(u ȍe^_[]覆S[>]jPE>`Y";h PKAd]"[SV[dY"hVt$t$t$%t1^[fffSV0[út$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[ t$|$jWj VW( jW؝^_[fffffffSWV[üt$|$t PuV_PQ ~^_[ÐSV[mt$ tP袱FtP)qFFFtP qFF^[ÐUSWV[|$(?u uV_PQ!t$$ot .$ tEt@u%?a)ae_PQjJRE@NT$RQjjjuЃ>T$u-aa`PQj[R迳T$,$ t|$ tEtHHu0aja׍e_PQhRh|$0EHHPVt$0t$0WRUуt 0$^_[]Íaa`PQj}RS[NhPt$t$t$t$t$S[ÐUSWVP[ l$t$D$ $ t t@8u'aae_PQhRg@8QUVwЃt 0$^_[]ÐUSWVP[zl$t$h$ t t@8u'aae_PQhRձ@8QUVwЃt 腷0$^_[]ffffUSWV[t$l$PQW t"t$ VW WjjPtU_PQWZ t$fffffffS[^jt$t$t$[fffffUSWV[(l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]XUSWV8[å$L$4L$u$X$PD$u$P| $$Pt$Pr覵 :T$$EjP.^D$tk|$jW^D$,D$ tND$1ɅujW]t3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWvx9!xt19)u|$T$(l$);$Pw|$$XD$0PNƃjP\tQ$1 T$|$$T@uX$L$0PVQW{vt5WxD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ ~v‹D$$t $uCr.P|$<1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Vr DžL$~9t/;$WVQƒL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j蝮|$l$t$D$P]t$ ]U]V]l$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$j]t$ ^]t$R]넍bbb1bPQhRAbbb1bPQhR"bbb1bPQhRnbbbՍ1bPQhR蒧`}bbbՍ1bPQhRgꋌ$hRbbbՍ1bPQhR52bbb1bPQhR\bbb1bPQhR=NUSWV[(D$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]NUSWV[ël$ |$t$t V*1L$1jUWPV^_[]ÐUSWV[[l$$|$ t$t Vڛ1L$T$jUWPVp^_[]ÐS[L$1jt$t$t$t$6[ÐS[L$T$ jt$ t$ t$ t$ [ÐS[ÞL$T$ t$ t$ t$ t$ t$ [ÐUSWV[XL$(T$ 7t$T$L$pD$L$11jUt$,jP`xD$Ƌ;D$u ^_[]LLUSWV[D$(L$,T$$>|$T$L$pl$L$T$ jWPjU1xL$ȋ;L$u^_[]KUSWV[[|$t$t Vޙ1pL$1jUWPVp^_[]ÐUSWV[ |$ t$t V莙1pL$T$jUWPV^_[]ÐUSWV[û|$t$t W81p1jUt$$PW^_[]ÐS[npL$1jPt$t$t$[ÐS[.pL$T$ jPt$ t$ t$ Q[ÐS[pL$T$ t$Pt$ t$ t$ [ÐSWV[ì|$t$WkuGكs^_[!t_t$t%<FF ^_[ÐUSWV[+|$ u ^_[]l$ t$Wkt t- t(Wkt(WP5 u뵃!}/=<\F\F ^_[]Ã=t̃~~ŐUSWV[x|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv,<$|$Dփ 6D$4)D$4@u \҉L$x MVit^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ=i$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWFhu#XDxuGws>4$$^_[]ËD$4  !rfUS [5E$D$D$D$PQ D$e[]fffffS[t$ t$ [ÐUSWV[õ$$%= uRl$0[4$AƅtǍHTD$t17YGPPUQs w,L$AGG GJG GGGDD$ GoD$PfGt L$y|$1l$9l$^|$4l$trV$$M(tXP=t<$tM1QE<$twWMut$ MuVMUMYHP@T@,MH@ @J@@ @Exf@H u"jh@Pe EuM(L$ uEQCM8<;c cPQjR蟝1^_[]Í1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u ёG OJÑD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR8l$ǃt$<)l$ D$8D$D$14$D$Lt$78DžN( u" .uGt<.utʐL$tXw P/ōG UTD$t1 .YMPNQPT$ Rc u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR94$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$h1Fvc cPQh1RlD$u‹.(1F)EHftf },$FtpPT:u|$t$u N)$xDuW@8/tOF(uIjh@P tFFU<$U<$u~yljF^_[]FUSWV[ût$tf8}t v$>V }t!v$v$v$I9V@9W:^_[]ÍcccPQjBRփvfffffffS [ hPQt$ t$ ,$ [ÐS [˾t$Pt$ t$ ,$ [ÐS[ÞL$T$ hP[ÐUSWV ׉[dT$4xtbQ=t= T$4t=uD T$41,L$$L$ L$L$ D$l$ L$RPQUWVC/=uD"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[NL$T$ t$[ffffff̀rS[t[̀rS[t[̀rS[Լt[ ̀rS[ôt[SWV[Ü|$t$t-9t!t F9u1^_[Í#?ddPQj*RfffSWV[,|$t$tt1WVjx^_[ÍT~dFdPQjBR藀uύT~dFdPQjCRt뮐SWV[ì|$t$tt1WVw^_[ÍT~dFdPQjBRuύT~dFdPQjCRfffffffS[.L$T$ hPt$ [ÐUSWV(T$ [L$<\$%t$@|$t;D$<|$"v+61t$ \$VP-q\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[Ôt[USWVTXxD$|$tt$ht&L$ptCwm\$y\$ˇefePQjxRs뵋\$efePQjyRs$vl$l1 D$͉L$4A\$P gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$HfePQh&RqV\$eHfePQh'VqkePQhrVt$xbq$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP  \$R11T^_[]Ë\$efePQhsRd$\$efePQhsRd$LUSWVTXȟD$ L$pT$htwL\$ j ֋\$ ˇefePQjxRd$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ eHfePQh'VObkePQhrVt$x/b$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Q 1T^_[]fffUSWVP[Ú|$88tqw$G$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUjƅtF PVWo+ u$*jU7t@ PVW<+ 1D$t01^_[]f̀rS[4t[ḃ̀rS[t[SWV [t$ |$t[D$D$4$JW0L$jjPWjQ1u#W9 u W01 ^_[ÍinGf fPQj񐐐9t uD$))t8t)Pt u+D$ PeD^_[]ÍffPQj@ROND$(SffPQjAR'ND$(7fffffSV[]L$D$T$ y9gRVQPR6Q4P 1^[ÐS[D$y%9gp]"PQj@R{R p]"j@4R p]"[fUSWV[Ût$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JTgggPQj?RL눍TgggPQj@RLq1^_[]fffffffK̀rS[ćt[USWV [èt$ D$P407$<|S_ NL$ 9t6ʉi)iAi ˍ $@H84L$DT$ o9s9s}$?9r|t$^uA$t209r9r։H8t$豿^_[]É݃t209r9r֋9s9r9r봐USWV]0|$0||$4D$P4t80)1ҋ0P1T$,ރ s;Dž4Dž<Dž@L$0A0DQ1@t$ sAs(1ہ1)L$4<$@D$0Hމˉ0|l$DPt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉H8)D$L$0t$轼^_[]ÍggtgPQhXRG[USWV[(t$0D$.̉)ō$P34t80)1ҋ0P4`<t@0t81HD4$譻D$^_[]ÍggtgPQhRFUSWVP[WS4tIH8010D0$9r$9r$H80i0mNA900W޺^_[]ÐS[~t$t$t$b [ÐS[Nt$[ffSWV[,|$t5jWt ctVW(1^_[ÍinhgPQjARxE몐USWV[ûl$t{jUt=ǾtUWUt1l$UPt$ L "19s#JJ8^_[]Íin&hgPQjVRDaffffSWV[|$1t,zPWzt |$t=t=tƉ^_[ÐSWV[ìt$t-̡VW tPW V`^_[Írheh0hPQhRC믐SWV[<|$GPtƉx @̡VP1^_[ÐSV[~t$ t%̡VPMt L$9H 1^[Írhh0hPQhRFC뷐USWV[È~D$01t:>t41 |t$t$ t$ W9 uD$ <=u.|$$ ]"9ttD$0]"M9u;]"s|9v9tfPǃ]"ǃ]"$jWP H0H8uyPD$0t$C )$jWP` G0G8u4)  $PjQC $]"L$]"^_[]ÐUSWV[|]"t]"1t0̡DtPVt]"Hى|$̡jjD$P tE t5jVt$ F:]"tVt$VŋD$]"9tPǃ]"ǃ]"]"UjPB ^_[]ÐUSWV[{81tR/tL,t4t$t$U(7 uD$|=uօt D$1^_[]ÐUSWVP[J{|$1|zPWtfƀ<=t^tR)tI1 $ $lt+Vt$Uw6 u|5=uمxD$8.1^_[]ÐSV[ÝzܡPVƅtD0^[ÐSV[]zܡPƅtD0^[ÐSV[zܡPִƅtxD0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[zyD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[yD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[ØxD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[xL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[XuT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t WV-1 WV轔^_[Í=iKjiPQhRgu_jKjiPQhRAhUSWV[{X|$t$tLtnWV虍t3oUV(t"}uG jQWPV蔘1^_[]Í=ijjiPQhRuxjjjiPQhRkSWV[üW|$t$tqGG>t1^_[WV轌tGPVLtۍGPV蛌tʍG PV芌tWVy묍=ijiPQhRmCjiPQhRFUSWV[Vt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    CjiPQh$RnjjiPQh%RDjjiPQh RGFGF^_[]ÍjjiPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[dTt[v̀rS[DTt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[ÛS|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1UjjPQj:R]kjjPQj;RqVAUSWV4[åR$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF'kl$0PQjUa3U $\9ȋ$QU$`- FfNZQPR$`U$`21Ʌ9$Fx$P$T)kPURQ2*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LZQPR$`$`2l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$p|kPQ|$W$`U0t;$Tg$P$T)D$D .P|$Wt$L$QRb0L$)D$D Pt$t$t$R)0L$)D$D Pt$t$t$R/L$)D$D Pt$t$t$R/L$r)D$hD Pt$t$t$R~/L$9)D$/DPt$t$t$RE/L$)D$DPt$t$t$W/19D$F$PED$1$1pD$ .D$|kD$׋D$ tD$ $ 1QPt$t$U.H)D$>Ń19t$un 1f$PL$$T)fv fD$ kVQURt$.L$ ;$T$ڥT$0L$RQPWt(8W$\9vpD$0Pe;fǍ'k$0PQhW-W:$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aG'kT$ PQhR(= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í ck*kPQhR KGck*kPQhR $$bFck*kPQhR ;KfffffUSWV[E$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPRMt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP谊 uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tOfffffff̀rS[Ct[USWVP[úCPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pg 8^_[]ffffff̀rS[Ct[SWV[B|$t.jWG=tjW^_[ÍkkPQj@ROfffffXBL$rÐSWV[\Bt$u8mkkPQhrRVtF~tP^_[ÐUSWV[A$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotPι܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$WoLokPQhfRF HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RXNjD$$fxxt$ T$@>P\fD$>P\fD$>Pt\ f|$fD$f|$"D$<$$!|$hVWt$8R$XgD$D$$fxxVT$@HVNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$\VWP$Pj%蒢΍Gfwhj$PG DŽ$DŽ$DŽ$DŽ$jND$$%ND$WNvnPt$t$t$DQ$Pj%T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWlYfD$FP[YfD$FPJYfD$h$!Pt$ Vt$8W#UfNjD$$fx$!xVUAV=*h\uL$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~Vi<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u y8{"T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ VoL$tL$8$tYt$`~l$(u2D$4t$%Ut QkvF Ut$`)L$8uBffT01l$(E;$%b%^_[]Q赁TǍYn΍On׍kPQhREhn΍On׍kPQhR$%]m΍On׍kPQhR.H΍On׍kPQhR$% mύnkPQhRx$%~׉ύnkPQhRC$%MTrWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jPxŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P" ^_[]ÍmnkPQhR@nnkPQhR|$KGnkPQhRoUSWVT[æ1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4okPQhR$׉nkPQhRkfffUSWV([%$H$<$$E UPM 1U4$Um$DUtڋ$D0Wۺt4$DptPW蹺tu뗐$@tP$Hp 腺j$DW訸H1$@T$t.$@sT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$4&t$$DPG D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$CT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$BT$L$ ut$t$$LUinooPQhRBhfSV[t$ t,FF#EgFFܺF vT2^[ÍL-poPQhR/밐USWV[ht$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ј L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPs^_[]ÍL6poPQhRAp6poPQhRUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [Ø|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW~ ;D$uY ^_[]ÍLLpoPQhR<LLpoPQhR]ffSP[MPt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RIWjPP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W| Pt$l$ U| t l$ /D$D$<F\$hPWf| |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~{T$ \$WjRFT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R{ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$zT$ L$E E$\$l$TUV/4$UV$L$$9sD$DQgV1ɉȃ0^_[]D$D捃qppPQj]RW\$@SV[-t$ t VV^[ÍqpPQh/R蟠fffffUSWV|[j$1tGljPW节t)l$XD$\|+Wy Wc1|^_[]jjWjjUjcHW8t҃'D$ l$<$D$ƅuUW 뚐USWV [|$$(rl$ NBCD3EB 3M tI1 ^_[]Ë|$,j<DƉ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rV]Ss@sщʉѺ u׋ $)jQWj?F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj>F4~F:F:t1F;pS[.t$t$[ÐD$@ ÐSWV[T$|$9W v#wG,ʃt$<u0 Ћ0<L  )r;GvD$Ot$1^_[ÐUSWV[Ht$,~$ED$\$Pv(t$Q 9qud)$sdD$VqD$4$iUw2藈 t$ rL$$D$4o |$D$ l$kqD$$$$`$ttl$$;A&$`t %"l$ q$D$D$ft$H D$0Iut"l$ q$D$D$Sft$H D$0 ut"l$ q$D$D$ft$H D$0tt"l$ q$D$D$et$H D$0tt"l$ q$D$D$et$H D$0Itt"l$ q$D$D$Set$H D$0 tt"l$ q$D$D$et$H D$0st"l$ q$D$D$dt$H D$0st"l$ q$D$D$d$`t|$4tM{xL$DL$ qL$,$D$t41Nt yI u6J rL$$D$ D$ L$@L$ D$q|$,$軲Nt yI u6ڄ rL$$D$ D$s讄 L$ L$8L$ D$|$,$$`t% tl$$ )"l$D$$t$H$l$D$ $vl$D$@$Zl$D$$>|$Du(f|$@u f|$<uf|$8ul$$ !x^_[]ÐSV[t$ tLtQ 9qu/w' rVQjP謬 ^[ÐSV[íL$t$ t M{u bxtXt4t Q 9qu'i rVQjPL ^[ÐUSWVHT$[$`$DL$`!ƅteT$l33t3ʼnt$ 4 t$l=lPp-ŅxzWjjPZT$lZ8u-T$~I|$ tBD$at5Wj T$ $#0pWzPQWk T$t Ug=T$;$Du"H^_[]؍0%W.{/USWV[5$$ M$$$T$hRVQP xNj$(|$tPD$P 1 Pj.E;$u ^_[].USWV[Å$$ M$T$hRVQP$ xNj$$|$tPD$P2 1 Pj.dE;$u ^_[]Q.USWV[l$D$t$$t$$UPt$( 1x3NjD$ PN|T$ t|.t;L$$} f.^_[]USWV [u$ $$ $ $T$hRVQP 1xDǍD$P{L$t|.t=fD.t$(Q$;$u ^_[]%-USWV[û|$t$Ft)l$PUYtF u1t^_[]øuSWV[Lt$|$L$At*99ttQ 9yut91x rWQjPʡtw ^_[ÐSWV[üt$|$D$xt9xt(y6Ny.Xy&my/y=yhy^[ÐSV[t$ )tYj(PV;t ytY'kVQj(P躝sY^[ÐUSWV4[ø$D$0D$I<u t$HFL$j.QPjuFyT$PQj.R;$tEL$PQVQ D.0;D$0u 4^_[]'USWV([t$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$Hz6z֍yPQhRvqːUSWV[ã}dD$|$D$ D$P0LlHHPP_z0ppp RQWjV$r D$ƀe^_[]USWVP[l$PU΅0PU超qPU螅PU膅qPUnqPUVUPU>xjPU" 1uRXMDHt?uj PU u8u$8 L$A.&L$0t9^_[]ÐUSWVP[Êl$} PU)txF u6|jPU! 1u[XMDHtHtj PU xt8u $8 6D$t8^_[]fffffffSWV[ì|$t$jWMGHO~;G~ t H WRIjWLO^_[ÐSWV[<T$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[|$(D$$u$PccD$D$D$D$ jWLG0u ǀD$PW.@jWqN^_[ffSWV[\_Ht Jt @t A ?t/t5Gt P[ÐSV[ Fu tt$t$t$t$t$VRjV^[ÐSV[ý Fu At#t$ t$ t$ t$ t$ t$ V~jV^[ÐS[^ t$t$t$t$P׫[ÐSV[- Fu t VFnjP^[ÐS[ޣ{" hPt$Q'[fUSWVP[êT$L$I):t$ 4$ t$,t$,t$,t$,WUVt$$QP4^_[]ÐUSWVx+[ E4D$E0D$ $p+E E$D$M,E(U$t$,tH$RP^\$M,u+L$D$ @ f PU0M4:tWׅt3QW^|M,$wt!<\tt<.uwu)ր:|$tb9DVRt$(?U \$ 3)D$E0}4},3trtl<.t t<2t\ϋ$T$aT$ .BE0}4B:D$ @ PU0}4D$|.ϋ$T$uT$|${)D$ }D$|E0 E4u $jt$jhVD$ \$1M0QU0E4A}4sLkD$E4D$E0f U0}4D$u0}4WVuX D$)ljD$ s1$L$ }|jQjhRD$$D$ Ɖu0}4$uu$+PWQjdVׁ9E4vAPVu0= E49s($ }|jQjhRE4M09U0)E49L$ u4U0D$T$t$${)D$ }D$ |E0 E4u!$jt$jhVD$\$E4M0QU0E4A}4skiD$E4D$E0PiD$D$,;$p+F:D$e^_[]Ã$"@f E4w, }|$jQjhR\$E4M0QU0E4A~|E=m U ME4u0} PVu,W?|?=D$f1))lj$}$A!u E z|PQjd$+Wl}$!u D$ E HM HL$HM xQƃE t$ %{V|$Wt$ PQjd$ +W9E4>PWu0: E49s% }|jQjhRE4M01U0)E41u;D$ / u E P&yPL$Qjd$+Wp~9E4>PWu0X: E49s% }|jQjhRE4M01U0)E41u E PrPt$jd$+W}9E4=PWu09 E49s% }|jQjhRE4M01U0)E41u E z|PQjd$+Wi}9E4=PWu0Q9 E49s($ }|jQjhRE4M01U0)E41E4u0} MU $PVu,W<CE L$)T$X$h*RQPID$ .}4$V<E0f (E4w($ }|jQjhRE4M0QU0E4A${I.}$$u M QU Qqu I4${$QRPVjd$+P|\$9E4;P$ +Pu07 E49s% }|jQjhRE4M01U0)E41E L$)T$Xh*RQPG"}4;ƋE0f (E4w, }|$jQjhR\$E4M0QU0E4A{D$"M }4E0T$WPo<B|jE }4v:E0 E4u($ }|jQjhRE4M0QU0E4AM }u ;L$:T$$WE0P;$( E z|PL$Qjd$+W%z9E49PWu0 6 E49s% }|jQjhRE4M01U0)E41E HM @Pt$jd$+Wy9E4J9PWu05 E49s% }|jQjhRE4M01U0)E41E E PE Pt$jd$+W%y9E48PWu0 5 E49s($ }|jQjhRE4M01U0)E41M AE  L$Z$$2L$ L$ }L$|L$)M01U0)E41E E |$$V$Pt$jd$+WDx9E47ƃD$PWu0'4 E49s$jt$jht$(D$$E4tE ;D$7}0 $|T$ }T$ |L$ M0QU0E4AE ;D$77T$$E4PW 9 E E ;D$sƃ}4 7E0 E4u$jt$jht$ D$E4t}4u0E WVu,P6r}46E0 E4$u, }|$jQjhR\$E4M0QU0E4AMU WVu,E P},}$u E z|PQjd$+Wgv9E46PWu0O2 E49s($ }|jQjhRE4M01U0)E41$E HM L$HM pQSE T$(|$$x|VPjd$+Wu9E4?5PWu01 E49s($ }|jQjhRE4M01U0)E41|$$^E 2L$ L$ }L$|L$)M01U0)E41E E D$$$Pt$jd$+Wt\$9E4a4PWu00 E49s$jt$jht$(D$$E4r}$u4u0u jM t$)΍VUUUЃ=7E43}$E {PQjd$+Ws9E43PWu0/ E49s($ }|jQjhRE4M01U0)E41E $E  8;L$T$D$dD$`D$\D$X)*Ƌ$P$ +Pu0& E49s($ }|jQjhRE4M01U0)E41E4D$E0D$<|$rv)$L$ }L$ |$E0 E4ujt$jhVD$E4M0QU0E4A}4s$@RD$|$XWu u$Q>E4u0} PVu,W()E L$)(|$1ҋ$L$L$ }L$|L$$+р਀tpRPt$jdVh9E4u(PQu0$ E49s $jt$jht$$D$ E4M01U0)E419T$ (ыE $+$[}$ $u E E $PE  ${|$X$PVQj2W h\$9E4'PWu0# E49s% }|jQjhRE4M01U0)E41M u4}0T$VW)$ E }4$'E0 E4u($ }|jQjhRE4M0QU0E4AM T$$VW(s$E }4&E0 E4u($ }|jQjhRE4M0QU0E4AM T$$VW&($E }40&E0 E4u($ }|jQjhRE4M0QU0E4AE MU $VWu,P2}$E z|PL$Qjd$+We9E4%PWu0! E49s% }|jQjhRE4M01U0)E41E HM @Pt$jd$+We9E4 %PWu0i! E49s($ }|jQjhRE4M01U0)E41E E ;D$$ $2T$T$ }T$|L$%M01U0)E41E E ;D$X$$Pt$jd$+Wd9E4E$PWu0  E49s$jt$jht$$D$ E4zE4u0} PVu,W $}4#E0 E4$u, }|$jQjhR\$E4M0QU0E4Au _E PB&yPL$ Qjd$+Wc9E4S#PWu0 E49s% }|jQjhRE4M01U0)E41u E PPt$ jd$+W/c9E4"PWu0 E49s% }|jQjhRE4M01U0)E41u >E E P)E E PE {PWVQjd$+Pb:}$u E E PE E PE {T$XPWVQj2Rb9E4!PWu0 E49s% }|jQjhRE4M01U0)E41E4u0} MU |$XhWu < WS:9E42!PWu0{ E49s($ }|jQjhRE4M01U0)E41 }$E H }$ T$XPRVQ1-o}4${ ƋE0f (E4w, }|$jQjhR\$E4M0QU0E4A{D$$T$X$PRVQ,D$ T}4$E0f (E4w($ }|jQjhRE4M0QU0E4A${E4wt$(M0fA  QU0E4A|$XVWt$,u +9E4$$VWu0o E49s($ }|jQjhRE4M01U0)E41L$$M M E4;L$s\}0u $M0fA  QU0E4AMU E4PWu,V&E4L$9M r$[E0f )E4B$ }|jQjhR$|D$+E }$t!p|VQPRjd$+P:^c9E4$V$ +Pu0 E49s($ }|jQjhRE4M01U0)E41E t$9$Q{L$ )M0\$U0)؉E4} } 9$Ƅ$ +fDŽ$+ )lj|L$|$L$D$Pt$jb$+P*]ƃc9|$tGE 4+d)8$Pt$RQ\}ƃcvn$|$9u4ZV$ +Pu0 E49s($ }|jQjhRE4M01)U0E41$0}4E0)E4u, }|$jQjhR\$E4M0QU0E4AM4E0.szD$L$.)E0 E4u, }|$jQjhR\$E4M0QU0E4A~`}4sf E4w, }|$jQjhR\$E4M0QU0E4AƄ$ +fDŽ$+; |$~.L$L$D$U X0}1b\$1< +9t4 :..x DN.ẗ< +L:xDN.t뼍G$D$t)D$:x DF.t.D$+9E4Pƍ$ +Pu0) E4t$9t$|$b$ }|jQjhRE45}BD$E4D$E0"T$bL$D$L$ }L$|L$D$ ,M01U0)E41L$0ЉȉL$9L$ $t$ 2\$9E4Pt$u0* E49s $jt$jht$$D$$E4M01U0)E410|09u4$D$XVPu0 E494$jt$jht$$D$$E4' bL$D$L$ }L$|L$D$ /M01U0)E41L$0ЉȉL$9L$ $i $t$0\$9E4Pt$u0 E49s $jt$jht$$D$$E4M01U0)E410|09u4$MD$XVPu0 E491$jt$jht$$D$$E4 NjE ;D$ HM 3M01U0)E41D$ $+$L$ɃtyL$u2E4׋M0A  QU0E4A D$ {RPjdVV9E4XPQu0 E49Q$ }|jQjhRE4$}$ }$z|PL$Qjd$+W0V9E4PWu0 E49s% }|jQjhRE4M01U0)E41E HM @Pt$jd$+WU9E4UPWu0 E49s% }|jQjhRE4M01U0)E41E HM @Pt$jd$+WtVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s'D$D$Q@(D$ 9s$ }|jQjhR)))x ^_[]1))lj$|||PQhR_!뽐USWV Չ $[Ó\T$8D$4 D$L$D$"u$ }|jQjhR|$4QA$93<$779$x|D$D$ }D$ |D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$ }|jQjhRMQUA+<$- %$D$4L$D$ ^_[]ffffYOZT$4D$#ѰѴÐUSWV[Z|$ l$t$~Jt$~2UV1x(ƃ|$tލF9wȉ9v-$(+t$^_[]ÐUSWVP[ÊY|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }#(^_[]E ffGftC,$RWxǃ9w,$)xD$ hHGftf,$RWšf 8 9Xσ95,$)5|$ oGwtc,$RWS 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [W|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.  ^_[]Ð~34$U菟x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quu賞]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[xT|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.a^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu[U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XQ\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō}}PQhR[|$ W}}}PQhR.}}}PQhZRfffffffUSWV[;LD$$L$1w|$ u p0}PUWVt$(t$(QR1 XKL$u0ÐXKL$w1USWVXhKD$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$l=~}PQj>R7;\$*~~}PQj?R USWVP[JIt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í*~9~}PQjgR 1fffffXOH"ÐS[.H"ht$ P [ffffÐ1ÐXGx"ffffffUSWVX[øGl$lD$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: r\MnsL$"jWRPj2Q) 9D$"PD$tPp7D$p$)$iǓ$))ŅtVT$sT$"jDPQj2R()D$"Pt$t$V64$t$ T$T$D$@L$)L$tOt$ s|$"jHQPj2W()D$  W|$W}6D$t$ $D$kTWPڋ$+D$pffffffUSWV[{Dl$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[C$$$hWP! x3l$hU$( xUW<1Ʌ;$u ȁ^_[]襯ffUSWV[;C|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[ûB|$t$l$tt$$PW%t ^_[]VW t W LJWVUF ͐SWV[1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[<@t$tAjVq"t2|$jV"wsf~ 1c ^_[ffS[?L$T$ hP[ÐUSWVT$0L$@[È?uD$\VD$ Pǃx\$D$t6R_=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$t$l$h$d$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5QV t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$Qt$,PVD D$,\$VPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  7 >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$HrM %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[=t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[~D$ L$t9u[ÍYPQjpR9S[.D$ #L$t9u[ÍYPQjpRD$t&L$tu1u 1tÐS[ÞL$ D$Qss)ǀ[Ãuu ǀ[ÍYPQjpR5S[.D$tL$ t 1[[ffUSWV[j C1tQ@@jjPl &(8t(Wz(^_[]ÐSWVP[k|$tcOGQ9u0$jQPHl 08t  G $GT$pw1^_[ÍPQjZRySWV[t$tRtC|$t3~t-0茔~r4s;~rP`VW^_[ÐUSWVP[Zt$t@F$t*.1tt$Vt 9<$u1^_[]ÍPQhR뜐USWVP[T$J $Ћ*1|t$Wt94$u|$ l$tWeE$F;$} $)Qtu<|uprP $كU|vl"ul"Pt&D$j.PWV!tl$t$$l"D$PL$QRPD$PWU $t!Q8{l$|$TG )|$TWT4${l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j"6D$0$Do5Vd5vnPW|$t$8t$HQj%艈T$T$@t$$P6#tt$6Pj%L$D$@9F f|$0u D$(8gt$|$u$L0V葮ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP}T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PREg l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V =~ $!D$1$D$$1D$\$|$$Rl1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<$=(ƋD$L$,)9Qt$@P7e D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURP踍 4$il$l$$T$8)ƒ)19s@Qi1$X;$(,^_[]Ë$LnRPU5 1‰(YnOn֍JPQhRֳhnOnT$$JPQhR詳T$4z?|$46[USWVT[$h>Wt1T$ T$G j(W¸hl$D$D$ D$$D$<$1|$ D$ l$Pt$ Vjǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< t,PW5jt1ɀ8 L$L$D$D$L$ t WP賩tT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍPQhRw]PQhRPBMUSWV։[Ä_~XLZu 1^_[]É4$t$0t$u'_ PQjHRw3>PQjIRS#$=D$,D$(D$$D$ D$D$D$D$1$  LDLDT ʉTDuދt$11Ʌك|$t к$ʃ$|$|$ Jt'D$,$9L$ L$uT$4$у|$3t#L$,$9͉u|$4$|$  t'D$,$9L$ L$uT$4$у|$$ t#L$$9͉u֋|$4$|$(Ϲt%l$Ƌ,$9u|$4$|$|$, ‹4$9utƿt׉|$tƺt|$ tƿt׉|$$tƽt|$( σtƹt|$,t¸tȃ4$9u$$|ȃt|$F$ȉD$1퍃}D$0L$t9|;l$}9u:ِtNwD$t9 :u5u1$t tuR|$$uF|$,u?t$t)tt$4VW艼L$9K$G O WoTURQPW|$JjW=~nL$t)9sdQWV$O V۔L$t|$uGL$t9s<:HT$t9s*D$F);$w$PcX1|$ ;D$tx^_[]ÍIPQjhRJ1IPQjiR&`PQhR`PQhR՝xEffffUSWV[$8u ljU|E(D$t`$$$tWtvRUuE urjjjuT$ !ЃE S1L$1$L$ D$L$ 1$uP}Tu'$tGEt@+E<$ $<$+Eu0)׃>t E<)׋$΋$x`<$1L$D$ D$$}T$uUEw$T$ E ulD$;tM ǡE=t܉t$L$4QP~t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP}L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tROD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQND$e ߋD$)D$Uɐu E;D$UqtjUzİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q*NE0EEEe jUz1뙋t$uyb)EۍkPQjGR菘kPQhRhD$D$ D$NkPQhR1EtfffUSWV [ht$@|$4uU>FD$FD$\$jt$8w1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$.u^[ÐS[޶t$t$t$t$t$[ÐSV[ít$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[Ît$ t$ [ÐS[nD$t$ P[ÐS[>t$[ÐS[t$Z[ffY ÐX߲L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXX$L$8t$4D$0<D$|$щ9t9}E.L$ D$D$$<@t<S3A6D$!t  9$<@A)ߋD$t‰T$$PWL$Q|$9L$ 9T$t$|$D$)$8RWQPݒ|$L$Y9OErt$\$t$X( ;!ЋT$ )$PWRQH݋\$ƀހ:w6$\u9E\EQ~߃^r}};|$tE\<< $:HukdT$Ɖ*t$i $:H|$ui (Ћ4$HUh|$9EQ\$( ;!ȋL$ )$8PWQRL$9D$\$t$;)$VRQPӐL$xW9sQxMl$ŋ|$݋\$\$ҋt$4L$8T$9u ~n.9s E)$ y(^_[]Ë$xᐐS[^jt$t$t$[ÐUSWV([(|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ Rn0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ÞL$T$ hPt$ [ÐUSWVT$[bɉ$t$4|$ |$0t=D$0|$ "v-f1T$VPR\$u+t-t$0u#D$ D$t$0t@D$u20u- iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF#:-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F#:-00u҉u#11Ɂ<$)ȉ#^_[]USWVP[xiD$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[Lg88tWƅ~102jj!jPu W蹡^_[ÐSWV[f88tW芡ƅ~,102jj|!jPfu WI^_[ÐSWV[lfhRƅt(T$jtV081^_[SWV[ft$08Vx08^_[ÐS[et$jt$t$[ÐUSWV8[óeM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3#11uPz,R$h#H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF#JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[êb8}tl,PQ諞#$|l#ul#;Dž<$}t+P ƅ,$~,01K#,$|$1jPUjW/DžuP誜^_[]h-mPl#ZQWFUSWV[Ëa88t P9ƅ~+01Rl$|$#u1jP UjW[DžuP֛^_[]ÐSWV[`t$|$LPQ#1WP(t $h#H(^_[ÐSV[Í`t$L$#t$P'tt$h#H(^[ÐUSWV[;`t$8#8t8,PQ8|l#ul#ћDžtA,LPQ#1UP't $h#H(^_[]htPl#8tWh듐USWV[k_t$|$l$LPQq#UP&tt$h#H(^_[]ÐUSWV[^t$l$8#8t<,PQ|l#ul#荚ŅtQXl$LPQ踚#WP%tt$h#H(^_[]htPl#tU냐USWV[^88t(Pɘƅ~k(0z|$1jPt D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[X|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ LPQ踔#ljPo|$x ,^_[ÐUSWV[KXT$D$t$>O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[W88t+Pxƅ~"0#u1jPI4$t$|$t6BR lP~;yQi|1)΃<$uPّ^_[]ÐUSWVXVL$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[U88tV蜐Džt> 8#ujj}l$(D$$$t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$V腏$^_[]ÐUSWV[ÕTE$$fBt π?:t 5?:uʀ/\$ uu5PW%jPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ WuD$HhPW荅 ,D$(W跆$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xW%~t$D$(0W~DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[AFtK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9u:<;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$ip/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףiQl$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$iQ9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[w> +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍ1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƼ1i4Q9uB ^_[]ÐUSWV0T$ $X8D$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[n1l#PQPl|l#[ÐSV[=1#j}tJj^[ÐUSWVT$4X0D$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[{$l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]ÍPQjFRqPQjGRj|$$b;PQjHR@>ffffUSWV[{#l$t$|$tU6^_[]ÍXKPQhRʐUSWVP$[#t$l#UB\t,jNtPx $Hp l#l#17"l# xuxt)txu8u밾U[^_[]Ã듍zdPQhRKUSWV[8"l#D$ Pm[l#l#l#$l#L$n#L$ǐ|$$tD$$9G t GtOl# tGwЃ GЋl#9tl#DžuZl#u';|$r$;|$s<$$<$C<$1l#t$ ^Zl#u#t7W՚u^_[]ÐSWV[ t$l#WY"l# xuxt&t xu8ujЉu $p@@ l#l#1W~Y^_[ÍzdPQhRIfffffffUSWV[$$$$$tD$$DŽ$DŽ$ $$jPX$@jP5YDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^͉PQjPRhI^PQjQRAT $ ;$u ^_[]踊S[Nht$t$Pt$t$7[ÐSWVP[D$L$T$t$ 4$hVRWQP^_[ÐSWVP[D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[Ût$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[ýD$ L$ $XQPRv[ÐSVP[ÌD$L$T$$XRQPV`D^[fffffUSWV[HT$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQKP֍PQj=R:P׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]ÍPPQhRL$8AffffffSP[D$ L$T$$RQP[ÐSVP[D$L$T$t$4$VRQPA^[fffffffUSWVP[êt$|$PV13ht$t$ GL x=|P3MfF FfFfn vF$F,F(F $tjjjV|^_[]Ísm8PQj>Rq)ffffSWV[ì|$t%jW聼w jW}^_[ÍPQj;RfSV[MD$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[ t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍPQjL$aD$l?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P葅\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $lXD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $\xT$ L$D$n6 D$0 L$ I $\T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P0D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$\D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0QZ,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwP薑ƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P}\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$y$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $|BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$y$PQhRUD$뀉׋$|G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$y$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$lB|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$y$PQhRBU|$뉐|$UD$xT$ Ӌ$lClj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P6E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PE<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [vD$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$C$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[SEET$@t$DT$$dpU }|jjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP0 )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[×l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[Ãm|$hE t$p |$<$ MM$Ujjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػd|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃dL$T$vثdv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU"$t?$L$Um($1xL$^_[]þTx0ffffSWV[<t$|$ty8L$tu1 1 ^_[ÍҋPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[`M1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػdD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃dD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثdv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ÌD$1r 1 9vW<t8Ɖ^_[ÐSWV[,D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[ÝD$ PHpR=^[USWV XhT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[ÞSVH[uD$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQj'D$$D$ D$D$D$D$D$jPj-\ j[j[S[ÎCS[nfffffffUSWV[Kt$|$tK1tt (h1^_[]ÐUSWV[À}uu\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋQt$(PV'T$4D$(VPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[Ý] |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ó\u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[[t$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXZǀ0o#ǀ4o#fǀ8o#ǀao#fǀeo#ǀAo#fǀEo#USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[üYD$H~( 1u 9r1$PƉ^[fUSWV[[YL$8?tP胒 wp#t{p#?u1>PaƅD$t/Fn?tP#FF ^_[]1?tPp#)ʉʁ oΉoUSWV[[Xt$tbF!r V'O8}t3Wm}Fp#p#tWKp#p#^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[HWl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P}T$,Bp# p#ti4$\8}th$Pӎ1}Fp#p#t14$譎$p#T$, p#D$TG^_[]Ëp#p#1␐T$1Ɂsrr@r"y(6s@sރx @tS[ÞTj,tL$H@[ÐUSWV$[hTD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUc<8?t:V譈?Ep#Mp#$t#V興D$p#Mp#$^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[èND$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [KE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[I$t|1q1d.PQjERx P$1D$jjW+| ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[Gt$t$jt$0[fffffSWV[ÜG|$t@jWqGHO~ H0 WjWR^_[Í?lPQj=R 럐SV[Gt$ t%FHN~ H V^[ÍlPQjIRy ffUSWV[ûFt$atrt!w 11ҊNtgtGɍyw$@ؐ+u˽뿁뷁 ՋL$) p1^_[]ÍPQj>Rw fffffffSWV[ìE|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:/PQj8RW f  ^_[f̀rS[tDt[SV[]Dt$ t;F0u ǀVNuFH^[Íj6PQj;RfffffffSWV[C|$A8uGG Ⱦ uuL  O @G0taW@9t QRG0GG81t&WhG GGfG u WG t'DV}PV}GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍrPQjJRSV[]Bt$ tF Ш u Vk1^[ÍrPQj;RSWV[ Bt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWP覈6@VRQWPL^_[ÐXoAL$AA A AAAÐfffffUSWV[%A$u hj1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVq VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC/p(1V (1^_[]14dž$j$ZtJpH0訳rPtv_t u8~)1 9}8tQ5݋t PmVt81^_[]ÐSWV[8|$tOWƲ^_[ÐSV[ý8D$ p|$s t.jt$ 1dž,dž,^[S[N8L$tAt[[ÐSV[ 8D$ p|$todž,1t$t$^[ÐSV[ý7D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[87l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNC׍ŎPQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wEQύ֍ŎPQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRԳu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[ 4|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[Ø3|$(o(o(OG0!D$;G9} $wD$D$ P襜$L$L$D$QPt$荠 $L$QjP t$٬$D$ Gjw $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[]2t$ t$t$ #F,;F(~#F0^[ÐSWV[24aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrePQjbRrUSWV[ø D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]ÍePQjbRPfffffUSWV[û|$oEtjPu7 EjWu,EtP@E EtPDžDžtPDžDžUՖW̖VP^_[]ÐUSWV[ø|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[íD$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_=D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[xL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$ePQjbRT$(L$?ePQjbRZT$D$L$ ePQjbR*D$L$_yffUSWV([X D$X!PQj5R虿ffUSWV[$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W, $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j>ՍaPQjXRgꋌ$!1Ƀ8cfffffffSV[}D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[(D$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]ÍڐPQh<R0j$jU0 볍ԫP#VUSWV[E$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XxD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$L_PQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$8щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$L_PQh|RƐ\$T$\$ePQjbR蕐\$T$\$L_PQhRa\$T$\$L_PQhR-\$|ffffffUSWV[X|$8D$,hEtjPu_ E wJrr G&E(uI1GxT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZcePQjbRɍIePQjbR虍w8ePQjbRn;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuEet$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tT$ ePQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtP7@E EE($}fu E(jQt$xsB tet$t$jbP臈эePQjbRdD$T$ ePQjbR8D$T$Ǎ֍ePQjbRUSWV[;|$l$t$FtP=F FF($nf~ F(^_[]USWV[t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7ePQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU ҸˍePQjbRR!fffffUSWV0[Ãu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍ePQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$eRQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$D$$eD$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fY?D$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^HL$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYϲD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[ޱt$t$t$ [ÐS[ît$ t$ F[ÐS[ÎL$T$ j[ÐSV[]t$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[ýt$ tAj@PV{D FPhjPHm F@FDFHFL^[ÐS[^t$t$t$ [ÐS[.t$ t$ [ÐSWV[ t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[0MD$$&ydḰ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <y#1D$D$ D$D$L$8T$jjPQjRq2tD$8y#D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$ vL$L$L$FL$'L$?L$WL$hjjjPQRCD$L$8T$jjPQt$R1L$81 ujPy _UiK1D:0D$D$D$ D$L$8T$jjPQjRp0t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR0D$XL$h L$xhjjjPQRuMD$D$ D$L$8T$jjPQt$R/tD$8he^_[]fffffS[. [ÐUSWV,[l$@D$D$ D$$D$(L$ D$QPj( @W 1|$D1҃|$H1‰|$y#2y#y#y#y#y#y#y#y#y#ty#t}y#t{y#tyy#twz#tu z#tsz#d1`YRKD=6/( !    s#4ÁƘy#uH< |$9T$vQ׋z#jjjhjPj! y#t+f@z#fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ t\u`\|$Dthh1|$Htppt$jWj ,^_[]þ |$ $z#jjPQjR,<$z#ȅUSWV[ë@W\tV6u dP7ƅt3dtUmuW0ltUmujW^_[]ffS [z#uoD$D$$z#T$jjPQjR*t1z#u,PQjAR'^z# [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[ûl$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPz OV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP t,NQW QRP FEE1^_[]ÐSWV[9D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [T$0|$,D$(L$$)q092sVP $D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[L$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[$t[̀rS[t[S[t$ t$ jt$$t$$t$$t$$t$$  [fffffS[ît[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[$D$D$huET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VRb"ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ĬȬ|$ W$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ` $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PWo |$ u9nuqF$hPWN nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0v $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP7 t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWP, t$l$$t$|$t$P@E$$8$j`_t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[ütM΋uA~8t:~4~"`N4F8 I9rPWF8^_[ffffffS[ND$L$ AQ jQ0 [ÐSWV[|$t$t+jP6 tH  W6,^_[ff̀rS[Ôt[̀rS[tt[USWV^U$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXhD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQwæ1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[|nt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øTPjj%Q4SWV[ümD$L$Pt prxxp| pPxtz xyVR1^_[ÐUSWV[Hm|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,蠤L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[=kt$ V PtHP tQ P V1^[ÐSWV[jt$>gthGt tww$Ѓ gpNjPQwU;u<tww$Ѓ 貝4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[ÌiD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[it$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[Hh|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍzPQjGR(T$4zPQjHR}(T$4USWV[ûc|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW,P=W1fu- O @1jW^_[]ÐUSWV[bt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍȓPQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[OT$B=sXDP[ÍÖ[ÐSWV[N$RQPhWvW] PWj! t;$uĄ^_[S[~NT$B=sD$ DP[Í˖@[ÐS[.NT$B=sXDP[ÍՖ[ÐS[MT$B=sD$ DP[Íݖ[ÐS[ÞMT$B=sXDP%[Íf[ÐS[NMT$B=sD$ DP%[Í[ÐS[LT$B=sXDP[Í[ÐS[þLT$B=sD$ DP[Í[ÐS[nLT$B=sXDP[Í 8[ÐS[.LT$B=sD$ DP[Í[ÐS[KT$B=sXDP[Í[ÐS[ÞKT$B=sD$ DP[Í%`[ÐS[NKT$B=sXDP[Í/[ÐS[KT$B=sD$ DP[Í7[ÐS[þJT$B=sXDP%[ÍA[ÐS[nJT$B=sD$ DP%[ÍI.[ÐS[JT$B=sXDP [ÍS[ÐS[IT$B=sD$ DP [Í[[ÐS[ÎIT$B=sXDP@[ÍeX[ÐS[NIT$B=sD$ DP@[Ím[ÐS[HT$B=sXDP%[Íw[ÐS[îHT$B=sD$ DP%[Ín[ÐS[^HT$B=sXDP%[Í&[ÐS[HT$B=sD$ DP%[Í[ÐS[þGT$B=sDP[Í[ÐS[~GT$B=sD$ DP[ÍC[ÐS[.GT$B=sDP[Í[ÐS[FT$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[tEt[D$t8t9@€tuuuuH+D$ÐffSWV[ E0t1jWQw t u1^_[ffffffS[îDUPt$t[ËD$1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[=l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[<t$t8D$ t|$tT$t121Ҁ9 11^[ÍPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[;$pЉׅtuϋ$tDRWPQ$$$4UhVH$yPVjl S[n;t$jt$t$PUSWV[E;$$$$pЉՅtu$ tD$RUPW$,$<QhVt$t;l$VPQhUJPUjk tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃ4P趸҃¿+w狔у̃ǃƒӥS[n9t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[8D$ D$D$$jVjj z#uƃ z#tjljj0jVjCj jIjfffffffSV0[J8t$̀rS[Ô6t[S[~6|jPt$t$t$[ffSVP[L6D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[5t[PS[í5[fffffffS[~588t3[Ë[ffff̀rS[D5t[S[.5j1[ffSV[ 5u14z#^[Ðfffffff1ÐÐ1Ð1ÐXo4Ð1ÐÐUSWV,[(4l$D|$@(|#|ƃ =sdf4|#Fw%L0|#=uɋ8|#뿐,|#QUhWL$L$뀋0|#|$@l$Dt14|#t& 9s8u+p,|#ƃ(|#D$D$(D$$D$ D$D$D$,|#D$0|#D$ 4|#fD$8|#D$D$Uj(P׃8^_[]ÍѡPQhR]fffffffUSWVX52$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$l*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$G8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$GD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$GD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$$4$4$4$4U$0R&U׶=r,j$ ?I;$u;^_[]Åt|.u|$`UPQhWf,hffffffUSWVX[ø$L$p|$lGtG,t$x<t$|H<>PVt$|UQ$$E$ 5BBWXfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$vCxnNj$L$|PQG$L$xPL$QG$ǃ$fB$) $W 9$A A L$|PQ G$L$xPQF$PjF$PQF$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPBƅxՍ7Pj 9F7Pt$&F7Pj5F7PjF$ 1۸$IUSWV[[l$ |$t$D$@tPN ) l$$FPj)uEF|PQXEfFD$@ u1ft̥P VPEVj EG fffG )^_[]ÐUSWVP[jl$0t$$T$ |$D$@tPX T$$։)͉ $9L$(B99t$4D$,WPYDGPl$UHDGUVP誔L$4 )΁r&_PQh=RCL$8QPC+l$ ^_[]fffffffS[^jt$ [ÐUSWV[5$ $D$0$jU!CEt U uEEEj9_U U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh^tkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUAD$ djVUp PQsƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w X1҅tމ8D$ Ϲրwr tt$$D$ uP tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$P1$<#t<;t΋$doma1$in $sear1$ch #j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P% $< t< 0$< w A< vhQt$8 ƅ_,Pt$NnD$ kc$< t< H$< w&`A< vhQt$V襇 ƅ_j VtuDU`1aL$ t ut1P&;L$4r$< t< L$;L$ $F< t< t*PVd< D$<@@@@ @@D$@D$8'kj5Pj $PD$PD$;t$ s E$EtJPEDt%uH9PWu퍃:P@PBitcsV[ML$0 ;$u ^_[]VUSWV[t$xPdžft91 9s)tQDŽͅtMtt|5X9utfxt PRWFcdžtP)cdžf^_[]ÐUSV[EuH|#jP<_$D$F$FWfF e^[]ÐUSWVx[óEL$ L$puH|#D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]TUSWV[t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$AtLt$0UP EO $L$(T$ L$nL$uL$ F< t< tjt$V jPV j PVҡ HjPV踡 &զj PV螡 tyj PV脡 ijPVj  jPVP jPV6 j PV byjPV jPV jPVΠ jPV贠  j PV蚠  jPV} jPVc $`FP5d$/FP|Gt^GddGtAPt$'F P;|GGtPQX7< < {$H׋$ut$0UP $EP뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]|$ t0oE1tVPtEuv|$tT$D$D$L$ 9AD$$A D$(W街)D$ QPt$z |$|$D$ @1tjD$#gRKǃ)|$ KWQl$Ukz L$l$$XD$ @TȃuD$D$+D$L$$L$;ED$ @ ;D$ |$ OP1Ry L$l,G )D$ L$D$D$l$$X|$#44$#Gt|# $d|# p|#Ml|#EHx|#||#H<h|#D$$PUF2)h|#4l|#4$t|#D$FT$t|#L$d|# p|#` Vl|#NPx|#||#Pǃ`|#\|#~\|#pd|#t'wu'r 'l|#$P:tBƉh|#ʼnl|#4$t|#Ett|#d|# p|#P ^_[]1USWV[ 8p1ɀ8 )σ|#tdUV薪ty|#U0聪td|#t21퐐|#V4QtV;|#r߉|#|#|#PQ:uK(PJPWQRj=d!JqVPWQRjd^_[]ÍC4PQhR菔fffUSWV[|#ƃ|#|# |# |# |#t |#u' h|# |#|#p|#@|#|# |#|#|#|#|#${:tnq6w |#|#K {R9u 뷐K f;{RtK;|3ҋ|#D$|#4$t$C|#|$)|#|#|#t_tU|#tK|#1ǃt2<2 u,#)փ|#|#D$|#L$|#|#,},T$t|#&M|#|#E,E,|#E9c9|#}(RL$ |$щ)ʃ|$  $sQ߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃ|#ET$)E uY$}u}M QW@Eg)Ɖ|#D$L$,E <$t r }ts1l$ |#5t% t |#|# I9uʉ |#|#@ |#|#@l$ |#WjPƉ|#|#uU蕕8y臕|#|#|#@|#WjP耮|#t|#|#|#|#,u1u?|$ tE,1(|#|#|#|#,$|$D$ ;E v:Vu>l$ A Aq NjE|#8L$@DP|#$1t$|#L$|#D$|#19S<2 u|2 uჃ؅B|#|#@|#|#|#։L$9Tt$t$|#2|#|#T$k9tt y6w |#|#K t$kR9t$u 말K f;kRtK;|;ҍQ6w |#|#K ST9u t$.t$KK f;STuS:t|#D$|#:${;L$t p6w |#|#C {R9u,럐C f;{RuC;|3ΉЋT$T$$Љ|#|#4$k9ty6w |#|#K t$kR9t$u$뗐K f;kRuK;|;΃|#4$-|#j|#|#\ƃ|#|#I|#|#=X|#)|#|#3tvƊt_XL$9 $|Gy $ DAD.D$8V9s .1%00PjX^_[]EȨ$ASV[m|#tz|#N9|# QP8|#t{NDDDDD DD|#.jA-|#tǃ|#ǃ|#^[ÍoUSWV[Ûj0,ƋD$F P,FFЍ(Ff~FF,|#t |#1ҋL$9u<|#F(|#th|#9tF F$FNj(|#|#r|#R|#|#|#|#^_[]19u뫐S[QPR誦 j0SWV[üt$8|#t3|#9t^t,|#|#z|#|#t7|# 9u |#~t v9V9^[19uΐS[Þt$w9[ÐWVX}L$ tsAQQBQQAA,|#tD|#49u4|#4~|#v|#|# |#|#^_19uSWV[ܾt$trT|#|#t/<t)|#|#z|#A)VPP.T$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍(ߪPQhRoL$4T$0^L$CPQjbRyoL$T$0z(L$ߪPQhRFoL$ffffffUSWV[{t$nEtjPu> EjVtE 1t u1@u)6d1Ƀ Vt^_[]ÐUSWV([øt$@l$<}GtjP71> G ujU躌0 81qujWjjjV 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP%` u !1(^_[]fffffUSWV[˧|$ t$tGw#jPdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUV&u^/|$$KQ;v RP>t2MQUQRPD EG/1^_[]ffUSWV[Ø|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$׍CPQjbRi\$8=$oD$L$,td;l$tX14Eju77 t%MLH4jP7^9 ;l$u*oL$1 Gw)f_ ^_[]ffffffUSWV [x|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$Re $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍɫPQhRgT$믐USWVhXD$|$|G =tŋ\$jj$W_{$jj$W;\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$o ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ# DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$W臅O t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhTRQbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$ثPQhRa끐USWV[D$lAB9w}) >P2Q7 D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj &`1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$Vc1Ʌt‰ D$0L$ЃVhP|[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$PQhRX\$T$ D$4@USWV[ؓT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJDHjWPVfi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P] L$,1TEMGDHjWPV.h t&dž(@f8u$dž  ^_[]ÐUSWV[VzA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVf t׋@f8u$dž wSWV[܀|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[ÆT$$wA =tF)G D$ *$Ffu^L$t P4$jHL$t$,t$,jWQPt$DFjWPQLetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[8t$0l$$D$jPj |$"uOƃL>"t%9HuHP H>"@[fffffffffffUSWVYvT$r 1t\z:_pX"_tX"_o ݃hX" 9stǃuƁxX"^_[]ÐSV[ZvVjV輯l#VPL^[fffSP[vn#u;$ n#jjPQjRft<$ t ǃn# [ffffU)ձܱnnnnnnnnnnnnnnnninnnnnnnnnnnnnnnnps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleanersegment %d: bad seguse count %d%s: inval seg %d%s: rewriteseg returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALLusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ... bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: failed to read cleaner infoRead cleanerinfo: %d clean %d dirty %ld bfree %ld avail flags 0x%x%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: must clean%s: enough clean%s: dire straits%s: busy clean%s: failed to stat ifile%s: idle clean with fs idle %d%s: failed to get load avg%s: idle clean with load %f%s: default no clean%s: fcntl returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segments%s: fcntl returned %d (errno %d, %m)%s: errno %d, returning%s: reclaim failed with errno=%d%s: wrote %d direct and %d total frags to clean %d segs (%d%% recovery)%s: cleaner not making forward progressSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such error%s: coalesce: LFCNFILESTATS: %mcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodes%s: coalesce: LFCNREWRITEFILE: %mbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpwritepseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lld/home/builds/ab/HEAD-llvm/i386/20260624161321Z-dest/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystemillegal inode block size: %d cannot specify inode block size when version == 1 %d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblockidx < lfs_fi_getnblocks(fs, fip)%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedexamine files in%s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260624161321Z SMALL REJECT_NULSLINENO#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.The set "$0" is optional and not included on this distribution medium. This is not critical and installation will continue. You can add this set later, e.g. by downloading it via https from the NetBSD CDN. Optional sets are: debug/debug32 containing debug information base32 containing support for running 32bit code on 64bit architectures Some architectures offer differen CD vs. DVD ISO images, the DVD images are complete and contain all sets. All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.6xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-30s %40s%-50s %-10s%-30s %-10s%H/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1134: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist