08PTi'&<  'TirnP''`'$. $.Ti'&P@@<@T 08PTi'&<  'TirnP''`'$. $.Ti'&P@@<@TU Ti`'$.yATiTiTiQ$f TiTiTiRATiTiTiPATiTiTiQATiTiTiVATiTiTiWATiTiTiATiTiTiATiTiTiATiTiTimKS%TiTiTiX`hpx$TiTiTi (08@HPX`T$FTiTiTihpxP$TiTiTidR$TiTiTi (08@HfJATiTiTiCTiTiTiATiTiTiATiTiTim<TiTiTiX`hpxR\$ TiTiTi$TiTiTi$>TiTiTi$TiTiTi$sTiTiTi$TiTiTiATiTiTim TiTiTi$TiTiTi $TiTiTiATiTiTiATiTiTiATiTiTiATiTiTi$`aTiTiTi (08@HPX$TiTiTi$TiTiTi$TiTiTi$TiTiTi$TiTiTi$TiTiTi$TiTiTiATiTiTiATiTiTiATiTiTiATiTiTiATiTiTiATiTiTi<)G:38Zp 2MH<F,`3X Vu/~uH`XxFy%wj |_]8o]HU_{p#1s"r8*a]WBRT>Q0} @YVI4 pt:$. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4P%4 (p"p"00}$22ؒ#TTT,,}$22Ptd0(QtdNetBSDKwGPaXU,SR ffffUSWVP[O.t$DujPjjj~jr0Fɉ$u& Q/tu|$Tu?;(s(U9rQ\|$u =t W%P%;sU9rHPz%$06v? P USWV [hN.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]g USWV[ÛL.; s' ~*u.UE9r^_[] SWV[LL.;s9r^_[f$SWL.5u1ƃ5$tЃ tX$k_[SWöK.4uYƃ4$t|$X<$kt(?t<$nktЃ_[WVD$0tP>tKj/Vt@Ƹ!q"&PV t&uVhp"hp"h3{(^_`SWVhp"hp"h3U( 1۸!q"&PCPrFh3j 5whu%h3( uh3j 4j}D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc539 u$1^_[Vhs"Vhs"1 53hs"j wVhs"j̤USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%SԎ&tutD$D$$D$% D$t$@N D$l$h3h$D$ @l$0tD$Ph$j D$  |$\$4t$,s$L$)L >QPhu" D$  L$s()@L$L bQPhu"L$ D$  s D t 4&hu"YL$ D dtPh v"?D$(@9XU袸\$D$T$T$9tt$N9BD$4&53h*u" 1h^_[]t$|ht"(%WS$h>u"h[u"jU53hyu"j*t$|hs"53hnt"3$hu"jhc 53 u153h-v"jԛSWVPD$Hw#t$>&W/t ub&$h"s"W t N1AQhc53Q u 1^_[53hBv"j?USWVP|$t$78h>s"WVܢ fu U3u  3)u 3uhAs"еIs"t 3hjQh 3u 53hRs"Ihu3$(&SUt uUh{s"j1h[s"jU$NPVS& PVf3PhVv"V% Vjjhv"&&hv"h3 ujq53hWVοV4&=tuVhs"jt8&^_VPΉj PQ  x $9u^Vht"j;WVοVԎ&tuVht"j t؎&^_USWV\$$1h3 d33 3sVRj=Px<$h٣jjh&UL 3H F H 3VP3u3t;#=t%{ 3##=uthRw"$3tttut!tcu3h 3^_[] 3Vhv"W Whw"4$hv"4$h"w"j腗hlw"hw"D$L$011PjPjt$hy$Lh3d3331PjPjt$hw"$3 3hw"j1hjPPt$hx"331PjPPt$hx"ā,2tVjk 3u$1PjPjt$h)x"茁33ËD$3h:x"jg1hjPPt$hPx"N 33h\x"j33u$1PjPjt$hsx"h3d3ËD$p3hx"j1hjPPt$hx"ր|3x31hjPPt$hx"讀4303fSWV(3t/ 33 t53)փ>8F u3P33 3 X3T3;d3 h3r*jUP33T3 X3 33^_[á3 3 t T3X3h&h$jהh&h$jƔh &h$j赔h &h$j褔USWVt$|$6!2cp#SjISVWf u= 3P]3u,3D$33$&Ahx"j%3$&1QQPab 3y 53܏3 ܏3 =,2r3uhNy"롡p3u#t3p3y"3$&13H3$& hQPa t3yJ13H 3 hP5p3Q t3 l3y 5p3L3L33utS1V 3$3 393rZ ܏3t= 3 d3@ L3t# ܏3) 3I d3 ܏3ujgL3 3P33  3t x3 |3t 3h`u;5x3 d3=3 |35h3VP5t3W 31VhЏ3膤hjhj5<35@35D383h -,2`3t%33 3 3;3 3ss$3 3tQj QjPH 3535353P$ xd53-31‰1 3 3=3 333=3 33 3xPh$`,3u63j535353P  t53h$3 33 33=3 33=3 33C3s 33=3 33=3 33u@s)t33H 3PQQJ 333=T3 X3j133133hzy"jPh$jFWV3=t=h=u <3X3 T3t;d39щ5h3s))Rj5P3 h3 d3X3 T3 u\53=3 tJ5d3j5L3 h3 d3X3 T3L3ʉP3)Ɖ=353 t jY=t3u3jPu 8u*35t3Pt^_hn#jhy"USWVd3|$,tT3L3(p‰D$l$|$,u 3 xT$ 33 t!3jQP5t3R !ƒ~t$VShL3 $~ D$ `18D$ Z 33 ʋ-̏3ȏ3t>5h35d3QPՏ3ď333133T$<$t$ ȏ3-̏3l$13L$ 33D$11 l3t,H3u#H35p3h y"T$l3L$ AD$)ʋ$tЃ|1@|p9@|533*d31 h3T$1 uK33I$T$ X3T3)ѣT3 X35h3-d3933$ t P3)PQ5L3& T31L3P3 4303 t(335353QPVR9 tjhs%jW$^_[]5p3h/y"5p3hx"5p3hx"j迊5p3h$j݊USWVt$(|$,\$$Uh83jW C4WVs(P( C8jUjW /8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"jEV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒup8u F ́Ĵ^v$h$j觉VP΋9v VVPQ  t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV03 43t/jh<1#jU 03 43tjh<1#jT 1t$PV褚FȺMb׋ ؏3-։+Џ3D$H ԏ3iى tL$ 1FD$|$ 5353535353535353hy"jdWp,W'PWjS 33 t?ƒ ʺ%t#RQPhy"jd|$4W WPWjS 33 t?ƒ ʺ%t#RQPhy"jd|$4WWPWj[S t$ ď33 t?ƒ ʺ%t#RQPhz"jd|$4W|W3PWjS ̏3D$=ȏ3jPt$ t$VÉiL$it$V)QPӈRPVSt$Whz"jdt$@V$VPVjR e^_[]EVt$;VIjfUSWV353=311C3W5܏353P$ Mtg3u53h$3W5܏353P$ ݅~3t )u=3N{T,2rOH,2d53 3=3 353jVP53W !ƒt^_[]hQz"jn53h$j茄WVl3uD5x3 d3=3 |35h3jVP5t3W !ƒuuJx3 |3ti1135d35L35t3P$ ~J;5x3|3r,f x3H 3Phm5t3Q xw^_xof@ 3Phm5t3Q tD;5x3|3s5d35L3hL3 3d33 h3 t5p3h$j7fUSWVX $p $l 7u hcp#j螵j)hkz"WS譊 H-$P&@30343@034383<3H3T30343uL3i0343SX3G`3;D30343\3,3P3d3=h3- UE=L3u =M=X3ui $=<3u=H3v$x =l3u j Vh)#Ot^_[]h~"h~"hJh)~"h~"hKh}"hL}"j{qUSWVt$ D$ɍ D3 ˍl$Sj hcp#PRWU#UVh @$^_[]fSWV|$13A3GO 31ʋ31 t$3 3jP53 39}3W3 39|_SQ33 3u 0353WjPFx!9u=3353>X0Ph#h3/ h~"'0٥Ph#h3 h~"N^_[0褥Ph#h3 h`F&hN 3uá03u tjwGjFUSWVjzƋ|$11K< @u=3t?jj53  53J33353UjW  A)߉n3 3N F53q033-3F 3:0SPh#h3 h`F&Mrh "]1H330Ph#h3> h"'0Ph#h3 h~"LV؉1^_[]Vt$53q0F33^WVL$ 3539})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 3u 03uu82^_É1jDjDVT$3t=31363t@9uхt3uh%hK1^SWV133j?~h"聇/"tW=t|8/uWh5"WhA"h3W 3tLP% t$hh"P031ۅu@W<;53h$jk"jjN"PJV~^_[V3tAP3xG33t!Pc 53n31333;53 0#PVhY&h3Oh"I^Vt$3t3P3t!P 53݆3VjhD3h 3 y "x 33313@=ujuSVL$D$ T$t$33533~A23BI^[fV13đ3̑3ȑ3PiPNYYؑ3Fu^SWV5đ3953t$3Vjjhؑ3ut=ܑ3ؑ3ؑ3jjPPHth"h$[HБ303@uȑ3=̑3VNtVP G~*h "5ߑ3r0h"h$G1N1Nyh0"h$G5đ3~3H 3ؑ31H^_[Ë 3u!T$7đ331đ3xD$Q3ؑ31HSVփuUБ303@uؑ3jjPPYGth"h$Gؑ3 ܑ3 ̑3ȑ3aˍؑ3)QhБ3P= ߑ3Б303@uؑ3jjPPFth"h$FVjjhؑ3^[Vt$ 3uđ331đ3x 1H^USWVh"IƊtx<0uFD uh"h$$EGuȿ|w WjP< 1T L ш @u3hjV  P31Fth"h$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uhA"XC^_[]eC$t硐38u@353Nj-31;-3M1WtÃ=3tj jwSVVVSt$L1Ʌ;L$uWwZ?E;-3|1MV31535353535353 3u 03uu ^j:jq;V53953}3I3P53ytC533 3u 03urufL$3r53 1^0ژPh#h3 h`F&A 3u‹ 03u tj:j9USWV l$ D$fD$p 1P 33193@u 9u3Sk3 t$$PPh,  $ x3| t %3ڃuh<1#Q膺Uuhr"QijD$P 4Ë $39}=3]39|A‰T$R53wNjD$3=3 3u032$@PSWH =3?5ƅt3VPP,+ 38uK=3뜣3Gh<1#53Jt:jPDž["x Q:? ^_[]Í|$00Ph#h3] h`F&> 3u03utj8u"j&7WV 35319}'3FىDuw9@u1=3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEhx0#P| UT1hx0#PÅt*t$Sǀ}!u?Se=0ǔPUhY&h3h"=eSFx(=(3uWh(v"h3 53+t$0B0[PUhY&h3h"=^_[]USWV |$$Wơ3$3D$31-3-39-3t\$=3t$ gDž~w11353Y6ts3PPjJ Å 3u03t$ Dž|$$\$9t$utt "<$u=3t!ʀ"9u 3 uh3PsP9¡3Ƌ 3Ӏu1A9|$t $ 3 𣬓33t )) 3u 03ut j4 ^_[]j3USWV1|$=3t WrGHOHt uG `-39}3V39rFU53kr-33 3u 030u 3F8W薳<1ۍF-39~N3 39wUQqt7-33 3u03uhtk30 F0Ph#h3> h`F&9 303j2G @utL30 F38|0蕐Ph#h3 h܀"Y9-130=3=3  )Ɖ^_[]js1USWV|$?!uGh@$Put$WI,VPÅt2l$t$ US NjD$8!u?SV =0踏PWhY&h3h"{8mS7x-=(3uWh(v"h3 t D$ )@ʼn3.0GPt$hY&h3ph "8^_[]USWVPl$Uƃ=3t1ۅtf;l$ `1V$th~;-3u=3t =3u8 GWPt$ F x4EEs @6;l$ |=3tt$$$^_[]USWV|$\$l$19t[=33t UPrUP_Fy0Ph#h3H h$"61^_[]USWVP\$53FEx @u}|~PVq6tj39~l3 39SPngƉ3 3 3u.03_tO53;^_[]Ë5 3W53Vd . ,1xщǃ|$uEx3| /539$~Z39V5 3>mcÉ53 3 3u03t  3W5x3U豐 ,$+HPS5 3D( |$tM1BDžh["40Ph#h3. h`F&41 303539} 3|$N3 39͋|$|MVPlt053 3 3u 03umua(/ )0BPh#h3o h`F&4 3t103uj-j/,SWV113H 37h 3ɬu83@%f39u 3H 3ÍF=H39~Y39wW5x3j=H3x3 3u 03t x30u 3F t3CԺ0Ph6"h3 hA"2%31t x30x33^_[x0葉Ph#h3 h`F&U2 3u03u tj_+j*USWV\$ D$1tt$hS"D$ l$1uHD5l3J l3;|3у  d3Qd3;=D2|hd3h6~%F1GD5 | <\t<l3H l3;|3hd3j\d3H d3\\5tjj ShX"蹌 tVGX")Ȋa"l3J l3;|3Vу J d3Qd3\$ !0l3H l3;|3hd3Pd3H d3D50 l3Ql3ɋ\$ ; |3hd3P d3Qd3D50 l3Ql3; |3hd3Pj d3Qd3Dhd3QD4 l3Ql3; |3~;ȃ t3 d3Qd3D$F9hd3Qhd3P똡l3H l3~d3H d3 hd3j 1^_[]fWVD$L$L$$$06| $ |r1 3hj"t$t$ X ot9EtzS,3ǃxtostypf U83먡 3  $)D$|$ta$8-uW(3D$|< 3b$3S 3D(35$L$jj!thj.1FhVVjhjh<3ƅux'43|$t$8t$0|$t[h3hr"B$8u h"_-jau$h3hq"Ahu"--y =3thL3h#h3e 83tPh$hd3衆 xt` x3| |3x51g3QPP M=p3=(3h3hr"@h":,j<%3p3h[",%3΃t0h3hr"S@jɏ515p3h3hr"-@h"+V藏Q=3thL35t3h"h3jrjkαPh&h3 j=3j unhL35t3h"h3Of$j0yjt$8!$h0h83] uhL3h#h3 jL$ ɸ!03Phht@j訔 x#$r@2D$ rD2ËL$=3t1@ 03Ql"L$=3t1@ 03Q#WV1F= 3t9|$ ?!t!hA#W覣tj/W}th")1^_3333x>3 3 33 3;t,uQ39;u3빋 3| 33t9t31Ƀ USWVP33DJ@t t@3@DJ@t uHH 3~Ã=w$&=|3!h<"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=p3t=(3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h("=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH-33=3=3 9=3 -339 9w hm" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sOvj h353>B 3wG8"%3 3:o t!gc ptrP  A 3< b=3Ho13PP9 3-3 =3=3 9=33-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@3 3AQP2 3<萧j h353X@ @2]8"h"N@2 3x w =33t30h1&ʿ 3x A =|3u;.53O1@3 3AQP@ 3jPP>3x  1q1ۃ=(3Ƀ=p3 ˃h% 3x  =|3u-5353 53g 3x ? =|3uL-5353: 3@;3?73-3x =|3u , 3IQ T3x =|3u,3 39QPn3x QVP 3y F( 3y 1 3y P5353g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !|3SPhA3x  1@+33uF%3x  Uu<2=83t1833x =L3hL3h#h3覾 3x }*x1Hptntlu  ˣ3@У3x '3G1333@Hptnt lu  ˣ3У3x =8383u2%|$Wt@$5353QP';3p33x ==|3uJ)=8383u53Q5;3)p3hX"h"h"3h%31< *5 3y qt3@P3@P=(3hR%+3x )53j 6'(Y$i*tB5̓3ȓ3 3u 03*t ȓ3f8 t$t$VN5335ȓ3ta3PPj tLp31 30`Ph#h3, h`F&  3tU03uZtCj菑0`Ph#h3լ h`F&l  3t ȃ^_[]á03tjD$ 3DAuh͂"' ËL$EEp $A8GMi 3913)@أ3=|3t W6Up31 3u 03u u^_[]jjSWV=43uj貽L$ɸ!033Pjh@$h"Hy|hI#CtkPX=Yà P3tGWP|3/tf/Ved.hDhup53jh@$Vj=43ujL$ɸ!03jh<3ϼUSWVPl$53'Ƌ=33-39ʼn) u)E1u1$3E@3V}tzP蘹t_3PPj DžtOp33H3u 03u[uE6M3@Pi1,$l& 3u 03ut j1^_[]jUSWV$ 3 ,3th"ckjP~3L$F$ 39} 3V339|BVP<533 3u 03! 3 u1C1E҃!%=83h83P|Ɖ$ 39V39V53;533 3" 037 09L$]939|WPg;=33 3]9~[39V53;/533 3u 03yt v3 3 (E 3Q39\u=Q3I ( 3G (E,$s 3L$A 3 3y 3)9~_39VP-:I533 3u 03 33| 3A(EA339r 3L$A 37 033/ 3Q3 ( 3݀ (5ē39}3R339|KVP=9t]5ē33 3u 03S53P\ 33D$1!P20KXPh#h3x h`F& 3 03u!u#^_[]h"qhu"gj'jVjk-tL$Qq p PIH1葈0WPh#h3ף h`F&n1^V83t.L$19 Г3uГ3H83t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hL3XWV 3 td< uhA"1 Q3I t;8t7P1ǡt3t?=3u6P0et395t3h"R5t3j+t3tV35$3WPX t3t.h'hL3QP75t3#<t33/҆0UPh#h3 h`F&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-|39}=x3M3x39|KUP5tYlj-|3x3 3u03uyS53W;Y 53=3tsj jSWme谅0TPh#h3 h`F&1 3u*03u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwRSj h353 1w%8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[39V532#533 3u 03\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=|3u't x3| t %3ى38339|NWP2t8=33 3u 03uuuw5303M1I!0:QPh#h3g h`F&1 3u 03uu^_[]H3,j'jUSWVPL$33193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP331S̪á3tP芬EPPjM Ņtl9u 3l$ u03ue$33+39}yF3@3P%Ut$ Pt$$hDž+9 3u103uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=3tj jvS肮vލD$jPjSu5vt1t$ED$$D$1E $A9T$ 439Ɖ $T$~c3t$ 9V53.\533 3t$ T$u03=3tjj RS藭T$=3RSW/R 4$D$D$ 3 $9~bt$ 3$9V53".533 3t$ u03=3tjj t$(S=3t$SW~Q Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu>t&D$)D$39~V3 39SQ-33 3u03|$~#D$$ D$ ud$th/"$=3\$tjj SV賫3SVPNP 3f |$%C<|0KPh#h3  h`F& 3t e^_[]Ë 03u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y39W53+=33 3T$u03%$9C 31F9uEEπ;D$$,$L$l)39~Y39W53*>=33 3T$u03ml9}C 31F9u,$y^=39}3_39|W53X*=33 3tT$ 03T$M 0E+3;3539}3J339|KVP)t)533 3u 03u^u`Iy0IPh#h35 h`F& 3u 03uu؃^_[]jjfWV3 39|ld 3j Qh3 tJP|HPh#h3詔 h`F&@53b.133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWW-9u33H23L2^_[USWV=H2=L2=3t p33$3D$j荣33 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=|3t׫H23$H2L23D$L21 3u) 03u&tj\hJ"$^_[]jlUSWVL\$d3趬hZ"9*_"tNjt$`hj"SV fttu= U߃u 3r|$L$ D$1&"D$PeƋO9rPSt$ {f tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ ho"j+L$j QP  $;Fl$|1ƋD$8u&1zPUy!Uh$j D$ th"j NjC=m@!sHQPW xs{QPW x4$Uh" =muqB dut\$fCShmWJ HefD$t$Shmh=m8@u֍D$Phm8@W y?60PhЃ"ӍL$fqQhmW 3Uh5#D$ukD$Pho"h"# T$"h"T$"h/"l3H l3~d3H d3 Phj"khd3j it$8t$8t$8t$8t$4h"蘋t$Ht$Ht$Ht$Ht$8hDŽ"wt$h"ft$ h"Uj{qPhD"h3֍ j\SWV֋|$t 8"?t>"VQP JB8l3H l3;|3hd3jyd3H d3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hk"$th}"P`bu3h"$th}"P6bu h"jh}"h"D IPu h"j> 0D$ u h"jP t$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$& U$뼃4t6맃dtket/1@D$c= UumWt$aXh΅"5 UKD$71@D$$+L$ 3 3T$uA 3$T$uȋ$D$,jj@R9l$L$ $tL$ $L$,1ۋD$Pn^CEu S)St$PʼnD$$q U(^l$$T$DtIL$ىL$$U$E L$)QPR 4$]EuED$ush΅"h%Zu]h"bh҅"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh3t$ t$,QPR}Bt$ ("yj|=3y h"|$$tQt$(jVjhSMy h*"jVjh53My h<"yh΅" Zǽt$(1CUVSwD$PYMUVSw53EMt$,)1L$XAAA @D$HPQSe =3u'l$hD$h8jU&j ul$uDžy h0#1O~fVS53M VSt$VM |$h53l$0fE<u1\ku@hWj u8k8*k18tƉjjUh tD$68Ztj8tEVSt$ x )bj8#Thz%|$l$8fE=3ul$0fE9EjD$LPj |$@f9fGfG3G$jVU tQf|$<tٺtf|$4t?3L$0u+fD$<=3ufD$4 i8t$>Nf|$Dt1BuNfD$Dh|$u%j t$[hN"jt$jjyh#ygh"PhS"h3趄j1A8Љ4DAtt;L5rSh"j2 1<0h"USWV u|$Wc1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hˇ"j2NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxjQWP Ql1eUSWVl$(D$,8tщ$PQh" D$|$,x &Phу xBWh& 1yJt$t$,WSh'"j0#t$t$,VSh"j0^_[]USWVu ]33,ĕ3?31=ȕ3̕3=Е3=3hM"VS I~Hw0$&ԕ3уCt DG UЕ3봃J U3ܕ333x5 U3`ؕ3UG3I5 U̕315 U35 U^35 UFȕ3 3) =̕3x =ؕ3tD$)T)&1PP0D$qU Qh"jl, $N tut ttL$8L$t Ht D$\$$|$1¿ u׉|$L$pL$ |$x\$|څy11Pt$RQhL$D$T$$D$4t$$$SWt$h" D$pźHt;T$v$uuD$,D$xT$|$$)ډ<$9|$\$߉ËD$lD$ @"9ؿUD$uD$Pt$L$(tT$Rh1"` 3L$(D$TD$X$3tt<$11D$|$PD$PPh   T$ t$$t$t; D$XL8T$4 2L8L2 8L$L8L2L$L2 L2 L8L22Pt$S 4L01 L0T$T$B`$|$ tt$t;< zD$p$tF8DQh܋"j.) VXjPh"j)t$(V5 3Y0Vh" $4LK4ҍ4v֋T0|0T0|0u׋$8tthxUj4 P?T$8H Ht1<D$@$L$D9ԕ3tx8D$,D$ tD$tD$,4 L$p3ލQ։9w9681 3D$pNt$u1G|$D$ 9ξ|L$T$ $8T$$T$tL$$t$Pt$ Qh"$¾tt $<1|$t$  $8:O_ d$1F$+4im۶D$D$uD$$SQWPh΍"~ LK<$KAgfff‰t$@ҍ@LK$tD$D$t$;4 ;t$L$ 8RWPh"j#t$(5 3L$0A; 3D$,$DŽ$߬$D$$D$$$߬$ (&D$tD$Phb"S8L$t։T$R0WVh"j-"#4$<:$D$tD$Ph܋"j! \$=ܕ3D$@P$P.\$L$@D$D+$ $$39:؋D$p$DŽ$߬$D$ &t\$QSh" zQ0VhT" 4$D$L$D$L8T$$1$߬$T$@L$H \$t \$$0‰$$߬$t/ ,&|$2D$2 fD$:l$:\$hl$2|$hWRt$QShu"j\$0\$84 D$D$$D$tD$Ph"j$D$tD$SPh<"jjD$TPL$D$P3vZD$p$DŽ$߬$D$ &v,tL$\$L$$Č"D$ "Gt\$Shq"tL$Qh"jD$< ȕ3tD$t@1ɍA;r^_[USWVPKtWjjP PK9u PK4t0jQwx!=3h#"jt$VPKxi8tPWh\"QVtPSh"W~jXt8VhB"jP 1^_[]fWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21tKIu顀2PK 2~ t1@K@9uUSWVD$921A9|G2SoƉ<$~ SjVB 2D$~Q1ɡKt<2*tBEB(B$B4!؉B8<:tWBuA;L$u5Kw5K$2^_[]V$\K `KD$D$ ,&T$ t$ 25dKt$T$L$D$\$ $ǐ"^$^Vt$FtN H N tNHNfr v V XK^VD$`sH) hKlK pKHtP4BPQ@@1ҋxKv9t|KKrh "jGtp4F@xK^USWVD$T$#25KtC=XK11-dK9| n-dK9t%9P4uH$3L$X(3\$ t Fu1^_[]h]"hV"hh"=USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv [F V>XK pK 29|[5KtFNu K5|Kt5FNHNFy F4VPVXK@XK1@j@PvU1@PgF ~4D$F(^$F0^,n#2^8K Kt q4K^G FtH 7~ F^_[]É K=hs"hl"hh"hl"hh"K<Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP KHKN^,H hKlKpKH@xKP xK KHKH4IKH89t;tprpK40Kt4F KH^h"h"h4h":USWV}]uuu W@t \K1@`K1HCSuu WW KN0F,xNF4VPe^_[]vjv < fUSWVP|$g$&s &G4$O,52w0VPww D$0^_[]USWVPt$ff$&s &F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jz8p KHtƒQ K@ K^_WVt$ KF0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdDF3hjv(; v^_ USWVPT$|$:%4K\$ K$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4K1ہ=K| t PtKK1t 98t@^_[]Ã^_[]`V15K5KhVhK : 5K^ft$ t$ jMSWVt$frLN4F,=2~0WPvv 1$&t\fv4V1AN4F,=2~0WPvv 1 &1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR1׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS_$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h"%3USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPY3T$3D$M u1^_[]USWV(t$FpaFaF 1bF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"|$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthuW1$2L$1 QWPUSVh4jÍD$(Pu Sk \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4j)Ël$hu P $\ E1PU\$tE|$8t ho"z,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"zt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"GB$  $ V)19tQRhڕ"dG 1@^USWV |$,\$$t$ tCPPt Ttt4RQhȒ"UN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthْ"FFhd39D$(u KHKpStURQPt$DljT$t hږ"wu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" KVRh?" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"Vt$Ht$wL$tI9ȋt$ tPQ$$h"1t$5\^_[]h"hv"h)h"Vh"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt讵|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ [,[D$ p D$D$D$,$D$ -,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWæƋD$0T$UW触ƋD$0 u$$$UWlljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPERP$GW #RPڥERPʥ$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW6Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP趠t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP+T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPx|$FV D$t RP[|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPF|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP轜$ D$TBL$?ttXLT$BtJ J T$$T$ QPNL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP踛ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV蠙D$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 蚤A L$H SjQ ^_[]fUSWVL$T$ BKulF1G&Uh#,$l3H l3~d3H d3 hd3j "u q1^_[]V3PPhd"VVjjh""@&Ph@#h3&ujUSWV׉΋*h"Uܗ&tCt[PUjhhKs 5K育Kt2KKWVS5K(k^_[]Uh{s"jÛ5Kh$jUSWV$:$D$VuP诬 9$j uP蒬 !1ɉ\$QSu# Ƌ88"u11F9Ή$<$1ɉQSu 躀 ËD$8Չ8"u !t$$Vhyd5K tbVhg"^_[]jh"7jh".uh"$h"h"$p h5"hM"j$05Kh5#j(USWV}E phDH%V~FhȘ"Vhh$VRSD$(P5KZ#D$0= M$L$A1yyy D$Phwd5KS D$tG\$ D$ L$|$j 茤ljL$ NjL$IuɉNjD$ D$|$uhjD$v1111O w+Ow?u$L$A1AAA D$Phwd5Ki  \$tmt$ NL$,D$(KD$FD$FD$ FD$$~D$(PPWt$,t$t$t$h"g KuD$1D$|$Ynhxd 5KR5K1111VQRP5Kh"hxd 5Kz KLQh8"ww ww5KhQ"w_G|$9w  jPQ5K!¡KtNSVPh"QWt$ 5Kd $9t#"QHhd3SVPhk"CكT$;r ZƉ[|$?e^_[]jjc5Kh"lh"h"hΘ"h36 j Qh"WV$u>$jvW s'Wh{dЀ5K t^_jh"j葕65Kh5#j譕VPPhtd@5K $t%t5Kh"$"uʙ"5KQK$$>">"scp#QPh" K$$ >"scp#QPhC"` K$$>"scp#QPhk"; K$$>"scp#QPh" K$$scp#VPh"^5Kh"jWV$u^Vhzd@5KJ tH$D$PWVh"$PwwwwVh "x^_%5Kh"jUSWV}D$Phd@5K tzD$Phd@5K u5Kh?"2K$|$\$ t$jVSW VRPSWt$hQ"e^_[]f5Kh."j9SWVP|$uX|$_ho#SƅthH"Su+1Qhwd5K t ^_[75Kh5#j轒USWV|$0t$,1@ U 3$1ۉ؉D$h|"WVF qt\$te+$95 31|$7wWh|d5K+ D$ ;D$t-i9l$sUt$QƉD$l$묅hhPV藻KL$ cp#th#RQPhݛ"|$ t\ư1P`VvvvvQPh" G;|$ ru5KhÛ"$t1^_[]W5Kh"j*5Kh"jjP|$u1Phd@5K KtQh"=XD$ 0Qh5#jSWVP|$t$^h#StDhx0#St@h@$SttT$da3 D$dD$ tTj/SgtF1;tٍT$d#3D$dD$,t>\$:t$1\$(X&&h"W  u1\^_[]hG"h "z 3=Kuj=ĪK̪KKKK KYh"5 UhӜ"Phd"j K=ȪKu th|"0"K Kt uh"t=2uh˝"`)ǃ|u D2j=تK|$\G1PPL$lQPjWȻt2t$dt"1PPD$lPVjW蜻t52=تKu4$P52ju#$=uتKȪK ĪK ̪K K=K ɡ2=تKt&jQPV 2u[52hN#jhh KQP2y"T8h Khܻ"2 K=تKu'L$dQPy52h "hKhrdAP= 52hI"хhKhedA52  52h["h Kh"莅$$t(hQP52h"$$ƒ DK>s1@![Vs ) ȣr$r$K KKKu 22]u1hQP|S 2u25Kh$߃52QT2j52|V_Ku Vh"8 11hKt1A1A1ۉL$@1hKdK `KhhK=Ku#KKKKKK t$\F|$LSSWSjVmt$L蓏Kn 1QQWPjV;y5KK52j/Vt@UUUU)ʹ3333!!сisK1Kt!ttKKcԋK KK1K‰ KKK1 K1AhQhKcm i-K=K / KًKP+==w !r%1H$D$ ʀŸw1D$ $}ȹKytKt  uK1I $L$9 K11O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj DK1҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$K-K=KKD$Kt T$$T$K=ԪKuu 2; K7=KlK_h""EK81uhU"-KL8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQR~PSt$@t$,t$4t$K1K1Kޅ`1PPPPPP =28h"1K8LFu=KuRhx"%tajh"b1к"WjWWWP+h"t҉Ku K=ȪKuKu ̪K1g=ȪKKD$tD$|D$h_")K1N=t 蹵@ 1<"WhVVWP+9tigfff։f5KKL$ȃjP݌D$ u hp"jwh}"(1HL$ Ajhk"1۾KD$KtB?t=kWUh" KL$ DD 3$ D$tD$D$ uK K1K|(.tq<(tk{PWh"? KKKt (BD$,T(2D$ TL 3$3L$ щtT$ KT$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R趑K=ueK$@D$ $#D$u D$ &1$L$19;ta $ȢK=KuĪKu̪Ku ȪK=Kt8K~ h"~hK~lh"c]h"4&=Ku1IK tKt h" &hZ"tKohKe$j%t1 KKt Kt3$ D$ K u=K5KKK1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ K|$E9u KD KDKDKDL /K KWQD$lPz D~ l$0$$L$ *D$ D$Xl$0|$$L$ tW$=KtduD$P $OD$hl$( >-K1ۉl$(-D$D$DK$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$K K5KKD$t$"C5Khe"0Phs"!h+" K K525dK5`KRQP5Kh}" hK" K K5K5KRQP5Kh"5K5Kh@" USWVPˁˀ K K K1KK~t=uKt 9r u֋ K~:K”>u~t:t  IuȪK щ $ ̪Kt&=uKօ4$u KGKtiKȨuh "h%kKtjK=uKЅ$tNK=Ku"PhB")0h "Phw"t K =KuQ8$$t`w%tNw%1KtiKх $t4$P5Kh˴"=Ku5Kh"1t"1K=u KK^_[]VPD$ L$ $QPgh"/3H 3~ 3H 30h 3]Ɖ t9tD3H 3~ 3H 3h 3ƒ1Y^h"j YUSWV1=ܪK˃y CS t dK5`K11 uY1ɉNVt11@5C Cg"t"Ph"5W hT"1He^_[]SWVP$2;2u+تKu"QhmdP9 y h#V11hK<=Ku;5K|- K1Puhe"V=K~e1K111 KKPt,K8C;K|hC"VShz" V$2;2u+تKu"QhmdP. y h#U^_[USWVP։赽1ɉQPUV 1O}t#Ë$8u茽8"u r1^_[]USWVP։ϋl$=KT+K Ktúcp#tJ$76PSRh"T$7St$h"D$7UPS\$ Sh"7PUSh"w77PUSh˰"Q7PUShܰ"97?PUSh"77PUSh"7PUSh"7?PUSh""'1PPPUt$(SRht"^_[]USWVˉ1u=ЪKh"DT$$8$43|$͉)uhcp#Wh" |$Z)uhcp#Wh"{ D$|$K:KK Kl$M?>KKKL$ u}tGE)9H9^_[]USWV,։L$D$DD$+"tD$F"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h" KKD$HL$LVSQPD$T$D$PVSUP͡D$|$ D$@VSPW象ljӸ1=2ƉT$ L$@PVt$QRuPSW|$LWVUl$lt$,t$,t$(t$@h",h 3jdhK |h/#hKK\$ $t < uC{ - 3DAu<-j D$$PhK D$$\$ h&SZK|$(@D$Ph"Sw^ $ϋT$ t։t=t$h?&SI^ t't$h "S3^ ct$ |$@D$1=2ы5KjVWRD$ՋD$D$D$D$D$$t$t$D$$  T$Ku1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th/#SL< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh3"KV(ƀKt$Vh " 5KD$,$t$P։ω,^_[]h"jHUSWV΃ twttu"^T$(|$$+KуD$ ;K"L$ K|.|$,T$0 K|$9=K|=Ku|$4u 1^_[]Ë-K~} ʉ$9twK|(tk Kt( T( (t1+K9\$ \$$}2;T$}#=Ku6|$4ttD(OG1nFݷ"t(n9Չػ}n9l$\$QAuƉKtt  $tt ^K K11 Kt$ -Kt$|$$|$}K] ʀ|(tP Kt( ;L$T$|L( (9Ή} =K{|$(t ;KKC KK"1$t=t K KS_"=K|$(5K5Ka1KKKKKKKƆKt$ |$(PK9Ku85KVa1KKKKKKKK1Ƀ|$(T$3\$1 5Kn K|+D$Nu K[\$j5KK)؋ KP|$(t$ hhjYKVfǀUKL$ KD$KƋD$$ȉ5KKK11KuK=Kh""u׸"D"=K1|$(9 Ku85K_1KKKKKKKKJu UPQM K1|$(tD$KD$K5K=K^_[]hp"j*CWVKt^ tڋt֋|҉tΡK4 K QPVlL Kƀ^_USWV T$L$K@hPhK/  KK~CKK$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRK K;UjP fDŽ;UtZF , M ;M;MU;; K KT$)ʉUL$  K1 EE=K KϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! MK ^_[]h"j@WV1=ЪKAut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$計!1Kl$ 22uhUP zQ5KP2  ;2u[jVW52F!1Kt?D$H5K#$SUP y 52V52  ;2tÉ؃ ^_[]h"j>USWV$0$,1@D$l$D$D$ $1h"WVLF suMj U5 U á U8=L$908"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J- 3)1<$L$jhQP4ThKhedAP脆 =K=Z9l$| 0Z@fKUjDž\$ t|l3H l3~d3H d3 hd3j /jhKhd3 l3H l3~d3H d3 hd3j <$ D$ttcp#t$"Ph"D$fKKWafKgdWPVU xnu)D$PhwdV: h"h"tVK 1^_[]Ph"25 Uh"j;4 hW"hz"6njlPh1"h3ǽ jMUSWV\T$%d`t$$t },u$t$ t$pL$htt$lL$\&T$$wD$$ 1H1 u#D$P#T$@ t h#"D$PL$@ 1Ҿ?9|-T$@ T$Pt# tj jt$Xt$LhR"vD$ (t$`uD$},u+=D$},u8GD$hT$@D$P uЉ\WD$)4D$\D$@T$P t1҉WD$)wT$ WD$)D$@t$PGD$D$$D$D$8tD$0|$uD$,tD$(D$HtD$D\$1 ud$u%|$vS\(ڃ|$r0É;|$t$`t$P|$@|11ډD$t$htt$\] t1\$9sk<$t$ u D$DLL$ ߉D.uD$ +D$D$ GW+T$D$`GT$ WCD$D$$D$&<$t$ uuh"GD$.D$8tD$0|$uD$,tD$(D$HtD$Dt$ptt$l1 uЋ6Vu\G[0W*PVu h5#E 1HD$j5KÅy'5KZ0*PVu h5# $DPS.7y'5KZ0)PVu h5# $L%=ta= uDKu DKL$t$QRPS5K~ul5Kh,&5Kh"NDŽ$$lfsD$tjV$$H$ $L$ Z$ $ u4h*"L$ u.$$lfst!$$Ph%q%4h<"L$|$u$=2|$TtK1Kɉ\$Hu0KtL;$$ s5$$ %DŽ$$lfsKt$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s hV" h"V~L$8J#$L= j|$W$($(uD$8T$ t$VpN|$(O11VSh$Pt$XxHW6D$(+D$L$,L$ ʃ|*5Kh"}1D$(+D$L$,L$QPVSFD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$D$\D$8L$\ 4&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xx>W(FD$(+D$L$,L$ ʃ{1QPWVth"j1F\$D1VPSh"WoD$XWVPSxE%|$$u1Ʌ|$t1ɉAw1@|$Ph5"oD$tt$5K5K5Kt$\t$dt$<5K5KQ5K5K52PWt$L@ƃ|$4tVeUSWVӉ $U|$j W\$ Sw Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ T8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"jUSWV31F/WVUh4" WVjhd" WVj!hz"v WVjh"e  WVSh"P WVj+h"? WVj;h". WVj$h," WVUhQ" WVjh"WVjh"h"WnWVj h"WVSh"VCcfD$t1B9| 2I 21$KIu顴2PK K 29|[54KtFNu 8K5,Kt5FNHNFy F4VPVK@K1@j@PNU1@P?F ~4D$F(^$F0^,n#2^8~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS7$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]hh"hY"h h">USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP13T$3D$M u1^_[]USWV(t$FUFUF YVF F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"誈$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthiW1$2L$1 QWPUSVh4jÍD$(Pu SC \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu PZ $\ E1PU\$tE|$8t ho"Z,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th:"t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPhy"SB$  $ V19tQRhڕ"D$puD$ 11L$ I,$t$UQPh˓"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$h"`1t$ \^_[]h"hv"h)h". h"hv"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$g"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$"pu0|$ r]@hD$D$D$,$D$ 3,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$g".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DTKuG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW蛲ƋD$0T$UWƋD$0 u$$$UWDljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPױERPDZ$GW #RP貱ERP袱$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPhg"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPhg"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPhg"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP莬t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPP|$FV D$t RP3|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP軪 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP蕨$ D$TBL$?ttXLT$BtJ J T$$T$ QP&L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP萧ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVxD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hՔ"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hH"h"h hh"hY"h hh"h+"h"h"o USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p rA L$H SjQX  ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP!-1 ^Vt$ V(1y?1I+F$ыT$ptj42QP,1 ^Vt$ V(1y?1I+F$ыT$ptj42QP,1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jL跭Ɖ t,U荭Ftf^81FF"PUSWV=PKtp\$1 ^uXGourEr?E!u$t.E( E,tWt$t$' Ut$t$ F(u1^_[]USWV(l$Dt$@|$<]N(;LrN,t 9ы|$H1|$<΋t$  KuN KNVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVhA"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"jDx@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ KKuPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp & ^ hjS V^_[]h"h"hh" USWV l$4E}0I\$8u tȉFSt T$$hmF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|ttx/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$"袵\$8u;l$L$4A(I,WhT$L$$D$ [ l$u L$4A(I,T$L$$D$ $ \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$ kF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$jF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tW}sƅuWh]"jr$$<$4D$Phd@Ul tj1OLVhedAU譻 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h9%t$}1 Sh"Uё CPh "Uo C Ph"U] CPh"UK CPh"U9 CK,C,Qh"U! C0Ph,"U $@D$t P(1-Uhzd@$<W臺 t1 VhedAWl hjUC D$ P$4RD$, 9L$׍L$9u0$S11:8tx$0ht"ob$11҉ $ƅ*ŰPyj PU老 ^_[]$0h"j]pUSWV81ۍD$4ShPSu舆1NtAljSPSWuW2?uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS hx0#Ut.P|$:"V(t!UhU"JUh;"1OUh"l$D$QUPhՉ%WytPUh؉%WbiD$$Ca2=ouVQ\$&V{V,$( ]hh"W ƃaT$q"V1u\$ىjW$( h" VT$X"V$$ h"V ^_[]1ىj=ߊ< t< uGjhN#W k2$( aj2WP~ EKu$( 8~y$( 1\$ىj(Sh$Pl u$PUhl" "j2PW&~ E2$( ;(|Vn\$}"V$( @V;T$d"Vg$$ hK"h"uD$ $PUh_"SëuU5<Shhg" $( aPWh"Uh&"$( x?$( Z1ىjPySh$P8k uSUh"5 j2PW| E2$( ;h||$jt\h"@PUW膥 $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"WUL$\\L$\\ $\]u^E T&Yt8u1҄tʋ$( t?r QVR V q)8uUh"Ih"Ph"4USWVՉt$hRK 1I t uFjhN#V u<^Ft t u^F t tWPWV tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhVp űD$ 1GtPh$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh"+C< t< t< uhx0#S ƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P蝧 t$$$ىh"rC< t< t< uSþ=$<rLjSh,"ShH"zfSh|"'h"t$<L$D$D$L$ oPrtXljo 1tX L@uH~vCtTjhhV" V覽$^_[]V荽 )UjS D$ D$ CD$CD$C D$C$Cl$Uhep#Vqz u D$CV)1$<;obD$D$PSh" =USWV$0xjWg{ƅ~F$0h$1jU8{~4$hP C9uЋ$4hx0#S[Ǎ$ىh:"$0Sqt| uƄ$ $0phi"QUyD$$0qhs"QPWىD$PUPUS u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Phщ%SD$L$ T$ ыD$E L$ T$ D $A9L$D$uPh"h"c}Sh"h" Sh"h"b $02t$t$h"$@t$Ph"u |$Wx}~14G;}|V1^_[]USWVD$(}~;$ ~VE pSt $PjVWjSyD$11D$D$D$D$$D$ D$h$"u Vuj H5$D&D$>j 5 UPt CrK밋 U$P+Crj ho#Vo ىVS.1PkuE$ ~S4Vo $Ph jSPt$VvuVh\" kWh"j^ÍD$LPSru $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV> 8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQ $PhV"Phr<rr h"jhr +rryt$$$PVW>ލ$P|$xh"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP܍ $Phq"Phr}"t5"PSh"# .1$P;$hn"Shrt$V"9;$PVh"|$$Vh"h{"jhr t$Cj=K:$h"Whrt$"?c.\$jh"WhrS$d|1$XAA$Pj2PQ9 $Ph>"Phr9rh"$`>ߋN8\&w&PVh@" `Ouet$$P\$ ZSh"h"$P\$;$PPh="N V`h-"Sh*rt$  09rh4"h@"$\>$Th i% VhR"$X~:$\1j hD$V "tQsC`;$X|j ~-hw"K$`>V;`Ouj k$X1~$1:t @`9u9u$\Ph[" 1@\D$,\$H|$PS1$hjVM L$,9F Vh"VhrWN h^"}F0Ph"F0Pv,v(v$h"nj hk"7$Th"CPh"h"FhS#%V荇D$0L$4$PND$8Fh9"Vh(r W  FtsShX"$PtPhR%hu"$Tt*Mbi)QRh"z j $XqPSh"P ]h"$X~n$1Wȃw,#"$&L$S7"!""\& }""PRhJ" F`;$X|ۋt$~G$`>G8tu #P\&w ̳&QWhJ"} `Kut$hn"VhrP >"t"P%t$1 E$`$d $jj h_$QPjV1yjhs`$Vc V$`t$Vh"$XMbi)QR$\Vh,"$|$|$|$|$|$|Vhi"b $\uMh#1wh"!L$!r"$PPVt$h"!11҉4hӀB9ucp#th#QPt$h"=K~S$h1hR#1PQh" C uߍ_ j  rt$h"Vh&r@t$<#;$Pt."}"t5"RPt$h"t$ USWVdp׉L$$xph"StÃr t1C$|L$ PVQ> Ou wu pu o$1hoVWڲ owt1$4 j2tW` F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0Ghh"W` Ƈ$L$h"Qh+r|$W9uh{"jhr Wdp^_[]ø"1@$" "$Pt$h"h3WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhx%Sa tVjh"Sa tBjhP#Sna t.jh"SZa jho#SBa u$D$D$h"PhrWh"PhrW=Kt?|$"t"PVh" |$u$4&Vh," ^_[$oWVJƿ3Ph!"W Vhd"W Vh"W Vh"W Vh"W Vh"W Vh"W Vh;"W Vh\"W Vhs"W Vh"Wq Vh"Wb Vh"WS Vh"WD Vh"W5 Vh-"W& VhD"W Vhe"W Vh"W Vh"W Vh"W Vh"W Vh"W jCVRhQJ t^Vh$j^KWVPΉ1WPhPPj PQ4 u^_Vh"QjJUSWV։ωl$PU\$hjS E9C Sh"ShrW Vh0"Wssss hI">ss3h"){""t"t$(Ph" t$4t$4t$4h"$t$Ht$Ht$Hh"D$8Ph6"$t"VhI"$4&h\"{$hs"gĘ^_[]t$ t$ t$ ے tt$h"jIUSWVӉύD$(jP#\1t$`FFF FFD$hcp#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPKD$HD$PD$P 8&5,&|$D$ fD$ l$ \$Tl$+D$Ty18&Ph$j($PT$D$ +T$(+D$0хyL$XD$\D$\5<&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P4 DŽ$ <\$D9r<s5=K ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$hs%S t jh#S7 t ;/u f. Gf./WS9SWqt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS9tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 ,KH $s-t$$tHfHxt P2)1^USWV=Kthd3jjh"Yjj9#tvƃ=Kthd3jjh "Y0K1GNIIˋ^s ,K tVfV(0KޅuW\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=K$ WbPt$hKhg"hd3Ut$$t$$|$$WƀH1@=KىV_bPWhKh" |$u V[v vYKF$5KUt$$t$$WDUt$$t$$W.PZN1@=Kt-ى,VaPWhKhg"hd3 ؃^_[]S1KK|NILKt!hKvǀKAPEǀK|ONTt!hKrvǀKFNDǀK|INOt(hKLvǀK|NAMǀKEFNDƀKt(hKvǀK|MODǀKECHGƀK[SWV=Kthd3jjh`" Rt=LLuFFF%)Fu9rV9=KtJhd3jjh"]DF Kt(t$hd3jjh"5DF K1V9vtRPh "hd3 Kthd3j ҟ$ 9̓>t9߁^_[]áKtPjt$t$Cuù2WVIAfF=K|CK)fK5KjQhK2Cu5KF1KPVQ =KFK^_ù2Qht"xv8u"h"h"5Kh"h3贑j:WVjh21t)h t 8@ W^_VK Kt7#K=@u%o>K KtK!=@t^USWV$$$ $jhWVU,KtE1M1 tmjWVS$8jWVS$8t$ShIz%hV茌VCe$ KU Rh5KDžtGhs%PftShF"h32 5KDžtGhA#PftShn"h3 5K[Nj5K1jPP6V+^^$DOGrhPD$Ph"h3膏:hPt$V1 $(j7V@ Ku D5KNj5Kj1PP64V+^^X^_[]SWV׉1jPP1V+FF9tX\$)yWh1"h3͎ %؉jQP6U~tF hP6s F^_[USWV|$_ OtGhS7E GO9}vDty)9|n4 ȉG.uFh.%Pd;-8K1^_[]USWVD$$PD$x/@th.%QȐ1ƀ81Mbi)KH1ًP1 t KP RVa5KAt\G9uGSVPnb t5KDžu*h.%D$Ptƀ8MbE^_[]USWVt$!M1 tFjhRW,Q,Kt(E1M1 tm`ƋU R^_[]ËD$0%USWVX=Kthd3jj&h"<K G1t.VE/tÀxtVh ">߉^_[]USWV|$u h;">WU Lu`Ɖˋ-KU$ DžuhE"z>-K)ً L9w؉9vlj< L|$ LWS^_[]USWV։ϋ\$ t;=8KWS L L LF$5 L^_[ËAP 9ttЋR9uIHËIH hI"Qt8Vt$V^S L L^SWV|$t$Åuh*"V,8;^ty^C Fs j/W2DGSR L LW WRFV86PxT1ɅF fN^_[USWVd=Kthd3jjh`".=Ktd|$xh@$W~ƅu0&b0?1Phz"h3l} Wh{";t$ f ^_C[0\*Phc%hs"h3vj kVt$5K952}/Lt P1 PLt52^1Fh3Vj&h"!'VjV|=Kthd3jj h"&=LtF1PPhLz; 2yCmZ0)PhLhY&h3u=Ln2K KALL KL~P1F K9|L=Lt QPx; QP52 *H K\L=KtPh #hd3t ,Ku@ L L LK,Kh3jj&h"%=LtD=KTtkLLLuI) L=Ku =KtuB K K KKK K DK@KPhs%D$hs22H=8K,Ku.=Kt5LhW#hd3ss hx#%19 =,Kun0Ki ,K_ =Lu,K|^1PPhL=:W0&Ph#APh"#91Fh3Vj!h5#j1Fh3Vjh#XpW0&PhG #h3r j\ 35K5Kh#h3\h3jjh# =Kuh"=K Wj5L< =LtjW#y'(jPW52"!ƒ=Kthd3jjh. #k =LK@1ɉ K \LP AL  L>t=KtPWh#hd3[ =\L LLhQV| LL^_[]tK PUh#k s-LhhLU. $?0=Ph #h3jZ jNUSWVE(KfKK KD$#h3hM jAUSWV$$=Kt$h#hd3.M Z$ $(މ4$9{CKQPh"hl$UH=Kt CU342h #hd3LtUCKQB+{))σ5#WRL$ QP$(UCKQB3{))σ4$U#WRL$ QP$,BCKQB;k))΃D#Vt$RL$ QP$,t%=K$(tqUhf#hd3K \{$(u0jhv#D$ P tFjh#D$ P tk=Kthd3jjh#E9(jtzwC@#P$"6C@#P$"C@#Pj$$t!!C@#Pj$$! u_{C@#Pj$$!!C@#Pj$$v! =KJ=Kt&cp#;$ t#Ph#hd3I =Kthd3j V^_[]*SWV|$t$=KtLWVhLP =KuWV5L t^_[Ë5K=K(K-0PSWVh#h3$Ij=SWVt$=KtLVt$hLP =KujjV5L!ƒt^_[Ë5K=K(KW-0pPSWVh#h3Hj =Vs,KtufKVVVC ^PD$L$ $QPh3KL XffG#R;;'BBi>V=LLt114Bu11Bu=Iu1@'5(K5K5KPh #h3G1^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=KuhVx=Kt 1^_SWV|$3Wh#S> SHKHQP~ Q1 PN tHKHQP~ Q P t HK@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#h#W t9hl%Ww t'\$j SWc $ 9uy6hD#U$~h#W4 t@hl%W" t.\$j SW D$ 9uyvhW#j=D$PhU5(LB u ^_[2hg#j3SWV |$t$ >h#W t9hl%W t'\$j SWk $ 9uy6hD#U$~h#W< t@hl%W* t.\$j SW D$ 9uyvhW#jED$PhU5(LJ u ^_[:hs#j;USWVh}$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUhg" tjUh|#| tG99ufD$u\$ tR$,4jVh%0 EjVh# 4jVh# 5\$ D$7f@jh0uht$Vj P5(LD$^ރ9tD$j@h#P ߉tD$PDaryDpriml$t?tD$PVD andfD D$P:DgrowfDnt$VD defDectsDuVjh#P$ V5(L5(L5(L5$Lh#^.Et2tR}jh#V H}j1hx#V #}jIh/#Vz t6Wh"-Sh$-UփOut$ h#n_^_[]1h]#jЭUSWV}\$j S5(LO D$t"NuD$Hj@PjSPh#jm$j$Vjj5(LrF=tPh#,D$D$ D$$fD$t$j VE 0K3 9 1L$81qAQQ a A j QV5(L-D$t$ *jh#E p  D$ @L$jhtjPjQ5(Lh#+hd3D$t$H1D$`D$L'Ƅ$0VhQ`5(L) $j D$tPS |$'y9D$(ȋL$;&|"@D$Ph#<+hd3/j nD$$<JD$ D$ L$jhtjPjQ5(L~e^_[]ÄtH<t<u'5$Lh3# 5$LhN#h3Q- P5$Lha#h36-h#*h&#jE 0h#`USWV $ ~($ 1j4h# ?C9u1CCJt$LUPV  CJjh'UVjS5(L~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5(L5(L5(L5$Lh#y) vL$D$$jh'hVjS5(LFfȁw$VhU VhU ƅtL$D$jh'h$PjS5(L]$f1Ɂw$PUhWh#gZWh#y(vL$D$jh'h$PjS5(L$f1Ɂwh#Yt$ t$ 1؃;D$ D$4ƜF>|$Ń h&h"cp#t>"RPh## $LD$tcp#VPh## $L|$ >"ycp#QPh #[#,^USWV t$4}ty|$8h#SLt:hx0#S:t,h@$S(th/"St '1̓uha$wtR1ۉjVjj5(L7 f ?F$ȈFfFF PVQ5(LY 0^_[]Ã|$ u(1AA5Ph'PPjQ5(L$V(|$0D$40liб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P5(LD^SV|$$jVjj5(L^$LtB>">"@tcp#QPhY#*! $Lycp#VPh# ! Ph2# $L|$ >"ycp#QPh# $^[`USWVt$,}ty|$0h#St:hx0#St,h@$Sth/"St '1@̓uha$wit1ۉjVjj5(Lf ?F$?ȈFF PVQ5(L(^_[]USWVhԫƋD$(1|$|$ |$ D$D$~{ŋD$,Sh#tMSh#t?Shl%t1jD$PS%& L$9=r1D$G9uD$@@ jh0uhVj P5(Lȉ$=r%ht$5$Lh'#$<$r],$1D L Tl| D  PW5$LhE#|C9$uV^_[]ËD$,4h #jžh#D$Ph#8VD$P H PpRQh# tVh#^h#O^VD$P H PpRQh# tVh#^h#mO^USWV$Gh4&V Vh5#N r[hG#;O yj hW##O,@tPhl#O, tPh|#GȅtPh#GȅtPPh# O W hVbVh#GtPh#z$hVjWƅtVh#Nj dt)$1@9}$݀ KAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ,L,L!уu+D$T$,L,Lhm2#jePh2#h3 jUSWVP=,L5,L1,9|1C=,L5,L9}`s&H-x&E9ƉMm|)t6jju uL$L$9ȃ}  $QS1F,MUۉu1;}E|uxSE EmubWV0#V81Wj8Wj-Wj"WjhhVT^ x`j"h0#P\ h,L jPV\ jh6%V\ (LWPWVy\ V^^_SWV։ϡ,LH ,Luhh,L,-Lh0#h0#hS{ h@$S:tZÉ >1#tcp#h,L5,LPh1#S=Y|@h,L PhE1#S y7h0#Ph0#j<|.i< cp#th#QPhb1#S t Sjj!h1# Sjjh1#,LtSPjh(L|h-L"u;hV(j螜S>1W芜WV^_[WVP1#=(Lu%(L<u1#(Lu1#uۉ"h(L5,LWh1#jjPh2#>=(Luh3#>=(Lu6hhh$2#[ xjh.2#P Z V\(.LWhF2#jQVL x.Lh,3#x>jΟVemjOhN3#N> (Lu(LujjO[1#u1#1#u1#$=(Lu D$@1#D$=(Lu 1#=(Lu 1#=(Lu "=(Lu $=(Lu $$ (LuH18h0#,WPV[ 8Vh1#j  8Vh2#藊j=(Lu h0#,j`jh-L h2#fUSWVكှ%] yBD$t$p2L4$D$4$D$$5#%sBD$t$p2L4$ɕD$4$D$-5#谕% sBD$t$p2L4$聕D$4$D$55#h% sBD$t$p2L4$9D$4$D$?5# % sBD$t$p2L4$D$4$D$G5#ؔ% sBD$t$p2L4$詔D$4$D$Q5#萔% sBD$t$p2L4$aD$4$D$6"H%sBD$t$p2L4$D$4$D$U5#%fyBD$t$p2L4$ғD$4$D$_5#蹓%sBD$t$p2L4$芓D$4$D$%q%}tQL$ D$h$D$p#D$ }|$t$p2L4$#|$D$hD$}4$ D$0D$D$p2L$}4#GHtD$$4#yG(D$$4#f$ z|$,u=.L2t|.LuteXu<$L$$T$ .Lu t GX@r9=.LuD$.L$"GXHw $\A#$1.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$1L$.LƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$IJD$(u;.L .LY=.LLD$.L$4#3D$(M I"$&|$D$ D$D$$$P_8.LZG4D$hL$$T$ JL$0$FLưD$81D$D$D$hD$ t$D$0D$D$$$ұ"4$~D$858 D$h$։1uG0D$$V4#D$,-1D$D$D$(D$ t$ht$D$ D$D$$$C14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$D$(D$4$D$.LD$(1ɉL$L$D$ t$ht$D$ D$D$$$荰{4$D$D$$螈`1D$D$D$(D$ t$D$ D$D$$$0D$($D$.LS1D$D$D$(D$ t$ht$D$ D$D$$$ٯ4$D$D$.Lc[iF D$|$D$ D$D$$D$ D$D$D$1L$.LV8 D$($zt31D$D$\$ t$D$ D$D$$$&A1Ah2$D$.LD$4#D$ @D$0t$h1AtD$h9k4$i^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$GT$<1Ht |$t$ $ϴT$a΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PS D$ D$ 938*V8\$ L$ D$D$W|$hE #SDhՃ&S;h`c&S7h{#S3hh=#S'hm=#SpD$t$ |$@d1ɉQD$PS D$D$ 9؋t$8/8|$1ɉQD$PS L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh.L4t2hk@#v 1<==.L ڍt$81 D$ \$phjSh.LPVT$R}$1BD$L4JD4`L$p$QRSRPV.L .Lu1$Ps`$w T&Qh.Lh?# .L1<=4 j=Vr9=.L j=VRT$81 D$ t$ hjVh.LPRWp|\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPТ$h.LhR@#D$49t 8Vh@#S1JD$ $$Qh??#,=.LD$t$=.L$D$D$,D$\$(VGC@D$p9Vh@#w0萤Pt$h?#|$oQh[?#=.LD$WSt$hG=#VD$ 81ҸD$ |$\$ Cj"$PyÍD$pWVPSt$ $P#\$ E $.Ljt$tS7 $.LjWV# -b0{Ph.Lh5@# B.L .L$Ph.LhY&D$ $u1@t$2|$ Qh>#(11G|$1\$ tpupth#QͅD$ t$D$t1@L$ ɉi%t-=#PQ^Q|$t F8t1j t$ j4$`St$h=#FQt$h=#7.l2m2L$ L$ ف$K{8P|$WD$ t@j QS} D$ ;$|$8tQtUL$4 T$hjRh.LQWt$.x l2T$ gL$4D$ .L1ɍAD$4tT8`T$ Q$QRQPW舞c.L .LT$Js`$wT&Pt$h?#t$L$ $d$ r $3 $tu¸{#tm=#PQh?#|$D$u |$u |$TF1@]i%t-=#Pt$h =#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qht?#0豟Pt$h?#|$L$lj% L$St$h=#{D$$ &+1ɉQD$PS L$ 9t 9St$h<>#,D$ D$ D$D$0L$0RPQt$,t$$P?tBD$tUtsD$ |$.LjVPM D$h|$tm811FD$&|$.LVVP  D$'$D$8|$.LjVP D$p.LjVP UD$1=.LD$44$Vt$h=# Ph4=#=.Lhe^_[]4$h>#ًt$D$t$$t$S荾@9s Vt$h{># Se@D$t$|(1ɉQD$PSHJ T$tD$pD$ 9t8u8 St$h>#Qh>#1ɉQD$PS ƋD$ 9t8t}St$h]>#St$ht=#D$t$։D$tL$8`OGL$0d$ rxL$D$nT$+L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h<# j(j-QPh.Lh<# h<#h?#h@#h.Lh4#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS̗1Ht$L$ltT$d;WuT$h;W(u Qo ŃtD$ppPUe D$DGXHr P"oXd^_[]USWV$l2`0L8.Lt `0L/a0LSh.LtW.Lމ)ˉESQ|$ W DW`0LV @V胺fǀ`0L/SU谕u.LUh`0L?,^_[]USWVhT$D$5#&1Ch`0L!D$ CL$;rjt$V ufD$jD$Pjh`0LVBt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPhzWt$hf5#|$$j@WVPKzWt$hv5#jgbWVPt$=h2Ph"Wy .Lt5.LPh;#5h2VD$$PV5h2? .L^_V΅tOHw;s1.L .Lte0跗Ph.Lh<#M Atʡ.L .Lt"h0聗Ph.LhY& u =.Lt^j%USWV=.Lˋ}.L .L t u tthd3jVuA}ti=.L|}t j MO؃thD$VuPߚ t$UtuRh"{5p2Rh%v% bD$VuP艚 tMD$PVh%<# D$VuPV t+t$ t$ Vh,<#]D$ s*P? D$L$ r!QPhA$ rD$rIPhep#QPh^$xt$h0L$;}u h5<#(j ?e^_[]PhH&USWVP=.Lu(ˋl$ D$$|$5.L .L t u^_[]Åtthd3jt$WT܅.L| t j $^_[]uCuWt$h"d K4$~DN1ۅtPh#Bt#=.LuPhL<##9t.LC뿃u,h5<#'t+ORh"rt51t ttt ttth;# 9uЋkT ;$tl  1L$D$Sjh" {t+1:LtPh;#w G,;{r܃TD$@TL$9uj oVh1A ^_[]h.Lh;#+USWV }=.Lt D$ toh;#Wtc1ɉt$QVW6/ T$$9t8u8,Wuh;# =.Lj11CL$ t$PSQVuu tWt =.L1=.Lu?=.Lu6L$1J1ыT$1 u#MUPj h;#1ɅRaMUPjV tK=.Lu-=.Lu$1H3$3|$ uMUjj h;#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh;#SUh#S t9VJf4$Euuhcp#TƉ$t^_[]h;#h;#j-Jh;#h;#USWV\։ύD$ jPj P 1u0D$F|fD$Y|Uh:<#j D$ P$L$D$ L$/Ph#j D$ P[ $fL 3/LA .sD$ L<u\$ SjPj SB E9[|$ t D$ PVh?<#d^_[]WVth΋u\~8tU~4~`N4F8 I9rPd1F0F4F8FXHr PdFX^_fUSWV\$3L3LhmA#sP\su 3L読hq"Pu |3Lj3LJmx &蹶'?c.53L芓hq"P艠u mL=mLxA#t#\#l$PKrt Pu|Qߋ<-t<+u{uNh2&S tGSM16kh}A#q3Lt8u)hA#q3LPqt 3L#hA#}q3LPqt 3LA#1=3LtjhA#~FP7֛j觛N=3Lu0j_`ujjB=3Lt!=nLu=|3LujhA# C1FVV7=mLuhD#503薞u\~jhA#B jM5mLf:0BuK@3L3L!Ѓt4DnL3LBzu=nLt0譚|nLjS=PnLu T3L=DsL~jhB#u j j 6GWVt$ y53L53L3Lut[<|=nLt=3Lt|2'V1Wu=WSBV8WV|$ W\@jPYtWP^_t$t$yYtjh"B#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@93L<3LU5{L襆=4Lu 3L4LU=v====,=XAf2 3Li4L4L 4LF=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff flTD$4LD$L$d$ 4L 4LD$D$fD$ D$5{L%Pj5{LRy 3L,^_[]VPhht@j> t1h>B#ktPN $t$uչ%~4Lh9B#rkt(P # 4L 4L2 4L 4Lu.hIB#!kt P #Tƅ~54LhDB#jtP # 4L 4L 4L 4LP^V[tPH =@@Lt1H VR^PL$$4L1Qw$p&QB#M(uMf4L xTB#4WB#+ZB#"]B#`B#cB#fB#=YÉiB#/uf4LlB#uf4L4LWV׉vu1=@@Lu WV藦^_SWVPhoB#iPi1Ʌ 2h%uiK&t@@LQh@4LPt@@LB#t@@LVy n)#D@LB#H@LB#L@LA;&P@LK#T@LB#|X@Lq"y\@L`@Ld@Lh@Ll@Lp@Lt@Lx@L~ nL@B#t @LB#!B#t @L= nLt8=|3Lu/B#@LzP&@L=@Lu @L1@Lcp#u @Lcp#A$@Lt8u3L@Lcp#⹇O&q@L=P@Ltt8u3L@Lcp#"q#:@Lt8u3L@L6%B# @Lt 8t1@ @Lcp#1@Lcp#B#w%VWWh@Lh@Lq)#s&V5@L5@Lh@Lh@LHP#tL%V5@L5@Lh@Lh@L?&tL%V5@L5@Lh@Lh@L#;tlj=@L#m@L.&z#cp#cp#tơ@L8t,<$1QQP( PW<$W@$hB#@Lv%=2cp#ucp#ucp#@L8t2<$ 4LIQjP謣 PWB<$Wf@$3#S>@L# tÉ@L#cp#tƹ"=L@Lucp#t‰hcp#Ɖ5@L>u KL^_[É$@Lz8{lV t<0 1=@@Lu Vў^USWV׋t$$\$l$;Et*+u(tL%cp#t D$ L$M^_[]USWVր9tMτtC1@LX U54LW @L1@LU54LV ;@L|ut$3L^_[]Ë @L4LUSWVL $։ύl$ D$?hB#Wذ)?SWUxr D hVUT $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$ixt$4hVW› L^_[]Ë @L4LV=nLt =3L=PnLuF @L4L@L8t!@L8t=X@Lu @L1B3L=TnLu @L4Lb=nLt @L4LH@L=mLt!=4L|1Fj 2F;54L|^Ë @L1B^ @L1B @L1B=@Lug=nLt =3LuN=nLt @L4L=TnLu @L4L=PnLu @L4L@LÃ=3L"@LË @L1BY @L4LHt$j5@L 1B)=mLtË @L9t4L =mLjË @L4L @L1BV=tnL@Lt@L1B5@Lt-F=P@L@Lt@L1BV^Ã=P@L@Lt@L1B^_%@Lt @L1B>@Lt @L1B'@Lt @L1B@Lt @L1B@LWVD$ #=$2 lj Ƌ @Lj" @Lj @Lj=nLttV$ @Lj5@L^_WV|$ 1Ʌ<+u OL$ GW誊-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%V舊trL$PQV t4uRL$xB# $x2P B#T$x B#$x C#w^1JB#^aD$# $2  @L9uVD$ T$5$2! щ щ! ‰ 19^Ã=2thB#Ë @L1BSWV@΃=2tt@LtVs3tx1Cj S*VGVFSP_GVhW%P$ @L=@L!VhB#j@WBWZ@^_[ËD$@LWV92t#֍|$RQjW1B$52^_Ãw&ÉfUSWVPt$ P!уtRPtt jhC#jh"C#l$$\$|$Q t^tY9uE}Y u 9Ճt(ˉ $19u tC ;$u~2KՃujhjC#t jh9C#jhPC#D ^_[]1ۅs IQRP踒fVt$t=2tjh~C#52^á2xy=@LuE @L0@#4@u.@LjhC#?t {Lt2Pm253LJ3LV1N=@Lt9t/ @L,@wB$@(@1҉,@Ɖ^USWV=2@L@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhC#1@$qQ52 9D$}@L럃^_[]USWV-@L1|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5{L(@L@9@S @L1JЅt8=@Lu/@u1u0@4@ '[WV@L1t[@t @4v @L4@0@{!уt RPF1G)t {Lt^_USWV@Lt>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH@L9t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë @Lt$@(@ ,@1HUSWV5@L1H(@$@9t#H1ًP1 u,@;Hs D4oL%D$z9tG1؋O1 D$ ~9 $tG#G=0nLt @t2x9 @}lh j~>tH @1HGG7FGF8~FNOG Fx ~,@;GsN+0nL~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@q!ƒ5@L@@2tOD2Q@u;G  )RQ@w u&@L0@4@&OD1@l$1tʼn$yjhC#1=3Lu 2x~OUQP9 5@L@@o<$t0@D$4@=@LtU=4oLu#L$ Qh$ 4oLj2=@Lt=pnLu q={L5@L9>tOOHO@L5@Lwx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhC# KL1H^_[]USWV@Lti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2á@L@u1I4@0@Ë9t1JQQ 9u@o @L4@0@1@@(@$@,@PPP@n!ƒtjhC#81PPjt$m!1WV@L0@4@!΃t@@9} 0@4@^_SV\$t$ 5t3L({@Lh8@j@L@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVl!ƒt@L @L@P5t3Lvz@L@u@^[SV5@L@  ˀuH9tPQP P>?dž @vv Hu5@L@uE u@C5@Ldž@tV>1@LP5t3Ly^[á@Lt@1fWV|$t$ t=ALttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVuTtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hcp#jThH#lLhlBLhxBLhBLhBL\$ -uF :tjhI#]jNbt'.t5xBLbt0:wtptcu+BLF&jShlBL BLjSQ ,uFlBLdBLpBLhBLxBL\BL|BL`BLBLTBLBLXBLBLLBLBLPBLhH#J1tPh~H#J1F$2VhH#WhALP(hH#dJVhH#WhALP ^_[hH#>JPJj3dR1B thH#Jƅu&hH#IƅuhH#Iƅt]h@$V蓗u6hC#V聗u$h G#VouhG#V]t1BC#w1 3TA ruƀ ALƀ ALƀ AL@=u=ALD$ ALSVt$ LBLM1ۅuD\BL;1Cu12(u!=nLu2 1ۅÉ^[D$ ALËL$=r!=ALtP5ALj h BL' ALu BL BLu BLESC BLÃw@ ALuQhH#VPt$ u ,BLESCuw ALu;Vt V5ALB$,BLxPV@,@ ALuPhH#V5ALj h,BL',BL^WVD$L$ =AL=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$T&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=ALt'~3P19wKS>~-19s2C,9r9v)CK$SUjuF8AU.V .o ɋl$u9tSv jt1|$jjSOF ~.EFE0uE^_[]VJLt";T2t1FVhBLP/ JLp^USWV\$,=ALtVJLtgفuHJLJ JLJL19*QhJL~-JL5JL1E4JLJJLJL1EJL=JLu JL JL1҅; <2t҉օt1PS;H*$h&=JL+"JLШu*%=tS JL1JL]^_[]Ét$JL5JL 2yJLBL)É 2n1|$ l9} SWhBLg uԉncp#tJLBLVW#=JL=BL5* JL8u!e0JLJLtP+JL%MD$Pe-JLE˨ -JLEJL JL? ǃJL^_[]JL] vJLeJLJL=BLv!x ux ;|JL=BLw%JLJL< t JL8 tJLJL JLJLB5JLaJLJL8r JLJL=BLwx u JL=BL\x tQ JL=BL JLL$:$2u)CSItPEMJLU'S,MJLL$JL JLtCJLQhJL91t"uPhJL: PhJL: JLJL;JLv9 JL;JLw JLtU uf5JLTJL=BLv@:%2uhI#N5.%t JL JL{ JLnWV։hBLNa 0r LBLJL9r1I~G@ JL19r 2Q1^_UWV1D$$D$BLBL BLЀ jjPj PPW tjh`I#11BLFЉjjQPt$t$Wbut$< w jjjj t$t$WM Ft됋}FD$>.uD$ L$PjQ课 $T$e^_]Ë JL1; JL|BLáJLt @@@ 1141PPUSWV=3L׉΋$$L$ D$1AyōD$PUS#D$=xhx0#UUG$W$ShUP 0jhI#U ShU! D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU  S]1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3Lo=82u=h2u =dhLP1TAPC]@PjVPW"]|8QZtQL8h@$W赈É4$pu1ND$PVIx#D$ =uhVhsI#a0tPƅdո(2Ex uָX2Fx uhI#h#S蟇 T$Z6VUhI#S:S[4$VWW/!V&!Ā^_[]SWVhI#/P/tt;^_[&hD#V]1ۅt+hc%Vq]tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%I#+I#Qh#Po tWhI#vZ Y=82t"hI#h#v: V(2=h2t%hI#h#v VX2^_[^_[USWVPӋl$D$ $uSPZSS1tD$ t}t8^_[]StV믉hBLjPN SPuSqWVJL8L$ ƋJL 4L9}I9uJLxtWD$JL$JLVJL8t,t$<$PD$JL8uڃ^_SWV BLJL$ 4L+ JL|51ۉ|$8tZO\$4L+JL$9|Ӏ8t-t$|$D$|$D$$8u$BL)ȣJL5JL^V^_[V5JLBLtRJL)Ɗ 0@u 25JLA=JLBL"JL=BL 1@^À=BLt8JLJL 25JLJL1@áJL8t AUSWVPQW$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhI#O+hI#@+VhI#P@ Åt^_[]jhI#Wz@ t VhI#Pe@ UXuhI#*VhI#P:@ ÅuVhI#W%@ WV9G t'փtPhI#V& G?G uG^_ÐJLi ËD$u5Ã<3PhI#USWVD-3LÅE\$9uz$1ۀ|tisljDDs9u>rjjx JLJL$t,tV#hj:} ={LTeuYÃ={Le4΃eJL~o6/=KLu #=(KL t t =^=KL;(KLCt}.CЃ jS&ed~hKL JLJL=JLt JL5=JLu!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=JLiJLih:%jjS\Fc`$&=3L R%t#-l25JL=ES[jUY  xSJLH݃t =nL-JL>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5JL hK#94L93L94L=KLSKLC1Ƀ 0KL$KLῃ5KL5KLJL/U]VsWWr!2@*=|3L%JLJL7nLJLh#jj$KL(KLn=3L 5T2JL }hJ#JL _gh%y1PPvnL1; JLJL JLHJLJL/=3L JL%hJ#1PP94L93L94L؉ك u. u.S莍i)KL5l2JL%aihR%{jVy$KL(KL PZw JL *$KLуBЃ@*? !1҃ ƒ!D$Z=KL,94Lt 93Lh 94LW jh^K#j#t$(VrOVrlp1BsRtM&=|3L=JL73JLЩuJLMj5<2ùe={LIv_*-t%+q1҃¹) $KL(KLS\B D$t1< 0KLD$ D$ PD$PD$ P萪 KLtjD$D$-<{|Q<`ʃ=0KLtR D$HL$@븃@$KL|$ ^s 8eBJLemhJ#1PPL!ùe94Le93Le94Le e 1?PS1FP@/$KLPhcp#50KL5KL虤 1;5JLJL|JLJLn蔰VVA 1;JLJL  JLJL|3L'M1PP53L =nL ,KL t|7ػT 1;JLJL|JLJL蛻=\nLJLu' JL|5 KL5KLPJL1QQm1;JLJL JLJL|3L|C=\nLu5 KL5KLP1PP53LA JLJL1҉3P5DnL1;JL JL|JLJLDnL聺觮5JL5JLDT5DnLJJLNVhJ#h1PP5 ùe94Le93Le94Le e /йSE*re|褹ʭOLKL1OL nL KLnL nL KLnLhA#CjjhjJ#JL݋5JL1ɸd9 jhJ#=t3Lt>t5KLOLKLnLKLnLj)eD$t Pj{@eJr蘬 L$Qh$1;JLJL|JLJL)O=\nLJLu' JL|5 KL5KLzMJLjjP1;JLJL|JLJL跷ݫjj蟷ūD$<3D$PhI#=3LjhJ#VR JLJL@nL JLJL@nLJL1ɉ JL|JLJL1@Pe(ejhJ#e1;JLJL|YJLJL 諶Ѫ=\nLu5 KL5KLLjj- JLJLʃEݣ`nLc JLJL`nL KL   KL1; JLJL JL|JLJLq j5<2?JL15 KL"5 KL1;JL JLJL|JLJL j5<2RCiJL1D5 KL=\nLt5 KL5KLJ1=W JLiJLme5t3LV?P/V$JL1ɉ JL|JLJL1@PuGjhJ#JL1ɉ JL|JLJL1@Pk 2V_e!ֹe5DnLRPyJ1A诳է JLJL1҉AQPcMOLNnOLJL>X`hJ#r1PP?ùe94Le93Le94Le e S賁+̲1PP5nLn豲צ1PP5nLjP#'JLJLؽy蟦=\nLt5 KL5KLGjj5JLd:0ؔJLJL艽*Pjj5JL9; eS贔D$D$PhHK#{豱ӡJL1ɉ JL|JLJL1@P"etbt3tFu j11A; JLJLwJ#|cp#L$QhJ#11%JL1ɉ JL|JLJL1@P'"e11A; JLJLwJ#|cp#L$QhJ#je5t3L<hD#P>5t3L1=tjh?J#o5l2JLnvhR%1SVUh蠻Ag53LrSPx]`nL 4L݉JL JLOL9‰}JL5JL)‰OLKLe`nL 4LJL JLOLKLi1JLJL15DnLQPHFjhJ#H3D$Ph0K#d ։u=KLtJL JLKLe,5KL5JLtI~V8Jjh$J#bUSWVP趮ܢGVD$1Ƀɉlj щ OLOL@L={LuH9ljD$u21xUUjn6 9-{Lu;=OLOLD$t@L {L2t8teue^_[]USWVPӉơJLuJL1 r4$0utV4$#JLJL1ESWPO áJL JL KLtu1Fx` sKu j]j%u0SW5JL áJL JL KLujhK#t 4$4$^_[]WV=2u=nLt =3Lu袬׮t 3L3L!ʃt]53LQYKLu =2uP5mL=@LmL@Lu _BLE5mL=@L1jPPB ^_SWV$KL߾%tD#JL/ V+=(KLu V@t hK#t uR%%P1KLPP^_[V蛫ơJL"~S.#V$^%=3L)KLVPujh~K#  tY>!t 4KLt Pp V!4KL=3LM4KL.hrK#qF<+t< t p3Lt Q# V菛p3L/7E=3LV蜭hxK#Pt% =3LV^XJL^(N5JLjF5JLjQP軯^5$KLV50KL5KLKL73JLJLPVp3LhrK#hcp#r^SV JLt s7JLZbJLshK#iJL shK#QJL shK#9JLthK##JL shK# JLfyhK#JL1Ct$‰sShK#jVC\VJLCuϹ"t.% sK#QKL^[fD$=ALt@WV|$ Wjeƅ~WhV@ ^_USWVt$0l$(|$$t UW4,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD ALH|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t WWD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f 8KL P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=nLÃB1ۃ=nLÃCɍH9 4L~Pj#|kKLSWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=nLÃB61ۃ=nLÃC%|$mu94L~HPj#jKL؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P>(V0ʼnP&(D$X9vpG$11Ʌu2~>9sWt$V( t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW'V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQot1=nLƃtEuG%t|QhN#hh,&AVh$6 Eu ?=u QhaN#$ u 覣!ƒtVHQh?N#^Ã=nLt$t3LtPP&t5t3LËD$t5t3LPF$1PUSWVu195t3LOt3Lt_jP%=t3LtJtWg%W"=x3Lu"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =1GjW1|]D$Ƅt^-KLGt$uhiO#wO#tʼn-KLPU[tt$VLt$ GFGu|$^_[]USWV\$1tx;tsSt$,jU tGt$h.%ShU-&UP=|$tjW܍x Pώ W{ ^_[]Vt$hI#jVPX ^USWV|$1tXȃ%t#u@9v8Ct78Ct3<#t1 x3L<%u t3LtQTPFCCuFjVzƊtfȃ%t#uJ9v8EtA8Et?<#t1 x3L<%u t3Lt QPS?KSfCEEu^_[]SWV1=3Lup\$S2ǃjWyShN#WPP<VAPtVPu W 1S V ^_[USWVt$~ƃ=3Lt ^_[]hN#I_"t9D#tPtʼn$hN#PatN#UCV8Ë KLuhiO#wO#t KLt$Q )ߍ49jVx$2 %2$SQPUhN#VW:S -KLuhiO#TwO#tʼn-KL]ۋt$t&EWyQhN#PeD ]EuWTVhv#QAD IWH |Sl?tV UW GUSWV$W,1ۅSSSW!ƒt$hVWĉ 01=ALt)PVtUSjD$P~ ƃ=8nLu)V#1tSD$PW(0 W,1 V豜ESD$P4$9v1ۃÉ؁^_[]USWVh#Pthx0#S!fpStVW,jUXvWhfO#Vh%UP8W hx0#SeSj ^_[]USWVPνdjjduljËFHN~ H V ƒtS tN)M9|>,$jUuWPFW Uڃ,$C^_[]SVt$ hD#VQ1Ct'hA#V<thL#V*1ۅÉ^[WV$ VtVWVtWt^_USWV 1=hnL]=3LPj\haJ#1Ƌ|$ 11@L|uM@-u)FhD#Wk)1%tuQ%t s@AAۃ\$WVSWH؃D$jPtWVt$Pc6W3 "S! 1tXt^~u1O\$$D$jPW uQD$P4D$(0D#^jhN#4|1 ^_[]ÉOVh;t;V h1|$rɅuŋD$(L#1O;PrS^ USWV=3Lt^_[]j荈h)O#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh3O#U{PljD$UV W S\$ ,8jUHrS\$SVUP44$v Sm \W[ Vf V|V$#N@ |^WV|$=t'sujjh(4$jw!уtjt$WRPS#^_[]Åt4LHPjytm=@LtPay1u11FUvUVRPVjv!уu {Ltw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 4L~&111RP!уtF 4L9| 1 4L19^fVt$tsVGF95t3Lu#1=2tu1Ɂ2tщ t3LAF=2tH KLv M vB ^9 ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12táKLUSWV\$S@Nj522tv W?6W |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@KLVEESËnU9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=OLjjPWV^_USWV,T$Dl$@ظBӃ=nLt  dnLt0KL @1)ʉ|ЉjSUQP虊كQP4v=nLtK uu|| t u+| t u{Ltt{L}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t{Lǃ݃ tkwRPW v=LnLt( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N OL CfN =OL=LnLti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1nLl$t$1E1!1M,^_[]Ã=dnLt׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhO#c^_[uƉס4LHPLi11 u^_[8iWV!Ӌ 4LIt*QRP4 4LHPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhPP#bKy1V[hVjRPUo=\nLjusj'hD$ jhD$T$l$ !Ѓtd9}\4LH94$SW!уRPvlj9Љ $A4LH $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$4L1VVjt$t$PY95\nL^_[]1K16-KL-KL4LH $)QUjSWP(1K[6=mLtf"g15KLSW=g4LHVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9KLS#>$4,$tt=t|<9KL|wC^w \$D$ShS#jW$4,$iS#f9KLu+9KL}9KLt9KLhu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuT#cp#6$4t$ t t_GS#cp#$40tUPtu T#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVKL^_[]SWV׉Ή5KL5KLhS#hS=w )WVRQKLS^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl3 t^KLKLKLJtGtO GO KLKLl3 tKLuKL^_[]ÍZ w6$'tEGЃTZ$'btPeu>fKL랄tGOm><1#놃>3#w>.&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]KLKLd   >KL KL KLKLKLRhS#jhKLS#KL_t>cp#vVh5T#MLP+t MLŐ"hFT#蹻MLPt MLWT#jVLMLjVLML5KLhlNLhxNL1NLPҎ $uNL^1|$áNLNLSML1hNLML MLML MLML@ML;ML|1ۉNLNLNLNLNLNLNLNLNLNLNLNLNL1HNLNLhlNL#hxNLNLP $uNL[USWV\$0l$,1=,nLuSUƉסdnL nLSU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| NL=dnLtU tNLhNLZhNLMLNLnL hNL9}QhNLƁML NLك=,nLWV^! tt$j VRP)NVb1 nL)~$hNLr5hNLƂML NLIu܅~+1ɊT 5hNL~=hNLMLNLA9uסhNLH hNLƀML NLhNLNL^_[]Ë dnLt nL=,nLt1nL@V5MLML9}9 ML<u"ML0PhlNL MLMLF9|Ӌ5ML5MLhNLNL^SWVt$\$u$D$0j?oP/=ALt&v!Ss1҅ SVqt1҃Pn1҅t$StML~- MLVt[uML MLLV3Zt MLt> MLVtV[t'i=ALtVs1҅ƒK1JFVY# p@L#h@L#5x@L#\@L‰^_[QY# l@L#d@Lʉ# t@L#`@LáMLNLNLNLáNLMLNLNLËL$1wQ5ML蜽1SVt$ 1ۃw)V5MLvuV5MLc1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJpT#9u!B1@uDA;1A+u%uVt1@^ÃwV5ML胼u߸ع#L$1uj jE1ɉHH SWV=NL u|$t$\$t-1 |15NL5NLtm1@Z ugnLt nLuU=NL~+OL OL\@OLNLNL5NL=NL1NL=AL NL%=uaOLPOL OL19Rh OLbmh OLm OL5OL5OLOL OLH OLNLu"OL OLx,1WV=ALt OL1At^_[ÉШu-%=tS0lNL=OL5OL뢋OL OLOLNLUSWVӋl$,|$(NL=8nL OLuBu>%j jzC1҉PP OLNLNLNLtwQPl'UWS  OLxtNLPhxNL蔅1 OLNLu+nLtnLA\$l$͉=AL1؋5MLMLNLRk5MLUWS% 65 OLw  OLxNLPV軄NL@NLVP诅V荄 NLAVUUUЍ@@NLNL OL9}ohlNL藅ơNL OLY$gQVlu&MLMLPjVPmNL$#5MLpNL9|MLl$ EVjUek L$ )v %uhxNL蚃5 OL6  OL ML; ML 5ML|tq=ML0jf jML9u"_l$\$u4Шx$_l$\$u$5ML _ ‰$ u*nLt =nLuKuG ڃ^_[]ALm_uiud1UWjNL+hNL t3KL91J$;KL} qɉы4KL)t _ML\$ PjSi 1EL$ML) MLPjS`i ǡML MLtW4V)NL~ZNLt\ [5x3)Й)֋$F UWh:% N1NLE1-NL$_PdtUW ]ALt6=8nLt-QdtQd UWl $UWS t1@1^_[]SWV=OL~4։1 OLPd VW u C;OL|1OL)^_[Ã=NL~OL OLNL1WV=NL~OL OLmNL|$t$ =NLuu 15NL5NLitb=|nLtYNL4L9NL|NLNLNLMLA4L NLH9NL}nL j |nLnLjf=nLNLtLNLtBx NL 4L9}; j,NLP NL 4L9}NLы NL 4L9|L=D@LtCH@L„u0=8nLt't4|$t- 1j1j 1j5ML95KL uML0ML^_V=8nLuajm5MLtMȺj9B#Fu=NLu"Ⱥj}T#Fu^SWV։ˋ=MLGML9=KL uML8ML4D$ NL; NL~~ NLMLNL NL^_[SWVML ML9}1T$5MLׁtu Ӊ ML@9|^_[ËD$L$ MLNLVD$ L$=NLu=XnLttNI1҉ tK1GhNL9~NLML+5ML)΋ ML ML0 ~^NLNLUSWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8{Lu/KLH9| Qu@ML8GO1H^_[]cS ML9t MLMtۉ>?SUSWV-KL\-jS詒 jS蜒 DžtVtRU5MLVo MLUPWZ U* 5ML 5ML=MLKL1t W 1Gt V ^_[]USWVL$D$ʃQPO1H…t$=KLMLD8OlV tn{Luc~ML>-KLu@ML (I=KL9rHŠIJML9s=KL)\8OVà uQL$ t MLt=KL91H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Va 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15OL1KOL|EtESSP tOL@ԋ=ML9=KL uS1Hte1ɺ|3:tWAuN1|31I:t?@u21|31I:t%@u1|31I:t @u^ËL$H1Ʌx 3USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=8nLu1@$5NL+5NL~1; 4L^USWV։L$|$0\$,ЃtNL!t6tC؃T$RjQPWSQ=nL=NL1ۀ=NLtw4$NL NLىȺVUUUЍ@)INL~4,IňNL1E 8Vt$0j* G;}|Cu4$SG NLtf OLOL!Ƴttt$,9} 5OL=OLNL1ۃtQML MLT$ 1ۅ~&L$ PjQ\ ML~ML\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1ENL;OLuXNL#NLuD$,NL=NL=pNL~01lNL 8jG;=pNL|hlNLtNL;NL~<$~NL ML NL$NL~1 ;j_G9uNL1;OLuD$PhlNLtML ML9~~51ɋML4*1 ML444A; ML|١ML) $ NLML NL; OL~(nL jNLHNL;OL؉^_[]WV|$t$ =8nLu1WVP PV WVt1@1^_Ð,OLH ȁgLr1gL,hL,OL0hL hL4hL 8hL 4hLƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=4L~%GW8É!Ѓu O;=4L|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhP#2(OL1111ۉu WVSU1PPWV+{Lu Ɖ!Ѓu(OL^_[]WVT$D$ =nLt 5nL1)|щƉ^_fUSWV t$ >-uF(s7hR%+V+h<1#+艣D$1S6]+S)S\^S>S;jy W>h#À8t>tkV聪tmSʼnD$!$U $ȃ$jP'袷t$PSh%t$U t$  Sa'Ņu>tVhq"F'U#LU資 j:W>W:1FVJ]V'D$$t*P*hT#y*/j ))3KLt$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhT#.1N\$h@$S4hR%Q)SH)h<1#;)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhT#1KtL tGf;t=ËFHN~ ;F~à tQu VS`V1Vj 1GWZWg%e1=KLVZ^_[]fSWV1hhL1K4t 5u'#ar'G__ _Gt P芄 GF6u^_[ËL$ 1ɅV-$t:`mL'W.t7^uMt3L|mL1mLmLmLt3L DnLdmL1pmLlmL tmLhmLt P蜁 hmLFu,~1S薺PW豺Fve ^F~ ^v;t3Lt PNu VSWh ^_[ËL$t@;t3LtjhT#x)1HËA QUSWVD$T$1ɾthL=t3L9~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9|mLu mLmLuUSWV\$SκƋmLt@PPVu|mLmL4 DžmLW! u^_[]USWV=nL|$,t$0h#W l$mLmL!ʃtWj UQP"mLu|mL hD#VAtxmLVUmLPh U#Wu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=4L9Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P~  $FQF^_[]V=3LtjhjhU#3xxPhU#j V3V||P|0tB D$0PhU#;D$$Vhc&P >t.jhU#1DnLL$QhU#$^ãDnL3V3x$ 4L1Vh@BVPRQ_DnL^VD$$L$ t tC8.@L$$Vh#Q 3>jh V#3xxPhU#j VV豶||P|0tB D$0PhjV#;D$$Vh#P >t.jh8V#1`nLL$QhNV##^ã`nL3V3x$ 4L1Vh@BVPRQ&`nL^V|$u%t$jVt0PhV#N#^V|$u%t$jV؇t0PhV##^SWVD$L$tPmLp=3LtjhV#"VP>PR Zt V踘)X!ЃtV谕5DnLSW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t Py VӟP03Vy 03QhV#!^V|$uJt$ =mLtVp3L-mLh.%_V_h@^^WVD$t t0t$PsLl7=tDMtGhuXF 3PnLPsLQh$5!Emtwt su!FF3FXsLFTsLF$37x V^_D$u54nL6Ã|$"7VD$Hs^\jhV#7<3V)h$&PhW#hW#V轲;3xu'hBW#h|W#hW#hW#hX#hFX#h{X#j^^WVD$t$ʃc"y$ 'm~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=nLutjhX#$FVPMy0PhX#^_ÉPhX#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;KL~KLA9s } uE9u9t},u E&| t3KL+KLx3 ^_[]WVD$Pt t*$TVݯPVLD$ps D$ stopD$Tab =t3|i1Gt$rV蕯fD,V腯4KLhep#Pk G;=t3|VYD andD theDen t$V45x3hY#P 0Ph$D^_à D$t t+uyL$tJQtQytWjh.Y#Mà$2L$%2AAD$PhRY#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh_$QVP46hD#Vt5>t |nL $nL8|nLtP9|nLD#L$Qh\Y#O ^ËD$HsjhtY#/Åu 3LÃ|$u=nLD$u =nL~GTnLÃD$ u)=nL| PhY#nLÃD$ u)=nL| PhY#nLD$u"=nLt=t3Lt*!ƒÃD$ t t%uCD$ 3^u2@t+$3"3P7QhY#V D$,L$(t tC1ɉ nL nL8,uT@L$,t$Vh$Ql >tejhZ#Ot$5nL5nLh$jV(0Ph-Z##t$D$,Vh$P >tjhY#9 ^ãnLnLD$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$h'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GnL1 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$QheZ#1QZSnL^[ÍD$PhJZ#҃=HnL=nL=nLË @nL1 4L+nLt$4Ph[#hmL mLUSWVl$,H mLt&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph[#hmL mLFVEŅ8D$EH$H'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=mLnAL$,9 ItIT$uWoD$,7mLj+o2Ph[#mLVB T$jV%D$,|$?+p3Lt Pl GP p3LCE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt Wk |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhmLP mLImL^_[]É|$|$ u D$PhZ# D$PhZ#͉-mLōD$8PhxZ#uA0h[#j*hmL ËI1Ph[#j*hmLUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph[#=j UQ xt-u)%tt0Ph[#1H^_[]SWV9toӉQ@jP ljtG\$=xnLt <\u ~t F <$t)\tPSt GFFuD$Qh[#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$mLPh[#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hQn#3rtP~31@USWV\$(|$$1E=nLuhnL?nL{L9<$l$D$l$ =4oLt=(OLt=pnLu3=oLubPjD$P D$tD 39PaHD$=@Lt=nLtft$,SW nL=@Lu"t1nL@nL| j=y!88#1Hpt9={LtoL[1nLD$ D$D$$PD$Pj 9={Lt {Lt, {LnL^_[]øjhnLUVVyDVe^]USWV\$.0G{ S<V1,jUVSh5#UPM^_[]Vt$V{ uVhan#hoL oL^USWV D$0щL$l$ |$$t$4PWUGƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVMGՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SF׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP}FÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWEi)$l$D$ ׋ $D$ՋD$1PPU\$SEыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP{Lt KLZ18oLWP(t>1C4$$8oLu V WSCu ^_[S=@sLt@sL \$3=;sLr 3H 3 $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P ƃ^_[]WV t$RVQ t|$P3GuV襒^_9Hw @sÃtP=USWVPt$|$DsLV<$=tnLuԇTh=\@L T#Vt$ P]Eu `@L48JMp;54L| KL^_[]VWj .^_[]ËL$T$cp#PPh|n# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu@sL^_[]WVt$|$ zt!3Phn#Phn#cp#PPh|n# ^_WV|$t$ t%WVra7ft=4L KL j Qu jF^_fUSWV\$l$=(nLu<؉%t1U1GWP?[PW1WPPUVd[1 jj1=|3L1Ƀ={LHPVWYq Åt!WT |$t8jhn#'D$ tP}D$ 0mT D$ 89t VVT ^_[]Vt$tP|61T ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} (nL@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø\&fL$tt"u$ 4L4LHI 4LIHsLʋTUSWVD$T$ 4L5HsL|1Gll\G9uTD^_[]SWVD$L$54LHsL|F|\\|N B^_[á4L~Ph5HsL USWV 4L; LsLHsLth!t 1G31K;)1G1I4:tl!GtˉPP  4LjQJƣHsL4LLsL~PhVv !t\l^_[]USWVPL$\$As 4L11H$(u4L1@$1HsL<#|tZHsL4ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$HsL1H; t$z|#=4L|O1;Ll |C9u^_[]USWV 4L~.HsL11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5HsLA1G1֋l9߻rB9u^_[]ËT$4L!х1A9Hh5'*PsL=mL'ti'P TsLh'XsLh'3h' 3h$'$3USWV \$4\{L\sL|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$ '=,nLEQ-s4C$ىË $Fw$'#Fw}$'X!уj WRPBBtDt L=,nL!15t3LhD#Pd1sTu~-\$PuYQA tLу|=RP螽1 $1=\{L\sL7f1=OLu ÊCCs|,v, l,uȡ3L!ƒtظ:,u5t3L资j W5OLQTу 4L5nLn9|$ V5t3L5t3L蛅PtmƉV.K +1+5Q ic+Ɖ!уRPUV\{L=\sLH8 \{LH=\sLwA5t3LkP豄 !уRPaٹ nL 4LVQRP躃g 3L5t3L,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15t3LMj WP j W1P9<"@|\sLcp#9 \{Lt \sLcp# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5DnLQ^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5nL1=mLtȉt 3PsL0A3L^5$3'SWVQ8Nj\{Lع\{L9r Ѝ\{LWVS] ;\{L;^_[VQ!уu$x 4LH9}FV!уtt^^Ð1`{Ld{Lh{Lp{LWV|$ =KLt5t{LtZ=@Lta=4L|<1W!уtRP虆Ws@G4LH9|vut{L覍5t{L^_USWV 22D$L$!ȃ2D$2D$ 1H2222=@L=KLt4$=4L|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$4LH9|u $u^_[]Ã^_[]鍌^_[]T`{LK|$thx{Lm=x{Lt1=t{Lt{Lj jhn#"V΋At PD FVC^hx{LSWVt$>t_w dD W[D ߅u1F FF1H{L{L{L{L^_[h{LSWVQ1u(\$|${LSt ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-{LVt;xH|p$x Hȅu^_SWV|$t$u;{LWt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=dnLuH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^x{LU1tHt$ !t Q9y}1I(t(t$=nLtT$$1=t{Luȅt^_[]hx{Lt{L=nLtUWVjW7!t"j]jRPWV je^_]Ã=l{Lu (nL{L`{Ld h{LVj5<2t2`{LjVx 1F=nLu=t{Lu@11N^USWV(U ]1Nt$ t$tr:tm1`{LPSi( nL1 dnLt)1V5t{Lhx{L nLdnLttxq @3h{L nLt =dnLtj)nLu=t{Ltt{L9t{LJ\$tP1ػ&!Ѓ1ojhn#D$Pj@t$>SD$$PL$Qt$Tt$V>{L$u:{L {L!ƒt&9L$L$|D$;{LD${Lt$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d{LT$X/ t$7 t$ 7 \$(T$_CtN4$jjD$xP$Pt$4t$5d{L5`{L2$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$6 V6 T$1H#E t0E t L$PL$THD$$e^_[]Ã=nLu?hx{LL$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ OLL$OLL$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$OL}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8OLKLt$4 t$ 4 }tEL$L$H1USWV8={L{L5{L{LD$$8u={Lu\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}{L {LȉT$!Ѓtsu!9t$ƄuY{L5{L;t$T$$|@Ut$ 9D$ЉʋD$4$KL@Ehx{Lh{L}!KL @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># h{LL$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o={L{L!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$${L {L!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ {LD${LD$${LD$ {Le^_[]1JЋ4$|$9ωL$}@D$ KL I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd={L USWVt$h{LtH>tC\$1EjU1GGGUSxL{LG={L-5{Lt~'V/ u{LKL^_[]W/ USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5h{LjjSt$DPV5d{L5`{Ls$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 VjAcVj6ch{LtW1FVjcVj cho#o{Lu"k3={LTP L@3t%5 L@3PV`Wt Oȅu{Lo# ={L$8@hx0#5ԁLIƍ|$PhWz F<$$h&P0u$$8 E$H $5\3WV$$h/#PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ {L5LPQ{LD$V$8tq$ $9t $9,t$ $9t $Q$ {L5LPQ{LutD$5ԁLh"|o#|VS|$t{LP |$Xx#tX#QVhSo#AVXSXx#1VHS=L1tLW}SPWS. ^_[V1FVt$ e`Vh{LW={Lt&|$t{L`f=3t ho#{fV$l3J l3;|3у  d3Qd3jPhLhp#+ t^hLhhP TLx;hVh-p#* t9hL[hd3Q蛀|hLhp#z535TLV cUSWV$$$ $Fhqq#PW-t܍D$Pt$4$h|q#hVxDž"t$hh`|Lt$  Ɖt$l$ U9uD$ D$ tȀ uWxkto4$hq#ehmU#$bh0#t$Ot$C9h3jjhq# -!h#4$hq#h3{ 1^_[]ƃ`|L_|LA`|Lv9 t@`|Lˡ3e%tt$1CSt$t$jjVhfO#WWxS^USWV$,D$D$=LVOPVW* \L1FVh~z"5lL VhL5xL D$ VP5L* l$jU5L D$1Ƀ=ăLˆ! uϿ1ht t tG1҃Єtt>D><>u^_[]'#1@\LPh,|L2USWV T$(\$$t$ 1`3PURSJ)ˉ<à uVh$wtt$|$u u)u%u!1ɃtsQl3Phaq#7tt DhNr#^_[]SWV \$ hShp## uP thq#踥 ^_[xEhSh-p#o# 4$]t t$Mj Vh;r#뙿 hF WW53t$S jWW|$W+[9uR1Vt$ 4$jShq#ФVjWV|$ 53j/Vc;t@jWhfO#QVr^_1@XLPjWÊD$l3J l3;|3~{у ts d3Qd3jPhdLhp#" thdLhx0#PBut:j53P? f=3u5Lhd3QwhdLhp#qUSWVt$81GWh~z"5lL 1-XLh.H SVD$hjƉ׉U芁~*9u$hd3Q2qEh;r#P11f=3tj)RPhq# jhL5tLp 1hLVW# WVOWjuO^_[]j5LW1Sj?OSW5OVVhp#jSaUSWV$l3J l3;|3у  d3Qd3t$hVhp# 1GWh~z"5lLb WSNWjxNhj9Ɖ׉U~*9u$hd3QRoEh;r#p11f=3tj)RPhq# jhL5tL萶 1hLVW! WVMWjM^_[]1W5Lj5LSWjPMWSFMVVhp#hW_USWVPhHr#臚1GWj MWjL9tDƅtZW^~9uhNr#81VjLVjL ^_[]h3Wjh#h%q#Z1SjLSVsL-3j/U0t@SQU>g h3WVh#jhq#W\WVPjh K$5lL f=3t%53>t=tLV>PVW踴 1FVh<1#5tL衴 |$VW5xL͵ ?nu53h0q#5g ^_VPjPVhBq# t=Lu.5 3VyVhHq#fhPr#輘P^Vt$j5LµVtVh\q#fhSr#zEj]WV5,3t)>t$=LV=PVW裳 j٩j{VhVhjq# V3t$3jh_$5lL@ 3u3$3%3t$3t$3f=3t53t$$53f=<3T#t~"Pn3t$33`L3t$3j3t$$3f=3T#t~"P^WV,|$8V5L(h~"W>t! $#L $ LL1GVW5L: hLWj*8^_WV,t$8W5LM(h~"V=1Ʌ#G OWj5L8^_V1Vh{t 5L- j賧Vhzt 5L- ^S\$1utjP[ESWV|$\$1FtCWPt1^_[fUSWVl$$1LL̀L%PhP3hs#t$4U11I~1L$$D$=`L8O>HЃ sX 4HЉ5̀LjhP3hs#t$4U߃ufH1K$' UL뷃EF Ujh"S!; jh"S ; h#S;D$QPuV Uh%S;h#Sm;zh#SW;$_=dL UЁL1@D$<$XD$`L=L Uj/SPLk<$$YxD$ P1PhPjPP5 Ut% ̀LL$ !P5 Uh0t#Qv؁L8L܁L= UWj8*Shh%hL膒 1@1H1HD$1@$D$~1HD$$ 3)t5|$L$(4htW%V9t5ЁL؁L8L܁Lig VjDVjDVjDVjDhL5̀Lht#j V^V4$jhd3dN#w('P_ D$tu1=dL 1A111ɣ<3 333=`Lt 3=؁Lt5̀L uW6uB=؁Lu5̀L u3^_[]xVhdt#Hht#Aht#:ht#jX5̀Lht#!ht#hs#ht# hs#ht#j#h3jj@ht#@jUh3jhh,u# jUfUSWV,|$@h] jBW^1ۅtL=؁LhxLUsu.j 1=܁LȍPU踬LjLx3=tLu?jPl LteQyLUh$tLWŅ?1GVjA=tLt1O,^_[]ÉVQ!=܁LuL$ @Vj5L 1Vh t 5L& VjA1@tLjhxLfrfWVP=Lt 5Lt$uhw#[ƅhw#Dt8/u33w# P Vh3P %1t'9uQPt$U 4'uڃ=̀Lu%h̀Lh8$t$ u ̀L%h4Lh%t$ u 4L=8Lj:h9x#t$ 1ɅuǡLu'>/5LjVLL50L؁L8L=̀Lu ̀L%4LY1ɉ 8LLt=LuLt =ЁLlj:h\$t$ 1Ʌ `L=؁Lu6Lt=8LtP5L31؁L50Lj:h{O&t$ t 3j:ht&t$o t 3j:h<#t$N t 3j:h#t$- t 3j:hw%t$ t 3j:hB|#t$ t 3j:h#t$ t 3j:hWS#t$ t 3j:h\%t$ t <3j:hwd%t$g t <3j:h/"t$F t |3j:h\$t$% t 3j:h #t$ t܁Lj:hE#t$ t 3=LLu LL3=@Lu @L3u+t$HLt P V%ƣHL3h#V+,tsăLh#V,tah#V+tSh*F%V+teh%V+t13Vh^y#W?U W ăL$11ɺ30 ߈HLBu^_[ñ1WV,|$8V5LWV薭WVܭ#NF=܁Lt L$f=3t D$#$d$d$ wfD$ f=<3t $Vj5L4 8^_hLjj  SVPf=3tjt$R 30utztD$=ĀL„u30u1f=33몈D$< t< u>jV5Lz f=3t|$ 3#tcp#PĂ`u 2 <3tu 3tt A8u1f=3t 3DAt 3DAD$jV5L f=3D$PO/hLjj USWVt$D$ $1=Lhk j4D$1CSjs4hLSWr Vh$OhLetWD$ hLjj; t$j4Uj4=LuD$ 1;$ȃ^_[]Ët$$4$3H 3~ 3H 3h 3'eȋL$ < U;t$ KD$ V1FVjy35Lh3#րVhLXdSWVP3\$ x3t%L39u Gt+t' u9tpD$jP5L Yـƀ_rL^?t@آLƒL LLhLh$=NPW1^_[P3H 3~ 3H 3$ 3Q&t1Ƀ=ăL!YXD$_rL^?<t@ LƒL LLLSWVT$L$D$=ăLut1<1ȃL1F9uRQP蕚 y48thz%z^_[hPy#USL$ \$1B1t 9tA8u[VL$LtSA -y#8t6u(^@\VPtL)ƃuf^?݈@L^VD$Ph8y#L=x3x3LFt3_rL^?<t@ LƒL LLhLh=y#L_rL^?<t@ LƒL LLF t*vPhLhAy#KL~ v 7^ÐWV1FLVW5|L͘ VW5pL ^_USWVt$jV5pLۙ  uD$41؍oD<jV5pL貙 D$< t r֍,f=3tLLt P " u3D$y1D$h2%PMLLtD$y3D$nD$jP5|Lߗ^_[]1f=33USWV1GWj.Wj.r VW.Vj.hLfCLCfC 1l$jjS跘 ~}D$tvjhL5hLw ~]LBt8StGWuG1GWLU5|L WUl$5pL1 1f=33D$hU5L jCMƉ,<=ăL  A9rWD$Pjp f=3LLtyf=3~g|$_r5,3Pt. LLYSQ;Y~ڃ tZG9r QRRNl$!y-/8u!PWjl$UVKEh@WأdLNI$'Whn#XEdL@dLN Q1f~ @dLl3H l3t;|3lhd3j!JldLv Why#D `Whn#DdL@dLN tEPP dLVd3H d3!6h$DdL#|dLh3#?v^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!ny#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhE%SuW 1@WljR1^_[SWV31t8ϻ3WP8t!CtWP#t Cuމ^_[USWV׉A tS^؃H$'n tWUtjPu U WF tQfB t thy#Nt*N 1?!9~ t~ N 9tF N^_[]hz#fSWV,1f=3t h{#B|$h{# >1FV蔁Phf@5L jh{#5L) V`j5Ljhxt 5LK 5Lm^jh3#5L֊ h,{#=hLjhlLRfUSWV $ uS[h\jhȅL  1H؅L\LhF|#t E|#LN|#hd|#$tL$ h||#US< ƃw$ ' ȅL׃B/ U8jL$QP[C $9b܆LL ɅL냀 ȅLw U%L` ȅLT ȅLH- Uh.#UGj|ſ|#p'h2#URVWU u<7t;utC ȅLKD5tX<=Eh%Uƃt=tUUsD$0@<=uEjD$PUB L$9` t ,QIKȅLh.#V8i,<0$ $ U|#5 U$LVP$LtAG$VP$ ȅLLL ɅLy=ЅLnh%UUPh5#Wh(}#gE+t%thy}#JE|$ DL$ $ 4hW uW$ 4h5#9ō$UhP tʼn-ԅL=ȅLLhPUm ؅Luz%t#P5ԅLh}#h܅LPu5ԅLh}#ЅLuG=LtyЅL$L=$LtV$LhȅLQЅLu7J$ ЅLz$u+hȅLPu,ЅL05ԅLh}#Z:u5ԅLh~#E=̅Lhj$$ tf \Lu$ th~#h`LPu$ th~##hL=$ DXLȅL5ԅLh#6ЅLtpp 0h.#5 ȅLuGXL#tt~##hL#@tcp#QPhc#5 LtPh#5ȅLuu+ ̅L0Au*h# ̅L # ̅L##hȅLu Vh##L=u#5؅LIu5ԅLh#55؅L衄u5ԅLh-# \LtPyu5XLhF#j+ ̅LAu$ th~#=@u5\L'\L$ th~#hv~#h2"h00USWVt[ׅtf΋p 't#t 'tVP t%]uWVh3#@ j+̅L^_[]h#h #hh"#h #hh5~#_jPPPhÂ#h3(6̅Lt@t hȅLЃj*D$t@0h#C@1hp#he#hh5~#D$t@0h# @1hp#h#hh5~#D$t@0h#?1hp#h߀#hh5~#xUSWVh݁#?1p 'tc D$"s4h#."s8h#"sXf|$rL$I#fw  'L$T$ t$"VRQPh#+ h#h#j胠D$f=313hjD$$P` fD$|$<3fD$ $T$3h$H$ 'L$f|$#t#PeD$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPh#~|$ujjPPө jt$t$ Ve VhiW u h#D$(|$ u,$PD$D$,$|$ 1hSWQ GG?t$>hSD$$P# G$0hSW jl$UW wh #fhd3YWh:it$V uO j.Rhd3%j`SWh:iV u Cw*8)|$’##PN$rkLPD$$PQF $<1|$Vh#t$kL4t4 'h_#]hv#P48~1D=PUG9uh#N4 D$4!4"4#4$4%PSWRQt$h#4(h#444,40k<SWPRQPhΑ#4`h1#hV#r4\t he#Yt hj#Gh#M4d6|$1A t$t&u/7t$t nu Qho#FL9Mt$ $t$qVjP$t$RVajhL#_Ph#h3 jUSWV։1hUS jWS{ sUPP踥 t'Sh9iP tViĔ^_[]h &&h׍#j薚USWV׉1hVUX jSU }VPP9 tAUh:iP3 uGPh#̘1FS@iĐ^_[]h &&jVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Ph#^WVh#f>r1D~PhY&GH9|j]^_WVh#f>r91D>Ph# 9} j:G9|h#^^_WV$fGjRWg WhiV t Đ^_h#j諘fUSWVu }65hcp#j hҒ#VW, Hw$( 'LLPLԃBu|1PP5 U踗 HL불TLXL\L`LLLdL너TLhLsjhd3Ϧ_TLS3= 3=`Lu.1L$A AAAQj jQf =PLXLLLdLhLTL31O=tpLD$3tchD#Vt^=\LukjjV e ƅD$ PVD$(!=<\$yB  3u1PPVd Ɖx\$pLr3=ttL5HLPL$Q d ƅ~E1tLVPSb i)u5HL5tLt$c ƿy5pLh$jlL31O=\$t$9ȉQdL$5HLu ύD$ PSq5HLr*V褠 tLVh1#!tLHLtLxLxLVd3h$茓lL3Vc3h#!ˋ$B65HL9Phޒ#h3z 1@pLD$; 3t=hD#Wt1#=\Lux0#PW;? \$ 3\$=pL 1$ӋFHN~ HVƒ =dLu u u1G1=LLup=PLu< u7 =XL>hcp#h#hd3_ p3@t>$@$Ph#hd35ڃ p3@ t_  =XLl3H l3;|3hd3j$  =hLxl3H l3;|3hd3j^:=TL,l3H l3;|3hd3jM5ڃd3H d3$d3H d3^l3H l3!;|3hd3jI d3H d3I d3H d3Ml3H l3%;|3hd3j-tڃu!d3H d3-3DPuWl3H l3;|3~ƒ td3H d3hd3Rڃl3H l3";|3hd3j^ڃuvd3H d3^?tЃ@Ӌ l3Ql3; |3~ ȃ t d3Qd3Vhd3PR=F @t5pLh$辎lLf p3@ui 3\$t Ve( 3%3Wh$wlL1;`hd3$ulLe^_[]hy"j蒏hD$fUSWV$$0,hcp#j 11E1D$D$D$D$$׉jh 3hJ#$VQ~Hw@$| 'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j U$ىY1ɉPXuG 3$T:-u"j9uzuI 3 u 3)t u <$u|$uM1ۋD$Ã<$D$ tD$ $4u9>WV-uTWh#D$u5t뢍D$PWZou!Wh#Mh[#j[$1 |$ $jSVQ u hA&Pd[1u8V1CHHf wy$ '|$uhU"[Åu뼋ss PVh5#M |$u.jSUUg ss PVh5# 1F $tCPpQ*|$t KP;AmPsT$Z|$Osh$1F7hA&jCnPPh#h3-jfUSWV$$6a)1hcp#U艾 -|L-L-L-L1Ch)#VW臓 e'H wu$ 'L-L-LŃo'filL뙃prvLoaLL|L%L-L-L7L-L-LL |LLLLLLLu 3)ǃ=L|Lu-tX1Ƀ=L=LtL$H=L=L=L=LtʉT$4蟛LjLPt$lVUhH3詚 9rUh#\hH3PH3 @3QT$/u>t$|9A@3A @3I3vy/th6#hk#jt$ D3Dh j=Lu$PhH3j$PhH3ku@z8uT\=Lu=|Lt@L Lt3D$ P6Qj1#$=@txUhH3D$ P6ju6h$jX#D$=@u|L L1ۉ  t1ۀ|$/uhH3h#.t9Ur|/u (IHr IH9/touɉt$POLUSWVT$juQ(L PUD$1t$CHfw?$0 'ss PVt$ h5# Pshה#>|$(5D3C,H3)=|5TShH3h#H t$VT1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$hA#QT$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3h#t$PV< L$@3@3=I3vx/u H@3=LtD$PhH3hD$PhH3sgT$KP3Qt$31 u@T$(3Qt$$3q u.shH3h7# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h]#r 1Gt$#KPqt$1BD$ $T '=|LL$ QP T$ |L LsHtbffM LQLT$ Lt$/D$ !=@8fush#jSt$ V^ 1G)=|LtRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=Lt$tjQ\LH LL1hH3h:${4$hH3h${|$t$ D$L$PQ^y#EHQh$Y{1@D$|$t$ =Lt#Vt$ythH3hP#{4$K|$tVK1C؍e^_[]Ã=LtVW1ۅÃ=Lt@1ۃ} t8G t2G;Lu'D$`PV t_hH3h$z1CVKthH3h$rz1C=LbWhH3`IGG;D$|uL#G%PVMwUSWV\$|$OǴ OOtQPS&M uG1CQPhH3LL t918thH3h#y1F#GGtPSLG1PhH3LthH3h#fy1Ft\=LuSolGt USL UhH3IMu%8-ulthH3hÖ#y1FuWhH3t1F^_[]WV$ hWvG t,$t'hH3thH3h#"vhv#hH3WItWh#bx1@^_Ã=LtjvP(1V|$ thH3Et hH3h#"t$vhH3!JthH3h#w1@^Ã=Lt jV1V|$ thH3t hH3h#(t$v$v vhH3-thH3h#ww1@^Ã=Lt jVF1PPhϖ#h3j%USWV|$j/Slt@Ë$hw&SuGhcp#WV  X 3)ƃHt4%Ij1h|#WV e~!r8$| '̛M˃K~3LtgPM믃st\vtcwțM듃FuXMMěMțMměMMZMNЛMBԛM6uX 3)ފ ЛM4 -՛MMu=MuěMuMțM,ttu'MUj Ms%jPRt=̛Mu4PVXu$#D$=u0YjPV(XuB#D$=@tM19t<1jA ŋ9uUVh$j"vMPPh#h3 jUSWV׉΀=ЛMtj}$hVSɆ =w6S9t)$ PQh%WS9$?A!=Mu0!L$QVЃu#D$=@`Vh$s1C؍e^_[]Í\$SWEWu#D$=@=̛Mu"SWVu#D$=@=ЛMțM>/uD$PVUV#X$hSW膅 Wt?$ VPh%hW[D$PWU#t VQrD$PWZVÅЛMWV/PVt@\$L$/PW»t@L$ Q\$S7u)D$ )=|\$=Mu=ěMhd3迫Whӗ#h3L 3H 3~ 3H 3h 3É؃t9 t43H 3~ 3H 3h 3ƒ߃Y=Mu#D$=@uW芆Wbu8=ЛMu WVBM PWQVQJCtW#1ۀ=ԛM$՛MVPWh#h3jj h#9D$t$QVP Ƅ fDŽ$.$$PQS\$4$9|$ t#t$WP諫$ D$Ƅ fDŽ$.$PQ)S$3$$3$ $3$$3$  WVh#z fD$L$TTPQ{ËD$L$TTPQbUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP4^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQPh^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQPl^_[]USWV |$872 hcp#j[ jit7D$Phht@j葶 uD$tL3MMM+u Mt$41۽h#WVu HσG$ 'M1M1MMMM1MMMMM낃w(M,M^4MO[Vsh7$ O=,M#t1#D$$MU`‹ud΋[QPVRRPSt$t$VuS9_u$<p$V$Dh9#n=Mu3v,hB#S svhB#@ =8Mtsvh#$ E@ %=`u6E %  1QRv4QPv0hI#h=(Mt:jj hcp#u\uXj\$S Sv(h7$ %=,M#t1#u\uXv(Pp=MtE(=MtE@E4P^M Mt =Mt =MtIME!=$#Dt;GOTQph%hVh3=@MtM%=@t룍GTPh$hV3hD$&PV' t+D"h5<#iM Mt1D$"P; 80衏 PVh#h3=MtYD$"P l3H l3~d3H d3 hd3j $8t$SD$"Ph$렁$^_[]h!#j;YWVxDtPM HMtC=(Mt@AI t$jj hcp#QPjV tZVhp#A^_Ã=,M#tz#$MyNjIуRPQWb[RPVh!#jXUSWVD$PP W#tƿD> l3J l3;|3~у t d3Qd3Guhd3Q=LMtXD>l3J l3;|3~!у t d3Qd3Gu7hd3QL$D$ ρÃ`MT$9dM}`;L$}XD>l3J l3;|3~!у t d3Qd3Guhd3Q&l3H l3;|3hd3j d3H d3 1D>l3J l3;|3~!у t d3Qd3Guhd3Ql3H l3;|3hd3j jd3H d3 e^_[]SWV΃=#D$=@u.$VtPZ 9r*thڙ#j8I|WP޿ ty/t AƄ/@L$M$D$Sٟ|/uH9tx/@tj/Sޅt@V蠟L$rShڙ#$1A $'@PVt$ MR ٍ$Ct1@$Mg4$諭PPh#h3jjMUSWV։π=pMujVu^t~VWt9軮8uR\$@SV;*t{SW-*9Wh$1ۀ=xMVWhZ", VWh#XF w=tMu=jW]uWh#H#D$H=@VO[=|M/jV]D$@PV(jWl]uD$1Pt$L7$D$2x cp#t:%D$1Pt$\耚1Pt$`ߛVPSt$D$BPh#h3#D$H=u}1PPW t$HhV \$D$MMVCVh"#D1C؍e^_[]ÉVhA#h3 3H 3~ 3H 3h 3蝝ÃtH tC 3I 3~ 3P 3h 3^ 3 tuÃ߉1ۃYM@Vh$ D'$MSP Mt$|$SPt$  Å11S5Mt$ 9x߉=Mt{\$(t$,l$( ,&$$L$$D$ l$ |$T$ fT$l$\$l$T$MRQPVSt$(t$(hU#h3y$5M5Mt$ ? Å6|$W\$S+At$uVhP#BS;D$hL$l$JD$pBD$tB D$xBD$|BRWtVh=#oBt$\t$\W N8tVhK#>B#D$HD$Ht$\$ \$D$t$Ph$BVtVh2#At$_SV1VA5Mt$4t$ЋD$HPWtVh_#A$Wtr8-t$Vhl#[A WtV|$W[t Wh2#H1ۀ=xMDVt$SWVP׉YjWP t$t-h#h#h#h#@1@^_[%tPh#hŚ#X XjWP t$th#h#%tPh#1돸#=xMu##jWVh2&Phq"S;Sh$ @j賦#jVh2&h#hq"WWUSWV8`3t PI`31MMMMMM 3it$L$ 'hjV `3YVhA#0jG`3hhV `3MhjVt `3ߦVhv#0jͳMu31`3Md31t~Mttja`3Ml31@5`3Ml31@DWVh[#0jE`3tMtj`3 HNtQ`3hMPLxCM%= ts=`=@5Mh#j許 蝥5Mh#0j膲5`3 `3M1HPhm8@5`3蜇 1ɅA M-M5MMˋ 3uHNHN3v$ '=HN=HN>1jSS5`3+!ƒu謤8fM-M5M a1H 3 3=MGt =}r t~=HNHNq˃u#=HNtPWUVD ~jWUV* tw߿(=HNu HN~~=3|318^_[]111RSWV։ωS7S>3D$t,t\$W3R4$ t$ ctjt$YRfO#1@jt$AR#1PW0R4$E t$9 jSVVL:x^_[h# h#h##j;VP=`3x=XIN pINt}=Mut=INtD(INHQP~'Q &M1MM$Pj 5INhٛ#5(IN` 5(INs=MuKhM5`36~u4#M=u"M Mu5MM= 3w=LINt3~ jP8 5`3 3~jQPs XIN pINt4=Mu+5(INh#-IN5(INr`3=Mu MtP1MM INt3 XIN pINt'=INtG(INHQP~Q MPj IN INtZ5INh #FuC5(IN $HN HN u HNHNjhQP'RPh#V1V5(INq5M^USWV= 3d3t3D$W7O+8M INHt)t h#53h̜#jL 1%ho#j653hL#0j^_[]USWV1N=,M=|3  3uhם#j٤M<uM-MsgMM1jWW5`3{xXͽuWURPѵ)jWU5`3zyQu t#M@M=|3:h#Ff@Phm5`3Vz x|3h6#j1^_[]USWV \$$|$ l$(1uu5|3M1jVV5`3yx\D$ljT$Ӄ=MD$MM9L$ujRP5`3yx+D$T$EU,=Mu# hj#0j |31N ^_[]USWV~=|3$(~$$~Mt)h#j蔢I1u)1ɍ|$h~W5`3 0|$fGWhm5`3x fD$D$Whm5`3_x \$h~S5`3/ $h~S5`3 GfD$D$Whm5`3w |3t1<$uzfD$D$Whm5`3w f $ HN11F$$~jQURL1ы$ʉD$ ʋ$$~) h<#b1F|?1jPP5`3Nwxg)y11=3|!h#11Fs1o觔hY#RjRP5`3w1yK胔h#.wh9#"khɞ#_h# Sh#0jB 1N5|3~^_[]fD$D$ D$Shm5`3Zv yt$hl#t$hԣ#0j٠SWV VhINj y賓h#0j袠 jVj y臓h#0jv 1N=,M(M=4M=INu5INhɟ#趟=Mhl3Whd3Wo MaX#tD# 3#te#QWPA S8 3#t<1#P5INh#hڠ#h#h*#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5M5Mhz#sWh[#T5INh#Ahڠ#4h#'h*#<=INth#j{53h١#5INh#ҝh#ŝ|$h Wf|$.|$t+D$5..L$f tW= r@hk# h.#hJ#Y5INh#Fh#9sWy\Wh#,M|35INhM#IN ^_[h#М0Mt PoE W30Mt M1,M|3h#j|5 3mtt$11Hfhh@MIth@M@M1蘏hT#0j臜 1Ht$:ihq#0jX 1HVt$V>u<Vh#0j*^\SWV|$$WZ ƃu[1~tHNtt 9 tu/ҎPW t#D$=@t 誎1N|^_[USWV1F INPH{ INP kj&Ɖ+MHw> INSPhDMQ@ M$ ML$QPhDM\hDMCjuhDM[jhDM^uH=HM/u+-Bu"HMP}PhIMHMPm0 hd3WVhDMM<p3@ubMM M MQP.t  INP(jhINjd xsZ1e^_[]h#0jՙ USWV (3x&,3kL39|׋yM1II1M1PQÅy19}WDu= 3h#j.hhMOÅy1ۉ9|(3x(,3kLShM3y݅u= 3teh#j迗M1E$sVhMMP. )؍M1Eh!#ji1IkFL3 INShM#1ɉ^_[]USWV D$ INxGD$M$1F1MSQ291C INhMhDMP$ INQu*D$PUhMQ8 Mtu= 3hΦ#j耖t$hMhMi- $W1CttUtB:x9u= 3tFh#j,WhMQ19uh9#j1H ^_[]h_#thDMQ<t M1h#USWV1C INPH INP yj!Ɖ׃=HNt/5 3qtEh#0j4 e=@INt Rrx7t$t4 INP(jhINjX lzbV1ۉ؍e^_[]Ít$\$D$MHw5 INVPhDMQ@ MD$ ML$ hDMkWehDMduy=DINtShHMt^TIN `INtShHMhDMUjhDMXt@hDMEmMM M MQP=HM/u+?<u"HMPwPhIMHMP* xIN |INtShHM XINtp(IN|NPWt$hDM)6Q=TIN`IND$L;MD$PMPhHM8IN`Mt@t=INu Pl= 3t1MHr@tZ tUhDMl'9D$X;MD$\M?uD$PhDM$Ã|$=INut$hDMÅ INVShDMP@ =INuShDM/!؃=XIN\$C=IN6D$(INHQPQ xIN=|IND$L;MD$PMMM M MQPDy hDMj=XIN\$^=INQ(INHQPQ D$L;MD$PMD$X;MD$\MOPj IND$uMD$ ML$ QPp`Mx5 35(INUMM M MQPhDMji\$=D$L;MD$PMPj HINUSWVj/hHMd1UhHM_yt>5@Mh@MUt /tOGh@MWUhHMhԥ#jjO1N,K|/t1NuhHMh#jj^_[]SWV= IN01F INt9t71h#jێmQHb INP R=TINt i< INx t `m#XIN pINt#5INhۤ#5(INŝ INujhDM^t(MM M MQPu1=TINthDMhxuthDMly INP(ljgSW, xaXIN pINt&=INt5(INh#2IN1G*ƃuejhINj ^_[USWV $ INxu d?*1F INP, IN@0D$ j-D$T$=@INjShDM9]jhDMQ$=TINthDM~ghDM+thDM2dM w's1PP5TM $jhDMPƀ=HM/u+4u"HMPpPhIMHMP" =INt4$hDMZ' XINt:(IN|Pt$t$hDMs.PhHM0INMhDMT$t8=XIN=IN(INHQP~dQ c INL$Qt$DMSPD ƉPS?&=XINtc=INtZ(INHQP~3Q 2Pj INPhDM%dPj IND$L$ʃ|QP  MMʃ|QPxnhDM*1C@TPhDMZ%}5TMh#0jhDM8chDM)t INP4 jhINj =PINtn)11Fe^_[]þDMPV$Vb뙉PhDM$뇃=TINt cxIx INPHx11@USWV $$h 5INSM' = u$ /,4ŏ4/t EƄ4/FED$P5IN#D$=@`1Gxv%xmlxd=@INt exRhDM!(ttjhINj Gm'15INh #j 1GĐ ^_[]{5INh'#0j҈5INhN#뻸 )D$ )D$$hDM XTIN `INtV1=HM/HMt$PU% ;D$vhHMhp#jN _D$PSEDMWT&W^jhDMKt'hDMK`hDM&'VShDMNR xơxIN |INtD$PhHM0I=XINt5(INhHM+INM=HINtEhDMC=TIN`IND$D;MD$HMhDM{MHt 1PP5TMX $jhDM#Pt$hDM WhDMD$P;MD$TM7wD$ PhDM;xINtk=|INtbD$D;MD$HMNhDMhDM^^D$D;MD$HMD$P;MD$TMx5TMh#0j蕅PDMWWWhDM!PhDM=XINe=INX(INHQP~ Q Pj 苖IN D$D;MD$HMUfHNMHNu IN@HN=~| h~PhL#thPh}#j蜃1HãHN35My x1HNHN HNHNʉHN HNHNM= 3u=HNt4=~| h~Ph#thPhܧ#j1H5M y xHNHNHNHN1$HN HNHNM~3HNUSWV=,INth #j艂1I^_[]Ã=HNHN3uHN1IxՋ=HN+=HN|$\$53UVSW莓)9|11UV$)݃HN|JHN 3HN~H5HNPHNHN;HNr֋ HN 3HNHN1)ȉQPx[HNƉ5HN 3ȣHN)= HN$HN HN1HNHN 31h;#jWV1N=3= 3uhm#jy1$HN HN535HNZ13~9} G{u'Ph#j~ xI1=$HN= HN535HN~ HN HN HN$HN HN1^_ËD$L$HN)ʉHNQPReG USWVu ]1D$ D$ D$HN HN)ȉ9؉| HN)։ HNQPVS)ЍT$RPQ 1ID$L$ ) HN $HN|~ HNHN)ЅqxUtX HNHND$9ؿ|‰HN)ظ|D$L$ 1H1@D$D$e^_[]V1=(HN535HN~# HN HN HN HN$HNV1xC= INt/x&5$HN5 HN535HN~(HN1 ,IN1H^VHN;HNv*5HN)QjP7n 5HN53^USWVt$4HN 0HNƒ|]; HNHN}O1h#W}=HN=HN$-HN3 ( HN9)1 -HN1ۡ31PUK;3tS1HNHNSHN 3HN9)QP륉HN HNNj-HNS5HNU"D +HN3)USHNHNHN )VQSC HN INHtt,IN1O1^_[]É-HNUSWVP\$1~cl$HN$5HN<$)"533x3ǡHN$5HN9|WUVLC 5HN)11H^_[]USWVPD$~Z\$ HN $5HNŋ<$)Dž~9HN$5HN9|WVSB 5HN)D$^_[]ËD$)USWV\$ l$؃|~HND$=HNt$)#534x\ơHND$=HN19|VQWD$ k =HN)Éظ|$1H$$^_[]USWV$  $x$|$D$|=lINt7P$Jy#Ln$ h#0j.{$|r HN1NHN)ȅ53  HN9غ|PQ$ ~|)à HN HNظ| uXP$I$3D$8$3L$4 $ h#jUy hx$ h٨#j5y L*m$ hȨ#0j z'm$ h#0jy111o^_[]USWV$$x$|$$D$x-D$PQHt"l4$h&#0jny L$|L$1$p0L$1HN HN)ȅ\$^ HN9|4$ST$ RT$RPQ$P~R|$ =IN HNtP;CJ HN)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=INt% u!$9$t4$hN#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=lIN$4t1PWFy#hjh#0jQw1HD$sD$$P$<F4$t'jVh&#0jw $l$ l$\$ 535HNW  lj\$11ËD$ 9D$D$D$HN}$4$t$ L$ QL$,QWP$PWP$@ ى9u1535HN$< ljޅz11 ͉$03x$3|$ uRD$$P$8iE$3D$\$3L$X $0<$\$t*Wh֩#<$Wh#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]Vh$0hĩ#0j8u1K<$+h<$W$4hx#0j uUSWV|$7t6|>/u/1N=8HNMWh/#js 8HN.|$tjh W* VO $=h#jJe*?Yt$8h#/Yt$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS`;xjh@HNSܾ y%#̬#\$XSV0je^_[Vt$ xFP=PINt.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(V ~H111Ã1T |A9uV$P$(! ǀ$1111틴$(3x$3|$ uUP$(3xLX$3D$8T$3L$4 uF1VVV$(9xE$($\h#CWh#.h#j%c #W$(h#0jc1N|(^_[]V=hINtLHN=dINtLHN=tINt@LHN=PHNuh T THNt01x&=PINtDyh|#jhb1N^WVlHNtP|1lHNhHN1NPHNt `HNtqA`HNuj13H 3~ 3H 3h 3GtN;43u1tB THN9G= |+`HNxxTHN PW1t-THN8j5LHNhTHN` lHN&1^_SWV|$tR?tMj tSƋ\$WOEH~ </u>ۉ^F=PHNt%\HNp!h#j`1Hhƭ#5PHN5\HN1^_[á`HNt@=LINtdHN=lINu0=~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V\IN~1F1u\INhӮ#j9W^ÐSWVL$D$t$|$ UpHNttHNtt\^_[c}\1KZpHNteSP/ti:tdx: 39}j U@ 3sPVW hVpHN:-u/tHNÈtHNnpHNtHN`S6h$# 3=S6h;#h3e?^_[f1Ã=|HNu1á IN0h#jV |HNt"H |HNp0h#h39e5INhV#;u_sUSWVd|$|j/7*INt@l$xINhV#P[INV#1C$ININD$ D$1D$$jh3h#WUHЃJw$ ';t$$@$ ' UM묡 3t  3LIN 3r 3t c 3P= 3#\$DIN! UkHN HNM#M%3tIN5 UR 3t  3 3\$pINtM 3e$IN\INLM 3=dIN.@IN Pt$ * NL$ U HN$LFM 3M 3M 3M 3xHN UHNM $hINq5 U[Z 3@K  38 U8-u xMD$ =INu ININ 3 3M#XIN 3HN5 UWO tj,VÅtj=Vtmj 8 tdAE0H@|HN=|HNt INsINuhS#j6B1O^_[]hg#h#hg#j B4$9 ɋD$L$01'WV5INh#h3-Q t(ο˲#PhV$h3Q !uءĆ3H Ć3~3H 3 h3j S^_SWVPωPQrt4Ƌ$| tC$S t'ǍCPVW DG  IN  IN1^_[USWV$t%t_݊M\tS8uEEh#j@EjY UEƃjSVa t3l$hUVPlWUh#j\@S $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=INtZINHVVC4$ Wh#ji? 1H^_[]VV h# IN IN1V4$Q Wh#USWV\$tK;tFj tLNjl$1pS"G woD$G95INt%INx!h7#j>1NhL#=IN=IN^_[]WV5INt;11GFu)uhy#j^>6h#h3M vu^_USWVIN1 l$$=LINKt(=?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=tlD$@1G8D$@1D$\1GEt$ hH#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhb#j59tNjE|$tDD$@t:$t$PVh#h35DVh#h3 D $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh.#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7S^(IN3WVVjuD$L$ L$$VjVjuD$L$ L$$VjkVjuD$L$ L$$VjBVjguD$L$ L$$Vjh#IN1INININP INt$,NFF FF)~ |$WVj% y|$ujWjj% WVjV% y|$ujWj>% WVj*% y|$ujWj% WVj$ y|$ujWj$ TWVj$ y|$ujWj$ (D$,WVj $  WVj$ 0= 3t3i=)‹1@?9 tR=INt3<$/>3i=)‹1@9 tR IN1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=INujh=P IN#t\u#uGWJ tjxGj jWA />3i=)Ë IN,t 98t#@u $j t!8h $1(Wh#j9- hӻ#h#j!-^_[]USWVP|$1N=INujh=S IN#t\u#uGW* tjxGj jW"@ c />3i=)Ë IN,t 98t#@u $j t!8h $1(Wh)#j<, hQ#h#j$,^_[]USWVt$totij/VL1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhu#j+1H^_[]1j1 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj7S CS>tKt^?tYڃCKt6C;C C})VWh3#j*S h#C=INt$INX Vh#jW* 4Vh#ININ1Wh#j** SY hV#}VQhڼ#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$Åt>V ,FN4A1RE113W 1J 4$$|'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=INu*jh INuh#j1(1N^USWV IN1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj2 Ël$EP" $$$KCs{ D$C $C1^_[]Ët$ h 3Pi  1$$CHC1FwCE3 S S h#j&1NwUSWVINt"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j: tx@ LHDh#jY 1^_[]USWVINCD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj( J1ɉHT$, $$$P HN HF F t$1 H;@u IN-INININ-INӉl$T$tQغ/>3i=)‹t01ڋh1 t@IN=INl$T$s}ډD$0! umщjt[IN=IN tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  hҿ#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=INu*jh= INuh#j1N^WVINt813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(萵 t^t$舴tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h>#jj ^_[]USWV IN1Kt$/>3i=)‹/uPVSDžj$% tWW tN$$QVQ4y8~V Q(y,~VIlNF INF5IN3Wh#!Wh#j V, Vhr#j ^_WV5INt~1FIN=INu~ t v6蚫 3  3tWWvvvv 6踫= 3t v6ά6 V 5INu^_jhÀ=INu1WVL$T$t$ IN11H<>u5Guu%P=INtIN11@^_V|$ |et$>t\jhT#P t !3=!3t#h#j|j !31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#Su3h%#Wu! 3u9INDžu91FWSh#Voh%#h#hH#V WShv#jL1N^_[USWV\$hSb1N|$1h$UWL O$LJ4$<rD ShINhIN   PhJNhIN  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ; 7 1D$ereRPQ  ^_[USWV $ $Hw.$' e| Rh&#{=INx1ۃd|RhD#Q1l$ hVUi $ jdPU$,l $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h #$F1 $F2 jdPV農 fF0 $j j0P HN HNtHNT$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U  $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R2 t$ hb#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0UC $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjhT#W} t1H^_jh#Wc u(=INuJNuJNh#jjUSWVl$hUh1N\$1h$WS  K$ǃ4$Yt"Yh PQ Ǎ A/G<rH )UhINhINo   PhJNhING  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPXyEtQQP  ƅ(8$VP2yElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu\)&-u~t6hx0#VDžu'0' PVhr#jH 31FUWP2t5Ë$rt$Vh#j$_Ft1N1 3t Wd^_[]fVjhj"[xKh@$PJNt)hx0#VJN1u;5JNV\=@INthj"hA#j 1H1^WVPD$$|$t ,INt$pIN XINt"=INth3j IN35INh"W 4$VW Wj  ^_PJNt$L$T$ $RQP 5JNXSWV|$1N|5JNt,\$OPWS t;j Su1t^_[SWVPD$ $|$t ,IN|$t$pIN XINt"=INthd3j IN35INh"S  4$WS ~V Ph$h3  h3j  ^_[fUSWV} u7(hcp#j! \$1h$WV2 LtPt߃95 3D$hl#+ƀ8/h]#VZush#VHua$PVltKD$Phs%lt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V;hd3p3@ujhy"jS~Pha#h3>  jUSWV$$6u'hcp#j螼 11Chr#VU谑 e~%q~3كrtރvt_x,JNŃV.PtrكRtwftAiJN JN뒃Wt6duqJNz(JNlJN JNW0JNI$JN;u 39|=JNu 1Ĉ^_[]7D$hƷ j$D$,$S I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h#C\$8JNEHu]j$8u 8JNPj4JNj$8tӋD$t$ VW2j 0JNtRtD$WW=JNui8ts_8?tiU8t_Wh$EHtjW PWh5# +D$@uDJNu;Wh#8JN;;=(JNuWp8ڀ=JNu"th6#VXtD$%=@t3==$JNu{W'W蛚 JN JNх ˉ4=0JNu Ő=,JNt@jPt$J u h|#\P`Tu8:VSNjGHHf wT$$'=JNWOh#wPBjWVa` GG =JNu"WOh6#wPbGHftIfft9G =JNu .P' PW~G  G=JNuWOh6#wPw=JNuG ?t"ow 觺 PUh5#8 =$JNuO1uwwq%tMJNtD<8tU28?tK(8u*?wYTtJNt 8ut/wh$8JNVLRDž=(JNu =8JNVh$&WO1@e^_[]LWOu1PPPWb uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWL D$L$D$)T$T$ 9D$t1$LW^N1PPPW h j$Pi KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWK D$L$D$)T$ T$9D$tsKWMj1PPPW Th j$P CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWYL ;D$t$$P$!P` L$)L$L$L$ |$D$ hJWL|1PPPW fCXK\D$L$ȃ|o"r \$9ËD$| S$PWBJ 9D$)؋L$D$ظL$|IWL1fUSWV\$l$UEtMƊAuA)k')KNj詹UعGG SŹG@JN<@JN KNt^_[]Ã=KNt^_[]USWV\$tKƊAuA)k')Ƌ,@JN1Gt?uStmt&uSu4@JNjVJ1^_[]ËD$t @ъ@uA)k')@JNWVt$ >tVG t|$u G?KNw耗 wu Wl  KNu=KNt^_WVt$ KN1<@JNt@JNVPs8uG'u KNt^_Ã=KNt^_6USWV|$tWBuA)k')@JN1t(l$sWPtu tC uމ^_[]jt$ }t@1ËD$L$ pqSWVKNƍ1Py1 @JNtQ:t @ C'u9 KNu=KNt%h jVWǣ~R1ۋphh#*p25"3HQPPX&"3Q C9uW職^_[hV#WV11 @JNt)@JNQ:ujPuFȋ G'uƉ^_USWVj0SN8H 0SN(11C}t$Ej=P t)AQUkhr#5"3O)TjUt_Uhh#)w4"3HQPP.%"3Q 0SNH 0SN(S Uh#5"3( u1^_[]Vh2%tauj40SNt$1Pc ơ0SNH 0SN@u1^fWVP5JNPЃ rF!'ut t- JN]$L'NF믉jWV JNJN !'jJNJN1D>G!'uGPOJNWVP! JN8^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5JN^_ÊVF|uܹո ѹ Ǹ É)B$:@B!'uVPQh# fUSWV|$,t$(S|=JNjLV`t:xIuxNt@jLPj V?1tE@j P,)=JN5JN5JN&1,=JNuƉS3^_[]ù#V=JN)u ^5JNQh#*WVcp#|$ |$wL!3 P!3 (SN>t'F (SNQ(SNJN@>vuڋ7 (SNQ(SNt @뭅 +L!3@P)5WNVrƉRPh$$ 1 ^_USWV8׉ˋ JNJND$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPhΊ"jVjVt$ ' USWV Ջ\$$St$$tƉ׃=JN%up1҉  ډD$$=JN&uU1ۉ D$JN JNME \$$L$SPy t D$$ ^_[]ù-#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹##v#wSWVP=WNJNWNQQ*Ɖ=WN=!3ttxt>uu&1ۉSPV Ɖs9u$8t*b8u+$t@!' t$@u^_[ù#%USWVPՋ\$St$gƉ׃=JNuKl$JN JNMES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաJNHwSjP ljաJNuND$JN JNN1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THJN JNN&ىWP1Eكra$"ى=JN#ÉJN݅~hJN JN2É׃'1HJN JNNPىWP1 1JN JNNىWPÉJNLJN JNNىWPe$É׍EكwJN|$4t;~l-JNb1A1Ǎt$WShΊ"jVkjV5JN0't1I1@1l$QPhΊ"jU5jU6! ؉^_[]ùI#T;#Jd#@USWV֋] $t$ơJN JNL$ D$T$uPV֋=JNWw,(%'80%'}uPW ֋=JNȃ}tً$VPt$ ֍Gw0%';E Qȉe^_[]fUSWVb!3$D$ h#x=etuD$ j0SN0hJNGVS?SaUV@P訨áJN)QPSt JN)١0SNpQVPSG$jhI#$ƅ<.u 1~.D0t/ua$Phs%FtGPVFt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$9t/h$&u0SN8Ltj0SN8j*5JNuj=JN5"3w"3f`5JNO"3HQPP"3Q 5"3'"3@u1[hp#[v0菙 Ph#Ah#7SWVWǠWPu2\$Ve$8"u6W蕠WPtVDJNV)^_[Åu0 Ph#jJNtjPhl# h#ÐUSWVD$ "3fa1Ƀ|$‰tpыLh$S9$th5#S$u 1t$.4NJ]taM\uNEU\rw$ '\0u!11ЃwxAunjt$>"3HQPP"3Q t$.PN    ȉš"3HQPP'"3Q<$t*"3HQPP "3Q 5"3s"3Hu 1^_[]ÁfHh#jf KNu2L$ KNjPV=KNt KNK15KN0ppp VPj- 95(QNt =!3ujVhV^jpPT$=dKNu dKND$ $1APVKNKNt1It$aVPL$T$ D$$PD$dKNjWVP|$t$D$$4$ WWV׉ΡX"3t L"39ty u hL"3 =(KNXKNuPh"h`"3 =,KNt5,KNh"h`"3 t*t$ Wh`"3 x4ht%h`"3xV Ph$h`"3y "3HQPP "3Q h`"3 ^_SWV|$t$\$]SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vfl'T$ L$9upu'0fuQhD&j hKNKN@^10KN8KNt'F (SNQ(SN>N@>vuڋ7 (SNQ(SNt  @HKN15+L!3@PơDKNPV HKN^_USWV\$0t$,|$WĚ5WNjVj j=8"3thƉ؃$1t7=!3u.D$0t Zg $uQVi=0KNu"W跚j袶=8"3u11E\jW[u HKND$0u^_[]jUSWVL$,|$(!306̓V̙$T'Uw1ۀ=!3_=0KNMjw1ۀ=!31=0KN$=HKNjwH1ۀ=!3=0KN=HKNuQ=TNtpjw1ۀ=!3=0KN=HKNt  u8V+1tu HKN1l=TNtUW_j\$0SWh a=TNtWD$,E=TNtt$,WK_=TNtt$,WE\$,SW=TNt\UW=TNtEUWyPh^# hL"3k=TNt www. HKN@jw1=HKNHKN jwa=HKNt HKN1V託VmL$,=VNt =r!3t HKNtu u^_[]PjjUSWV@|$T5 KND$$w=*"3tttnVN5WNP$P hn#Gtj P5"3w Kȅuh#5"3nl$jUth5 KN5KNj<$t&4$h#w5"3|$HKN\$XKN- KNj wD$ KNu=KNtSwKN5 KNj KNu=KNt]<$t&4$h#5"3T@^_[]j5 KNUSWV\$;s3=*"3{VN5WNPPChn#6stj V5"3 vh# u h#"3HQPP"3Q 5"3rl$KNttmu |tF1ۃjUk}Sl$SP% tuQV|HKNJu KNu=KNtjsUsV贁HKN KNu=KNttJ=*"3tA{t;VN5WNPcPh#5"3U^_[]SWV|$GWN=*"3 VNPQPhw"w "3HQPP"3Q=u"3HQPP"3Q 5"3*juw  Sw5HKN=!3uZ0KNt"u*4KNH 4KN90KNm"u4KNH 4KN 0KN u?"3HQPPL"3QFPU 1Ո`1t$XtOË$t)"3HQPP"3Qv É΅u$u t(PV5"3 مt ȋN΅uء"3HQPPo"3Q 5"3|$ +t$4~jh'WU u|$$ƅuf|$ L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$  fD$D$ f=TNt*fsD$=X t= u ft$}u$D$@f%hu D$KNjUgrD$,ED$D$tD$L$` =z!3u f|$t$Ut$4s t@HKN|$D$D$`t$dD$,F L$KN=KNtYD$t;=PKNuKN=KNt.t$`5jt$hL$D$Hs*|$ toD$ t$,uHKN.u D$ 1@t$,pKN=KN  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]WND$(WNPKN_<NjD$ KNM D$(WN=PKNPKNY1PPWk 1ɅȉD$PPVu3Ft,ptF VNQjRp ^SWVQnWt1OS jjP t6>F1"jjPg tv^^_[USWV|$41GGG =!3l$0\$SU~KNAjUgjUPOi uAKN=KNt 4$1CSt$SU\$t$$w KNu=KNtS}^_[]h#VPLKNu1PPVPjh!3r tF$P|LKNt.1QQVPjh!3Wr tLKN@=PATH5LKNZ LKN !3 !3^áTKNSVhcp#^0SN8ujN1^[1ۈ!3!3 5\KNthB v650SN VNSSQPV@KNá0KNËD$ 0KN4KNPËD$@4KN 0KN10KN4KNVt$ |$|v\Ph#1@ #5"3(14^_[]UWV׉΋ `KNuj'=2k< `KN11D$ T$l$ @&D$ $,$<$\$ D$[#D$ ?6u0uFjh$WK %W裑|80uHx.t x0@te^_]fUSWV|$7j/Vlu#$jVP uaK$$WV4 Pu 1@Ɖ$m=hKNud$$UVuG肠8t8s8t.i8 uPVkt BVswju$P OfSƒrtt~ dKN7PSCPVh5#jSWVt$|$t$VW 譟t 衟^_[Ã|$u0 jWD6u8SNXKNV衉jUSWVPD$tnt$ t%1;t <:t9tGt$C,89-P!3}8w,; L!3t,WSQL$ RrL$ |9/u 1xAA/D$PL$QhKNE9u,;E-hKNL$Et <:tEL$<:t1ED$(Q虎 $+ L!3AQt^_[]USWV$1C1D$ 1D$D$D$\$h`#Hw5$'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 0SN9A0SN93t$$1CjWtV@wM$D'|$t&|$ t4t=0!3x'@ |$u0SNH 0SN8uVNPVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿlKN/tPEȃw?$T'|$u/|$ u&u |$tf<u t$Um묃KNr5"3"3$@thj#1@$$$$^_[]SWVt$KNlKNt5Hftfu950!3| PP 9p}Ëu̓KNr KNt^_[Ã=KNt^_[USWV$G$$d'oVNEjWS PirM䃼$$twh#1Vh#bGPh$KNwNPQ_ KNu=KNt h#D$Ph#/th#h#GPh$m t*"3HQPP"3Q*"3HQPP"3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!lKN3tFWPKtc6|$tTKNWkPKoƉf@@ WP KNu=KNt u1KN^_[KNKNQN  KNu =KN6USWV$$$j/$cturfEE^VN9tth#Vt $j$q1Ʌt@@t`tm$umtisD$ P$xfE$K8ߗ8ї$ u=0!3x $u  \u =0!3y& u $MƋ$1Mtfyu0!3YL$$j$P 1OD$VXnGhKNtAPh#q|t$t-'5hKNh#B|t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=hKN$Nu$Q8tG8t =D$}o$E$\$|$$t$t'5"3jS\P$hY&VfEo$T$pƋ$$KN|$ÍD$ uj$HfxT$ ufBuω7 KNu=KNt ׅt"G GfEG EG fEGE fEEĜ^_[]KNT$ Éuj$fxE$ufBj KNtbiVԄC+L!3PkVjj$t3fxu*SVn$=KNV$h#SWVP!'1t8|$!'L$8u%tWPL$ t us^_[SWVP"'1t3|$"'L$8uWP蠅L$ t us^_[V"'t%"'jPf@NHu^VlKN 0!3trft fuxB =KNr^USWVP\$=VN1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#7xt1<:CG럡0!3y x50!31Ʌx $y $Q50!3^_[]SWVKNlKN>t+fuwWG ߉?u׃KNr KNt^_[Ã=KNt^_[WV|$D$ KNjP+@ft*fu vfFGF GF GF KNt^_Ã=KNt^_WV t$D$L$ KNfO !3fOPGWVU KNt ^_Ã=KNt ^_jt$itfxupU%1USWVt$4$1E11D$h#輀ot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;0SN:6B0SN*1\$ D$}u<$uhq#߃<$u U't']'8uUPujU>ƃ<$tvh# h#Pj v#[tih#2vh#0SN8tc"3HQPPp"3Q 7<$t"Uh#h#Rh#0SNH 0SN(|$t PjD$PU1L$#jUHfL$@D$wS$t'j/UZjU?>~<$耎0] Ph<#@<$ulh #]<$uh#D<$u h#7<$t,Uh#P)VN\$|$tIGh#~t$0SNH 0SN(nv<$uh$K뒡VND$ CjUD$PO PdK<$u h$ Vh#t$vt$1^_[]h+#1c#ctcp#RPhN#Ph# f1PPt$  5L!3@PcUSWV |$$D$ \$(=!3tKNH KN L!3 KN P!3 (SN1ɉ KN LNH WN@\$$(SNtH (SN~KNKNeH KNKN+L!3$bLN LNu&4$$bp LNLNq LNl$4$LN-LN5 LNx=tA LN0F$]5LN΅udKN(SN.4$LN LNt OLNG ^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t8VNt D$"3 < (SNH (SNKN1=u!y@u=D$D$KN$(SNH (SNKN=KNutKN+ L!3;L$~axu[(SNHKNk(SNH (SNAKN@(SNH (SNKN$ |$D$ЉD$$ (SNH (SN KN aT$,H KN$t)Ut$ StKN+L!3jPHP T$,>~y=u|$ D$ _RV/ uWN(SNH (SN~#KN%aT$,H KN `T$,H KN$Ut$ RT$4KN+L!3jPHPT$8 `T$,H KN>(SNH (SN~KN Z`T$,H KN8 _WNT1>uO@t*u t  $! QVT$4_T$,H KNWN_T$,H KN$_T$,H KND$$ |$tu^_[]USWVt$0|$(=LNt8VNt$D$"3&jb\xNFjWh&X 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tjuZ $HT$0JB^_[]WVt$ NȊ@>*u [t?uߋ=LNKNLNu(Qs9PYLNNQPc5LN8 LN KNu=KNt衻LN9t31Ʌt AuQP"u=LN7v LN6^_Vt$t"LN0vX5LN΅u^V5KNt1KN6P7 5KN KNuۃ=KNtߺ1LNKN^USWVt$(PYKN+L!3PXL!3Gtr}t  KvC#:t /tQ t7=!3tAL$,u8 (SNQ(SN#[O@랃tP`Y^_[]Ã=(SNu Z(SNL!38t!P$ tx PYu$hI#ljPXGËD$,tÊ'$< t< s4< w*(SNH (SN~KNKZH KN(SNH (SN~KN!ZH KNGw/u}/uE+P$ USWV,D$DD$l$@}E$u D$E!'D$D$D%D$ j=UKD$pD$(|$$|$l$|$t;D$PU!tdáKN+L!3D$$1Us$t>D$t;t0KN+L!3D$1ue1C}@$uKNKN+L!3D$=!3t-E1<*t&<@t"1ۃ wйs\111O|$1CD$%t$RPUT$1 u=KNL!3D$)ǣKN=(SND$%D$ u!L$ȃ@!"}@u =WH KN(SNH (SN~KNWH KNL$ CuqCD$ < w*(SNH (SN~KNVH KN(SNH (SN~KNVH KNL$ Cu1CK $Ix$'t (SNH (SN~YKN\$$W1C:څu0L$ QV1ۀ>t5KNW'KN$ukU$\$H KN=KN+=L!3t$ t$(SRWVuKN=L!3KN)=(SNSL1CKN+L!3t$ Pt$ D$ t[1GFtuրut܋ KN KǸtuŠQ1ljOu,^_[]ÉUVh9#荴8x+D$5WNhQ#mt$#u+HL$IQt$P5WNhl#BD$ƃHT$QRP5WNh#USWVKN+L!3D$KNKND$ KND$$LND$(LND$,5LN=KNl$0UER\$+L!3PCQ\$ S$UIRD$,LND$(LND$ L$$ KNKN5LN=KNk$$ L$1ҍ|$DT$rD$HL$[|$  KNu=KNt舲hWt$I yy8tKNHD$]Et uD$F끋D$H9 (SND$} Q&ST$~ (SN @N1Ҁ|$t' tـ s ـ w (SN@ (SN@D$KND$ x PD$t P`. D$tP>TKN$uD$+L!3jPt$$ D$KN KNu=KNt<^_[]USWV D$4L$@-KN5L!3l$)hPD$(SNH (SN~KNQH KN=L!3UPW#D$ POKN+L!3PN5WNWljӍD$ POL!3 KNKN) (SN (SNjPQKNSWhΊ"jPKNxt$GF9Iu|$"tjVU0 KNA KN(SN)(SND$ ^_[]SWVt$1ۃ|$|$áLNt#9xu 9X up2j>M LNKNLNLNxpX ^_[WV=LNt$ 95LN~?=KNKN?P, =KN KNu׃=KNtKNLNt?9p|KN8P+ LN8 KNu=KNtԮ LNu9q~)q$95KN~ LNLNKN5LN^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) &(SNH (SN~KNCH KNH KN(SNH (SN~$H $ KNQKN >KN $Q$ PKN$eØt2H KN(SNH (SN~$H $ KNQKN >KN $Q$ PKN$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G(SNP(SNj=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rLN9tH9u .%8/t Fs%Q D$;5LNtF/}tEEGXـxs@<$uokt$n tdǀx .u.uN jWt$ t8tG@u@/UPWV͇5LN=KNtt$ztWE/Q LN߀xruX@8tB@9tD$P5LNx5LN,Ą^_[]ËD$1Ʌt AuQPFWV|$ WGQ@P7WPj7p LNLN^_USWV\$D$|nOʼnmIWP)|$SUÉpsyRx 7u߅u҉3D$^_[]SWVt$(\$$W7C KNL!3KNP!3(SNLNjs(SNH (SN~KNT9H KNKN+L!3Pd6jVP Wp7^_[USWVt$FPhep#ԩ"3HQPP腥"3|$Q1ۃ|11E4OE9uSh#z"3HQPP+"3Q|=1C4薤"3HQPP"3QC9u1^_[]Ðh#貗h#託TLNH TLN~XLNH XLN#=~uTLNH TLNUSWVP8!3H TLNt+u yTLNH TLN~xhL"3諤h`"3螤 \LN18!3~PXXLNhSp {e]8t_8!3xL]8#>WjW !Pjj  hi#F8!3p\LN8!3@1ҋXLN  XLN@@P t 1+XLNTLN8!3{tXAˋ-\LNM \LN~ @لtXLNأTLN="3t$5XLND$耢5"3"D$XLNH XLN0~^_[]øTLN\LN1\LNTLNh# USWV=8!3w KN^t)kU=L~D(< t< u 8"3Hc FXLNFTLNF \LNG $9t V   KNt^_[]Ã=KNt^_[]!V TLN1~^Ë8!3r t ~6u1@1zTLN XLNSWV\$t$|$KN 8!3y tjM1 8!3I  8!3A$A XLNH TLNH \LNH XtK =XLN5TLN KNt^_[Ã=KNt^_[FWV$KNjW9ƍD$PV7uT#D$ =uD1PPPV< u2jPV u <$ELF1PPPV< uZV!9t:$Ph KNu=KNt胒Ā^_Wh#ߒVyh:#̒VfWh #踒VRWh#褒Vt$KNhH VjjV |$ t8!3H~Q8!3pxuhq/ 8!3A1TLN\LN4!3 KNt^Ã=KNt^隑8!3tL$T$9PuHuáTLN 8!3A \LNAXLNA4!3Aj8. 8!3@1ɉH H$H8!3WVt$|$ KN|$t=XLNWHTLN\LN54!3 KNt^_Ã=KNt^_ԐV58!3KNFx PߊFtPs ~ u8!3VV 8!3H TLNH \LNH XLN@4!3 KNt^Ã=KNt^I8!3Vt$ 8!39tLNtPu^hR#肐=8!3LNt-Ã|$t=8!3LNu LN~P8!3@fWV|$ 9=dPN=(QN@!3t P貉jhj"莾@!3MP؈@!3hM PM5@!3FhPNB9t jj1Vj螕Vj蓕Vj舕g $QN9tQj1$QNP5@!3hGV0`% h hPN9tQjhPNP5@!35@!3}@!31VjʔVj返Vj贔=dPN@1V1tV;@!3Fuh#Z!3^_hU0$ hPh#.IU0b$ h3U0L$ hPh#@!3;D$u D$@!3hcp#D0SNSWV=lPNjQEƋPh$מ|-1GPh2K$谞G;|ۡ"3HQPPR"3Q _5@!3GtJKNV[V KNu=KNto^_[h#όh#ŌS0" hPh#覌Vt$ hcp#C^USWVhcp#nC=lPN0SN1FjPlj+pPNi5rO@QPh2#a |,Ph2K$;E;|ۡ"3HQPPݘ"3Q W0SN8tH 0SN@(1^_[]h#{h#qUSWV\$n;%u(sV\8V7H3#KS783#dS7 tPNM5pPNAt#~i9:0#I {tPN3#4$D$D$=pPNC1tQ~H$8?uEt$PcuUt$6t 3#tl3#K\$ueZ*t%tS-tU+EC#D!3x+;tPN}#5pPNit b#\$1|$ t5^_[]áD!3t pPNiR#뚽R#SUrUSWVpPN)i5rO=D!39u=D!3)tPN~9ut Ku ]t]tu`ǁTtCiu3itit0 5D!3^_[]SWVt$KN~X1tttG9uމjQ=uPO19}q~5@tu ƆH KNt^_[Ã=KNt^_[R+5pPNi5rO@Ph:#觇+5pPNi5rO@Phz#茇P Pha#xWV11Fh#W>kt!Zu忀ރlt puԉпɁu0SNtg8tbPh$m=!3u =!3u@0SNtA5"3jPvW:0SNH 0SN@uj詄W5"3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh1&W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$thP#jD$PЖ ] pPN)i5rOC-D!3+9tti-;)t RPh#jl$ Uu\$D$P?<$t+,D$0h&#jS@S\$<ŋCt:tBuM ,%Ph+#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Sq;l$ ō,@)QPh4#o0 hb%jQb ݍ,P,;WD$P荐݃FD$ ݋\$GHO W輐H EuݍCWPB$u/1M|t؁Ph2K$WP N1MM|FGHO WRH GHOl$  W.H|1GHO W H ~T$KWyD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =!3$tCt>5@!39t%5@!3PVf$=tPN~y\$t$1=pPNtEt*t t.<$u u/S0=lPNu WE;-tPN| $^_[]H0 hjPh#zUSWVD$4\$,tl$0|$WUS ƃu_H8=VNtKNtPNpPND$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1opPND$ tPN$iD$ 9T$tcu tQ=(QNt 1=!3uL$,uP9tPtu "3P KNu=KNt~^_[]Vt$KN9tPh džƆ1z KNt^Ã=KNt^c~WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#5t$ntpuXSND$D$D$t 0SN8D$t(1PPSؑ EjS==lPNu|$1tPN-0SN~6@ pPND$u}t!AH Et{1jPƅt9u ED$u :u G Eu0SNt Dt111D$uD$tPNL$L$t$D$\$l$|$ pPN@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$tPNC$jU9 L$tc|$tNuJD$1rȋi4hep#jD$(PYl$D$D$L$D$u U D$\$l$t0~Ot)D$tPNy\$l$D$tUD$tMjPST ?jVDžtjuS3 =!3u V DŃ퀉0^_[]h#zSh#zzSh#ozUSWVP1$1C11h#B1it"gu$ڃjt puЉ̉( 0SNt yjPƅt,1tpPN)i5rO@Ph-#H$t#tH~1i0 tPh1&͊11G^_[]Ã~1i4ht#蕊"3HQP~G ;| Z %P.G ;| "3Z;|lh#xh#xV1=lPNujt$ St1+^V1=lPNt. tPN~$ApPN1F:uI}^V=!3tO=(QNtFD$t+ pPNi5rOA1ɋ"3u0VQhp#R ^USWV=lPNu65tPN~%=pPNFt WNlPNl$tPN~"5pPNHI}KNtfiPƋ-pPN=tPNiPUV ~ ;uKuU l$hZƋ=tPN5pPNi 1҉AJw)׉=tPN KNu=KNtavKNfdž=!31dPN1B|iP KNu=KNtu^_[]SWV\$|$-ƅtt.VSt$W\$<$D$ #^_[=08 Phz#uUSWV|$ (QNtWdW~*15(QN KNPNV>V}5dPNl$t$t%t =!3ttttk0hWj~Wj~t uupmul1V̤Vhc%辣tOhc%h#uSVjuV5@!3tTWjzWjzt*=!3t!WjzWjzWjzulPN^_[];0 hPh#ktUSWVt$ l$|$1ۃ=(QNt/t*=!3t!ttSVu5f@..@.^_WVt$ PKNNJujVj 瀾tW5@!3J<u%+pPNi5rO9D!3t mjVt=tu  ρπtt=ttu j8u VK KNu=KNtq^_r90 hPh#8rSVD$L$ =!3t1ۅ SPjN ^[Ët$1҅tހu1=xPNu2lPNu) tPN~pPN:tzt Iuh#~xPN1@SWVt$$1@=PN|$(1@z$#$$'Wh#bjvu hsT#h:%tjjvjv t1~ h#21@^tjs%;th#h$jvh%1Wvh#1Wvh#Wvh#jvu hsT#xhY#kjvm~ t+u hsT#Gh#:jv <u hsT#h##Rjvu hsT#h#7hw"v hzp#jvh#jvu hsT#he%;h#kFp]hzp#P~tF1SwJhN#.Sw 1> #t#P uh#hs`$vh#v#'1B#1###1#N9tQhep#jWWSxuF x%Phep#jVbVjv S hD#51^_[h#h#jvUSWVfD$ |PN PNl$$1D$Uލ}<$1!# x$']1,$]&~'t!=\tD"t $6\$ \|$ 'UӃ#\$ t #T$Ӊ$Ӄ;$#|$ t #,$ߺF&!}D$ ##(} u,$#$%)|"qT$t=Ӄu?<'t u9$;u<'_.ֳ",$,D$1 <':'D$t#@ʼnʉ]|t GhJuJы,$ɉ/t t"@I PN|PN^_[]WVt$ tG|$t jV~t'h:%h:%jVvu^_USWV$t PN =PND$P `VNt PVNdVN $=PN1jh'S耒 eP >@Hx@u8/ZD$PV諬x D$pL$t 1D$tD$p1ɋPN9PNhKNtH1 8t:tGt89=P!3^ 9=P!3~hKN5L!3WPVx >DR#A=(SN jn V !: fiDle cDhangD ged߉Vv"3HQPPv"3Q D$pL$t PNPNE;-PN1-PND$PĔ^_[],fUSWV<1Ujg-D$hhh UPjx 09A9u 9ÈPNj U PNjPNhcp#U h`#!3,$UhPN\t$T|$P KNPN$QN(QNXeD$PVWVW=PN Àu0{=!3n$hp#KNttQu dKN HKN<$B=!35=(QN(ȃu6$QN(QN4SN$KNuO=KNu7"3HQPP2t"3Q h`"3tD$PKN=KNtkf$$=PNu>hI#n't1Ph}#QPP[V$=!3u!3 PNt N=PNuEt$(Vh#t8t$P1TPV$WN="3t =4SNtj'kuD$P4SNu/jM=!3tFh<1#rh`"3Cs*1ɀ="3ˆQP'i="3u=4SNt4!3WN5HKNOp$$#uSWVD$8t^KNjP踓ƅx jVc KNu=KNt~dx"1=!3t=*"3t*"31G ^_[11="3t "31j褈V3V蒈=!3tt*"3u"3^_[%USWV|$(V11C=VNt3n1=!3u4t0j5"3jh`"3q!3P=8"3t.te=!3u\1Ƀ=xPN xPNjPXh1;tW1R=!3uIu=!3t7=!3t.h#pEVu}$u蜅V#^_[]Vt$KNjVx1jP KNu=KNtbj^Vh#c t1Ã|$|D$pPmmft$ th#bt$t$n th#bWV|$ W@PZ tWPO^_h#bbSWV|$P!39~b9KN؃P tr H!3 L!3P!3H!3 KNu=KNt aP!3KN5L!3>L!3)P!3 KNu=KNtGa^_[h#aD$t L!3) P!3L!3j h#j蝎 %%D$ H!3 L!3H P!3H (SNH ,SNH,SNËD$KNH ,SNP KNu =KN`Vt$KNH!3;t H!3PD FL!3FP!3F (SN KNt^Ã=KNt^E`USWVP!3<kKN-L!35H!3,QNt|F9uuH!3PV0  H!3H!3+ P!3 (SNL!3=P!3,SNtG90uC H!3 L!3H+HH x@WSUPy 5L!3=P!3 KNt^_[]Ã=KNt^_[][_h#_D$KNL!3)P!3 KNu =KN _V5P!3P!3(SN5L!3^WV|$ 5P!3+5(SNP!3)(SN9|5L!3^_ËD$ L!3) P!3 P!3L!3+D$ȣ(SNUSWV(L$@D$D$@t-΍i11P'wDGÉ,$Eu1ۋD$1 [!3t$Y!3t(81"3uƆ2"3u Z!3@uă^_[V(D$ T$0"39tu#RPh#Kt#1"3t(81"3uƆ2"3u숁2"3^WVt$ ~t)~tP uv ^_USWV jA 0SNt_y 8-uUD$$0SN1TSNP  0SNy8-@P1F Pơ1t6?-u1t+O^0SN-uta50SN1^_[Ph#6HPh#+H|$u1PjPPeKNjw0SN8t PI KNu=KNtfG1ËD$Ѓ w#j jP躧 uHSNASNËL$~ND$tH  DSN=ASNu HSNLSNASNhLSNhHSNQpphA#?GUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjhcp#hd#Z J|$:uUD$8@?jPhd#Y ^jUhd#Y 1|$D$0)@<Phk#h`"3V jhd#f1?\$D$01@11T$4*l$Phep#j UWhUh#5Y D$EEjUt$0Y u0^_[]À|$:uD$8@:Ph#K1L$0L$4XUjDfVD$ 8"31qqA1Ʌ `PN20PQ8"3p ]t u 1%8"38"3@j* 8"3 u^qqh#DPD$`PN/$yQXUSWV'ơ8"3@tu'tƃ 8"3 x,$@D$t.$x$18uWPtG'uD$tKjD$p4)t6NjpVWPVt E$ht8"3@^_[]USWV8"3@|$u 8"3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8"3@@|$Fu6|$uD8"3@ 8"3Ap8 u|$u8"3@^_[]jjX 8"3ASWVƻt u j pxʡ8"3@^_[USWV8"3kE1͋ 8"3x t*`PN,PN8"3@ C1Ƀ8Qs s j@8"3HOH O oKy K9t?U1CSp| fSh'P= 8"3HO@ G 襯8"3!^_[]WV@t$P 8"3A uyW wWh#40'h#j"Q Wh#j"PQWuL$Lx40'h#Vh#jPQWUSWV8"3@1u 1=!3tMtݡ8"3@xuUj @jhÉGpjTaC+t8"3@tj (pƉ^_[]h#8"3t$p0h#K?USWV8"3@$ u8"3@$EŃCߡ8"3@$'$ 8"3APUj ^á8"31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjjljF j0G5jGt8"3xJjG B u08"3x,u%@!'t@/@!'uh#jÀ=!3tjjj 8"3H0+H8O U 8"3p0jR@ 8"3QPI H pGu58"3~ hǨ%v^m|$F8"3xujD$ 8"3Hu 8"3H L$ qx0j@8"3HKH K {@;u.8"3x }8"3x|$ T@0GjG 8"3@t(HS u 8"3@8"3x\$\$j 8"3HK @0Cku8"3x ux,uhǨ%pjD@<"31ɉH H 8"3Q0PCAHrAAtejC9t jW\G @:8"3@ u8"3@$EŃ!ߡ8"3@E<$t!t;tj dXÉ{؃^_[]/ uS\$|$8"3X0j&x@ 8"3QPI H X t\$|$D$C 8"3APsVL 8"3jj 5jj,jj#jj jjhǨ%jjjjWV8"3x$G Hs8"3jpW$ uq8"3p(x,u~ 8"3At8 u @A8 @tHA~րxru\tuՀh&#8"3p0+p8j@ 8"3QPI H pG .Ps8"3@F 8"3t1^_jjVt$&9u^jVVL$1!'tA1B1t A!'u^uVt$j@ 8"3QPI H p^USWV |$$tD$ D$$D$l$E1$8"3xc 8"3x0$t $jPƃF 8"3QVI N ~ut. 8"3I!'tAt=t A!'u1c8"3H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc4!3 8"3A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j8"3 $+H8N~L$NL$$N @0FEPqj/vuG4!3 8"3+A8FF8"3@4 ^_[]jjjjh#L$1!'tAt=t A!'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;PN}X;PN~PPNI;-u{tBuG8"3x0+x8j@ 8"3QPI H xF^_[F h#lUSWV|$4!3D$ =u ?vl$$5L!3P!3(SNG$|$ t u ϛ t19uD谛 $ tC9u?,$ u4!38"3HH }聛Mt9t u>u:<$ t=u虞$)jWP蘞 |$l$$uS\uN(SNH (SN'\F u%(SNH (SN F4!3#á(SNH (SNƈF t豚=v4!3藚=t h' u4!38"3HH (SNH (SNf=L!3)FV 8"3x4!3+D$^_[]USWV$$1҉T$ T$$D$(54!38"3r0='t1$|$ fw|$1/fFn D$j8fNL!3 P!3 (SN= 'u ƒ=(SN$‹nD>  $8'='u f|> (SN4!3Bס8"3=' f|> SD>fT$ T!uhЃ`Ř0N,謘05,/L>='fu (SNBn׍MN|$*@01fD T.fTT.fTT.fTD'fD1AL$1(ljƒ(M (SNFD (SNBvNO|$`@81ɃfD T7fTD 'DfDfD> 1 = (SN\G`T$ t$>Hff (SNT$ Bf|>D>u6t$褪 nMn (SN}f|>  (SNBFfL \ D$$D$f|>tD>t (SNBf|>u D> (SNB (SNB:Ã{t !' (SN}E+=L!3 (SNE{|$ðD$ #{w#}cD$ 1@Xftf|>u f|>Iu6v $S nMnD.='( (SN ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD'fD (SNT$ B1AL$ Y) NjFfL (SNB)H 4!38"3@8xt `PN `PN$8 Nf|C\:`1" $}f|  (SNT$ BFu6$虧 Ft$HFfіD$$D$UP`ſ1۹$t'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD'fDu6t $膦 FHF (SNB^趕= t]I\t 'u 5 t =u 4!38"31Ƀxɉ `PN$6 (SNT$ 'uF|' (SNF$ '$< u (SNT$ BT$ (SN c˔et$1  4!38"3x5`PN0!'ωD$Ѓ L}\$f'f|t (SN (SNB\' u (SNBNf|t (SNB1@D$v (SN (SNB݃"XŃ'K D$0$: nt$T$ Mn (SNB1@D$t$`PN$4U ܏` Ń< ?\u貏\ ? \$1SHЃ w&Hw ÃHÃéOu \ (SNvNO|$@81BfD T7fTT7fTT7fTD'fD\$ IÑL$ ur%=V =(SN D$  $ swF (SNP?ˀ (SN@F (SN x?ɀtw (SN@ (SNW?ˀg^ (SNGJT$ :豐,D$SNSND$D$$SN萐1z!'t.(SNH (SN!LjG !'u\KЃ w4(SNH (SNLjG ÃЃ D$ u t (SN׃Zn (SNH (SN=Gt/ up}tk(SNJ (SNi#@ǽh#tE%t@Ń:b D$D$$'y¸U1#, 9u(1|$Nf|uf|t Ms@ L!39T$ vNK؃|$F@11fT T3fTT3|3|t3ft1BfTft|'fq fq ƋT$ TLNH TLN~XLNH XLN (ËFD6\$D$$'1')G (SNx ?ʀtw (SNE (SNO?ʀ (SNGZ (SNx?ʀtw (SNE (SNO ?ʀtw (SNG (SNA?ʀtw (SNA (SNH?ˀ; (SNx?ʀtw (SNE (SNO?ʀtw (SNG (SNA ?ʀtw (SNA (SNH?ʀtw (SN@ (SNA?ˀ[" (SNAD$ ??s(SNH (SN~2G:(SNH (SN~$_1:B ܿˆB1'nD= 'G='tf|cf|.3(SNH (SNk5L!3Gf|uNT$ ؃t 4$t$Kŀ>ts4$OlAT$ )B8"3L$H,L$H $貾8"3pM tΉ$誚 Nu8"3xĨ^_[]1HE;PN} ;PN~PN>uxkjy1$&tu>tyu6EBE9E0E"EEEA }8"3h$ Ή$s Nu=tuS$C#$Z#4!3 8"3A0$#^$g#K$#?$#3$f#'$}#V 8"3xt@@ ^Ãx t#`PN$A)8"3@ @8 4!3H0TLNH TLN~XLNH XLN0蜄ƃ~0:=F $'/ t=up럃F~t\u^ 4!3@4!3 8"3A0yt`PN K`PN$T(*;|u0d|8"3@=t*軆4$D$D$'4uۡ8"3@1v u4!38"3HH @1@Q&8"3@-8"3@8"3@&tQ;ub8"3@ 8"3@Ʌ8"3@8"3@ 蘅8"3@u+\u?! u64!38"3@81Ƀxɉ `PNP&3jjh_"2 ˁVȋ 8"3y8~0 (SNQ(SN轹@ 8"3Q8rq8^USWV\ӉΡ8"3@D$ 1,$ KND$O+L!3D$$UP KN$~Sʼn$S5L!3P> l$|$tD$$ KN KNu=KNt$w4!3D$-L!3P!3(SN8"3x t*`PNPM%8"3@ 葀ǃ[~!\u9耀ǃ[C tJ$Q u"4!38"3HH s`un=ub\tX`tS4!3 8"3QQ NDt""u$(SNH (SN~E\E \@ŋ (SNA(SNٷ@(SNH (SN趷EL!3@|$t~PŴt$jP~ D$pŋȅut$ j蚴E8"3xtH@1D$4!3D$j7ǡ4!3D$4t5 8"3At$ D$AEx<8"3@t$ Ex P!39ًl$蕵 P!39~=L!3(SNt1SUW觰 )(SNKNUi $ KNt\$=KN\$tt 8"3T$ Q KNNf|u%Du (SNQ(SN@Vt$+t$ (SNQ(SN@~.F(SNB(SNȅɵAJ։ȃՃ\^_[]á8"3L$H0h#Wo<$t 4$j /8"3@D$ KNjPZ jj jjVtQ" N^V 8"3cp#ytA5`PNt7t u(VNVN54!3P5`PN #^USWVt$,|$0l$Uز5P!3ݱ1BW;L!3u(V^GSN9w&SNWVS聮 U跲^_[]Áw: t9v$P5SN聊 tãSN$SN랾!#뤾/#USWVT$L$ - KNÂƊ*"3(KND$1|$08"3D$|$ljWitJD$8"3*"3Vz- KND$(KNKNcp#jUh\$t$l$= KN1F5(KND$08"3$V\$S( {Vh'P 8"3A |$t|$t=!3u #@݅u:T$1rIJ$JB *"3VVRmL -L!3=8"3D$*"3t$xD$ KND$(KN؅tȁĤ^_[]jhL$1jRfL$1tT$9Qt uÉV SN1t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu SNtu(Mxju PQ.Ex P@U蔍 uF^_[]USWVl$ t$\$|$t|h@VS` VStDžt9u 9t S}@9u95D"3}5D"3^_[]Åy0 PVShd#W;@WVSh~#USWVt$ |$\$l$j蜭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jH@ SN$SNM|$];PN};PN~PNEu9] uSNtX9X5SNt-pt 9^t6SLF9t S$? SN1tF9Yt? SNtHt 9Y jjS> PkD$($@t 9XjS;>1xKNSN  bSN PN9|AQjS= ǃt;=D"3~=D"3x jjW= j蹫$JBXxp KN|$u=KNt uSNt$(WUN mCO1O ntuK5SNjSD= DžD8t 8ujjS= Dž0 PSh# \$t "3t"3|$t "3t"3^_[]j 迣 PSh#p 0 SN1tT$9Qt uÉVt$5SNj Vu< u SN|Qj VW< u8FPj VC< u$j j V1< ujj V< t;D"3~D"3^h# WV|$ t;G;SN|.GPSƋG9tVPWw<w^_WV H"3 A H"31F |71FPWW; y w;D"3~D"3P;gfff  SN^_USWV$$$~KN 8k$ 'n  SNt9i V SNtQt 9j b Y<(O8=!3tNnjU9ƍD$PV荮#D$ =nhh]n$SUd9oƅtjV9!SjV9 $/nhh nhh U9 ƅV;5D"3~5D"3|'u" !39uu-jjWo9 9t1jPWV KNuQ=KNtH A1jPWUy v 0 PWVPW^9 KNt Ā^_[]Ã=KNtĀ^_[] hh j 躟 PWUh#j 0螟 PWh&#O 1F5dKN\V0 PUhr#% @8V808dKNj0} PUhO#USWVPxa|$\$;D"3~D"3oU= VUS 1jSSA t!t$8$^_[]h#f4$71EUjUjUUUjSj uVwt$ g SVD$5SNKNPV]SNV=  KNt^Ã=KNt^X1=SNSWV5SNt4|$t^tCx P27jV6u^_[SWV|$ D"39|ȋt$|9}9| D"39tV6jjVW 9u^_[?W6SN PVh#WVSN |;PN| pSNt$ Pj V6 y28t 8u>SN jjV5 ;D"3~=D"39t V!6^_Vj 蛣tL$ T$5SN0SNPH^áSNtT$SN9Pt u5Pv 5USWV$|$<\$81D$ $D$1F5 U5 3h#WSn !1tbh$W^hD#WHuo1h$Wthv}"W讶t D$1p@|MD$K}h2&Wvt8D$D$h7# j5"31CKD$D$u}hZ# v11 t=t8t8t6It TNrTN KNt^Ã=KNt^ISWVt$u TN1ۃÿSNt6SN8t+KNSP KNu=KNtSN=TNru^_[,^_[V1=TNu#SN1A:t2>u TNr^WV|$ 0TNu"t$=KNtg=UNu^KNWuS =SNtӃSN8t2t-UNVN=!3tu=KNu葽0^_WV|$t$ TNuWVjTN<rjV芺uƆTN^_áTN=TNt1Åt8uUSWVUN1GVN<UNu@@uuUN=TNu΋4SNtã VNS-HKNV jPEVq t<$tS-HKNm UN^_[]ù@rA<UNtøWVt$ 95VNt)1Wj;Wj0Wj%5VN^_ËD$VNVNUSWVhD$=VNuVN)=UNt VNt D$D$HKNVNHKN=VNtt$,jVu 5 KNet$,jVu45 KN=TNu%=SNt?t1SNPWKNjV=u5 KNBjc|$wfs 5VN賹1ۍD$X XXPj(gSW\$\$ \$\$O?r 1@ DD$jPj  ^VPK"uf5"3t$WVt$|$ ?t*FHN V>Qu95"3u V^_5"3t$WVt$ NfuVNFNtF t0fu^~KN ?NQPF N)NKNv豏F FF KNu=KNt V N^_Vt$F t-)t'VfxQPR yNFN F^5"3t$USWVP|$t$j'Vmt~th#Vb<k>t!h'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9="3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Q j'Vot)19<>^_hL"3oh`"3bUSWVD$~@|$l$1SWU t 蠶8tF r)~1H^_[]ËD$)D$KNX"3tPk 1X"3P"3 KNu =KNPD$L$ T$$RQP XVPt$t$V tt$ P4$!k ^h#PD$L$ $QP5"3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+WN+,VNPqq h#jhWNWNSWVP4VN<'C PVw u,$$wXCGσCGCuhVNVh#8 u*$ VNVNVNVN^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv/ t61^_[]ËD$t8SV ƋVN`uVN$i VN#t#$#t%`WVN㟉VNt$D$$~# ^[WV<5 KN1$|$PWYt $D$PL$LT$H= KNPQR 5 KN$<^_USWVL$T$tHtA|$9t91!'Írjt/9t+1!'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U藢VsƋ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#WV<5 KN(KN$|$jWu"D$LL$H= KN(KNPQ5 KN$(KN<^_USWVD$ èu|$=Z!3uÍD$PQW Ƌ@KNNt$݁ uF @SPуF`u vYf F~tuF1Ɏ! s%t É^~\VNtHVNu`VNt jW~ KNuk=KNtb[r2j菆XxL$H @ $  $#`uWe `u Wve fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=tLGu% uw` Gu#W` @tw蹁Gg;uWNr^_[2SWV|$tfh#WVTWK9uWh$V't*tUj'Wkvt8)WPh # h # GhN#Whq~%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhY$tUhY$>=uD"3HQP~ j( P "3j)n~=uGuthZ#EU"3HQPP"3Q ^_[]USWVPWNuWN hWNT$ t$\$VN1<$?tIOt !T$ ttуt݋ WN9|QPiT$(WN%WNt=t (SN>:G (SN:pUSWVD$(01r$11h#ȗt7ptnuO1Gru=t*t0SN8t$jUt$VD$D$^_[]á0SN8H 0SN(tϋ$ЉD$D$D$ P1PU L$ \ =u4)Ftt.L$!H=tFt=t UWtvtt($t@u7=t $ H 4$VU) 0SNH 0SN(e&UQh# 1@D${1 Uh3#^9ru Qh#NQh#CV:tX1h[#Mt(IuNt xuփуVP0SNH 0SNu1^hI#USWVP\$jPSh 1NjT$@tуu1FKNuaՋOW | uujh'S GuGOu' u wZ  $WZ G KNu=KNt^_[]SWV5WNWN~tFu7jwl54"3v hT!3:x v Z 舎DNtuV _ BPRуG u wY FGF GFGVY N^_[ËD$ *ÃuD$jpp 1h_#USWVP1$1E1h#e~ft&vtxu teuԃe$뺋-0SNEt=$ ˃1$u Pn ƄuWu ƋEu1^_[]fSWVt$|$h%6Iu"h#t4DO1@$'N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h#h#WV|։π9!utNWNtfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP5~I1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$ t$\s19{USWVӉϋuWNfx@$8'$PWw1ۅD$PV_r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW11ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVW蝐1ۅTVW荐1ۅfVW}VWi1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]NQ9-u1tQyt8ytBÄth #Qq't1h jjhl'Qh jjh|'h jj h$'RKËD$L$  )VL$D$ 2)u AJ)^USWVPj PV־ lj8t"ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#iVh #^USWV׉聭t 9Fup  ^^n9uM1PPn~ōP(rPUn~ LH;NuS/Q #~^_[]ÐUSWVt$(hcp#jg D$,^H $x?-Ok-u)sstdluu~xwGWÅu"3DHt'1Ʌ SكhI#5h3DH\ƃ~ƀtVAtVVh/#jAރ $hu&SL1Ʌt:Su+$891V5"3Vz|-$K$8ʉT$h2&W1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWlu.&|u" $4Ph%{ 1@D$l$t jW Sj D$PU{ ljӋD$9t-ف8ur1u 8tQ#xcp#UPh## 1@D$\$ $4hj#1@D$F \$ t$Ph#jXKNPPPPh#5"3>jWVPΉj WQz 9u=у|=}^_Vhy#jQh#Tj5"3jPWV@X`LN4LN0LN5PV>t)j=W+cthW>uxPhep#j@VjVh# Vh"3hE" D1$VWh# d#t%VQh~# j,h#h#} VWh#nL^_=KNt 1TLN\LNP?8"3\SN1pSNxSN\SN9SNtj=SNu"3L"3"3`"3"3tPK "3Vjn15HKN>CPkAQW1^_[SWV|$t$$'$(#'Vw vVw d_ t"Vst Vw?w4N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u$'E$#'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tG Ã|$G USWVPu }WNWN"3f`|j%v]m O1@ 0WND$,WN|$@t$(q%v>%L$ h#V<*u C hs#S1N .u{*u{ 1HD$Chs#S1HD$  t$CD$'C`L$&~QF0 $\$'. D$׋L$ jj D$tfL$tjWt$QPhWNTFu$@$'WNl$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhWNАWNL$ Q0)|$WNH WNT$ l$=WNuM|$L$ jL D$tbL$l$tf|$ L$D$$WNnd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$WN L$\$L$$X8GWN0WNE ƋL$ cjl |$D$VPt$wWNWNWNWN1  WN WNWt$*|$$WN \$$(XNWNt PC V~PT3 WN҉D$xF\$wZ$$'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V(XNWNT$t PB T$WNWNt PB T$15WN5WNЉ\$H\tF5WNX])P0tXM\$u/^t-u#F5WN벸^tic\$>T$ j5WNF5WN{ 31:DYt 7GuF5WN\$DF5WNȋ\$+1L$ jlD$t1L$t5WQg(XNL$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hWN PRQt$QP  WNFPJ0 WN VjxP蹇 7sWNT$t t$L$ t PVRQhWNMT$L$ t1PRQhWN.VWhWN1PQ*t$P PQhWNW tWNWNT$z \trB<]*<0tu$%' ?$$'."'#Eu uShf#WN 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h #WN\),ҋ4$u|$ uWh;#WN ^_[]WVPWN0tpWNA1ɉQPV賥 Nj 3#DQt$c#r& WN+ WNVQP$ WN1^_SVˡWNH WN u:"3Prp~r0 P"3Q 밅uWN)"3HQPPP"3Q^[SWVPWN0t"WN<'t<"u1B^_[11f 1ɉQPVg lj+t:<-t6 3DAu)WN+WNVPh# WN $ڃ^_[SWVӉQtǃArVh#赿WNGPVhWN[' D$WNWNƇWN^_[USWVP׉1PPP ,>U>t@PUQ x$tG9tCWN+WNVPh#WN+WNVPh# WN$^_[]WV9t"΀:t9WN+WN9t\VPh#ZWN+WNPh=#裾D`8"uD=WN+=WNj"eR PVWh#nRPha#] WN^_USWV\$$8l$}hN j jhp%'Uƅu!hN j jhT&'U͓ƅH h]#D$uE#D$uM#]=,XNtj Ì,XN؃0XNU#wu \#jw؃uc#LD$uj#-w؃uq#D$uy##u=,XNtj ,XN0XN#w %u # *' #u D$u #Uw %@u#4fD$u# D$u #D$u#D$u#D$u#,XNtj 觊,XN0XN#p%'tXp%'|$FTPSh#jdW߉,^ u΃=,XNtj ;,XN0XNtj ,XN0XNp%'1p%' tN$L :Ntl P#PSQ8#uFj PVC h8u$8u؃^_[Vh$jWVh#jUSWV  f<~NLXN 4~Nƒ 4~NPXN3 4~N€ш 4~NTXN 8~NXXN\XNhF|#Ot h#7t8ƿ/'#PVYtG uVh#j $$1ɉh1#SU P6$+'`XNkj j5 UԆ ƃuEg8"5LXN|XNv UfTXNWj j5 Uw ƃ _%pXNj j5 U7 ƃuf8"G5PXNxXNXNhXN1A5 U5 Uh<#VXtch]#VWKtXNdXNBlXNdXN/TXN#e8"tD5XXN  9uXXNrCjh#5 Uh##VhO#5 Uhy# 5 Uh`#ju h# \XNt 1ҁ‰XN4~Nփ95TXNu<9PXNu2<~N9LXNu#8~N9 "3t "3dXNpXN=xXNu\1ɅQ|th# 3=lXNt)ͅt=tXNut 1jhhXNP4 $yhXNh$jf=pXNu1D$(Pt$O@u#D$0=u dXNpXN1N1$+' $$h"/"t$h#Qh%hVzV訝th@$PO$Ph$6`XN^N $=^N=|XNp\NB=hx0#t~t1@$$Phmdt$ hh#h|tWWhG# $=]Nu ]N =]Nu ]N 4$h\N TlXN $$1 uWhPh\N5 1\N\N\N\NtjVh\N~- h\N\ $RhS\NhXNVW0 5hXNVWF5 WPl$t$D$ 1ɉHHD$UD$ Pja Džy#`8#Bjx߉DžVrx9ujUj  1|$nhx0#$PV|<hjh\N\ ^ W&Pt $h#xhd313H 3~ 3H 38h 3Qljt9 t43H 3~ 3H 3h 3Pƒ߃NyjUj h0#1\Nd3hXNVW4. 5hXNVWj3 h\Ndtd($Ph$-$P=1@PojUjg / P P hA#.#tǍ$PWh%VD$uh"Z$P躘e%jPhfO#QQƃu W* VUnWVθj#,'PV0Pt uVhQ#jcG TXNPXNGLXNGXXNO1$~Nt^_^_WV΃=$~N (~Nt>\XNt49t0]#]#9t<#9t<#QPh #_ 5\XN$~N(~N^_SWV#\1'1'VSh#h3xI9#uj-mVPjj"P th'#؂1Q1(,'$ =uhW jj"t$  1$4wF"u4$ 1@^WVκ] u1H3 r1P^_V΀=dXNu6=TXNt\ t41t)Ph\N0h\NhedAV xk^Ã=TXNu\ Jt=pXNt7tXNt.h\NhedAVp th\NhrdAVY t=^NujkhS#jhd#jUSWVPύAPjh!#hd3vGw41'hE$PhL#hd3v d3w(hX#Vv w,h_#Vv w0hf#Vv w8hm#Vwv w4ht#Vfv W4O<W8#9tQh#h{#hd3;vcp#OHtQPh#hd3vcp#OJtQPh#hd3ucp#OLtQPh#hd3ucp#ONtQPh#hd3ucp#OPtQPh#hd3ucp#OTtQPh#hd3ru<$f$1۽ad3Pjjh#0&wVh#d3PuwVh#d3PtGtmÈJ9|6{u;[tVPWhB#}D$(ffL$(D$ 1ۉa)D$u!)tPt$h#|L$4 <)ǘ΋I<9vt$h#|$N<.”T$9vt$h#`|$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h #| D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ]N]Nt$(L$QhV3|  D$ 1h#VtG<$h/#V芜4(1>tYj:W D$AL$\$h/#SB,1tD$hOZ&WGtkhM$WGhs#WF\D$Ph#W- D$q;XXNef]NujhK&l$!U  l$1'1tUP QF`1'r܉1hD$ Pj <$Wh# zD$ D$t$ <$}trÉD$h"U6 t:h"U$ t/h"U t$UWh]#y F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh}#yD$ D$\NFʼnD$uf5\Nl$u D$l$l$hQ$WDhA%WDh#WDh#WDh#WD h#WzDh"WdDTh#WNDh#W8Dh,#W"DUh"W Dkh0#WCh:#WChG#WChR#WC<w ~W|$Whf#dw T1<$\NjD$<$rt$Wh5#5w D$f\N@<$Wh#wXXNf]NjUh\NjUh\N <$t$ht$0Vsw J21jD$ Pj< D$\N뜉1jD$ Pj D$\Nq1jD$ Pj uuD$\NJ1jD$ Pj uND$\N#1jD$ Pj u'D$\N1jD$ Pj^ tt$W|$Wh#uD$\N1hD$ Pj uD$f\N1hD$ Pj uD$f\Na1hD$ Pj ^D$f\N11hD$ Pj .D$f\N1jD$ Pjc D$\N1jD$ Pj8 D$\N; XXNsr"jW|$Wh#W|$Wh#΍L$$ t$]N|$0~NL$$ L$ ]Nt$0~Nrh/#V8l$}}(,'1ۋ>t.W8>Lt t uPUW Á,'r D$3MDHu D$"91hD$ Pj t4$h#UsD$ \$"r)Ut$h#6s h #)sD$1ۋD$(]NND$(]NW`=4(t$|t%h/#V L$1Ҁ<tʉT$D$< w'<$$+'L$ L$$]N<$tL$$L$ L$$]N|$0~NcL$$t D$|$0~NL$$]N16FL$<$C fF|$0~NL$! L$$]N|$0~Nt8L$$ D$|$0~NtL$$]N11A<$D$ h\N1D$ ȁ(^_[]4$h#aqD$ WVPθWEV\N ]Nf]Nh\N f]N=dXNu=pXNu#$}h\NhgdV 1h\NhfdV yK8t K8uv$=pXNu(PhmdVn xX5"3hiX _1=pXNu$h\NhgdV2 y 9#1G^_ù(#h#1 뙃="3tt$ t$ t$ , YJ1HVD$ t$=\NthPh\N ^D$L$01;VJt,uVh#-t"uVh#Vh$VhJ#Vh #|o^h,~Nhmd5"3& USWV8 $RPh h ^NQ ~N XNv|Pt$h# o lj D$T$1D$ XƉ 11 ‹l$_N ~N ^N9 ^NhWD$P! $;D$cp#=^Nt =}t=}uЉD$$#=XNtȋ XN=WEVuT$tf9XXNrD$Pftt=XN%4$t$Uh#m D$t=VEW=XN$t=VEW4$t$UVh#m=XN|4$t$UVhC#jm=^N$D$PSt$Ut$Vhn#1`=|XNu $hXNSd3V 5hXNSVI SGSt$VhVWu ^ND$ L$D$11t4$h#8^_[]USWV T$ $11F1Ń=XN|Uh#Zl QPWD$Pt$9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=XNtUPhF#k Ɖ ^_[]Ã=XNtUh#=XNtUh##VkċL$T$tPh\N11@Ph#t"j QPd uAE8"t1HPXN1Yh#jPh#gt"j QPd uD8"t1HLXN1Yh#j9SWV։ϋ\$+lXNtItEulXN1tGtB ^N_N ~N9w1 ^N 1tth\NQA1@^_[Vhf#jnL$1=TXNT$ PG1ɅɉWV ~N~( WRPh ^NQ^ ~N9u ^_h#uQVh#j$PQVh#jUSWVPӉ΋l$|$uj WVc EuC"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h/#V;<t#ƍFh/#P1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh8#Wh#dh1۹0~N؃^_[]ËL$9/up\ND$\$A/jPU u$D$ \ND$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#g0~N!Wh#{g0~N1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#̋D$$Th#Sut]"2'W 1PWS2 '> uۀ$U-$T142'D$XP# tpC"uD$TPhN#X$T$끹2#2'j" $eFMu SQЃ {Sh#HXh$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$U Vh#W7 $TutoFhO#/$PQhh#R~$ #OR$fw(ha#S t*VhH&S tSh|#R뾋$G(w,h#S t*VhH&S tSh#Q뾋$G,w0h#SI qt*VhH&Se tSh#rQ뾋$G0w8h#S )t*VhH&S tSh?#*Q뾋$G8w4hg#S t*VhH&S tSh|#P뾋$G4wVh #P~I$ $u ~ˍ|$@WV(9t"b&J~PH k$1'1OJH w@$1' D&B(D$ D$$l$ CtGtngtbcB8D$D$l$cD&ɋB(D$(D$,l$(BD&ɋB(D$8D$<l$8D&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=D~NuHr8jVSW D$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph<# JhK#J~USWV|$t$t$h"V}L Gw43'h "Ph"VWL GPSh"V?LGPSh"V,LVjjhcO&GXtVjj h"GXtVjjh"GXtVjjh"Vj Xw(h"VK w,h"VK w0h*"VK w8h?"VK w4hU"VoK wu 1<1A71Au01<  $jj@PD$Pl}D$ Ph$@C9u<$u4l3H l3~d3H d3 hd3j gF1^_[]h#j>fUSWV $ $ D$-@1H~NL~NH~NP~NT~NP~N$X~N\~NX~Nt$ h #US c~!P$4' `~N˃PtdT]= U?1AJ5 U蛊d~N뒹 . UX~Nhcp#n `~Nb `~ND$h~NT$:@=H~Nl UD$ Tnt uBxou D$ 1Ɉ l~Nh%VOEtH~Nhcp#`ء U$j:WC-P~NtWutmP~NS c$ \W`~Nt`~Nt d~N 39$ 1ɉL$tVh$P7 tj/Uu Uh"h%v%h$ U<VDžuV(Dž7h$Pǽ Ƌoh#Wt(h/"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tUilj?,$u1QhD$PQV hp~Nhzd@P tq$ PhedAWg W腌|$ WD8$9",5'uW3 N,$h h 5d~NP Ġ ^_[]h#j螼$Ph$j躼Vh#j}h{"hz"ʍD$ Ph# D$ Ph#j肼D$ Ph#롍D$ Ph#땍L$ Q4 5'h@#USWV։ϋl$j V U CCCOK G^_[]9!h$6'Php#h3=jz2USWVP׉΋tASW4$4(VS Whk$Vt$ P9 Wd É^_[]USWV|$1_h#St$h/"Sth#Su\H~NtoU3t[u=l~Nt .=l~Nt%X~NtoU3lt [u^_[]USWV$D$|$P~Ncp#tW3$t CÅushC$t$ uD$o%D$ h~Nt L$ mt L$ ^$D$ D$h $$ t$hl%hV8$0|$D$4$L$h%Qc?1G@΍K9|,SP Ŋt><-u(GD$tj=Vt>FD$ GD#th%D$P>u|$1F1B,$֋$$$,$D`~NtPcp#tH"P$hI#P8 xF1Ë$4hu%48C9uj C7[t2ƅ|$t t$u 4$j tA710hY#|$t t$@ 4$5 ^_[]ÍD$jPVg x!L$ȃtuuh#誶묁tlP PUh5#?D 끉 `~NutD$P$ =uW$P$u<1#t#Pv vvh2$h3-6$SWV։ϋY Wss ss҃ Nt~j |nWss ssԅuA N^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉš襡腡 PQ40Q40<81<8D@D@LHLHTPѠTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40740<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7}Vw wjV FwwVVFwwBVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu%SCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0ŝS4C0EHȉCHudh$VŋFN0NtbSQP 0Nx N~,=NtffOfGG@ Չn,~$N()ǃ~$N(=N9<$D$hP-N>N,ș)N,)n$F(teh$V$FN0NtbSQP 0NHT$<L=NtAf=Nt4f.<$ ^_[]HNNF,)F$N($fOt@ HN븋D$L$t$ QPQPUSWV$$$ $$$(hY$SV\1j cD$SVWUhPD؃r_܅N95؅NrPSV Pt7=Ntf%"=@tsl#WQhy%d Wh$T^_[]USWVP|$\$s s@=Ntf9uRNt=pNt=Ntj:D$1PPPs sQs s6ON3C N3K u "3&=Ntf%"=@tsl#Qh$胣s s/)SUh$ pNu =Nt:yj h$pNthB$EJ=pNuh$u=NNt7t;f5HND$Njh$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=Ntf=NtGf"@tsl#Ph$/SVz.=pNt)1=NL L hY$Ih$$p$l tRQf@ NN 1VW "3L$@D$DD$ t$|$ Npt95Ntʋ N5NT$Htt tɉL$LL$QPh$=pNuh$515"3PPPjNN  5"3RPjjt:\N=pNhN$GD$L$ NN5N=N tYjj=NHNtt,fI=NtftfI=NtfIfHVW51NN9pNt-j > NN djjQP NN AQP=Ntf%=@5N5N8,$t$R=܅N؅N t# Fjj WSҗ9ݹÉrFND$P9|$P$d닔$hjj RS萗 )ˀ0^N9whB$訞h`$Ntf5NN15"3WWWjNN CRP5"3jj_h$hk$1HN1P^_[]Ë$d#N N$tҍt$PtV$lSUQP4$SUfH1G@u5N5NhA#SUu.$l#$pthA#5N5NSUq5N5NH=NNfA=Nfh$HNh$h<1#(Djj5N5ND$DD$+' t$\$ VS@@PD$PQVSf@5N5NtfA=NtfA$l$p!fHG5N5Nqf@5N5NSU5SUh$ t$p$ph$? =pNj HUSWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ8N@4 1WjPQWWRS 9=Nf"3 Nff"3=Ntwf"3 Nff#3=Ntjf"3"3f#3=Nt"3ȃ=Nt]D$ Yf"3 Nf"3f"3 Nf#3f"3"3f#3=Nt"37D$ G UV=Nl$$tApQt=NtRPA(=Nt1ҋ 8NI4-0NteQRP 0Nxtt$V/11jWpz =N=Ntf=Nf"38N;x4})}jh"3W8 =NE 8NA49rE =Nt<$fGj \$l$u6_=Ntf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=NtfUVfXW|$$Wf@t$$W=NHNtt,fA=NtftfA=NtfAfH ^_[]UUSWV$$1Q ܅N؅N9;$$߃9։$PU$T$L1 B(Bѷ $BjZr1B$J$=Npt$ =Nt ɋ=NNL$xtt tɋ=N5N1L$|1ɅDT t$t RP蔃5NUVRP tE{[|$t}SWZljUVSWl)SW2lj_{[ |$t]SWljUVSW')SWlj?UVSW)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV N1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =Nt SW  8NL$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =N<$\$T$|$(t$,DpLtL|Dx=NRSTtDp8ND$0X0vvRPVFvvՀ RSĀVFt|tx|$8誀D$T$Rl$$D(D,=NtFB\pTt8NB0FN FNDxD$L|׉L$L$؉D(MU =Nt]RQ& 8NI0VP U EMhɡ8N@0 ȃ=Nt3ȃ=NEhD,t($8N@0MU EhEhD,=NL$ tL$D$D$=8N,$\$ 1QOP\$  t19}#8@#pLp0l$$ 0NɋD$taVt$P= 0Nx4ƍ$5NpS) 8N@0fPt$t$ 0Nx5NSp N=Ntf؋Nf"38NB09}+^jh"3SD N8NB0N9rF =NtL$L$ L$ 1YJP|$ uL$ 19}#8@#rL 0NtaPt$t$$ 0Nx=Nt$,|$(DxL|DpLt1҉TxT|FN=8N<$09NQP})RPv}VF^vv_} )RPN}L$(D,D(D,EM =N\$QP} 8NI0)RP|U EEhhȋ58NN0 )ȃ=Nt^ȋ58NT)FN^FV )S\$L$4$*58NV0)EM Ehh )ЋL$Ev8QS HN1Ą^_[]Éjh"3p $Ph'$k=pNthh${6h;$߻F & 8N@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fo ^nFD$hF$D$pFD$lFNpt =NtɡN=NL$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=Ntf)9F=N\$tAf)=Nt4f=Nt'fL$=NfVT$Rt)f~T$JR>>fD>=Ntq1@1$CD$ƈCCEUL$ q/G9<$u1A=xN=N\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=hNt Vt$t$Ut$h$1Ƀȃ^_[]1A=xNt1=N<$\$ HfUSWV $8$4}tE1ɉM4M019 N‹DT 9 NtRPvM$U(E$f M$E$U( u ^_[]%=uLI8N(9‰|ǃ=TNt<|u=NtFNFh1 tNtD$hVP2 |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =Nt RPu 8NI0VQRP~։D$D$ ЉT$t 8N=NQ8k=NL$$tL$D$ =Nt QP9u 8N#8t@DQL!!IT u‹$8U t#DT tE=Nt!RPtD t(=Nt1҉EU}@U=}@|$HNEM QPQPh$3WWht$聇h$'uQ{u u 8Ny0ƃ=NNt:tMPWt?UUlCD$T$NQt PWs~V ~V hl$.N4N@ 뛋58NF8E -NT$$tT$D$ =Nt RPQsv0 I)؉$ʉT$t*DT tZ=Nt RPs$8D t6=Ntȋ$81҉AQSt$t$tv<$8}@ud<$D$|WHNE$8I QPQPh$3UUht$薅h$<$<t78NHt)$|$-NCq qƃ=Nt0FV=N|$$tJRPq)RPq4FV =N|$$t&RPq)RPq)FV )FV hl$+N4N@ USWV|$ \$t܅N9؅NaN N ‹-8Nt9ˉrux9ˉ\$؉jL$QWP|ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס4Nt`v0WUL 4N8NpxjV|$(WS@)Љ NN=NjVPS 4NA^_[]WShD$4N@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$8Np0vv_ $G 8Ny0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPz19rÃ=N$t$ \$ti=Nt,ۉ~A1_t4nT\$F9uۉ~1O ɋW @9uG W5N萲t$ D$x 8N;Xt|$#=Nt JًL B tmt$v vhK$hWWVt=Nt$$B1ɉL HNt$ $$Bt$ B C8N;Xt`R5N踱T$\$1ۃ=Nt%JًT tN=Nt#RP3mBt/=Nt1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbHNL$AI QPQPh$7W]Wht$h$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=Nt+FV=NtGRPl+D$RP l1FV =Nt*RPk+D$RPk+D$ډFV +D$ډFV hl$&&N4N@ 1@$5USWV\$41F~3|$0l$,|!̅N ȅN9|)S9у} ȃ^_[]Éދ8NK89}=hNtOI.A!1‰9)=hNl$,|$0t!t$4PWUh$v8NPVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=hN!$l$|$ T|$0tN# $ND$T$RPWUh$Z 8N<$\Ttq!qIVPt$ Sh$ $@l$19=hNtk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$8Nt$Sh$|1Al$,|$0USWVD$,\$( NNփσ5N= N11 J N9N6 NNN9 N@D$ N=8N\$jD$ PL$QT$Rtց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =$N(Nt0N8,NT$t4N‹D$ȉNN8NWUS58N5N贬=Nl$$-N+l$(=N|$`58N1VV=Ntf%=tjvdv`fVdF`vlvhfVlFht4fTCut4qfTCuG9a=TNt< 8N(18NSS=Ntf%=u1=Nu(x$CS =Nt RPe9Ƹs& ɉ @u ɉ @uG9wt$t$t$58N5N襬8N1Ƀ=N N^_[]PShd$awUSWVl$|$8NjVUWK 1ƒ NNNN=N- N=N-N N98N8#{H1ۃ=N(=0N-4N1$N,Nډ(Nt@$N -,N=(NWhY 8Nt^_[]UWh$Tvh$Jv8Nt P$ 8NUSWV l$ =N1ɅDT =Nt RPc 8NY0މD$ʃQSRV{ wÉD$4t,Px 1ơTN$`NQPt$0t$0舳$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ hN; dNu3P5XN =XNt-XNdNd hNXNQhN4 ^_[]h$\tSWV|$t$TN`NQPWVDtH 1P1 t^_[WVh$ tVTNtR hN~%XN46φ ;5XNsTNP趆 5XN訆 1XNTN^SWV\$t$s sǃuG=NtfL$%"=@tsl#RQh%t s s=pNtfh$NN{@t1H1PPQQsHsDs su SW=Nt6hhNW -h $葠u7=pN{놹 Ns s4NH HN^_[WV|$t$ WVh$ C܅N95؅N0WVh$=tNt7=Npt=NtPs t 0hY$'=Npt=NtPh@Z&2=NtfPh $=pNtqPh"1Ƀ=NDT =Nt RP>_RPh)$ =NtF(F=NtjP|tPh4$^_SWVD$H8=Nt3P PP0p4u'11C9}QBRQp< P0p4^_[USWV|$_8+t]Cw$pj VWVQrtu^_QhM$oUSWV(] }@ND$1 tSW述19t%1SW虰ƀ8t ܅N؅N9׉r ܅N؅N111 Ѻ8N$D$ jPSWht$ƉыT$ ʉ)ЋxNT$9ы $t$t$D$ ҃ w 9rjPz tkt$ t$T$ QtPt$D$oT$ D$Љ$9s $D$A9u<$t1D$t T$xNVhd$(oD$L$LxNL$ SW0Ƌ 8ND$\Tt$uT$ ( $ $I#L$֋$Jȋ $։t$ ΋I T$ RPhN8N5Nt$U NNttut58Nt$ 5N D$xU tU tt$h$m=NthNN8NjSW$D$xU up\t$ 4$t$ ,H 8NLT$Lh P5Nl 5DN5N襦=NtNPP護5N跓NE%=t$D$ t*ȁt,1@D$@8Np81FhN讪NSWD$N$t$V<$t.=NtXRP=NRMT$=NHRPN9L$0ơ8N@0 T$D$=ND$0T$T$4=Nt$$t RPUNMt$t$$=NtȋMD(8N@0T$,‹t$(΃=NNt+tMVRMuVFt$t$ M7KVRMMQ AD$:MQqD$T$AQ!EL$DT=Nt1ҋ 8Nq0RP耐 ƋL$ jWSQӃ=ND$ t7~SPt$t$$NjT=Nt RPM|$)~SPt$t$$=Ntȋ|$1҉\$$ t/f 8Nq0RPݏ xËD$L$ L$0|á8N@0 T$ʋL$ȃ=NL$0T$D$t!D$4=Nt)PQNLD$ T$8=Nt@ɉL$ D$ =pNt h$X=Nt h2$XhU$X/=pNu hy$WX=pNu h$W3=pNu h$W6=pNu h$W<=lNt=pNu h$WT 8N|$Y8֋T$  SP5N5N5N5Nh$Wd,$kdы8N@DWSQPdD$T$iщډWSUR)jj RPRPt$t$t$t$t$VD$Ph9$$=hN 8N+؅N ܅NN NN N tQPho$] =hN-8NKC)s, N-NՋs4HS8\$ ډD$$+ȅN$T$̅N $ $ډ Љ NNtRQh$ =HNt8h$5HNtvvh$r 6j =PNt8h$N5PNtvvh$1 6j C15PN5HN5LN95NtmjhI 8N405Nh QVT 5DNVʍ=NtNPPҞ5NzN=Nt HNj 8Ny,t+xN1TtRe xN 8NF;q,rxNPe xN=Nt =Nth$S0N1=N=pNu h* $S=Nt hQ $SGRtgD$Ph.%u1D$t)L$ jQPh.%ho%9]t-=pNu hq $SW ^_[]1USWV@ND$458N~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B ЅNl$9؉|58N|$0G;~,$LHN4H~KT$މ)1@ ЅN9׋T$9|58N1҉t$L1F NNNN9S,SދD$4HxL$HD$81ۋjV 8Nׁ\Tډ\$tQ!QЃQ SPhNE8N5N|$D$Xt1NPSWUʼnFظ|߃\$ <$w4FN<$t LX FuWFsT$ NN$@=NtfL$fAf|$l$$j H hX PNPNT$ =hNt| $=Nt RP$3RPh $l=hNgq$ʋT=Nt RP2WURPVh $a($DX=NtPh $<HNh $Eh $frT$ '|$@@u' T$t$SUt$A Nt$D$, F=N=N$@=Ntffu$@=Ntfft}SU{$@=Nt?f=Nt/ȃ=N $ApfAAt$f=Nt $ApfAA $AtfA1ɉ N N N Nl$T\$XNpt4$9 Nt ʡN N$tt4$tʡN N1ɉ$dtX$t $D$LPt$衹=N=Nt=`Nu,$$@\=NtȅSUh $C h> $,p~SUؾ19 Nt1ɉH\H`HdHhHl$f!B=N,$(E\=NtȅƄ$E\=Ntȋ 8NI0H111҉,$L$ D$t ߋ 8NY8Om\=Nt͋ 8N#8߉@DYL!!ÊIT u,$\$lD`Td t<=Nt RP/D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$98NH4 D$|$׉D$|$=Nt݋AQ=Nt-RPw.!Eh=Ntȋt$|$1҉11 ˉl$$WVRPSUhf $uA=pNth $hT$m|$t;SU蕼ƃ=ND$|t1$=Nt RP-FVHN=NtȉFhܽ$|$jj$$$$SU z $A`Id=NtEQPD- $plph+-1$D=NtWUPVh $  $AhQl D\$C58N;^,T$$L$ NN׃ƃ=N5N 8N9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-xNt$| ؋T$(tu3D$1 Kl$@؃,Ut$HwK ƋD$9\$(s+l$ UhS $>j'SWUt$@hw $hL $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wN NʃǃN=N|$ |:w wh $= =pNh $qjG $D$|$tjVU¾ ЅN<)1CVUh$D$,p p*N NʃǃN=N j K> hp LNtHLN HN9tDy1Y1 t 9u,NN$|$ ,LNHNQ1I1 ы|$ tLN$G0W4L$Aڃ]D$ p ph $J< =pNt)h $Z1C+HNh $;h $h1Ct ؃ ^_[]HNjpjRfUSWVP$T$1B@B! HNN8Nx,11=Nt>Q:8Nx,$kd1PWSQh $h3FN8N1ۃVU聶tzljl$ t$Npt=NtʡN N1ɉT$HtttȉD$LVUz8tD$PWbu(C8N;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$NŅtTM1ًU1 u3VSh$w wNHPUMpXN LN9tmu1 LNͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $7'h= $F9h`$eh $ejj聴=NNf@=Nfh $8hb$eeU1hPVPVҜ1Bh& $8h`$'et21VWhVWVW莜1 tah $+7HNh $du<tf@=Ntf @f=NtjjxfhT j5hN5XNrWT$1B@Bg -XNhN  $N$Wt>E6+5XN=hNkdPWVQhr $h35NuF$h $vv 躑 NA1ڍF$h $cvv 6ǃ=NF$ N&jPj#1 NI F NQPQPhSt=NF$ Nt%QjPSh)"$h $>6#HNQjPSh)"$h $36=pNthB$C=pN1F$N I1)щN$uh$b-vv *ǃ=NF$ N$Wt jP["1҉GW1҉GW }hjD$\P> =NND$tt7fD$T@jv$"-fD$T@jv$!fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=N$tD$\=NtL$Lu$D$PD$PD$XPyN;,$/HN$W=NvN5XN;4$]|$T{$AhjW -N=Ntt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=N$|$TtD$\=NtD$L$|$TtD$\D$PD$PW٧;4$=XN;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h $ss QPTh $(^t~s sqf@fNCKK CQPhA#ss oOCK =hNth $ss QPCKhA#QPss fN HN;<$=XNhN4~^1ۋ/uu q]]8u9rۋ=XN/CK tS  StQP HKX9rjj轄`^_[]HNj&ejǜPhV $/L$D$@, +A,USWV $0 n8$=Nui=Nt`E=NtȅtNE=Nt$;؅N܅Ns&E=NtjPo@E$F0N4 utEhs%P})$0 F=NtȍL$A=NAAhhs%Q6 N NtD$D$L$L$D$h3$v v薉 E=NtfM9v%}EPhM$.t$h?$4[4/E=Nf)=Nf=NfEtf=Nt΋$0 AI 1 h$QP辈 h $Z$0 F=NtȉE$?$PpZEL$fAWQU>- $)fEPUV- =NtfD$fXWPU, $0 G0W4w wmfH$XHN$0 =Nt>}t8h$v v贇 h $Yu EBHNF0N411G9 v vGD$@=NtȍL$A=NAAhhA#Qs3 N N tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=Nt2f)=Nt%ffD$=NffN )fD$1fM$0 A0Q4MT$ tjQkfHD$=NtfPjUN D$fEutEhA#Pyl$L$Aq $0 JR ωtljh$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=hNh$ڃD$=Nt΋D$p@ =NX}$0 ~h$v vڄ Eh $VJHNB$$0 1GPVtXD$T$ F0V4=hNh$ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV( D$fXSPU( E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQU]( $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh $ U4$F0V4=Ntȋ ܅N9؅Ns5h$juv v݂h"$T4$=NE=Ntȃu}uE=Ntȃtb}u\FN U=Ntʋ4$h)$jRQPX=Nt}Eh $T1 NEtjPgC$0 A4y0<$$0 t=pND$=NJR u=NtPjVRQ菁h"$cSƋE=NtjP1Ƀ=Nt fN1ہ@€@t f NfGHN4$Crv $0 A4y0AI U=Ntʋ4$h $jRQP褀h"$xRHNzE=NtjP)Ë@ C$0 A4y0AI $QPQPhRcE=Nl$\$tȋM=Nt1퍜$UQUPhScShd$$"PhZ$ %9-pNth$l$\$ h"$zQƃl$\$$0 A4y0| AI KC=NtaEO9tU$0 AI U=Nth$jRQP%GEh $Pu $ HNfO4$E  ^_[]ËM PSh$"ȃ=NtUSWVT hNXN,=Nt>)"=hNkdPWVQh$h3胛N}ww cO W $T$ WGO ƀÄ:1=pNt4=Nt+=Nt"uGO 1F9ƺw1 tbQPc8uS=NxJ1v6KNj@ $GD$wOG tQPb8u E;-N|E;-N=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ \ D$TD$DNpt =Nt ɡN-NL$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ 7 v6ΜL$QPt4t$t$af@jw wt$t$~t NN1JQPFafpXN9)T^_[]fUSWVT1ۍT$1B+' 8Nx,@=Nt;8Np,kd1PVSQhB$h3xN8N xN<\$11ۃVU衛VUm`$t$l$ Npt<=Ntϋ NN1҉|$Ltt<8tϋ NN1҉|$PdtX 8Džtɋ$L$HQ$(7'xtCVU誓tV=hNVUhj$^1=NL L tOjh$sPNtuQ1y1 t6 u_VUYdtl=hNtHVUh$D7jh$$PxyQ PNP0 jh$D$P CxNL$;JWD$ PNNtDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5NN8Nh$h'$ ud8Nǀh P5NK 5DN5N,=NtNPP>5NN8N@ 8NHHщ8<=pNth&$5=pNuh $u_h 58N5Na 5DN5N&=NtNPP75N'NN8ND@RL҉111C QPha$[ 8NHLщ@D=pNth&$R=pNuh $h 58N5Nz 5DN5N.%=NtNPP665N@NN*HHPLщ8<҉@D1ۉN NdN8N1Ƀ,=pNh$1L$ 8NL9| 9Ph$8N=pNth&$=pNuh'$Ih 58N5N 5DN5N#=NtNPP45NNN@h$L$>N8Nǀ,04ǀ(<HHPLщ8<҉@Dh P5NI 5DN5N"=NtNPP45NNN NdNG?8NL-=pNth$:h$7N8NǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5N 5DN5N!=NtNPP25NNN=Nt}=XNuth 58N5N~ 5DN5N2!=NtNPP:28Nph5N5N6 hĄN5N=8NVhA LVjP/@ G011D$)9|ËLG8 $HLOd t1SRPV5N6t0|$u)h8$h $s1AL$=NtLSVV36 8NA8$HLId t1SRPV5NU=Nt SVV5 =8NG0ŋ $A9̅N ȅNʃƃVh ЅNVjP> jw,xNy9 ܅N؅N\N9؃s\NÉ`NhNC dNUPhƣXNUSWTN Vh @NF8N $N=LN |N1Ƹ1ҽhWV5(N5N|5N=NN5(N=LBALtl=TNHhf$Xh $11IPPQQPV7(Nf@5(N+6 (NfA,NFȃtvFjPh$ =pNth $=pNuhT$nt1F(Nf@5(N5 (NfA,NFf=rmh$=pNth/$葊=pNuh$t0fF(Nf@5(N,5 (NfA,NFffuzh$=pNth&$=pNuh $tt=11IPPQQPV6(Nf@5(N4 (NfA,N1Ff9D> <:PVQʿ D>/|)Ot$L$68N1ɉSh"$=pNthN$Ph$lt$" 8NQP#T$1RQQD$P1Aá8N;X0t$~~1Ƀ=NT$DT =N|$t RPL$ pL$QSRP辠ǍPBHN$|$1D$D$t1)ÉعF@jP谲D`r9w<$r$l$T1C @<$9uG<$;|$}8NX0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ8N@0)ȃ`T$1ۡHNـ#h"$b=pNth&$rMh $ ع`֋,$L$t1ɉȉD$ օt$ tH 8Ni0T$,RQUt$> 8N;A0l$,} $L$l$l$,8N@0D$Mt$ |1TT1PD$T$ ʃ=Nt RP%L$(ωQM D$H 9tet$C9\$t$$h#$ HN4$F4$;t$SD$`1HN0^_[]ËL$ ʋ 8Nf9u Sh"$褤D$`,t$$h"$lj 8NPhS"$CUSWVT$L$D$0(D$ X=NtSUʼnӉ OD$$8N@09ʼn} t$t$5D$PSUt$< 8N;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5Nt9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP辏$<$G L$;L$t9ta щʼn$;D$t`1h#$辢^_[]USWV tN$8Nx0UWt$0t$0!Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR͚ HNT$4$1B srl$,$ ȈU1wX=Nt vN!9GX=NtȋL$,1Ph#$蚡 HNL$ $  h#$y=pNth&$Hh $t$D$OPWTP1GTGP^_[]HN1USWV|$,$t$tN1@$8Nsll$lNtpN L$  ƍD$1PQQVK9 8N;A0-T$zu D$`1]l$z$Ń1EGpD$hZ D$ Pt$ u&xMt(T$hZ D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh+#$џ=pNth8$$Fh`#$Et3s ss3st$Vn[E;,$uHN$%t#Ph"$0j USWV0\$T|$HOX=Nt1D$,D$(D$$D$ D$D$PL$Qs tPst$OGN҉L$D$td$PQtÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ6C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h&$:'h%$hE&$h h$$Ph$&$ O4$V0Vh%$h%$h h%$h%$hWVt$ F,t@MNth&$9F,P1~,>d9~8uv0^_h%$h&$h h$$D$x,u@Pt P軣鳣h$%$h%$h h$$WV΋I01t*N8~2IN8tPQP PhN0G;~4vɃ~8u^_h%$h%$h, h$$h%$h%$h2 USWVEH1Bx,T$1hsM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS聢e^_[]h%%$h=%$hF h$$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hj&$h&$hK h$$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h%%$hP%$h` hf%$hP%$ha h$$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h%%$h|%$hq hf%$h|%$hs h$$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hj&$hW&$h~ h$$vfUSWV\$$|$ l$t$MNt5NSWUh&$USWV5N 1^_[]USWV\$$|$ l$t$MNt5NSWUh%'$8USWV5N1^_[]V=lNthU'$Œ2j5PNHtah'$腌h $+tSPNxL~61 LN s"@Pt4h'$ LNPNF;pL|^5PNvjPNt'x,tPPNPPNáPNt x,tt$t$t$t$P1WVt$|$ VW=NdtX=Nts,8N`uau33 u1@1^_WV hNt1 LN 8N1!`u/aʀs2hlpx1Ph'$ԊPh ($h $gJh'$蹊8N ǀdƀah P5N  5DN5N=NtNPP5NѰN8N!1111QWRPjhPNhh)($h $艶lh'$ۉ8N ǀdh P5N4 5DN5N=NtNPP5NN 8NdPs+aʀu Ph ($Phc($h $蟵hK($8Nǀdƀah P5NM 5DN5N=NtNPP 5NN^_jUSWV1L$ AL$HAL$@AL$<L$ J'L$A J'AJ'AJ']u }h($SV訅 ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uh:'jBƉe^_[]Ãu95 3ujhJ'D$P_ u1PPD$Pju95 3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQN~RPt$8t$@t$8t$@WT4u2h;)$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Phep#hVnD$@w ww7VPh)$S  1h')$+hy)$W fUSWV1L$(AL$$t$@L$ D$ }] h)$WSz aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9 3u~]#D1غ$Phzd@ tN|$$tOh:'jt$ 返t$@賔1Oe^_[]h:'j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$*$h'*$t$V,]9.V {_t$Sht SLtt$DV2t(Whq*$V 1;uV hT*$TUSWVP׉ $\$B hPt1VSW `0F9ut$SW H0SWt$9^_[]fUSWVt$0l$,|$(\$$D$ D$hb+$VU{ puSWguOt1A1@D$ 뼃Ptf1@$1@D$띋t$u D$9- 3W:ʼnT$jW 1t<$@jW0tat$Vt$UW!ƒt=Wt/|$uW t1h:'j1K؃^_[]É4$1VjVVW0 jVVWt~1hQPx fdžUt$ t$ UP1@PVj1QPQ1PW' PW4$h+$Whh+$ h~+$h+$W 9fUSWVP$|$ t$l$1hKz#WVy fttruG$95 3u4jUk/jU^/jUQ/ uh+$"h:'jc " Àuh+$Up1O^_[]Åt&$jv ) VUكtt$ <u&$jw  WU~tJ 1u$jq  VUJbh-,$Lh+$Bh,$8SWVL$t%T$1H1<213:'F9u1^_[USWVT$D$\$1f$\$SpjPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALh0$Suh0$h0$USWVP\$|$tus$g" $"$j`ntQ1@PVSjPt$8t$8W E1u>4$hR3$W VtSh3$W4$h33$W 1H^_[]UWV} uOʃ U|RQPh1$VUJPRdx& $T$W1ٹ|$5 Uh61$ 5 Uh"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhJ'V{: 1OujV5 UqMuW?,VQ>~IhF1$Qp1$VQ7 t1PhX1$Q= 1O^_SWVP|$1N?u\j S5 Uo 8u1u/|$ҽ8u Ƚ5 Uh"W ^_[WV|$1N?t5 UHa1t^_h2$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5 U  у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5 UbxL$T$$$jST$ RL$Q tXS?$$ىډWT$$jD$ PST$Rɜ t)t$h4$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jhJ't$6$ tjVt$6$ jQV$Ѓ $V I iTh j$U$  V tZs0whq1$V1t^_[]1;BB ,FjhJ'P5 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0h1$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1Ph1$Q= 1HUSWVt$|$ t)l$\$$jWUSc tWUSh1$1h1$VD*l$(\$$jWUS0 tWUSh2$V1H^_[]Ã|jWUST11USWV\$1s3h%5 U. t^1W1ɉQD$0PW T$L$,9t9uD$8tB1ɉQQW{ T$!уtD$8D$D$L$ 39ŋL$uH 3$ȉщL$9H 3$ :':' $t0PQ=t"@'}tPt$u^4$t$,h%D$=$uSh2$W \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQZL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZhn=$P%1D$Bhn=$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh=$u51fUSWVPM(,|$8O] D$1h=$uS3 sujsWVVuutqD$9 31t$$uӽ1Ne^_[]ÉD$H@ D$ juVTjV;H A D$ $Y$jV  jV tuhG>$u1D$3D$3L$ u41D$Bh^>$u-hA/$h%>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhJ'V  tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$th>$S菿 0+T$x|$yRt$h>$udh>$D$t$th>$S511A $1A;L$0D$4D$,L$ |L$Vt$VjS@L$)΋T$׋jp jRQWVS 6 $p q a  yq @N F$FV0~4j\V϶FSܹ H @AQ@Q A$Pƃ׃q0y4QLAHS%?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu01h^?$h?$SJh@?$SfUSWV0u1L$ L$AL$AD$] }D$h?$VS- a~bt1iugD$ PW*u5D$PWD$PWut3NT$T${lht#L$<1QWh WWj WP1 L$<99t3r3=u1H$Qhht@Pbl u$ԎNu@L$wG'ԎNs t95 3juVuu hA$;D$|$|But3L$L$T$xupt83|$H1 @uًt$uWt9wWuVhA$ue 1HhG'j(e^_[]V @$hn% Pz h-$ @$Pa h)B$4D$ @$tD$ @$u |$  L$ L$ك@L$0فL$(|$w7Pt$Vw wE VϠl3H l3;|3hd3j Vd3H d3 l3H l3|$;|3hd3j d3H d3 GtOPh@$>O1w7w & l3H l3d3H d3 hO#D$O1w7w IƋWMhD$@Pt$0w t t$D$Pvw 0T$уL$, ԎN1҉L$$9L$,hd3j t$<|$ Wh$PV|$Whep#P$WWVxuhhK&V0 Vhcp#|$Wh!@$ϞD$xu2h؎Nhep#h$VVhcp#Wh0@$蒞3$Vhcp#Wh0@$xD$Phep#hVIVcp#VWhA@$HVWhP@$9 D$4E$ȋ|$gw t$0j cp#QRPjt$LV- xVhY$E$gw |$4cp#cp#t$t%VRPQh\@$觝 Mt+WhD$@PSw M tPhd@$tl3H l3t$~d3H d3 hd3j |$G8jm$CQj$PJ$?Pcp#PVhj@$cp#PVhz@$ G0O4 tQPh$P:Ph$B$|$t$ ދD$$ʍ RAt$Qhcp#Ph@$腜l3H l3~d3H d3 hd3j GHt$sG 8-uXG $1҉QQ$$Phep#hD$HPD$r> E+u(ljށD$D$Mj@$PVw tPRrL$9wȉD$WMj@$PVw tPrL$9wȉD$u|$D$ ?L$>G CVhA$hE$A$PSw71P E$G5$PSw w1P \$|$tD> 1@D$,$t$|$@u  jhWVƉE ك@T$dt$`wQj hcp#|$Wt$PV x'D$`D$t$ \$\,$A$t$ tnՒ"tA$Vt$ P|$pWl$pU譍l$9~?r1D$@$t @$Vt$ L$( PЎD$D$D^_[]WVtfy8tH8|$jmWj$QÞh@$jAƉjWPz t VjA$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj hcp#UPjS yD$4$T$dWRVhA$迍;tSh$謍j ŒP^_[]fUSWVDt$`l$\\$XT$1 J'A J'AJ'AJ'B0B$` hB$VU k)Hw]r$uStJPSTu7HsutPD$PSH uhG'jXD^_[]1Hu߅tjhJ'D$P t9- 3uPhg.D$PS觷벃luhL$ At$H NH N@N NhN1NFNFNFNF^Vt$|$uD$ hN0NFDNF@NFu$L$4fL$fB$PhCG$S $PhPG$S t$(蜰 Åt$(ư $fǀU1PPPEt>!ƒ[u$t$ ;$4t$8& D$t$ fËt$01 |$lD$PhOZ&S D$lPt$SD$PhwG$S D$|Pt$$Phn%S `$Ph$S B$Ph#S $D$Ph$S tj$$Pt$ 菄 D$DPhB$S D$D9M$ $ȃhL$pQP- t$誮 Åt$Ԯ U$61QQP<!ƒ~t$ M$$VP 9U]$|$$D$jRP'<!ƒ=M$$VP萿 9E$1SP|$WU GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uohL$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hM$ MHtU4uL9rRQP t$|$t%u@uhVY) tIF81tSul|$tDEM9rQWP2 u@u`V) u@yu@u`V( teEptUt$8ЃtEu8uXV( t, ^_[]hL$hK$AhL$hI$5hL$hL$)u\u\h+M$udShL$j^ wlh$j fUSWVt$X 1tvt$+Z t[SL tCPMd Vt$^\ tPUW] uW SI 1S< WsX ^_[]USWVu]PhL$S6 t$f1j?1Nt}ǍD$ Ph$Sm td\$ t\hjD$PMA jS\$S ShiW>' t$E L$Uf jQhL$P je^_[]PPh$t$ u1$YVPt$ t$t$V tPh$V u1$^USWVt$t$Y t Nj\$ Pt 9v)D? D1N*Ƌl$Wt VPUZ )SjU*@ ^_[]USWVt$t$OY t?Nj\$ P t$=C1H]USWV@uPh2M$V ] hM$VzX tPs |$ P\$$ShiV\@ |$ jSq PhM$u `Z VՒ ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPq t!PhM$SZ Vz 1He^_[]ho%hM$hh;M$;WV|$$hM$WzW t;Pkr u1Vr jPV/ VhiWQ? t^_hM$hM$jVh;M$;hM$j V Nh$3V V (Nh`V V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhM$hV>tVh(N$YV0FߋD$t$j7QPhM$hV>tVh=N$YYV0F߁^UVuPhEU$VR t3$L$ AQhiV= u hLU$31e^]ho%h@U$hhO$9UVuPhU$V t3$L$ AQhiVe= u hU$1e^]ho%h}U$hhO$9UWV}W#ƉPhd$Wg tZt4$P<tW@PVtn tGPhU$u V t>V[1e^_]ho%hU$hhO$}8hT$hU$hU$ hU$hU$j9 h+U$t$KT tPhU$t$uV HhiA&h U$hhO$8WVPt$|$D$PVW tKD$tUhL$WS tPhL$VV H^_hiA&hU$hhO$7hU$hL$jy hL$j= SWV$hQ$SrS t]Pen GAsdWt^WPhQ$StNpxPhiS3; u?V1=1HĐ^_[hV$hV$h.V$j hkQ$j USWV 1CCj7Shxi Pu uhT$?,$PuhT$#Ɖl$D$Shxi W4 u hT$j0 $L$9~D$~*1t j TSh$^UG;|$|j jTVjgLUSWVH,X'D$@(X'D$<$X'D$85Nu#D$1D$11D$=ND$(Pj-u hS$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=Nu11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$P讎u hz\$jz t$ D$D$t$$1|$\$F =)3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$

u WhxQ$j PED$L$AËD$L$AËD$L$AËD$L$AËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$H@)3 )31SV\$ Sh)3=uCЃ r"CrCr 401H^[h)3$H?r 4 ؈)31ыL$t pN1ÍAЃ r)Aw AwÉ741HUSWV1t$ D$hVPM0 )3xxNt8u^pNǁtNxN|NNNNNNNNNNN@wh)3R&uhS$0h)39&uhT$ht)3 &u h5T$j $5)3tvh$3%61NNN(3tt)3$h)3$U ƃV B~>CNNF v/FwD$N'NAu"hZO$-X$N'Nxu>Wu4D$P1VhVVj V5 U N9t$:*ƀpNl `C Lvms)3(3u$&3NNrNND$P1VhVVj V5 U$ N9t$taYN>NONCatTl5$&3+wtz(39t)3 &3$ÿ%3؉$(3 3 N$u =NuB=N=N=Nu|t =Nu =Nuftu^NuS$ttH)ŋ$L$ T$ RQL$QWPU%u@ u&h2"hkO$,5 Uh%j t$PD$P & u hO$D$t,DtVPyDžuh2"hO$JW WtS)uh2"hK$Wuh2"hI$)3t H9t@h2"hO$$@ t%VWЃ$Wj>hP$h2"h*hO$<(USWVC-l? uhEV$hkO$j Ƹ)3jmPcp#cp#tV$jL)3PtV$USWhKV$h3I)3t VSm#V$ucp#WWWWWQWhV$h3aI$V8~ j=V )31tT$q9t Iu^WVΉhjW) D$PhbU$V, tZh %V C tQP-^ L$PyRPQ WhiV* u hmU$>Ĕ^_hiA&hZU$hhO$&WV hwR$QB t;Px]  u1W] j PW< Whui V^* t ^_h[T$hNT$hihO$&&h}T$j h'Q$0w1ÃD$ 1ɉJJJ JJ BRhiP) t1h^Q$j $1ɉJJRhiP) u 1ĐhkQ$jb Qh)3WUSWV΅t Rx> < < 0($D$P*!\$D$1t$$tsVXsD$tVP;Vh$W trC=ND$uCt\=NuCuM=NuCt>=NuLhj$V,' VhiWn( t!$uۋt$$4u=Nt ~ j }Bhd3sWt& )3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhQ$h$VeVUh?R$B jl$U$VO Vhit$  t$,$t!Ph]R$LBVhLR$|,$jt$V Vh~it$  t$tPhhR$Aj Aꍄ$P$$ j:QPh~R$h$P$t'$UhS$~AUE}uj:$$h~R$h$Pb$t'$UhS$#AUzE}u-)34$tVWUmuj|$W$V $$ DŽ$@Vhit$V@  u$ h#S$@1@Pl$U%jWl$0UG 1@D$81D$ N$$t$$ ʋ|$t-ƒ ʺcp#th#Rh[$QPh#hS$>D$|$ t-ƒ ʺcp#th#Rh"QPh#hS$W>$$ t-ƒ ʺcp#th#RhS$QPh#hS$>$$ tQPhS$= $$ƒ ʺcp#th#RhY%QPhS$hS$= N$$5$$ t-ƒ ʺcp#th#Rh[$QPh#hS$Z=$$ t-ƒ ʺcp#th#Rh"QPh#hS$=$$ t-ƒ ʺcp#th#RhS$QPh#hS$<j ;-)3ƉPV5ĔNȮ ǣNV!1u ĔN$h%#Z1H^_h %hKZ$hhsY$)WVPt$T$hX$V 0 tbP-K VJ PW蘽tIƉPV5ĔN  ǣȔNVy1u! ĔN$h%#1H^_USWVt$T$1hZZ$Vq/ thƋ-ĔNPJ VQJ PWt6ƉPW蟬t>V ݉-ĔN11H^_[]h %hWZ$h2hsY$ha-$fSWV|$ tI1H>t$|$\$jR PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VG tE$$PwCt/$F ~G F1s f 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1_ USWVuD$ tV} ]CtP7, tEC tP7, u/D$ Ph$&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V<t|$,$h%WA5D$u&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ t tsË|$D$4t'u#D$XPt$ZD$4D$4D$ PD$8Pt$ t$  ÅuD$ xW1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WPg t9t1ۉD$=rg"11HD$$P|$1OL$L$D$L$T$PQRhZ$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P"NjD$fVSP sD$ t PV4$WZB WX<4$uM S]s {te|$t^t$Vt$t_@PWA WtNVsE0Z* ߉Vub ۉt3EF ^C F1Vt$hZ$hZ$hZ$hU$ hZ$hU$j蝫 WVt$tVMr 1H^_V t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t P` 1GG GGY1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7-% t+{0t>-uUsrt>Vsbt)up c1H^_[]Ís s(CtP7$ uCtP7$ t1@뿋C$1$`Z'4v6 !6 PH  v6l tMtk $t$ 4$UQ$t^hb$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhw`$j 1Hx^_[]ha$ha$j軑 WV0t$<|$jWh]$V萴t8W t7HfJBRhiV t!10^_hfa$hSa$Whqa$jG h]$jk SWVNh+3VSNh+3W@VgW^NhV3 NhW(NhSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW2 Whi$ U $!hxb$u$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=Nt PfD$(WhiU t$b$f|$*ub$=Nt P|$fG WhiU t2D$*=) Phb$=Nt hb$fD$(IWhiU> t2D$*=) Phb$N=Nt hb$61Shi8U |$Dhb$ 1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh b$蚡 uVhb$h 11t j,v DLxPtT h b$2 v<u h $ j * $PhiU tDhb$ $t$hb$  hT# j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR Phb$C $=tPhc$& j < $=tPhb$ ^_[]PhNb$jR h3jhh c$kÃD$1ɉJJ JJ fBRhiPm t1h]$j" 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hw`$jϋ USWV,$@$PhiV tr$A jjj"j xgljj2 xi$-hSW9Y xB$/uE$0uf$Ciu.h]$lj1H h^$貉h^$覉WZ 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$hz%h^$h}^$h;`$h]$h^$QL$4QhT^$ (D$f($-D$](E!L$:!PS E P| $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 0Nt 0NE1NtIAtcAtCAtPA tSA@tBAyAAT$h0NUWt$PVt$D$VPRRh^$,l$ }"E!Ê<)\<$['=N`Cs|$[VPWl$Ph^$h_$#<*<0<2=N<$^$<t^$sQh$_B#1L;cp#y_$QRPh:#*G%9u<]K%C=Ph^$h$=NS<$CPh$_$KPh)_$K s k t?L$D$F0_$PWh%v%r N%܋L$D$(Mu} L$D$D$F5_$PtPtPus_$F_$ f_$"QPh%v% N%D$ŋL$D$(ȉ</=N%<C<$[' `$=NCPh^$=NCKSRQPh^$h _$9C~@sFNuQPh_$ IRQPh_$Muj>l$ L=N?CPh^$(sh^$h$=N<$CPh$_$tKPh)_$^Ck tAt$D$x0_$\PVh%v%* O%܋D$t$)E}twt$D$p5_$ttus_$F_$ f_$"QPh%v% N%D$<t$)ƃl$ rPh:_$pj><$€_$$['_$rQ=PuJC<u;h^$h$ =NyCKQPh}_$ ]=NPȹ^$6<"<l`$_$ _$`$`$&`$.`$6`$@`$E`$N`$W`$^`$h^$h$!=N<$CPh_$1D3 cp#t_$T3 ׃l3 URWPQ_'h_$uj>l$ ^_[]ø wl`'ø"øSw`'ø"VPt$ D$Ph`$V' tD$P^ho%h`$hh`$0VPt$ D$Phb$Vڛ tD$P^ho%h`$hh`$WVt$(|$WhiV tgD$Pha$Vr t7D$D$WhiV 1uha$}1H^_ho%h a$hh`$[h`$j/~ fUSWV8 y hc$|hx%b y hc$|jhd$% t\IL$jQP{- D$tPhe$<|jhd$͓  D-31 VPh  VPUSWQRPh3`$1EVRQUh_BVWhj. 1H\$(C CCVWPPUPP P P PPPPS8VSjI |$www wwVWj  VWj VvK SmK W_K D$ @ )T$VVQRWP81I9u 8tމ5PN D-3tщ1@8^_[]hf${zj !jjȑ he$ۑ u8e$jV te$jhY$he$Vhq"he%? j j USWV`~ZD$=PNtIt@ƍD$H@ L$1jQRRjP:ut$VhXe$< 1t$HFFF FF1G>\$SVj} l$ UVWn 6|ƅZD-31OjUjZ* t:9uB$=hd$jVH  8uh D-39tttn1VSj VD$$Pj D-3vhd$@jjj) 1VSj VU6hd$1=D-3u$=|$ u'1VSjS VWjG `^_[]Ét҃t̓ u1Ht$8F FFVNF Phe$u1c$WV苏 td$D$8x xx8WPVF q"{jhd$h%# e%SWv Whfd$j;VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP# $H $u˃^_[áTNH TNt$Vt$VPhc$ij ;VqD-3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPj֭ 觭XWV1N=PNtED$@ L$1҉RRQWjP茪t4$ h3e$^_VQG jh`'vE jVKE tPmt^Vhe$>jNVhe$)j9PD$L$ $QPj ŬXPD$L$ $QPjլ 覬j9XÐUSWV$$D$D$D$,1H$11D$hf$WS~ f~/P w`1A$`'5 U D$u[FtR=5 UD$,D$낃g U8#u(@j L$ QP=u $D$8L UPy@$) U8#u)@j L$ QPt D$D$8 UL$QP j D$ P5 Ut D$D$8c1Fj D$ P5 Uqt $D$85 Uh6f$8 3<=XNu-\N~q5XN1ۋtVPuJVh$FtPhg$FtPhh$j -\NC 9|?,u)É\$(k <D$j0 D$P# Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4@ D4D$8u 8tz`Xt$7XNu XN-\NCPVBt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP0 jD |$tt$ VUW.  UWB r8C|$$8D$@PWStD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW't!t$ VUW蔅 #|$$tS9u$UWA RWC $D$utSPWC uWhf$o1ļ^_[]Ë 3DQu0WPVt$ h"jRT USWV\$ l$|$t$1E1@ U 3h"WV\ ou%jShe'5 UQtEPQǃuA 3)ރu4t$$V4Nut$(t;^_[]h5"jS Ph"h3 jGfWVt$|$ VW t$?/tWh*"VhC"^_Wh"jkS fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Wht@^h#V^Vt$VCt@^h$%V|^WVPt$jWV59 9t9u x^_Vhw"j`9 WVt$|$ VW t$?/tWh*"VhC"^_Wh"jG9 fWV1t$|$ ɉ @4u/ȉXȉX\ȉ\ȉ/q/Q/ PQ40/40<8.<8D@.D@LH.LHTP.TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40.40<8-<8D@-D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7I-Vw w6-V Fww"-VFww-VF^_USWV\$l$EffEffCEffCEffCu u,S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu+SCuu+SCu$u +S$C EDȉCDu,u(+S,C(E@ȉC@u4u0+S4C0EHȉCHuhxs$i^=N<$= Uhp.%WŃuNG= U1I#PPjPPd/31@D$  U1"PPjPP Nm U1y$PPhPh NP9 U1s$PPhPj ėN = U=Nj:W\\Aj/WI\.?yN U빼u$l$,UU݋\$$UW|$P ̗NȗNs3DH,WD$h$W*hV&WNW NN17z$PPhPja l/3,N 3DHWMD$<$Nhht$ 3=d/3_=NtVht$5 UhZt$v5 Uhs$fht$\h5"j( WhDt$EWh|$:D$ =Nu1=N@N$1󫍄$BNAl$$+D$ -Nt1$ 1|$ D$tFtA NWPUw u5̗N5ȗNt$hv$|$$/&$PU訨 u:4$h+v$! *$ $hЗNhu$$VhZu Vh?v$l$VjD$ P葅 ȗN-N-̗N݃=N~VUWt$ hYv$ϡ|>9|Pt$t$ )̓M}t$=\$l$ xN|Nɋ|$  xN=N ̗N5ȗNσ|,@σ|1ҿ9  N9|щ xN|$ $j h$P u N|$ P=NЗNR$ffsh"DShЗNhau$xN=Nt|NNt&hQhv$ N|Nt=|hPhv$ެ =Nu1=|N1@N=Nu xNN=h/3,=Nt#jhhw$h@w$h5w${N=Nu=d/3|N裼Nt$t$t$0Ut$Vt$t 9t V t U =N$PtC tƃh s$Qj 0*Phw$jd$ PK2 j\ jR jH h.%;5 ԛN$NȗNApQtN@jxQP$Ph s$2 j0SVhw$jd$ P讜$\ $|$8j)U$Pѣ $PSvu/jZ$P$dP v u$<mfsHjWV tz9uD$8uz%PSP$Phw$ЗNWhv$*Eh"hЗNhp'e$Phi$jX h#j  hw$j _ WV5N貂uhu|$PhK|$h3iPh|$h3T h3jjhd">P=N1@p'twh#h3 uj苓USWV׉ $芃t$j V|$ WS D$T$ twxn1ɿ aJ~-µ -$p'r $dž,<tx(=Ndž dž,dž(Ɔ l/3p/3u(jh|$耘=N-5ܛNu"jh|$T=N,5ܛN |NN0xNF4Qt$Qh|$=Nw,5ܛNF4Ht$Ph}$=NS,5ܛNF4 N9}"QPh1}$ =N+,5ܛNF0=)hPh_}$著 =N+5ܛNF0=|)hPh}$a =N+5ܛNF0N49}QPh}$5 =N+NܛN;|N|QUUUU)ʹ3333!!сis{09\~\{0\\5NsXș9}%CX=N~Qh}$聖ܛNsX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h~$薕=N**ܛN{4$=N11F9tA uPh\$j $Kd=̗N5ȗN u։<8=d/3[ WVhI~$ =N)ܛN<$C4$8=N`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPiNjs8ƒPVRW&)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh}~$襒=N'ėNtm ܛNyxH1҉$q1ҋ8$$)$<$$1C$I8$ N=ܛN_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$Wg1C1 t׉Ë$$QPV$$V9s($$$VOgÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPdË$Ë$ʃQPRSɒ)ÍC4$$W$$P$Q;@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ"cj$P$$*@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh~$ =N ܛNB$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d/3$_|HL!ʉG41SSjhjPSNN ܛNI4QSPqm ܛNH N N NP44Q5Nщ N`@#HL 9| Hh h/3H< NHX NH\ NPTXH fǀ$蘮%=ܛNO4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d/35O _(HLJ$N$$$t!LJ^F=N$$߬$$ڌ$0&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$~$衆 ܛN$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$$>=ܛNO0 9| IУNN=Nu\Tu))УN1VVjhjPVNuN9NN5NjP%i =NG̗N ȗN1ظ|(RQh;$n =N̗N ȗN5N5N~ ș)dہ|4q'GuȹC=NtL1$PP$$5NV1=NVhZN N1u;1$VhjVur  =N5ܛNh`VW> =NtWV5ܛNx\NhhPvg 1@$=Nh$貵=N|o5ܛNN,I\Tt~!NȃN׊Nd1 t1WPhA$RR$r39u1H$Whht@PL PPftu!ѡNt $ Q$=Nu$|&ܛNH,$$DŽ$%$ ܛNI,$1$ DŽ$1hd3u;ܛN$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h߀$=NY ܛNj5Nd 5NFU $F +$^ܛN$~J`^p=d/3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=NuFh$ NlK`ڍOȃ$ډFd;v&h$[=NܛN5NF $11ہ~U uv`щSAܛN$~!ـ1@ NIl ܛN5NF=d/3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5NN uҋܛNB8H!tk)D4ܛNB8)Nj5N$9sE)ȉـ1B~U uv`5NF$CHu͋ܛNB8$؋N9ȉ$J`~U uv`щSܛN$~!ـ1@ NIl ܛN5NF=d/3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45N;Vs2р1@~U uv`5NF$BɋܛN$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$NH NV$P V PV~x; Nup=NtNs4PPg ܛNN@NKd15Ns4NN ܛNq4jP4] ܛN5N{0 9 NPVQ4 =NtN5ܛNP5N ܛNy0N$ryxtG$\褞%TuCl$AP$ ܛNOu$ց\TtQ!QЃyId t15N5N3 5ܛN\TG~8^xN`1?9'N+$~0lj$Ɖ$)ى$=N$葝%GlNN9wߋ$9w$ܛN$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=N} $H$$$~A=N2$=|j.u扄$cp#t:% ܛNׁ\TtQ!QЃYId t1RP$VhS$9v$$;$$|W=N9ܛNH,t =N $$ DŽ$j tDŽ$CܛN;X,/$~ j t=N $hjPX d/3 N+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A`m$h.$ld/3fDŽ$13tt/3$_ lj$DŽ$ܛNH4$ $ H5ܛND@VL!! $`Nd8l'.fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t/3@ lj$DŽ$ ܛNH4$ $l$h  5ܛND@~L!! $߉$Nd t1$Sv4$j2ܛN@0p9w Au1H$$DŽ$1$$tjd,ǡNܛN@05NV$SQP$h$l Nɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=NCX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$~$pthj$PbT ܛN\T$$i$$ $$$$DŽ$H0$$_$ ܛN@$D$@L!! $`kh$h)$l$  ܛNId$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h ܛN@$D$ @L!! $$Kg$($$h$lܛNHd t1$S6j$$V ܛN$ȔȐG$11F$t =N$$=ܛN40=d/30w4w+_1N$`SWPV( $PjSQ =Nt$W=NtNǀ\8 ܛN=Nx\hhPP NQPVCWV=NtN ܛNq4PP[ 5ܛNHLNd t15Nv4t5N95NvG=NtܛNp4VV 5NN@N=ܛNOd1Vw45N5NܛN@4P5Ne^_[]ÿWjVO 1=NVW\hA#kBhz$Ɲj& cj%cj(bԛNj bjbj'bjbh\$Lht$Bjbjbjbjbjbjbjbjbjbj~bj wbUSWV=Nua΋\$=NtNԛNSt$PR 4׋ NUPSt$$5N萾 9u^_[]R0(!PWVh5$jj$aUSWV"=N΅ NuܛNH4H N N =N;ȗN̗NܛN;}FWh q'1I!;HtG#P;Pt;H uV9R_1ڍ_5NP=NWh De^_[]USWV΋L$l$=Nt=NteUjQLp׋ NSPUt$$5N 9t?\P0uPWVh$ij"+`NԛNUPQ% ^_[]SI`wD$$q'1C:Qh$h3Jk .  [SWV1ۃ=N։ SjQK =d/3@fF F)f ^_[USWV Ӊϋ5ܛNF Nd t15NG=NtN5ܛNPP; NyU +y/\$|$y1U =ܛN1=U L$D$uq`|$ G`Ӊ $u щw*l$$q'р4l$skPh$h3i =ܛNND$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah~$ h.$hX$011҉ ^_[]ÉՁ|$U u L$I` L$w$q'ʉـ1@BPh$h3h 8ʍ 6ʍ   1$5ܛN$~3%)1@ NIl 5ܛNNK=NOd$sC=d/3CNdЋT$ t1҉t$VQPR,;{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRiL$|$ щT$ՉD$ȋL$D$VW|$RPhыt$ʋL$Vt$QRP&:$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45ܛN;F8|$}X1Bσ) NyU uI`1@5ܛN;F8|$|=NtNVPP袯 5ܛNF Nd t15NUSWV$΋=ܛNG Od t15N=NtN5ܛNPP NxU t)h~$6=N(NxU ‹l$(H $t@\$=NtN5ܛNPP腮 =ܛNG Od t15NwܛNNHC, $9r%UQh$}a =NVܛN $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5NWܛN\TudNjpxt$0t$ '$<=NWV袪1L(ɉL(@ u1LXɉLX@ul$Njpxt$0t$ '$,;=NtrUV1tttp,TtDpC u1Cu) % $D l$hVU ߄% $D9Pl$ܛNT$5Np0^_[]jGVj @VWV։σ=d/3ȃ@PQR =Nt'ȉGffF=d/3u GffF^_fUSWV$8tW ƅuWh]"j $$<$4D$Phd@U tj1OLVhedAU' F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h9%t$Z 1 Sh"U CPh "U C Ph"Uu CPh"Uc CPh"UQ CK,C,Qh"U9 C0Ph,"U' $@D$t P诔 1-Uhzd@$<W& t1 VhedAW& hjU[@ D$ P$4D$, 9L$L$9u0$S11:C8tx$0ht"b$11҉ $ƅ*ŰPj PU ^_[]$0h"ju USWV81ۍD$4ShPSu1NtAljSPSWuWJ uMU D$t$$$Q1e^_[]fWVt$|$ VWW8 t$?/tWh*"0hVhC""h^_Wh"j fUSWV|$$\$(SWt$(t$(")jj`SW=~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV= 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^9|Pt$t$詜 )σ}4$ N-NuU-NuY54N=0N$N@19lj| 19ǃ| Nu N͋54N=0N$NˉjURP$=,Nl$ up(Nu-@19lj},HVh8Nhau$jPVW$! 19ǃ} hv$Z ,Nt$VUt$  t Uȝ t 9t V趝 jEUSWVӉ $5|$j W\$ SV Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Pht"1L$8ɉ׉u L$8t 1@׉׉|$l$ >48"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$hU"j WV623Ph*$VN 1GVWjhd"Vhr'WZCfUSWVu} D$8jP=8N59t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ,N5DN@N33t$ƺQ=\ND$`ND$ hNHND$`NdN1 hN5lND$8pNtNxNS|NNNN5NNNN[N@fN3fNN 33fN\$H$SW 93rWhN. 5N|$t"VgYjVhN 1ȠN@N NNND$N DN+ TN 1҃r1I15`N~σRVPW5DNH19w+5`N|$OL$)9r΅u Nf5N5N5`NVpNYVjP* GD$AD$ 11L$\$`NTNtnNtHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& `N@Nt N `N@ pN1HpNL2 pND1\$;|$t`N)ápNf\0 pND1 hNu\$fT1 pNT1fD1L$ G;|$tD$ N|$11t$LNPN=N~i N i{5NQ54N50NPRuh$RE `N N5hNPQWhZ$+E`N@DNtN1QQjhjPQxNI 5tNjPb( = Nuk4N 0N1! V5$N 1N1Ƀ *&Fu  1@D$$=N|>h$1v=N|(L$ `N TN1PQhA$PPBD$$r39u1H|$LWhht@P  PPftu!ыt$NtL$QT$= NuL$L$D$ 1D$L$ 11T$hd3v=Nt$tXNtOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5N`N1TN 5xND$ hh@NPt 5DN\NP5pNVt$R =`N=TN XN15$NǡtN)؉1t$ P =DNWjh|N% \NH9|$u_DN5`N TN)ʍZ9s1Gр|NB9r)|NVhPx% t$ 1Ƀr!11ƃ|NCω 9rωp 9ǿs"ˀ|NCI 9rޡpNL$  XN1Ҹ|NPt$ 5hNVj|NP$ |N DNL$)QhP$ u1|N@ upNL$ D XN1Ҿ|NVt$# 5DNjVG$ =hNtb1=dNt 133/fNF;5dNrpNL$ D XN1h|N5DN G;=hNr=Nt$|\tX=NteNt\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A= N|$T$T$|ʉj.>t$몸cp#|$|$t:% `N TNjQt$,PhS$\?T$;D$_=N* \Nt= Nu&D$ D$D$j ->1hA#>~ j >= Nd=N1N$hjV)" fF쀁6fFD$8FFFU fF5DN ׉؉t$ ֍$fBt N$,F܉VDF81 L$ F4D$4z XN1CL$ =DNWD$(\WD$S5`NtPjt$0! N 9`L$97|$0NTNL$,ʋL$(T$\N1GL$ T$D$ ND$`ND$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V XN1CL$ \$N `N=DNt$,9sD$()QjP t$qL$ D$41ҋt$(VW'VL$Yj=NtNt 637363@1=DNà r t$hhjV fFA3fFDNÉFD$8FFF XNfFfFV DNAFmlj\$r*D$p1ۋ DN1zC9uߊ XN1h|N5DN5DNf583|$D$1ۉt$ 83x1ɉt$)r}NRQP Wh83|NV 83|ND$ fN XN1Vt$ \9\$t5DN83D$ CiL$T 1VhVD$pPM 95NtNt334353fD$TA1fD$V33ƉD$XD$8D$\D$`D$d= fD$lfD$n XN1@D$pAD$| XN1h|N5DNiL$Tj fN1ۃ=TN 5xN<hh@NWw 5DN\NP5pNVY 5TN XN15$NơtN)؉1WP5tN5xNe^_[]h$h~$ $h$PL8h\$Ph$h@$VhR$Rhz$PRh$hVh҂$hVh$RVh&$Wha$VPh$h$vjVWt$h$gh˃$`h$Yhz$Rh$KRQh$B̄$1&$'h$h$"h$hڅ$h$h $ h$hM$j蹷 USWVhN=NtrNtKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(`NЃNt N `NЃ^_[]SWV= Nu0׉΋ $N\$QPSt$ 5O1DOЃuȉf >O1t$<jVjP5O 4jhOjjhD$<jVjj5O1 hhPj O|$qD11O0PT$1A xVWhOhD$) h=$՛h3tP1B PP@tPXPP\PP`PP|P xP uCء`P(P\P$P XP P|P xPP ؉+XP\PD$HT$Ll$HP+`PD$8D$85H&v?|$ D$ fD$l$\$4l$ D$4Ӊ xP|P&whO HPLP xP|PPPPʚ; xP|P6eĉP11ۋLPHPD$T$ ؋PP\PD$XPD$`PD$5PL$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05H&&t$v xP|P5P=PP|$(t$(|$D$ fD$ l$ \$,l$|$,=Pʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5xP |P=POt 1AOy7O O9}(DPi-@=B'DO@9uDPe^_[]h$h4$j茙 USWVhhPj ȦOL&\$Du{'-hPpPD$hD$h5H&\$Dݜ$݄$hXPjB u{(-XP`PD$dD$d5H&݄$\$DtP;OD$D|P xP t]+ XP\P$$߬$P+`PD$\D$\5H&&s=PuZOtQ|P xP t5+ XP\PL$xD$|l$xP+`PD$XD$X5H&wD$DD$DPO P&w١\P XP t>+ PP$$߬$`P+PD$`D$`5H&D$Dw\$8O$fDŽ$jh4Pjc D$8 T&|$&D$& fD$Bl$B\$Tl$&t$Tj$Pd SD$lD$lPD$,Pj5O5O5Od <hXPj OD$8<BC97)؉D$D$8 T$\v'\$A9PI؉L$A tPIff9uP`PP\PPXPPP Pu`PP\PPXPPPO 1D$18 8l1A h$謓h3AO<1A t$,] PVh>$. ΍T$(jt$>Ph"$D$ Ot$؉T$΍T$(jt$F$v'h$΍T$(jt$Jhl$R΍T$(jt$bF$v'hz$΍T$(jt$$Fft$NfQPh $ ΍T$(jt$؉t$h'$΍T$(jt$^؉t$h?$v΍T$(jt$z0FT_hX$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h̐$΍T$(jt$؉t$h֐$΍T$(jt$d؉t$h$΍T$(jt$9؉t$hV%T΍T$(jt$X؉t$h$)΍T$(jt$-؉t$h$hn$Ph$L$lL$AQ D$iPh$h$ h$h$kNh,Ph$Qt$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ_$L$dT$C;Pu#PhPQD$XrL$$ D$LPPQhP T$Ҹ_$u1G`$T$PRL$r |$ rIl3H l3~d3H d3 hd3j (  }T$A{^N2D$ˀ) he$uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhj$-hI$9 |$ sSl3H l3~d3H d3 hd3j q  }KF߉Ήs(T$hQ$w L$T$؅t%l3H l3~d3H d3 1I hd3j hd3ءP;O*؅tءO!^L$AQ T$Q=P P t+)|$L$p|$tl$pP)ЉD$PD$P5H&PPPP93v93PvP\$CfK%Pf!tP PT$ .KfKfPD$ 0P@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J0P@)t2(uK POt1 Phc$ P O PVh$  PhG$hՍ$h$h$AfPh0$hU$hi$h$h$h$hʎ$h$h$h$wh$mh5$c Ph$* 1BD$D$pf93@)f~\OtSωL$!ȹT$V!RPt$ hދ$ T$ D$,Ot1RT$D$fxf593OruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BOC9D$=O ؉T$5O|$7DO)RQPl GD$9L$~D$8:DOuG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5O)DOt$>RQPh$7O;O}0u h$Ph$Cы\$1B\$D$\$D$T$jh#$j` 1AhN"WV8P~bPP l3Ql3; |3hd3j. P d3Qd3.H Pby`)PP l3Ql3; |3hd3j P d3Qd3H P|tN=Pt4l3H l3~d3H d3 hd3j I PPhd3{h3nXPP\PP`PP8^_jj1A1=PPKUSWV׉E\$1AMO]E uWVh$t h$Sh$Ot5@D$ T&\$D$$$}Ofyuh3je^_[]UVh1AtD$O$$)tPD$$֌$PD$$$PtD$$$tPt9+ P} $$!L$LD$L ,&D$Ht$H\$$9$$  PO PL$DD$D=P@|-PT& 93 P\$,D$(\$ D$\$D$\$D$$L$OP P t5+ PPL$XD$\l$XP+PD$@D$@5H&P P t7+ P$PL$PD$Tl$PP+(PD$L> QPhG$lOtkD>L> QPhh$F|>uGD>OufPh$"L> ffPQh$l ^_[WVOu8jjV^4 t'86^ PWh$hh,P"69 Ph$hh,P^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hǓ$z1$t$t$ t$SPh$y UPhґ$_ t$t$t$ hޑ$Ft$Z Ph$,t$ @ PhY$r0G9s'GPh#| KG9r߃$^_[]fUSWVƀ8-uFh1#Vu TPh1#V1u XPT$,11CD$D$h$Rt$0豆 Hw؉$v'\$̃duE뻁뱀=TPt\랉\$떁댁낃u1 31;L$(uj赉1L$ 1ɉT$Љ $PL$Au $APgD$t2ڋL$ PW,Z Wf uމ$DluY|$uja DžuY P蛇s`$t8=TPuIj Vh1#b Wh$T1FVPh$V} SUM h1#=XPMj Vh1#  Wh$V \$cp#ۉ"O$VWS諴 jjVWS蝴\$u(I 1GWWWjWjxWjmWV^Wj SVWJ u hQ$je| jjJ u^$8j? uH j? j j{J t)qtOQ> j jTJ ut$8t1Aj jh1#ñ ukWh@$jh$ t$U@L $Q2z*0WWI $tcp#V)PSh%v%W){ SWh-$jKAV{t&=TPucp#ZVPhє$h3jfD$tPh$Y!hHy'Ph$h3jbUSWVPu } hHy'WVk cR~5StET P͍Hw4$4w'tP벃LpP|P둃ftTdL hPtxPePVPGP8lP)  3蜄P=Ptjjhc%G PND$ jjj"q PjL$$Qh@hP" u h%xPi )ލ<S H $Xw'=lPt1Aj D$<1CPS D$D$ PSD$D$$PSۍD$D$(PSčD$ D$,PS譍D$D$0PS薍D$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F PD$8gtj5PH rD$ D$cp#D$D$cp#_;-PSAt.H$1ۃ=xPuWh'$h $hp% >hu&Sg =xPuh$hޚ$hp% 1CPFLCSS H3 VT$W$w' \$@1ɍP$Px'P1A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12ȲP#PL$L$# 1AD$ PD$@PD$ D$<+PR D$ Pj$P;3P;3P;3 PP׋t$#D$ PjPd$zT$ ED$ L$TL$@JL$CP";3-L$#d$d$d$L$׋t$вP:P@.P"زPP P\$ PPP t Pt P1SSP L$Y\=lPj$)/jD$D$ D$cp#D$cp#PL$9a|$u qP Pta|$  ‰4 D$=PT$tD$1@D$ x1ۉD$0hhxShP atgcuL$P PPP@P$PPP8PP P 0PtJt$(~A|t1Pt|$ ObTPPtPt$ tH@WVhPh{ P=Pt=Pu$PtMD$tH@Vt$ W{ =Pt=PuL$$PtDD$(tIAVPWz =Pt=PuL$(-${PtDD$,tIAVPWxz =Pt=PuL$,;$.PtDD$4tIAVPW+z =Pt=PuL$4L$P tDD$0tIAVPWy =Pt=PuL$0Y$P)f=P=PtP=PuG=Pt4l3H l3~d3H d3 hd3j P1=hPIWhP5P0< u+#87tt)7|$t+u-$/9|$Phۘ$!$|$ǚ$ PPh$83u=Pt"1ۃ8=P1ۀ?D$PSVh$chd3V^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjVʎ+D$  Pf1PPWSjV蒎|$dt$ \$h$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9;3tE;3P{y$L$t h$h#$QQh%PPh$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lPD#PPh$@ l3H l3~d3H d3 hd3j T$h9t$hu h$ L^_[]hp$ jhМ$jaY D$t'T$tt h$h#$QQh%PPh$t ËD$t%u$%tu $Ph'$$$Ph#&USWV|$<\$8D$4t$0~u/jUs u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR~"Ph$tPWh#c ^_[]USWV|$4t$0=PuMPhhPZct P'j.hP讉t@hPhPh t"^tCt0Wv`rhhMc%hȶPVh ^_[]1w)ȉPjQ SVU fEu jUBr WUu&VhȷPShE$hhȶPȶP^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhȷPShn$hhȶP`ȶP[SWV$L$4D$1G{'t$"tZ@:t9rD$Ph=$s,^_[SWV|$t^D$uFD$jjP\  t1Nj0j.Vهt@hPPDu7ut$+ Mc%hVhȶPf ȶP^_[VD$L$ 1Ҁ0QRRhhȶPVPĞ thhI%hȶPɇ ȶP^Au yuyt$Qtu ȃP蓩 Q苧 APh$hhȶPȶPSWVD$ȷPQ4x$R÷P4x$RķPƄRŷP.r|I1AFL$ tWWVWhX}'+ u;D$ D$ PRWWVD$PhX}'`+ tt$YcĨ ^_[]h:%t$ T$ tԉ1|$l$Vh$PVS]Ht$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$(]t!ʼnD$t$Wh|dt$趏 ul$$WhedAP蛏 f$a$>ukSt$h"h9%h$W_Ƅ$tԸP55$ a$tW$QPWx $Kà9Éu|$$P  1h:%j" Å~A1ۉh"P-ujVh"h%v%h$WƄ$|$tԸP\5$ a$t~$QPW C;\$ mU`|$l$|$$PUSWV , uj{D$$D$<$sh$VAthh%V/3hUC Ƅ$hh%sut s hh%V蒼tt s h$Vrt PbN ԸPD$ h$VItHáظPth$Pl(j,SutZ S$N,PD$PU_%xD$!=`ÉUh$ B SMDž?tG<$tSWUh$h%h$V9Vp# tEUh$~Zh$l?Uhʟ$h%h$P15ظPtD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hL$h$SF\$ =PuD$S$D$ P$P謱 贙8\$t$PhV$1PPU uUh$r11@$~#Qh2$ 1@$\$$$Ĕ ^_[]$Ph$jp2 蛗Pha$h3[ jUSWV L$P$T$t-P*jhP PšP$T$1i E$48t!u6$t$PBT$ uF$t$P&T$ tEM<ǃ hVu$01 ^_[]ËD$ t 0P$4$݋D$ t 0P$$ؾPPhhPz0 uhPh$j1 fVD$t.})zh*rQh$5P jQT%:%%x}'PQh%v%5P賲#u5PhL$#jQ^ËD$ H^WVθ%x}'PVt)uVh+$5PC jQSGt8tPwh$j whˣ$Xuj wh*rQ@ GLrQPrQ^_WVD$ t;5PrQD$=P ,Pu Px}';pt8@uVh$jV/ @u=rQthrQPh$赀 Phˣ$襀u5PrQ=P^_Ã|$t ӣ$yjQÃ|$t %XjQÃ|$t ڣ$r7jQÃ|$uhrQh$5P述 jQÃ|$uhxrQh$5P莰 ձjQÃ|$uhTrQh$$5P] 褱jQSWV$$DŽ$HH$pyƋ$ ƒtS!=iQk$tf$a$atσ=iQ =jQ PSj $;rtr1Auu($$hJ$PQ te$P$$hU$PQm t8$(1;BQPVW7VH>jQ^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1HhjQtrʄt<$1ۊjQt8tCu 9sjQB+$=FFu4$D$|$ 1 *jQ$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ *nQ<$؉D$*nQ$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5Ph>$<$?uhVW]9 x^_[]USWV0$Du%$H$Dhp$PQT y1E-{Qhej(UhP舻 t$H4$=LPI1VV$P Í|$0;=P={Q$H5jQ5iQ5iQs =iQk$tf$9ƒ=PRPSQGy={QuE=Pt<PP$Hct{QP {QVV$P Å 4$j{QjQ0^_[]Ã$D|Ã=Pt=P;1 T$󫋄$HRjh4 |$D$=Pʉǃ={Q$H[L$05jQ5iQj =iQk$tf$9Ã=PVPRQw={Qu9=Pt05PP$H1t{Q5PG=P-={Q$H$HL$05jQ5iQj ƃ=iQk$tf$$H9=PPVRQv={Qu_=PtV=PP$H1t{Q=P$$H4h|$螰D$P E;$Dnj=Pt#P@=u1Hjh<1#P jhPɷ WV={Qt@=Pt75P=)QP)Q15P=)Qu {Q^_USWV1@=PS=)QFϻZ$ͅtUShh$5P75P[t$PhVh 3xd3L$DH?ujQt$j{QĄ^_[]5Pjj/h$OUSWV $ u{$$hx0#wtrƉj h%Se- iQ iQ@$t$l$ jhUVx!|$ toSjWj@b!Vyr wh $5P jQ ^_[]Ã|$T#t~"Ã|$t!h?$h4$h$$5P覝11HjQWVt$D$ tu51>#t5PRPhb$QP#5Pjj6h+$JP1jQ^_h$hPt$t$ jQh$hPt$t$jQWVD$ tZ}UuZt$~h~"WJtOhT#WJtBWy7vh$5P Z1H_1=,P1@1,P (P1ҾT#t~" щ (PPVhĦ$5P贘1=,PjQ^_ËD$uD$L$hަ$PQ tvD$ph$gu<=jQu0=Pt5Ph$Z D$ph$fgu+rQwQ{Q>jQVD$ L$jQt u]H \PHQ"tsP+ t8[=sQPt5hsQh2$Pw jQ(^鳘Vh!$Pjj$hK$CHV1^ËD$tIDuD$L$hU$PQK t$D$php$GfurQ0jQSWVD$-uD$L$hФ$PQ  1G={Qhej輴WhP t D$1VVt$@ ǀ?tx={QtyD$thWhp$teu rQ={QuB=Pt9=PPD$bt{Q=P {QVVt$ DžaSj׳{QjQ^_[ËD$uD$L$hx$PQ tmD$_D$L$h$PQx tI|$BD$ph$mdu8D$ph$TdurQÃt8jQUSWVt$ |$.E1ۈ$5Pjj,h$D% u v1.贔jQ^_[]jQUSWV D$ #D$$L$ hФ$PQS L$ ȃ#D$$L$ hJ$PQ) D$ L$$|<$DhD#t$=it3$8|t+4$$H$ݧ$ 3D$$h$0hD$1E-{Qhej臰UhP t D$$\t$={Q1D$ H9=P@$t2%ҧ$9t$t #$T$$VVP4t$Q܀{Qu?=Pt6PPD$$" {QtA {QPE_t$j覯{Q$9t4$3+衒jQ ^_[]SWV$tKjjQtK~SW 9uWj(1uh $ +1HjQ^_[þV Fujjۮh#) e%tj/VxV t@hQWn =,Pt85PVPHQP~ Q Pj =|j5iQhfO#WVь  jWVÌ Vh$ jQjqSWVPD$D$t&D$t$h1$PV rjQ^_[ËD$ph:$^u|$hB$ tD$x|$WhM$^WcPjWp uP|$hU$~ t D$x |$Wh_$;^WcPjWo 1ۃuM|$ Àu*D$p Vh_$]V`cPjVto P5Phg$ D$jQ={Qt =wQu&=wQt#hwQh$5P jQ5Pjj%hv$>ËD$jQ-=sQu=sQt#hsQh$5P谍 jQ5Pjj$hK$>ËD$uD$L$hǨ$PQ蘺 teD$ph$\u<=jQu0=Pt5Ph֨$G D$ph$S\urQ<jQËD$uD$L$hǨ$PQ teD$ph3$[u<=jQu0=Pt5Ph$ D$ph2$[urQ蒍jQËD$t8uD$L$h:$PQQ tD$L$QPhcp# BjQUSWVh$V $|F$$h1Gh4VY 9}hh:%VB G9$uVh$Zu jLTrQ^_[]ËD$t8uD$L$hO$PQ\ tD$L$QPhi$ MjQËD$thuD$L$ha-$PQ tHD$:D$L$hU$PQ t$|$D$ppho$Y Ãt͋jQVD$t$5PPu h$Y%萋jQD$ ph$rY5P^VD$HrVjQ>5PPuh$*YD$ ph$Y5P^VD$t$5PPu h$X%؊jQD$ ph$X5P^Ã|$u|$t蝊jQÃ=Pt 1PP)jg=Pt 1PP j}|$u|$tDjQÃ=Pth$%X釽V1VVcVI}VPD$ D$t}uD$p*jQh$WJ*t+h%W8*t h$W&*u7 1Cvݻtt@PuDPhz1H!DPP5@Ph $5Px1jQ^_[VD$ L$jQʃuCuDh$P5(t$Dh$$t$X $t|$@t$t$@ЃD$;Pt|$tt$D$L$dC.$`7.$s.$tg.|$Htt$HD$H|$Ptt$PnD$P$t$MDŽ$$t$)DŽ$D$Te^_[]ËD$lt8uu L$DUuD=Pt;P襡D$HL$H+PtD$Ej/t$L0 t@Pt$Dh5$t$HYD$t$IPL$D|$D$81iQiQiQiQ$$9Pt1$Pt$u$\$` iQiQ|$pyiQ$hx0#t$L蒸D$|$t$A$QP*u5$8$<$$$\$` iQiQiQ iQt+t$޷j5iQ5iQP0Y=PtPt$Hh$5PIi iQiQ tQPhDZ$5P#i5Ph<1#@ 1O$=DPYDP1O$8|$pu5 D$TQh[$ sPht$hW =sQ|$Lu:|$LD$puuhs$t$Hh*$[uhi$}D$LiQݱ$|$LD$L8|$dD$t$h$}8P莞$$W<$<h%VCk1A$<$ǀ?tvj:W- t=@j $QPk ~޻t?$9u3;$u*W<9$<r$)PWR t/h%VjDžm1Ft$Hh$1$t P$$u |$p$$iQ iQt$Lt Vh$t$dKt|$dj%Wt Wh$1$GGG fGJ$P$xPW# $u2$t'8t"$tJ?t1h.%Wy<tVhT$Gp$7(2WDŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB PJBB D$$PRW$8F= t ]I0RtD$$Z$$Pf-j j WhSvv , t%h"PS j "PW =Pt+D$$xt!~$t$WSP5PSdv jv# Åx`=Pu~PvvS-x)$P$P$Phcp# ykS 1KW$Ph$g Nȉޅɍ$P3; PW$4hm$mh1N=PtJ$t$uP$$t$uPљ$P~R{QWhY$9tNu1h@hڴ$hP t P05)Qދ$tPDŽ$$t4W]7PjWqC $tPVDŽ$$t4W7PjW2C $tPDŽ$D$$t P9 |$D$$hj($4P<tQh$$芰D$$\t$ Bj4PtV=PtWh!$5Ppa t$$tI=P D$tPt$hh$h$5P3a1@t$ht$hh$t |$dwh$Vĭ #h.$V譭h<$V蟭 Pxt'1ɉϋ4hKy#V} G PЉ;zrۡiQ iQ5Ph$ 5iQ5iQhP$V/5iQ5iQhe$5PP`1F&1t$lh $V $`#=0Pt"D$$$t$QP躬|$h$ tPhƵ$W薬 h?$h4$h׵$W|D$$0$|$Pt1$t$t#tD=P$tPh$5Pb_ FWh!$$8W $$0t-=PtPh$5P_ FSh$Wʫ t=Pt5Ph! $ h#t$ 虫t$21V|\$D$Lt$P5B3DƉ$$ىD$ډ׋$$|$dP‹$4$8$ PˉƉ$D$@1S$P$+$$$$+$ى|g@By)Q8j$Pf$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5dP5hP" h#5hP&M|$`=$@$Dt$hk#KhD#t$j&D$8|jjj m$D$@h@$Px D$@|$@DŽ$%iQ iQ m!ڃt9}M#$H5iQiQ$$!;$$=Pt5Pjj hE$D$TLD$@d3x=iQ=PP PƒP9}%PHQP ;HQ#PHQP<Q 8tB$ڋ$!t iQ5iQ1ϋ$H1 D$h2%P h@$t$mND$@|$@tDŽ$ t$oD$@Ph$h|$Vh$OS2"hP)PSh$:hò$%Pt$HhS$jykh$h $WbhX$WL$D$ D$8t$4D$ D$0D$D$,T$1@މPj -Pt$nth*$Wjbt$@E$= $#$1V$W$$$$$$t$@Ѓt$@Wt$ u.5P$PP艊Ph7$V2L P=P| jjiQx& iQ PiQP; iQD1PP1\$  iQ iQPL$T$ T$8t$4\$0r\$ P1tt$h$5P_K L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Whȷ$OUD$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#M7tt$h$5PJ T$d|$?D$TD$L$ L$8t$4\$0ËD$D$,T$1@h3$TD$L$ L$8t$4\$0h$TD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hT$$S$D$8$D$4$D$0t$,$$1@މt$$h$mSD$L$ L$8\$4q$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$)USWVD1D$ D$D$D$fD$D$0D$8D$4jh߰$Q t}D$V~ƉD$j@P$t%L$L$4$P@P~ƉD$j:V@Px~D$ t$D$0|$P$jPW4 D$4t 8D$t{8tvD$ t8tj;PZ th4$P"h<$W hD$WVWhy$sQ Vh$cQ1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh.%V @L$ǃuC=PtaD$t$uI$t>th$V1Ʌ $t}th$U1ɉL$<=$P=Pt 1PPѼ=$P(|$DhPW |$L$D$L$D$ tD$ D$$=PPL$QPp=PPt=ut$8t$8t$ D$Pj3D$T$"tQPh$YO "D$Pj觓<$l$,|$u'j/VtG1|$t>tFhhO&l$LU l$t$1l$ -rQD$Pj9-rQ*x1l$,1Kd}Z<$t3$DSVW Sh.%W SUW <$hh%t$LV t$l$D$ D$<4uT5PP=Pկ$tݤ$hP|$LW |$D$Pj5PPuj/UC t@ʼnD$ D$$=PtAD$Pj?>uP=jQuDh3jhh$)1D$PjT8jQ1ۃcÍL$%L$0d؁D^_[]1EhL$LPh$hǸ$jJ USWV օ\$ |$$jhϰ$Q l$t=jh߰$U t;jhװ$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CS:yS\$$UP { uG<$WxC Uxj@VV|$$tZ{ u $Pw@PwƋ_j:St@PwG_Ot[uUnj]U$tYÊ@t<:uL)SUV^ Vf,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PUnD }t $9ut=s fCt$t$Uh$vJCC tWt_ukPKUVh$MJ t$t$Vhҳ$5J\$ n1HJ3P(ucp#U8vC{u{ /%t.%PvC1 ^_[]h{$j- WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj_\=Pt<}!Ph$jdV=:~ PIu1IPVQ蹈 jhlPO VdPj[=Pt<!Ph$jdV9~ PIu1IPVQP jhlPO V΋tPkFtPUFFtP>F^WV΋AtP!F~t,WPjW FtPF^_SWV׉΋j:StDSsP蔄tj%StSh$Vz SShx$V` G tu)GfPu G=tPh$V+ h#V^_[USWVP։ϋ\$l$ 4P<tP/ZPUVWjZ x.1tETw4s,I  $8 u@$Ph$&F1@^_[]USWVPӉRilj4$6Mw sEWSU 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ P P P P P P P P P P P P P PT$(JJJJ5PrBJ PRSW t u 0&$@t0hP.P PSWh$DjQhWhP sQP<$l$\$HWj j UhSwwK t h"VS j VU =Pt*$xt!$t$USP5P9w jwT x6ư=PuPwwV^yWV\ USh$˵ #$d$dh$eC jQ4$ xwwhP GP4$ $PD$HShPVd D$HP=PuD$jUjjV$ hx0#Vf \Qh@$VS `Q=\Q=Pt5sQhT$5P8 j}^\$WSjUV WShUV sQc$d$dh $Y 1h@$ B\Qt P `Qt P jQV蓄 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4PPhjUD$(D$ hnjTD$,D$D$ PD$D$$$jQ11L$8L$\$0D$t$$ 4P<tPjTW5\Qv=W5\Q\r&wW5\Q8tPhW5\QtPhhh _$5`Q55`Q+Cà u $EPuw|$5uprk=8Pub=iQt&t uu5sQhE$5PT5 PHQP;H\˃ PQ $w3DXtjQCУjQjQuss)5 $ ȸdtȃru3DXu 1@OuJ t$ tB$T$у)l$t=Ps=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t jQD$ $؅t荌$79L$`L$AL$PPS6=P\$0l$uE5u@=8Pu7PHQP~ Q Pj 65PD$x u@uhD$ Ct$jyKD$=HPPxPBz P|$tt$uD$jjQP=PjTKhx0#W'-D$|$D$ D$fxtD$XD$0PS}x.#D$8=u$$ iQiQu h$5P4, Sh$Wh*$蹨iQ iQ@$ t^L$$hk$Wktha$WY@$u3PrQH D$fxL$$D$@щ˅tVWh% Wh$@rQSvD$|$ P@Pt9tP $PtQ@P9|ʉ׺9օt PQb$Pj@D$ujj HD$=iQtDP=Pt iQ!ȉ'D$$jSPt$k1PrQHsoL$1HfytL$IT$fztD$PW5P5 P5$PE:u h#衦%\$(St$tƃ t0tiP P;L$D$|TPHQP;H~0Q#5PPL$D$L$Pj#r,͍D$ Pt$ j t D$@ @PPD$ Pt$ Vt ttD$@ @ujPP1HjSQPЅx,5iQ5iQhʺ$ $u h$Bn} tcP P;L$D$}%PHQP ;HQ#PHQP~ Q Pj C+D$@ @tt$( 0Wh#谤D$@ @t/t$ 0 8 t hԺ$脤1HPPj=|$ tD$ t$ЃD$t$1t$VP=PNPj#*SWV |$$D$hˤ$Wt D$ˤ$=iQk$tf$D$LrQƅu=sQ= sQ 4F95PrQt jVuh$)j$=P95PrQt jVth Ph$t$ jhP8 jh(P8 hjzDPhˤ$W LP|t1@v5Phþ$1 M5Ph$ j!#jQ!hbjC$ iQiQ tQPhʺ$ \$$SWh% jOf j"D$ iQiQ tQPhʺ$ Vt$h%v P1WWE"W4$jCj%"=PSVh$5P$4$jBj! ^_[Åu1t P!=HPt jI  |$1=LPP!=HPt j  |$1=LPPi!=HPtV \Q1j J$,y h/$藠=Pt jQj`YVV=LPt j j =Pt jQ4$jAVt$h% t)Vt$h% u=HP j =HP{jlWVdP1V A5{Q5PiQrt suYY$P$dWPVα Wh$V PIu1IPVQ?m jh(P4 Ph_$jS USWVD$=PphPPiPjjP" P(PtL$jQjhP iP<<=Pw=Pj=P=,Pu Phл$Ɖ=P~&t =Pu!h\Qh#5P! =PtCjQ=$ 5Phջ$脒 h$1A =P=P=P=,Pu Phл$JƉ=P~&t =Pu%h\Qh#5P  =PyjQ=tT$ wJ5Phջ$‘ ?л$tgPh$=P $3л$t2Ph$=P$PASV3Q LPSV3Q QEPSV3I1  $jQ=t$ջ$ <$$T$$$VRQPWhG$h P R$$:$:$:$hPPD$ffjPk=P5P+l PP=TP1hPPu fjPPt Pk iPjjP脧 P=TPu(QT$ RQhP$ P hPQhhPP@ (PtjD$ Pjh5P D$1hPlPpPtPxP|PPD$PhhP5PNI OD$hPj5Phy h׽$K=TP" iP$t#/=P=P=P=P1)L$ ׾hP󥀼$u DŽ$$j j $Qh$QPR^ =P=,Pu P$P$Pt$h$Ɖ=P~&t =Pu.h\Qh#5Pz =P+P iPtPVlP mPnP5oP=jPkPSWVRQPh$TpP$qP$rPD$|sPD$xtPD$tuPD$pvPD$lwPD$hxPD$dyPD$`zPD$\-{P|P=}P5~PP jPkPPQjRVWSUt$|$$$$$$$$$$jjh$;X=P[=TPNTP1ۉh$A1A#h$h$u TP1ɀ=iPD$jD$ Pjj5P 1Ƀ5Ph$S 1E=iPjQ=$ w5PhJ$h`$z5Pf P1AJTP;jQ=t+$ w!5PhǼ$W5PQ裊 뗠iP<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph$h P_ , |$ |$|$1-hP-P-|P-xP-tP-pP-lPfhPD$L$  ȋL$$ D$( ȣlPD$ $ fD$ L$$T$(t$\$VWRQPSh$h P 1-hP-P-|P-xP-tP-pP-lPfhPD$L$  ȋL$$ D$( ȣlPD$ $ flPf jP;PhPjPhhP5P_1ɀ=iPuD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$h P' \|$ |$|$1hPP|PxPtPpPlPfhPLpP@uD$ $ ff jPjhPhpPv 5Ph$5Ph$5Phq$5Ph-$5Ph$=PUSWVX=PPtuPjjPqb ƃPj5PRb t$PD$fD$D$jP֥4P<D$T$ |$ Mbt$1PW覥T$L$+T$ +L$(x@Biy1PjV_ u8tz8#thb$uh$Pt$4\$8VS5Pa ǃu++8t !8#uoVS5Pa t׉5Pza =Pt$jWa ut:|$9uD$0jPjjW V5PEh$裐5Pa P1e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$5PhPHb K=PthPhY$5P 5PDjh@hPh 3'tEt W=)Qk P0t&ƅu'$*$5PPa /˩$~ t $=Pt)Qj 6W6 P8 P05)QV =)Qt'~t!PHQP;H~Q~  Pjhj hj ^_Ã=PtPHQP~Q fPj fV5Pu<FA\t"uAt""tFAQt FAAtF5iQ )Q;$iQ )Q1tu iQiQiQ^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4'RSt$Dh'$QP iQiQȃPPD$u݄$|9s0;T$ D$r$|$\$|?؍<)hI$؍<)h<$QP N+iQ iQT$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jhdP VD$ B J1rrJVRV5s $^Ã0D$4L$8T$ 1ɉJJJ JJQRPD x$1H0V+0j0^USWVh=Pu=Pu }t$XjVq+pQ~=tQN+ xQy@BD$HT$Ll$HL$$D$$5<&P PЃ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иcp#th#|$d5iQPRQhd$hW]|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQcp#rh#+|$QRhw$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ QHQP~ Q P2ʍHr̃t"1QHQP~ Q P\t"u5QHQP~ QP誫QGduQ1G QHQP~ Q P\[~#\uEQHQP~%Q'H wr? t:,u3Pt%QGdzh$ 1NQ=QiMc%'hQPztu :v2USWVՉhQQ葅tDj.V趄1ۅt6UPpu&)WhQVf u1ۀQ1C^_[]SWVD$=Pt5sQh$5PB nD$t$hA$PV` uA PPtPt$~Vt. P9PQ jQ^_[Pv蔘t=Pt"=Pt5Ph\$5P 1G=P Sh%h*rQhb =LrQ=PrQSh$hxrQIb =rQShn&hrQ0b =rQSh<"hTrQb =trQSh8&hrQa rQ=P1PPv h?$jP WVPhPwơP?snt$h|$P ƆP P?)PRQh 35 x?t$|$ )Q1; P ^_Ph`$\C ^h$t$hB$5P  =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=$PtDt Wwkhq$.$t VZkh`$PD$D$ L$PQRSm:4$uu|$l$ `PPtQSh'$PSh6$P  D$WjPUh 3tU5`PsƉ$t=Pt`V{Sp<WFWt$P_ Wh)i$VB` WSV7` $t P@j4$Vh:$覟uD$uqhB$0 t66h0#t$hB$5PjQkt$VD$V覤PjV躰 D$PhM$Ƌ|$WyPjW荰 u{D$ u?hU$0 tt$VD$ V1PjVE D$ 8Ph_$蚞Ƌ|$ WPjW 1ۃD$  ˀuPh_$Vu_4${Q1F=LPuRP,=P{QShY$5OuhS$ 1$tP\h$|$t.W+PjW? D$tP'hD$|$ t&WPjW  D$ t Pgd^_[]h@hڴ$hP\ P05)QWhhsQ usQwQ{QV5P=,Pu Ph$Ӝt>h$h`Q$[ r1ɀ_Q.)h`QPh$5P8jh$h`Q^ tfjh4h$h`Q^ tN=LPsQt sQj h$h\QS- uh5Ph$= S=LPsQt sQLrQj hӣ$h*rQ[ th*rQh$5Pg 1HsQrQrQrQrQrQPh$1Ƀu 1AsQu ǀsQu rQP5P^Vt$t3DH@tNFuhf$V|tQjhޭ$V,] tDhk$Vf|t9h%VT|t.hw$VB|u'sQrQrQ rQrQ^á`Qt P觟1`QPsQ sQ=$Pu $PPPP{Qt Pd{Q=LPtPPj=Pt#P@=u1Hjh<1#P) jhdPj WV0jk=Ptp`Qt1@=u1HjP_ 5`Q衞`QPx#jP3 5P% PP|$ j%=PtD`Qt1@=u1HjP 5`Q`QP1iQP8u 0^_Wh $j3G D$tPQt h$jG h<$j5G USWVt$ \$l$|$WSU tU̝| u;HDO 1 t$ t$fO gK9uX 3I 3~ 3P 3h 3R 3 tuÅt$g t^_[]Vt$VQt^Vh$j:F hhsQ[ tsQUSWV={QPt`=PtW$twQPhhQ j hQwQtJQ1PQQtNjwtQQt$h5PV1V |0/thh.%VV hh$VV V5$$P  PL$PiQ$-P1iQP$ t1=LPPGt*@$1SSQPVhҧ$y2%u8jQd$$r t\Q$ t1=LPPfD$P$iQ-Phx0#VoQVQt2$75Q:QVh$PB h$ 1^_[]USWV,=Pt8l$@11 SjhU tUh|$ ",^_[]<$tދD$0S ,^_[]WVP5P=,Pu P|$=rQtft$h$+uqj h\Qt@j WP0  =3LO@1 5Pjj(h$guru=jQu=rQu rQ1HtJ=,PuA5Ph\QL5 PHQP~ Q Pj 1H‰5P^_USWV45P=,Pu P\$L=jQ=rQ!t$Hh9$+j h`Qst|$j.h`Qhsth`Q`Q4$uY`Q519 bQ1f u>h`QhE$5P faQ20haQh$5P aQt$1 U薗Vh$UX D$(VՃ!у $ P5Pjj(h$ksu=jQu=rQu rQtj=,Pua5Ph\QR3 PHQP~ Q 0Pj # ,PtUh$5P 4$|$5P=jQ1Hƒ4^_[]t$h$j2hQ#jtQh$jZ? USWV\$l$jW rh#WqUh$SW Džu&Uh$SmW DžuUh5$SXW Vjq^_[]SWV{Q5P=,Pu P=jQhl#+wQu_j h\QptL8tGx"uAHt.1Ҁ"ux"u"@wQZHt@r1ӍwQ5P=jQ^_[SWV$h$V:O VqI hs%P衖1Fta\$SW| t?|$/uH$V豔PVS褕 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhu&P; ƅu 4$躏 1$^USWVHu\$ $Cj j ShWuu  t "hVWF j VSF XP]t/M I9Nt vuvvSJs jjS ƃPjS \$fD$=4P~%|$@jWnG4PO$Cuu S VjP 1D$ PWhpq" D$ PWha$h$03#81\$@jPPhSvv} thh"SOE 8Sh $2-D$ PWhL$轚8$\$=4P~N1PD$PeFT$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,78t-8#tj}ud8AuZku<FD$ t:D$L$ PQhhu { t\$ ۋEu Y 躙D$ PWh$1 1He^_[] t$$l SWV|$GHO~H0^_[Ë\$1NWsu4G `f@u98t /8#ug GHO~막뭅t USWV|$\$GHO~H^_[]1M;G~ uWS4u4G `f@u<誘8t 蠘8#ug GHO~렉륋t$t wWV|$hD1$W>t.hu&W,t!t$?tt$ h$.01F1^_許 th$jg1 Vt$ Vt$  t^Vh$jA1 USWVHE ML$8t$QPV DUt$F|$ D$ 1@P T$1=8QuW4$T$WjVhJ$$P t$t Sm@N| $T$ V1PPPD$T$4$y t h$D$ tPV t h$L$#L$4QtKfjjW tT$PQL$ftDWh$b4$u W{Vh$Wh"KWh$*$l$pT$ 3T$ϋD$1 u V/4$ $Qt$Pt$h@$s4$V $W|h"$1B1PW 5C<\  Cj$jZGٍ$'j  1$'t$'1T$JAjD$ $$ _EQED$$hD$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$PQ$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PV?Ǎ$$ D$ VVD$PV>94$=x31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$PQL$ QhPN PQ11 |$ 1 $R=t1BuڋD$8L$ Qj P=  Ǎ$Pj t$= ŃuuD$ L$ }D$HPEQ4xWt$ P4H $(4$hUt$PH L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$ZE o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[sj $( PS s8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =`Q hh V EKpCDH@uٺ$$&G=`Q GK4CDH@uٺ.$KfCDH@uٺ;$GQC t _DH@uA%ƋD$pWla@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,PQt!9}uEpVamj PQxt$p@ PQ>GWVt$F1EjhhLQ Å%|$څ,h$|$th$zHQ HQ11s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ V: uF9 Qs Q^_[]VP Ph$' USWVP׉΋$1m~ w]$' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1 vh$ dur 34$ dQu0>t*j 3@x B3B3[>u)jH1҉P5B3 B35ojH@B38 B3>u+ j5HQhd3Tu lQPthy"j HcPPhR$h3jtUSWV\$|$t$ pQ1EtB5tQWVʊ QQ5tQT1QQHt8hx0#ptQ QI QKph0T#jh|Q3{rfQ"Q ...Q|QQ@xQ pQ =QuxQ8#uxnu hQ  xQW1 t,E-xQ@J}pQQR)ʉ1ɉQ9‹\$kQ1m1 QQQu>#u~nu hQttQ1B C1ɾ8f Q@xQ1ɋ\$uQ\$t1A ^_[]É^Qh$j USWV|QuN Q19u:=XQuQ 3 3QD$Qd3Qy"Q1NHQPPRQ= 3PWQ=ħQtCħQS萛S5Q thħQ5Q* oħQ=īQtMQt=d3tPPVQ5QhīQ īQQ=QtQQ Q@QQ=XQQPrf|$XQ8t0W5QħQV W5XQVj =<W5Q$V W5Q$Uq V .U PWVhF$WhīQ;w9hīQQ޻t=d3t PvOh@$hīQd{QrH9tt$t$P QH9tȋL$!QP QīQ=\QuQQQd3Qy"hx0#PzQ5Qh$ lQQ$@1Q5QP 5QhQhQ ƅttbQ|0 uNt$@ $@ $QV5QPQ1@|^_[]5Qh$j` 5Qh#h.$h$5Qh$j h$h$ =īQuh$ hīQjmh$벡Q@ u:HQP~ QPNt5QP˜ 1=XQt \Qt SWVQX1t^hx0#3xt&Nj@HOWNuWL[뾋HWP9 WL1F^_[V$ $ $t$QPhVsV5Q5Qh$j V$ $ $t$QPhVvsV5Q5Qh$ ^SWVP\$|$įQt PBD$jPSW PįQVPSW įQ^_[ÐUSWVQjhȯQn91FD$ЯQHQQJBtOz T$R uW|$+;A ȯQ̯QQыR L$y th|$ Q)щ;HT$7D$t{T$A ȯQ̯Q+Q. Q;H@ ȯQ̯Q|$toQu1ۉQ1;AQ1;AT$t1jT$ Q=Q1ۉ__ WjWSQP>P|$t4JT$B8 Q;H`QT$Q5Q1~>~ VjVWQPO1FT$1Q=Q1ۉ__ WjWSQPhOT$t tCsBtt$u Q;HrQxt$tQ1BtȉÅQJA7$'=ЯQ5̯Q$=ȯQFPj W+ @) ̯QQPW HQҾ5=Q QR҉Y = 5Qh(v"5Q s u 1Pjh<1#ȯQS1P5Q5Q)1Pjh<1#QS1P5̯Q5ȯQS!1Pjh<1#ȯQS1PS =ЯQ T$ȯQ=̯QGPj S* ƅ ԯQD$4)أ̯QԯQ 5QQ9aQj5Q5QhȯQj5̯Q5ȯQhQ 4 5Qr  T$ȯQ̯QD$<=Qd3=B311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5B3r5Qjjh6~%!5Qj$} 5Qj } 1-RyL$ tKQs D$ ;B3r5Qjjh6~%!15QWjSy!t$ tsQtejPh'( tQF;B3r5Qjjh6~%$!1') $Ph$5Qo Z;B3r5Qjjh6~% 1t$ D$13Ph($5Qo F9ut$ t$L$)4B3F9r5Qjjh6~%j 5Qj$J| 5Qj :| Q@ @9  ֡hQ ЯQu55Q5̯Qj5ȯQ =ԯQt5Qj { j jhȯQE ЯQ5 =ЯQ( 5Q5̯Qj5ȯQ=ԯQt5Qj q{ 볋5QQ9Q+ȯQT$JQQT$ut Q;P ̯QT$IQD=ЯQyBu%hh r F 5̯Q5ȯQPe ;̯Q} jh<1#rE  [ T$=Qujjhcp#hQ ЯQD$0̯QD$,ȯQD$(ԯQدQܯQȯQQԯQL$(t$, Q5QL$0 QQQQ=ЯQ_ ̯QQZ=x39ȯQ @ ȯQ ̯Q9r Q֍Q@PQeQ5Q F@+6vFt P uF6^_ËFp vh$j USWV ՉL$QQщT$Љ$ 3QE]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B ,Q9r7 ,QP5(Q(QQQ$Q0D$SPt$Vr it}ŋ4$L$]\4$L$t&uE\,Q9r+,QP5(Q]ƣ(QQ5QF1C4$QQ\$D$ ,Q9ȋ$r+ ,QQ5(Q(QQQ ^_[]USWV`}$111D$h.$u W uu5 U>ut0Gtg U;u U$8u 3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%Sb t+8ttDGh5$j 1E L$3 ths% u3h$j tD$PW uh\$ۃ|$ tt$贬 uhf$뼅tt$ uh$렋Cu/h#( e%tjhm$VV\ VeSPZ QVhp$ !APh$h3] jgRUVQt@t $e^]Vh$je WVP։)B1ɉQPWk V?t$8tB1H^_A8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV Cf{~a11C403t?L$qPt+{|7u!473L$1qP4 D7EC9|^_[]Vt$FtKPA F tvPv ӍF vQv趍F^USWVP1k<jP3~4jP3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<jP3jP3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùwGw8x)xy yh3jjCh$H jNV1=HQY ^dt*jjjN VV5TٴLQ5TPQj5TA@TQjPXQt#1ɺXP3A<.uHQ1 1@^USWV D$0f 9TQZ XQ,I fEE!f ufE(Mt!U1f~ t @9ufE,$gtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAh3ja W1@$̄'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$܄'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuDLWbB=m$ 5TG5TW1QQPSt$V5T5Typ1U)19}1ۋ$p$)ŊEt9}1< ˊEE5TzhO$1VV5TUVj5TVj5T" 5T5T?= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3j^ bxu+=LQ LQσqt$VoVV5TAIh3jP^ ,$,$fUuE 9|)BfUh3j^ ,$T$4xut EfEuGza|1x(| E9}ED ufMh3j] !}Eu)u[E t uP(u}f;}]D; jt4_D; tt$4UЃF4; ~ttt$4WZuE tuPu PE uu3EXQ,Et)u^E t uP+uEtP9EEf~3M1tRMEGЃ9|׋E4t t$4UЃu聀EE tPjE ^_[]]t$5PQt$t$h$h3NZ]$@ t$St$t$ t$UPh$'r] $A It$U5LQt$SQPhX$h3VN$jBUSWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$p褌tS;tNt$Cj S)؃ QSVWD$pdt G}uo $ $l$Atl$|$q6KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth0$VSw.|$Gu1PPw|$ GL$G)VQw w ^_[]D$L$XQ fAËL$1x9 TQ~XQUSWVl$0.TQ9}=XQDP5XQ_Ǎ PjQ+ =XQۉTQt @tFj$菟 101Qj-dQE3\Jك@to@uwt uDZ@t< ty< =|Qu =xQtI5\Qtj 5\Qd%=|Quj 5\QK%hQlQxQ|Q?=|Qu"5\Q萁tj 5\Q$j 5\Q$1|QxQhQlQ|Q xQf)lQ1ۈD$uhQC5\Q t$L$4 5\Qp9Ƌt$|25\QZVUUU9}j 5\Q8$|$uCj 5\Q$KVW5\Q8h E߃ @ ȢhQlQ=|QuW5\QFt7j 5\Q#%5dQ5\QcxQ|QhQlQ5\Q连 ^_[]t$Ph$VPt$D$ L$ $PVP1A4$^hcp#t$t$t$t$USWVP|$ \$$l$(t$5\QhQlQD$,$VpUPX1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW肭j5\Q1ɉV,$E|$@t[D$@8tRD$u:hV%5\Qat$@5\Qah#5\QaWt$Dt$褲 ht%5\Qa4$F5\Q}D$ 5\Q~5\Qt~‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5\Qa5\Q}th%US5\Qa/)PS5\Q 5\Qě5\QÃ~0L$ZD$  1 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ覨 KOuLuH|$@tAt$t$D|$Wׯ Wh3j- D$z19Dzf tN;L$$} 3DXuh3j_-  $9A)RPQ $8GED$t+)j Pt$5\QL$hQlQD$t8ʋL$ u|$@t$;D$@u  $L$t$t$PҮ 4$蠹0^_[]hcp#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5\Qz5\Qcz$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}StŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P?tC@j P)uL$$)݃} 9WUQS5\Qƅ|$ 豠VyƅtV5Td4$5\QsPWw5\QWPWT1PPW WٖD$E|$ GWUPS5\QwPŋ=\QVPW=\QVWPWS5\QhQlQ#WUt$ ShV%5\Q1$|$<\$HD$LD$t$(SPkT$t$t$Ht$HWtIVI4$tWVVMWfUPMWM^_[]hcp#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]hcp#t$t$t$t$USWVP|$ \$$l$(t$5\QYhQlQD$,$VAUP)14$SWt$(^_[]hcp#t$VPt$D$ L$ $PVP1ɉ4$ ^V5\Qqu5\Qu^fUSWV $$$  R15XR5RhQvuɸR RTRhRlRh% D$|$ hW%SU詟 e~o~1pKrtCGD R붃fg5 Uhx0#VPhWx$ \$h/#WD D jPh# t \$Sh|$W,$ u4 3X%'WPWV}y t }u몋}tE$th/#S\D <=u͍4@h/#PBD Fh6[%Va 04$VW萧 H RhlRhhRh%W%5 U bS$$$ Fm UD$/j4Wh;[%wu#D$=uD$h|$d}:hQ[%z t61W覣 t@ < uFrW r 1Wq jhD1$h$ Au5Tlrǃ5Tyr1FVVPWׇ R:$t5hR5lRw5 RhJVjVjhުj5TB4 hhHQvD$D$@VljD$ VԟD$1Åj2P賞L$t|$ o u*t$ s%n ut$ Y%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11VT|$ t$~14;40C9uW"Vj tPjjVhH#% ]^ RjdRj" R1V譑 Si9֋$| hu臸t== Rt j jj$2Q1 ^_[]Ét$ h11GQWP Ph#h36 VW=h3jj,hV% j袹h3Vjh+W%VrV1Fh3VhEhY%VPUWVV} hI#萬 P跧 3|[p"=lQt>V荙PhZ%Wa 5lQ5lQlQ= Rt>VEPh[%W 5 Rk5 Rm R=Quh3jjh[%e^_]Ã= Rtá\Rtt$P- j2j+hI#聫 tP褦 t h.%蓦 Zjh w hjUSWVB L$QAt  Pޝ Ń j hY%Uar ~ uF t$|$ WK WrfD/UWk Wj\ŋ>7Ptn,$n ;nu:FUW薥t^FPv~tFljFn ~D$P~4$pUV Sܜ ŅSIk ^_[]ËD$L$I41@USWV1t$ RjVt$t$ t$t$4$jJVP;= RP蚠t$Vj ն>hj]jYj߄{jVfDʁVYVjj^4?15 RP RVPX~BjhyRjPWyjhx= RV/Vbu%Rǀ$jhxup裼^RPh$jX jtOR)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP脡tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uV!fVfSWV1t$t$t$ t$t$4$5 RjgV#jr4PVf8 R$*tKuKt!PуtR$PRL$$Q3 tXD$t$VSVx)VOud[%uo[%t*VB^_[À)ujhbsu Vt5TI1WW5T 5T艹5TSj 89;xhj_jZjC]jVkJd[%o[%!}E'USWVο$WQS" Whz[%SӚ WSU Whe%U跚 S1tGUt0VVVVVVVVVVVh"hu41PP/t US^_[]SWV$SQVt Shz[%V% SVWX She%W Wit VW^_[WV1t$t$t$ t$t$4$5 RjXVtkjo4PV[5xGR*tD$$tL$PQ^t$VfLtV誕^_ÉWj ?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4Vo9D$pPt$VW Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW3 L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04` Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW轂 5lQt@WPhZ%V 5lQ5lQlQsh2%h[%lQt*W蚋Ph[%Vn 5lQ.5 R0 tPhU#h%v%j[1e^_]Ph[%h3 j UWVVǁ = Rt>V1Ph[%V݄ 5 R&5 R(5 Rwh@$h8\% Rt81hH\%W莄V虊PhS\%Wv 5 R迺$0Phl\%h%v%j[1e^_]V1hhPhعPjjPj jjhe3h谸4xjP航V蜹^h3jjh[%ʹlQtPjjh[%貴j8 SWVD$x1|$lQt RPS1; P=PVh5#W臟^_[USWV$$$L$$QPhV $hx0#V, $D$W21K4$肖 1G9r6|$  WU͖ŋ$(\5F4$( ÃugD$ PVbuH|$dhx0#V$t:|$G=lQtVh\%h[%P1KS1D5$$t 4$$0 4$:ulQtVh\%h \%P1ۉ؁Ĉ^_[]Uj$$$1K_ USWVu ED$l|$(PVW/  ED$8D$1ۉΊ<'t  j Fj'Vu Vljt$ t$PS D$ t$ )VPh"L$Q/ h\%V t+9s'T%u@u @Qj*PS ;'uC|${*1\$$|$D$8j/W6 tWdb É@/ WQb É|$PD$Sً ND$+D$D$ .t Vt$W tS螋 Džu]D$T$L$;ȉD$Pt$ ǓSD$L$Wt$t$ h\%P[. 뒋D$L$T$;t RSY |$\$$h:%S* G|$\$1\$L$9} KD$hpP6yKSq|$u9Mx{;5TtVSjP|$ۋ|$t h<1#5hP5`q3H 3~ 3#h 39Nj|$t-qj8 n;5Tt V@)|$ t E%u15Tq5Tj5Tbpt$(KtwP9uW'D$td$8u-e^_[]D$t$ hx\%ju Vh\%P 1S!D 1FVD Sjhc%C VSۊ t$C $ D$pL$|PSt$(耬 t$ tklQt*t$h\%Py 5lQlQ Rt*t$h#PF 5 R RhO&D$ 0u.h\%D$ put$vm t$e s hrRREtt8tjPF u%t$V63 6h]%4r j3L$1Ph\%r USWV։5T,1@P5Tj`5Tnh1PSU3 pGhPm2GhPS1CS}3 5GWh$Gh6%(2FPU躑m5TO@)VUPRQ5TitcjP芏Rt05T#PV)5T.PV*1PPVt Vm^_[]h3Sj+h\%S fUSWV-1@=Q$hxb%Pjq h}D$1D$ $ $?$V>99%VW% PWt$ VW G|$b%4'3D$WPWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P輁 FD$ |$$ ))Ƅt$T$E8 }? jS` ƃ $NfF&Ju1ҹhuRRRRQRRQjSD$DPju触4D$D$D$ D$ jt3D$ Pt$YD$ p Q )) hPhQ 14X'jVhQ$ t1GuD$(Vhc%j@$S. 1PPD$0PD$XPSR t|$Lub4\'hQh%v%h-jSj"D$L1QD$PPQQSR Shc%s1=Qsu=Qlu3 QDH$D$$Ph.% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvJh1Wt$TV j!W|$0W iW&]hhad%QChQPPjI=Q hQPPhh2%h-e% Phzd%j+o hd%Woh*d%Wohd%Wohd%WnhQhd%Wn =Qt!hQhd%Wn $9hd%Wnhd%Wnhd%WnWh!`%jtnhQhd%h DŽ$hQVVj~j hh_%VN Qdefa1ȋ Qult1 j h_e%hQ^N Qmanu1ȋ Qual1 Q1 Qnone1 Q tlf=Q tb=Qt`hQhQhoe%jtChQhe%Sj~$$QQhhFe%HOh"IfhQhFe%hSe%hL [ 8 QhH]%D$ Pj3 ~ht$ hQi{ t$6j hQNth]%D$ Pj ~ht$ hR{ t$j hRt=Rt QhC^%D$ Pj ~ht$ hQz t$膅=Qu:h^%D$ Pj@ ~ht$ hQvz t$Cj hQ[t=Qt QhhQtu=Qt QD$1@$" h߸QS$Wy VQPPjxVQPPjw SW8t%Q|$$|$ t |$ujQPPjyE|$t jQPPjz^hQt2 =ŴQu=G_%=r!ƒR_%t]_%=ujQhŴQy jŴQPPj{hQPPj}Qu4D$D$Pj_|$uhRPPj|x=RA]$A]$tR=Qh_%tQ=QtQ|$ti=QA]$A]$tQ=ŴQA]$tŴQ=QtQSVWQRhQPhQhQh"h,$L=ŴQA]$A]$tŴQ=QtQWVQRhQPhQhQh"h|(jjjq xP5 Qr_%Ph$hB ha}<hQhd%hSB S"jrjQ$H1WWV$Phb%I t( ;$P$Tshc%jPbt^DŽ$ 1WWV$Ph!c%rI ? ;$0$4&h5c%jPh`uq5dR)1H t$t$1t$ɜt$߀h_%j<$t$jGQ1@$F=Rh@$h_% h_%jft$(VXc VlPh_%h_%Wtf=QthQh`%WXf =RthRh`%Wt<pRX1ɀ=rR/rRQPh%hh R2 1^ËL$1BhRWVt$=Qu jG7Wj ~u1@lpR5TRo1ɀ=rR/rR%QPVWhpR =1ɀ=rR/rRQPVWh Ro 1^_Vt$V dЉh8 R$^WV D$PhR{ u:$nfsu-VhRhpRl VhqRh Rk tWj t1F?t[htQhRh"a%jPu>RUa%hRVWhpR hqRVWh Ry 1 ^_SWV=QhUQu(hO%Q\u9h߸Qh^a%U=Rt h_%˵=Qt h-e%赵|$hQhka%hW h@$WƅVWPh|a%j[h$V[=QthQha%Vy[ h!`%jj[QuGWPh|a%jK[=QtDhQhŴQhQha%V%[=QtCha%ThQhb%hŴQhQha%VZh!`%jZh2%ha%XPha%jZ d%SWZh*d%WZSWZ=QthQhEd%WcZ hQh]d%WPZ =QtPh߸QhY$W/Z hQh#WZ Wzh!`%jZha%ZuhQha%nS=Qthb%XShQh1b%FSt Vj^_[USWV։ϸjPPVb tCËl$hjW; ojhQWHh WVS- SR& 1H^_[]USWV$΋$PhS%|u tWcp#V ^l$PSU pR<$utRPVUWhd%hC1Ʌȁ^_[]ÿd%fT$L$t$q"u/Átu s$Ãt6u8h6h/u uhI%!w'hhݮV D$L$FFhTV~ ȃ ^SWVP1ۉSSWSjh`'Ԉt{4$`1ۅtjSSWPjh`'詈tEh:%Vj2 t&|$\$PS׃th:%jD2 uV q Vq1ۉ؃^_[USWVe%X'\$|$jSPmD ƅt Eu$wS7e wh2%7f G^_[]WVD'|$uT't%|$ jWQD t u1^_ËL$e34USWV1td։σSPSW  t u6P1PhPPj D$PU< D$t΀8uɃ<$uð1^_[]ËL$e3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'Ee%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ, $V1VP 95 RD$40$X@hP@tt$45TzBMh 3f 5T.9r  Rɉt$ =1MD$Ni8D$$11t=i8,4`RtǍXUSN݉|$|$l$$RRƀyH1ۉLPTXVUQb R" .hQPa VUh Ra ,RL$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPR$()1HD,048Ƃ(1  R<5RRZ`R|$c[ RP$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً  RɋD$L$ӾV Wcp#QSPSl$GUU R$H@ VWcp#RPQSD$BP# lQt% RQUHDRhUf%Pe =R$0 ơR$pL$*QUPVWjj:WD$ D$D$ PjvD$ t.- RL$QP5R u<5Rh_R$Pdž$l$R()8 R `RVXRVjP L$ D$@D$9  RyuƇy$u4P4 44SF$똋D$R$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$&D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4&El$L$),$|4xfDŽ4DŽ4&T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ&D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ&D4B1hPPPPjPPjjR$PjZ4$1K|$$8h$j7 D$Wt$sD$tvl4u^u3h1PPPPQPPQjt$,$Pjـ4ÃtCD$WSrD$lxS襁1H$^_[]1M4$臁$<t4u/h芢hPhVf3Z R4f31@멃= Ryu R Rs19dL$w BsÁt1USWVD$$R*t1G.$ )$Phf%hV o%jt(hfMVhf%h% j$ i.%W踢R$Phh%hVL WVhf%蜥 ]h.%Vjj\Q1PP3Ahgjl1qq$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$t'hhg%D$P tg%D$yg%X3|$0tPhf%hW Whf%D$P o%D$f%zh0g%D$PG lQtPjjhg%r1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#tcp#$h%\$t7ȉL$7 T$wXClE;F{Pp\$CPW\ SXt$0|$4hh脕L$0QjP7. P8W_XtVhih%t$y> S>X= Ru#D$@ R@@hTPihgi%\$ S0>hi%S">hi%S>= Rth Rhi%S= $ 1|$@VVPWhk% ;wcp#r#t#Qhi%S= hj%ٕhj%̕hj%迕= Rt hj%評hj%蜕1h!`%WL=S誑Wse^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ |'h'j%U UeuhVg%h'j%Uz U>FjVO1Ktljt$"h6j%DG$Go%G w"GhHj%DG ${$o%C(s4C8|'hZj%DC<{@o%CDsP$sT|'Sh'j%U UstlShlj%U "U$DF$F^ FShj%U_ F|'UCF $F$^(F48ihVg%h'j%U UtlVg%Whlj%U "UCF$F~ ^Whj%U F|'UUCF $F$~(^48+4$iƷm۶|$9UHQ1Khg%賙tzhu#臙tiD$hu#Pj記 XWl$UVt$t$%T6TOu4$TRPh$hÑ 1PP}#R)t5Phh%hUѵ 鋔$ 1$ 91APuDFl9Ɖr:RPh$h 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhj%hj%hhj%ݖL$T$jt$oËL$T$jt$XWV׉κo%jujWZhcp#Vhw0#蘔 ^_VQ1ɾ 9r^^VD$QtU@8xtlIuAH1FVVjjhhQ0QRx tjhQj:H tQ^À=QtjhQjH QUSWV 1WWjG &iP@SPj G t$ á3D$x1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tE`R|$$t.jVjG t 3L$Nj4$D$/devG4$D$M[1O4$1O1VAP ^_[]USWVPD$tPpP11OFtFh.%P譌t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T k%wk%Ph#"h%V ^_[]Vt$D$QPbLt(D$t%t!h*hPQ+]D$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5`R.@ujPGD$1҅D$t 9tL$BuT$ЋT$P]1hPPhGhjjAPjQQhf3w h4WPZw NM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hPuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP3FD$1҅ӅtwU耉t\P,40UQt5L${|$P=$tL$ST$Dځ8Nut/$E t$JLЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WbDŅjWMD{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ D$$@$;E tL$ A;L$tI1۸hSShShj t$ Wt$ R> |$F;pRw PHD$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQބPVh5#S(J^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6iG^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh'k%h:1^_[USWVu e%H'jVP uh8j}w  jVw2; e3Oe3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhKk%hS6 Zɏ8^軏8PG@$QP"B'$HffsWBD$BjhVk%1ۃt$D$hqk%hbk%WR Vhk%SQ Shk%WŦ S<$Ph}Dt$VWDW}VJۻ$Phk%$G 1ۄ$hk%$hk%PߣL$LQhOZ&PP t$,04t$jj hcp#RPjV |$LW~3r \DZ@uWQVt$hk%ht$ " 1C}$.1ۿQPSWΉ t$L^^^F~ FFVhQt$ ? t |$dJSjVs $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj hcp#RPjV VSh$ht$ڣ }G8@É؍e^_[]Q=}t'fy"Q QNuEt FuXt1€1ɾQ( Ӏu A'w'Q ' Àu A&r  uȃsƄ\$,04t$jj hcp#RPjVd $PVShk%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj hcp#RPjS W$mPSVhk%ht$ -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h-i%qM Y|$h.%u q{Džtoh|'6\{tkDŽ$v/rDŽ$/dev,$$VuP^4 D$/devf@/VuPA4 Q踃낋E\tu xt@@AED$5`R$ttt$PуuNR덬$WPU3 t$/devfF/RWPVx3 [Slx\as%a9aO$CQPU33 {PWVR$t(tt$Pуt Nj5R,$1D$0$h@hP5tt$GRPUcytTP,40U4t-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS1 $WD$pV0 l$ Uh%V8h ǰD$h/"Wxh#Wwtyh#Wwtgh$WwtUhh%WwtCh"Wwt1%D$t9l%tD$VPS0 VWS0 Uh%jrg DžED$4$v PS} t"vh$jsx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$= RSWt$t$s$1PWt$t$s|$l%hWΛ 19D$t%Vh:%Wr/ D$VpWa/ u\$t&Wht%V@/ WuSW0/ W'tN9|D9...Wh$vv; e^_[]fL$19bUSWVP\$1ɸ't׉'t҉'tэ Q'ƆQBu14QB9uQjuQj|uQjmu Qj^u$QjOu$(Q5QV"sË-QUs9w߉5 QVr9w-$QUr9w߉4$Vr9w1Vhcp#hl%PP ,Q^_[]}V|V$u#V@1 ȃ|^V|V$C#V3$1 ȃ|^V|V$#V1 ȃ|^U4Q0Q u;D$L$A 1RRPh0QjQN4Q0Q]SWVh6%whxw1WWy ƻe$StSuhl%W#V0 VS6^_[WVt$D$D$PVW t$L$QQPhm%jӚ4$ 6 ^_Vhl%j SWVPVjB>u1@GpR!srR%VPWShpRї wsVPWSh R軗 1^_[USWV |$ faa@D$z$1Ccp#=Rtho%jRVrPWh%v%hvD$PUAD$h R5hQhq%j訙xRrW!pRutRQWhrRVt$D$PWhr%SR$'D$D$ =mdt2VhRhpRU( VhqRh RB( 1$hVSz t$t$t$D$ 8QjVV ~;Ƹ PV,D$i jQP e9]D$|$hzJWw2o ~#u4h8Qh R 21jio Rލ$HQHf@&tJu1SSSSSjSSjjUVjlL4jmtoPV>VMkt8QPh Rs u`~*=Rt!ho%jU1RPjn)D$Wj3>\$tt21ۅ1C؁ļ^_[]hCr%h1r%h'hiq%quUSWV|1ۀ= Rt}h Rher%jŕ ueRr%%pRhRVWSU hqRVWSh R VU#N@1 É؃|^_[]ËD$L$I1@Ã=Rtho%j(RVt$ D$t PmVj<m5 R^USWVPWj<1F?tih RhRh2m%j讔uLRsQr%Sm%hRVWSUhpRߑ hqRVWSUh Rɑ 1^_[]SWVPVj@<>u1@;sQUm%hRVWShpRx hqRVWSh Rc 1^_[ù1@t QIt1ùtAQt 1ùD$QAuQËD$QSWVhFlhy1$hWVu 㹸g3WSChWWh)Wj65,QWjWPVW8I4SP;V)Jİ^_[USWV|$1i/t\1tWQtI1r rr2tM0u&1q1ur1ۃ0݃便Mr @뜃|$tB RNBBN^_[]USWV|$D$L$BJ 0uQ=(Q1۾K&- QB0t#1urFQtu(Q9u'Cϸ Q9t0QQtQ0 5$Q|$Q jVPhl%WW/^_[]WV|$t$ Nt tuh\m%Ck\m%fm%2t.%jjPWV^_USWV|$=pRt hrRj;WWGpRutRl$}QWVh"d%hUm 1PPo ơpRt3Ѓ<PUuu#D$=ueߋ$$$t RP{jۉt{uhkm%jz$t]PUhm%h[Z$tRh{hSjP2 jP W\+VS+jUhm%h V}% V-+tP$tRUh$hh jj7Ah5 R~ 1@|^_[]Ã=pRt=XRtUhm%ju CQ1$tRVt$hB'%V-gtVpRt R R^t$-pRutRUSWVt$,VeD$j$t$VC@to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44dL$|$)L$OGj$W?DžuD$@PDžj$t$0?|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$VIG 1D$44Uř D$44c$D$D$ j$S?Ņm<$t$ >tV\$Sx Vc$|$);\$u ^_[]hq%hq%h hiq%lSV5g31/t.T$ g39u9t Qt q/u^[V1ɍt$QQPVhm% y1t1^USWV|$(1$PPWVhm% $D$(1PPWVhm% Z$LF1d$Pj%*4$>$'hd6%Udhhhr%dhgUdW 5 RD$h\jU5 RN] 'PPqhVjU5 R3Vat PVW HWD$ P St$5 R\ 5 R,85 RSjhs% j D$ PU Ukhs%c D$(SSWVhm% $j hs%fMuQ1AtCjV u4Vhr%"1ɉtjV uVhs%j) D$(SSWVhm%I u$~hm%jTȁĐ^_[]1USWVhhr% RtPjjhn%<1RRRR RRg3/u D$8g3ڃ9tQu@RQ/uD$/u.RR19hajN g31@|$>ZQM RL$ RL$j5T>5T萧5Tr=Rtho%j聈RRR6P5Rh)n%jatapRWj B0D$ttRN1ҋ0t1t /u oBrgQuƃQR1QuAuVD$u,D$ RD$R1@QR^/ RFRRQR5 R5R5RPh0n%he` jjh,_t$FVj.~thvn%j軆hn%j謆hn%j蝆1GQQthn%jfh.%_L$QPdu{ho%_$QPBuYD$3$L$3$ t?ho%h2o%Mft!hp%WWh:jHj j j jVWW94ƣj3WP*j3V9Wn jjet$5|Qhep%WV h p% \$WPS S茢SVj  jj}e1@^_[UWVjX WW: W |$ hPWZ j WO3thZ$R |QtV("RWQPh%hge^_]1PPj1Ʌ2jQ#D$t PiD$t PXWh$h3#U jj#T5 R1N^_[]t$ Qt$ QV=11N4$̛t$t$t$4$VD$FVjW#F^SWVPD$$h2%hp%Wt@Ƌ|$4T1Php%S 4$WV6 VPh!`%S]^_[hp%ho%S q%)1ۅtHq"t]q" 1ۅÉ[USWVh%# P<D$1Ʌ$l$h#U9 ti\$WPS 9s?hh.%SJ =w%hVS4 =wjS t@h#U~ u4$1jVr 1Ʌȁ^_[]4$1AVt$VO1|TsrLc1f ^Vt$hB'%VGQtVRt qR R^WVt$ D$wǃr9t\e:tSPQj? V5T.>V5 R>V5TаV5 R5T蓗5 R腗5Tg5 RY^_WVt$ Vw/ u.>vf^0-PVWh)q%h3y Pq%^_WVt$ 0cPpRPGt$>FFVjF^_SWV=g3/t/t$g3GtPVOt /u?É^_[USWVj$t$ (1ۅtKƉ|$\$FUShSSj WVa $Vtu;D$ rj$V(ƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUx tMƅtPt$VF0 SOVUP tP׃SV^_[]VPT$ D$t$4$9VPv ^À=QuaQgq"Rq%,Rq%R3D$(RG$ R&q"0RSWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW $L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQPF $LL $UT4L$ L8L$T$T@Lƽ$$hVWURH uD5<w |5L Ku1PPD$P )ƍD$Phd@V+9 |$D$|PhedAV9 V(f$1 GaD$P$,hTr%t$V\w 1PPV诽 $C]su PUhhQt$t.QCD001 Q1 u=QtZF9|4$9ja$,h|%$0uv EPPj{ jOhQD$4PQ! D${O1ɳ$$uƒrL+1Ht$,D04$衽t$$,h|%u&v EVPh$Pv EtE @E w-G$9@  V@؁^_[]1D$L$I@PQwʀuQAuQ Q1USWV$$1$hWVtP E jShWWh)Wh5,QWj jPVW$4SPV$1Ĭ^_[]ËD$1ɋ0t1urQA1ËD$1ɋ0t1urQA1USWV ։D$ $E1$ j D$$ ,$D$r%?t $Er%us%D$$r%r%u-s%E\$$(Rx \$\$$&HD$\$$)|$= R=R=(R$ <$D$D$Qs%%<$q|$4$D$ (RD$%,s |$D$  RD$RD$s%=Qu$ByD$1Ƀ o3\$j3C|$D$$$6%D\$$(y{|$!<$D$(RD$j3{=o3cp#|$l$ D$D$8s%$kljl$4$ w K=Qu $fxD$|$D$$.$6%C\$$'|$u1=R=tQ=(R$ <$D$D$Qs%#<$t|$4$D$ (RD$%bq |$D$ tQD$RD$es%$juLl$ t$<$D$u%i$ \$<$D$0v%i$ l$4$u > ^_[]Á=m3ftp]d%=m3PFSWV|$ty|QGO4VSMAtRV t{S5|QQVhwQ5xQh\%hSf jShj2## fGj3~"PptVʇV1^_[ËD$ xQƁwQ QfH QfH1SWVt$xQwQV~)S4:Q FQFQF1^_[ËD$L$01.@fSWV1ۉShPS$ tD$$PY0 t V{M8VgM81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6.u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW6V蕵y M81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë= R1SWt$ t$L$ T$:D$T$SWt$ t$r:D$ ׋ Rt$ t$(2t%L$\PSWt$t$,t$RPPQb $ R1WSt$t$:D$T$WSVt$9É֋= Rt$Ht$H迍$PWVSt$t$t%PPPQ!b $VD$`Pjhq1@USWV u C(D$|$8hjWF wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QnJ<$L$ PP@Ǿ'|$D$u$L'B H'BD'B@'QP׾P'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$ tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)hD#SD$ &4L$ tEH/uj#EH@EH`L1^_[]/EHjSPb EHHLSWV t$ vDhH&WS6Y 1WSSPPjjh_= SUFDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vLD$F@ F5dR8pe^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|jo94$ukGllPw!GX FPvt~C $i)ىQRP+ 1D7D77qfD7 D7 jo4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A WOu\$ QfA |$tAqfAAjo 1AA tAfAAp A pAufAAOv) 91jEVVh5yh[vhrjJVjVQPhQ4C(OL$<@C,SPM{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch.%P%uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SP*{,1s$PC$10s$5C$s(C(1ۅÉ؃^_[]h t%hs%hlhs%6,USWVt$ kFllPv=Nj\$FFi )tkllklPRQe ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ W{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh, WP1^_USWVRt$ 1$V[/} Vٞ$T$GD$ pjVXD$D$ 1ɺ<t$Vt5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vhxt%D$DPh D$8D$ D$8t$XjVt$(1IQjFj QP3 D$89D$ t PV$PN |$YtZVր MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWVT9 )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ R}] aVt$ t$~؉e^_[]USWV D$ 8t$8L$j QP! $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPp VGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋ R1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSHD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hA$jVA0 C `L$rL$DPhUt%uL$DPhZt%jQ0 D$D---D$D$s RCjO SjPe ƋEx tjP SjPD 1jQq SjP( ÍD$ tSWVhut%Ptb SVhxt%Pbb V2W)S  RD$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hA$j$P. t"?tt$ Whxt%D$LPa D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P/$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD B$uR1jPPPh-hPj jjj%VjM&4x!t$PWV)1@^_[]ht%ht%hhs%L WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; @'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS' t$]EْfEG9v1PPPPPjPPjj(WD$8Pt$44x4$P_Ws11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hqjtu t1@t=Qt@u.1}h'ju tEx lw%rtVw%tDw%M u@=Uu,>t'D$ L$R;\M`|ˀuK(Ѓt tu tP_jbjWaƍD$(PV$1 $$QPVpa $Vb9$ul$`=u]tP$PS: $5fǃU'V.bWh$hzw% uQe^_[]SWV0\$@1҉1 F FFF =QtjP4D$VjRRS3<^_[USWVR(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hw%jkt1e^]USWV8=QEM 0~klP1ԧËE E8؃lklQSP  ߾̋'R$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$f1hhzx%h1USWVu|$\h jWS t 1@p3D$D$ Fw$d'谂$RTp3CzPc9^jτ T$D$D$PZ Ph'j3 RPT 3 Rhp3Qt P茡?t5hWz%hQjF 9 t?hz%D$Pj' PPhMz%hQj Q|p3D$Pt$hz%D$PjlQt+L$L$QD$Pt$ hz%t$ D$D$PD$t$詠|$s p3=p38:FKhRhRhO RI& 0p31ɋFtu:x߅t$1G GGF G D$ 0AD$ 5T1VV5Te 5T׳5TiD$\hKVVhh j&jFVjVWPV肺4ƍD$PV[Voe^_[] Rh5ojP!1xV]HuhJUSWV|$L$D$p Ƌ{%|$t{%SVPUWO^_[]USWV`5Tm~1WW5T; 5T譲5T?~D$$USWV D$ =,Qu RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS肊 F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hw|%h_|%heh|%&USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h&\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$X!Ru zX!RD$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$Č'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{1Ot1L$D1 L$8ɋT$]t"9tjQP T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(X!Ru xX!RD$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$Ԍ't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{b11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut|%1^_[]Ãt ux(tth~}ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuD?{ l$(Ph}%U h@$U [Ɖ$Uh}%j=r D$Ph}%V*r wXw\w`h~%VrPwdh~%VqwTh.~%Vq f1ۍ{aE4'WuWuWh9~%Vq E< t<uEMPWQWhQ~%Vq$<I6~%9|<1#PV[qC9z1h!`%W8qV D$PD$Pt$\$4Shv~%h`~%WS1(^_[]h:}%h"}%hBhR}%h"}%h1hk}%h"}%h h}%h"}%hh}%h"}%hh|%USWVhj~{1O1ۍD$ShPS$4腄9+ōF,PhedAU  l$$4$0$($<$8у|1҉$$x F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$萮t98t4 .jPL$Q} D 9D$ u D$4$,$F n$9Љ} 1F$F )ЃF n$,$G9t$;$$h~%jP r=t31>t9>u 9>t0uk9uVڇV҇OVʇU;1@19$,|;ЃV荇t$:؁^_[]USWVHD$1Pu轄Rhju;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d 'uu FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h:}%h~%jg6hR}%h~%jh(hk}%h~%jih}%h~%jj h}%h~%jkh|%vD$T$ L$DrRQP5z ËD$Djt$ P講 USWVl$j/U 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=,Qui"sv<$Q P!RT!Rtx(9w4Ju1AQP}ãT!RP!RH P!Rk4+$1 4+VhH&jR 1D+ <+ hsܿVPh%jW 1D+'<+(D+($D+,t+0^_[]V΃=,Qun$Q) 1t(@"uP!Rt T!R9t 4Hu1^USWV|$4L$0Rt$`VQWQ ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=X!Ru RfX!R~V19|(1@@89|~@w1A^_[USWVP=`!R|$(L$111= '"\$uӀt0t u@ tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h 't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV(khh 'hQ QklQ11Kj1lƃwD'DtGCuޅtH=\!RPk`!Rt)1ɀ<t ͼ'AuVD|^_[1V \!Rt(`!R1t ҡ`!R \!RF9r`!RP{^fUSWVPt$1hӸ4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h%v%jQQWRjjh~%,1^_[]USWVhu}WWPHD$T$RL1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvR@u ǀ@>1t$(F F>D$,Vt$|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W0D$0F;trԋL$4T$B9rwP/|$4r!1FD$0P/F;t$4rD$0=0lD$p[D$6MD$v>D$  cp#1ۺL$#PWVSh0RQ t$kPWcp#PShPV RVL$'Qt$t$t$ t$PPhDd$h6%苷R$0葳$R$ppFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCPffC C ^CfCCl=\!RrC fC*C,zG1ۍD$(huSSSSSSSjjWPhv48PG@,H`t$VW6WJFuQ1K5QEut P3ut$5Qu1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$D$^_[]h%h%hyh~%USWV$(E]0耩ƋEppljl$E@ t PWcp#PWVSjhY1U5 R|$ wwt%t$R5 RRPSQV+ U5 Rw$w 讥l$45 RRPSPU G\$skh质SjPkA P胶VkDQj!h%V詉 V`hg%L$5 RPRUQq h:$5 RP%PUSF hPSD$Ph%%hhQ 1҃9QDQA \߉$4ŧPWh@$j$W hWhQ` Nw@EƆDQ Ft3N$t.1@ƄDQ-H9s Nr,DQ$EBL$ ;QUQVh7%W ` VhDQW_ h6%İ^_[]USWVX] E81hcp#PPPPh<%PP 9_ vSL$QSWPL t@D$ tWD$8uN Quh芦 QD$9H*hcp#Vh @$Epk+D$8u RPt QPVW҃ R1VSt$t$ڢD$$VSt$t$L$8QRPt$ t$h<%Ep7kD$V9p1h$YQVu WPTtY$UtOwGD$VPz)vVQj P胯 W@ )Q$YQP] H LCF;puD$VPh$Epj e^_[]USWVLt$`T$d\$1*kvs0C41GPjhq3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SPe4ōt$ VP5tUISbg~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5Qg|$.QL$`ʉAfAD$ 1Ƀx fJ1O Sf1L^_[]USWVpU t$01^F4jj_1AǾ'D$ǃ@4'SPHD$ $RL1OًP|T$|$`1 |$0jP4D$DD$  R|$ 9ϋ$|$1HPPVt$t$WRQjD$ SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQN D$\$1hSSVVjjp ;tUSP@u54$1hSSVVjjpϟ |$u^WVD$ t$tL$ HPQ0vtpvhhPh$V\[ ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV h%1jx$%xtD$PV5H$%KtD$PW1yoh%jhPW6M D$PWX1u!h+%:PWh%j蛼1EWh5%j= hWh%W處$hPSL D$PSu"h?%WcPSh%j%1EhH%裕hPWoL Whv%j 0l$ShH%hR%jջt D$%PV$SPWL h^%V轔%1PWQU}h%V蜔SPWK hj%V胔PW%PUE%PVcPh}%U' ahg%V>Ph}%j ;h%zhPWFK h%VPWh%j辺h%7hPWK h%V蹓1BP$h%V蚓Ph}%j] h%֓hPWJ h%VXƻ$r3Wh%hUl 1tVUh%juŃ|$tjh+$$Ą ^_[]USWV ։Q> 1Ht L$ L$$WF $f} r= jh%Ul u&USh%D$P uh#"7 WYF Ņu>L$4t&t u$Ut$ t$ h%jոt$ TW $ ^_[]USWVՉfD$/D$jhs%D$5萑t&臑8t}SPh%hU轵 VSUH 991j/U t5ÍD$9tK9vH8/t@PM CߍD$ PW}D$%= h$PW FƄ$/u&蜐$QPh%v%hUմ /h$PUG hhs%UG e=@uWL x*|$VW$PnG 9r>?0|$W Wbڜ01Ĉ^_[]hUN t}/u }$$tcD$U襌W蚌Ɓ`|$tVh.%UoG 9=VWUWG 9%|$W x(W7>1F1S0jh* j SWVύD$ PQ1xVD$)tOjW#x@ljj PW W u $=rɁ uƉĜ^_[USWV hrljPhW@jx} \$hjSK jh%|D$ƍD$ PhW@V+} t$1hUS ,$\'tWP脌u-QD$C E,$ !u1L$PPPPhLjPPjjj!Qhdj4t$t%jt$VW*\W>k6V ^_[]VD$@t(L$ 4@T'VhW14| FQ1@^ËD$ QfH͌ QtPPQQQhā%j蛳USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj *[>D$48T$y:D$ػ˺z$L$~D$<P t3cp#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$cp#t$DRQPh1%jV贮 D$ T$Bj5 RQP.cp#t%t$DQRPh1%jVp D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5 Rt$h%v%jt$hVD$XP1WWjjj0w, R|$4D$0RL$QW<W,D$DPV?{ljӍD$DPVC|$߉څu D$$H؋Pٸ"D$<hfm%t$|$,] {t+[1h.%Sևt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#蒇Pt$h%v%jt$hVD$XP1PPjjj0,j D$DPV4 D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW赱 )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5 RPQ/|$ RPhA$jWG ; RCVSjP jPPhQ= VG(^_[WVt$ 5T[5TU'~$uFjP@F$1O~(1hQQQhhshRjFj WjPv$hQ?b4F(x;F,VPTv(%cv$tlIut5t.j+茂j,耂L$PVhp%jPQ蔧 'u tEj,j+QL$jPPQk: h<1#j**L$QjP83 h6%Ԃj-t$R5 RPh$jFV j.ށh'PVh8%hhQ İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5 RRQ~L$RPhS$jQq G<(\(|(Pu#]j#!L$>PSWht%j&Q%j5 RSW}L$t$>QRPh1%j&V $F|(,u)|$hgPhW%j(Wڥ <$1e<(Ou*?D(Ltۍt$hzPWhT%t$t(Tt(PPWh$j(Vu 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhc%vREt 4$B|$|$upd^_[]1؍L$>PWhM%j&Qܤ  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&hHt$PWhT%j(V\ 4$h"VjP lj|$D(dph~PVh\%j(W *USWVR$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPváRH1WjHDWWQZơR$1$ R@u <@TX uDHXT= RtLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W Wcp#WRPPQ1ҍD$*W Qcp#QRhQPD$$W Qcp#Q1Qh0QPY&)ߋR0|D$pr|L$$QL$.QL$QPt$SPW, R09|Njp*|L$$QL$.QL$QPWSSj'&- h6%0{|$p{G$DŽ$$T$0<$tT$@BfBB-"ffJ B ;"BfJBI"B fJ*B,W"=\!Rr~(uB0fB:BxT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5RN t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u! L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh.%D$ PGot5hfm%t$ 2ou$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0 R)ދ R\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ː L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(* L$)։t$ t$A5dR 1Fh%h%h]hr%kL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4ZS tt<1^_[USWVGD$5`Rl|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1h!R9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX&AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh$I349tBƍ|$WP%V24x#9}Qk<4LE1UЍe^_[]USWV1h!RT$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=Rt*=-R11M<t9\@u 9DDMHEr=RtO-RD$PP1ipt$1t9 :ut$P9t:,@uލEpr=(RX-RJ<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@-RD WVu)y8u.q$t"y8uqxu Hu^hT#h5%hm hޅ%RD$x8u@hT#h5%hm hޅ%RV R; RtD`Rt99t‹9u€`R2t `R^WV΋$tRttyu)`R9tЋ9u`R0u1H|$5`R,1C1҉T TTCD Srk<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D Sr$k%V =(R^@111 $D$iX-RP@X-R 081tsuL089\04t$1Ɉ$$|$ |8tkPh%jPIY X-RPhˈ%h/Y Ph%$U5 X-RQPU X-R8NuL$L(ɍ$~,Qh%h|$%W(V hWV X-RL$L,ɋ|$ ~,Qh%hl$%UU hUV X-RL$L0~,Qh%hl$%UU hUVe X-Rl$$QPVh%hXl1X-RD$ $ 88Ƅ$48ntyPh%Ut$%VU PV$ P X-R$d8ntyPh %Ut$%VT PV$ Pr X-R$08/"tx0#Phv%Ut$%VT PV$ P+ X-R$t8ntyPh'%Ut$%V;T PV$ P 5X-R$,8U,t4UhXe%ht$%VS hV$ P 5X-R$,88Ux,t4Uhx%ht$%VS hV$ PF 5X-R $X8l$~4Ph.%hUWS hU$ P L$ 5X-R\8~~Ph:%ht$%VS hV$ P L$ 5X-R`8~8PhA%ht$%VR hV$ Pu L$ 5X-Rh8~8PhH%ht$%VR hV$ P/ L$ 5X-Rl8$~pPhO%ht$%V8R hVU L$ 5X-Rp8~1PhV%ht$%VQ hVU L$ 5X-R7 878h]%ht$)VQ hVUj X-Rt$PUhg%hTD$X-Rts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=,R@D$1HD$$D$1i8-R$P5`R\$ "$x 1ۋWSPQL $($0}U$W^ W(|8/tW(fDŽ/-R $< R(P$PW) t $L|$$t0|$t)$Pl(t$^(9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4=-R,$V' PVh%hD$)PN 5-R.cp#tw0#PSi] >tiD$Pt>Shމ%hJQ$\$ -R$DL$4L$0-R0|]t$VPh}%WP -R( ( PQVhz%WPt$\$ CCa5-R.> >,>(>$> D$)Pt>Sh%h8P$$(t$,t$(r lQt PQ1`lQtWWh%C)`Whk%h3)Q lQt8Whk%PQ lQ1Ntjh%PP ^_[]1N=0Rtt$hʅ%jPYO SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ RV;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$}8$ytPmptYWtDžtFE tWPV u WVOjVSq E t VPV|1HPPS| ƃxQ0^_[]hT#h5%hm hޅ%T-USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tI%Ǹsu8j5 R L$RPhA$jQ? 5 Qh?oh@1PPWVhu%U4du31P_L$Ph$jQt> 5 QhAt)u D$ hep#jP3> 5 QhBt)u D$$hep#jP= 5 QhCzt)u D$(hep#jP= 5 QhD<t)u D$,hep#jPv= 5 QhE4L$QPVhu%Wy ^_[]USWV$@1K $ $0'_ 1hSSVVjjhF4!  /t$l$ WSU UhZa%WS< S|/D1l1_R, 1GWV<VH /11 11$H t1$I$J1$J( 1tiu`$K,\$ D$4hep#US[; 1USSVVjjt$ S[ xL$1^_[]WV|$ 1uOG Pt/1; }O"hx-Rx 71^_WVt$ F1hWPw dž dž dž$dž(dž,P40^_USWV$h^t$hPV $$$X'D$@{tUh:%V USV} 8Ouڋ$xhUuhViSPhw%V}C(~Phep#hVk9 }hWHC,~Phep#hVF9 }hX#C0~Ph%hV!9 }hYVPhw%W1^_[]USWV$Tr3u*11IhuPPPPjj PQQjh4r3Pg4Tr3Nw'$[($l'WP 1N1jWWVVjjhZ l\, ]0D$4hep#QP*8 1PD$PPVVjjUN D$P x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP  Qkd)Qh%V@ ^_USWV$h^|$hPW $$$'{h_} VPhw%{h`^vvPh%W[ha41~,t[hb1~0W[hcǃ4Vuh^V0FT~Ph\#hW5 shd[hg1~`{he~vXPh%WF\~Ph%hW~5 shfmFd~Phep#hWY5 shhHFh~Phep#hW45 shi#Fl~Ph\#hW5 shjWPhw%V/[hk1~pPPWhw%S^_[]USWV$@1N R$oT$' 1jWWVVjjhl|Gl=OlR,1۹mWS<S1,G,10G041jWWVVjjhn! 1`G`pX"q\rd shD$4hep#QP3 1PD$PPVVjjU D$Pw x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@Zp褣Qkd)Qh%V`< ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hq%hZ%hh%$ SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FT'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$4Quh4Qs1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$ '@21^_[Ã!t*Wp1@<QWPV. rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZVquE0],ۋ|$ut-us8s4s0s,h%jHuhj|$ W S,Ws0aD$H3C0L$D3K, KD$P3C8L$L3K4 5CL$QPX) ;D$t" VPs0s,hU%j={@D$XPW tVWs0s,ho%j {E4tL$Ph%Q" D$D$uPh%j?t1ۉ؁^_[]E@USWVt$ $= R$Wh5%jP 1t t^_[]Ë 0Q! ÍD$XWhG%Pj1~jDjtD$$<1#Vt$\vVjvD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h/#W ƀ8tt1tCuVL$ D$ j jV{ É$qj jV{ t#D$Zj jV|{ D$T$C\$ \$D$|$u\$uthh:%S2 hVS# \$E61ۉSt$,j SV { É$ tbD$ ʉ $tQD$ D$tGjh4A$t$}Vz tOjhBA$Vpz tdjh%A$V\z te|$ush<1#jtD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Uy hjL$tJ@j`PQT$ T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\PC T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv W߅uv^_[h}%ht%hh% D$ph%jy iSWV=$Q5,Qt^s蕭3苭tD#$t$j(PV{ 4$I_u9hs.|$0VPh$jxWB WVV &t Ĩ^_hA.&hC%hh%' USWVσ=$Qu h 1t0?t+$Qt!-,QE WPF tt/|$thh%SA !hvS, u4$$$$$St$h%j ^_[]SWVD$Qt$Rh%Pjh<1#t$e$jh'P uWh<1#je$tAt$h/#W/ 8tjt$2h<1#jye$ut$O1ۉ؃^_[USWVӉ΋|$|$tBhڌ%S h%S h%S h%S h%Sp h%SZ h%SD \$h#S* ǀ?t()$h'WP uE F@j`WV -j(W tj)P t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|huPl$ 3hep#WU WUUjeUK H>wѻPD$x0hep#SUj SUUj-UtK H=wˉRDD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á8Qtr.8QVt$ 8Qu X. 8Q19vFt=NH.Rwu1w.RZR^ËD$Hs-s <'.hT#h%hhG% Vt$ =8Qu-(t;u2L$ rȃs\'$tuPR1 ZRmR^WVP|$t$=8QuJ-j PVc =v1t-h t  .Rt4.R^_Ë $9u։^_-=GRtGRù^-D$1ËL$T$t$ h6.WV D$$s1!t$ T$L$7GWh1. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh--WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh^A-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vhp,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phg,D$PhUI,1\$}UM;t;Gs} Shh%q} ~Sh݈%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh%h$P $L1QhPjV趑x`WhydPA D$VdJ|$t;jWS1 \$;MU}h%h%h hG% 1e^_[]RSQ Shf%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSڿ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H.R)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVf )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU @$\Cǃ1:k0hWV D$4WhPW$XuwD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(3tÉ|$Uk#D$0jPUQt$(31 Ⱦu#\$,hPt$ N W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,Ph P蠟D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhj@rtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x P+tn{ C K$;}sL$4QjSPL t_D$HtW.R)1ɉAw Puu2S"j@jP fdžUSw1ۉ؁4^_[]h!%h%hhG% USWV4D$L D$PhjpƋl$X\$T|$H$'We F|11Kn^؃N$F Fdž?džjh>USȰ @džPWWtt%D$ D$D$D$F114^_[]h!%hI%hhG%׺ USWVhED$$11@D$"$C,t P$0t 14nGuVn1dnFusnSn^_[]h}%hX%hk hG%訲 USWV$C,t PjhPjsht3ƋkjUNgtUPV WmV8!S(^_[]SWVx$'<.RVhH&j S [Ћ('Cԉ0CC |$ t&1ɀ8>@,19QvPW9] D$vP6] 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h1%h%hxhG%豣 USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]USWV0$H$D715 rR5rR5rRD$D$ D$1D$ha%WU4J pu UrRe~ft$lt*zD$ƒbtCeubD$벡 UD$ ChjVV5 Uhl%, rRrRzVhVV5 Uh$,D$Vu= 39}4D$$D$l$ t%1PPU D$yUh$IL$ tHt$(Uhw%V] hx0#6nuRh%fD$0Pt$/ #D$8=$$ rRrRjÍt$0ShV u UPV UjD$0  rRrRSy h%t$(g\1|$PVy hő%A y hϑ%vuWjt$>V1St$/V4$Dt$8%Sh#PPC>t1hݑ%t$t$U4$t$5rR5rR rRd3|$t3$rRr3tʆ3=l$u1HL$(Qhht@Pb PtL$* (rRt$Juh%lʼnPUyhK%T@ D$ yh%@$uBL$$4jPU4$t$ V6q6h%j>P hkj 苢 j|$WUt$  x>tq1.SPt$ $  y 19u2rRrR)u 8t1FVh)%1FVSh7%V%>t$< D$D$L$D$ L$ D$|$tvD$ P5ƋT$ уƉǃtωÁtt؉D$ u K 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj 6 U6YL$ɋD$tPֳ Vp P hcp#PVhW%h3 j襳 V jVנ jRG VPN ^Ð=Xr3u ZXr3$rR@=u1HP1;Xr3USWV}uCjh@rRN @rRPrRDrRTrRHrRXrR0rR 4rR pr r11ݜ$D$8d|$<) 4|'RSt$Dh'$QP荵  rRrRȃ||=rRrR݄$|=s4;T$D$r(|$$\$ ؍4)hI$؍4)h<$QP ƃ}u 4)h<1#QPӴ ơ$rR@=u1H$VQPL e^_[]+0rR 4rRT$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppu%hƒ%W 8t 8#u$SjV}j tGtV $1E48FB$)Ex t$7@[hƒ%h%,芖 hƒ%h%s 7hƒ%hג%FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh jPGuh%h%\VÉhPKt4VhjP5Guh%h%V1H^_[USWVp $$$!19L$PVW1Hl$U ƃU VD$PWl tb$UtM$Tt訥 $TPUh t$jWg tu)$j4'WUm 1Hp^_[]Ë$j-UP> D$L$PjD$L$PjSVt$ t P닆t>PvG1džW1ۃ1ۋt9P+Gdž t^[V: VN 1u 19^SWVlT$|$$VPC1Nt/ǍD$P PSW% t W3l^_[USWVӉjh0jU ǃt{jjjV轎 L$ FG#tcp#{G#tŃ=%cp#cp#t 5%؉cp#ts%|$ucp#SQRPhE%jhVo ^_[]USWV$=~ 71Ha~B11ۋ$4V <(Gs@ ,PVQ e C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)5 jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$P'd ^GNON1wOWhPw cBvEVE1H^_[SWV$uShb%h %&Q $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8 贏 89h%hv%hPNF G8~ ~u3FVhjv ;Auh%h%Pt6hWv p t%uh%OPWVu  s V^_[WVp׉$ftPh%%h %O jL$PQWP jjP PjW tnjjW t\PjWz tHD$|PWV t2Phjp @u6h%%h%N"h%%NWw h%%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jW{;jWp;5^_WVPt$4%@5@u^t8tW%V$%8Vhj%B#45@ubV,>jjP,/ u hړ%K,dž,shÓ%[KjB3 t1t3u5$0$ $1Ph-%J $ $1PWh)%J^_WVt$ hD#OK8r4@84^_6t8t uh%W蟲j;A^_WVD$  uzuq0x t-@ h%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uh%ID$n D$SPU6Yt,Ǎۉ,$t1j@SPA3 SUh%JI SUh%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pv w_ǍCWt$PY ;)QjP节 hG%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQhŚ%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYh%Q{~PtVFDtt NLtL{#tC%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h%@jjAVB u h%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC Ph %>G$C$G>C>>l$ tك**PWQQ IWtsDtZƃx t@ Wh%A>Wh%k>1Bj FNt*HN+}  h %t>1KtJV @1}} 1KGOWtQWVl$ GT$tIO9tA tBSh6%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhhp] t$hY%hJ%<$1Phm%<1F\$ MbihS$( EuVh%o<u{ 87t { 8 uF띃tVh%@<D$$ \XPWoB5Ƌt8t* SVAuSj$(= ҋ>$ 1GOtHONG PtFA (uUGGtIO9tA tBG|tOxD@UUP# ;(WQjj0>[V/t?t$VtS? t@VS@ hY%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/y 7 Vhĕ%h5#B:T$1|$`F(f9t(~ tωӍV QPRhؕ%9ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$IP\$Sh%:9 <PUt$W"PSh%%9T$ V>t*4$QVK H^_[]USWV(|$H\$@?hB%W;j )hS%W%j t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkb 3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtUf t|$>@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp  D$e tEl$9u9l$ D$ D$L$$ tT$T$tt3uI,Vh%T31Bj$!#L$T$1Bt$sD$L$$L$ D$ @UӋ|$<1Ҁ|$ ‰SVU ,T$9|$<4tt8tPT$BT$9|USWV֋l$8 苑4 48tt84G@81ty1C td 鋐 tG Ph%1jOI9u$1^_[]SWV׉΋\$tu)(%t1PVZVnjVSu0%tX#PV^_[Vy t\΋t V5t>VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4S]a tE9uD$ 9t9~ ux<$hB%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uh7%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/Xh%S` hB%S_ l$$hWU/j jDž0%\r31K$ 8@DjW9u1,1@PP|u1Ajjc uD$$l$ D$D$ $\%t%UhP'P$VF?u$\uYM'4tQ6uD$럍Hv H w?$' U$Tw$'D$ %D$[D$PxGD$ %D$2 $\ $$$$`"!5 U $`D$ %D$D$ %1@D$x ˀFD$9 3t$ZSX-$`q-$$h$d 3)$|$t$$V|1UUUV;Å$U$SjVFދ$h%j D$9 3Vt$(VC 31UU4V^;/$$Pjl$4UAF@h% 1h%$\u($\uh%辴 $XL$9 3%ދ$HSY 6G#|$tcp#{G#|$l$$ths%QSh %j+U $\$h'h%, ha% 1cp#PPPh %j+l$8U蜀  $X$\$X 3|$tD$$9tD$tnU荳 C$X$\ڃt@  u% 艌$\$X@l$$$h.%uh2"h#%0)k"$jj te Uh=Gjh'$o!$!|$tYU7Hr?Pt$hm%S( |$WVmg 8$Uǡ $X$\$X$\ 3T$QR$4A $$Xh2"h0%l$$4D$t<t.<unhP%褱 D@U uDh2%| LHU[T h?%Z TPU5{ $Kf (Sh"N' h2"h?% h2"hW%,'$l$$$Zu UMuh2"h%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t P}U $$Uw$U(UH$;\r3t P$\P@1uh%%$\t3$Pt'jjQP] uh2"h %%$H'$`hd3v6 $$\$S ^_[]Ë$r,u' 3Qj$4J $u*$X1PQQ$ $$[@u h%$$VU hǗ%&$$X0 $\$X$\Uh=Njj$t'UhaNj$$[h2"h%h2"hϗ%Vh%#U UhIj2j$rh#b 8th2"h%#$Xb L${oZb 8 L$X$\$\l$$hh% u!gb 8th%h2"h*%# hh8% u!/b 8th8%h2"h*%" UtUh2"hH%Uh%^"1$Xr;$\@ щ$X$\U=tePh2"h%b"KD$Pjh0j1@@ B|h0#%UPh]%1" 贪$X$\҃ ׁ u$X$\r>1r 3$L$QPU $X$\ %r 3$cp#cp#t% t%WQRhU-&NUY#0t$$1:D$OhPVu h4%!VhJj$$uh2"h% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x uh%P%$4P; C$$|$9|-h&&D$L$$PP)  ƅUQh%評$\D$L$$PQ6l$$UhIj$\$puh2"h%I$$h2"h%h%&h2"h!%h2"h@%h2"h%l$$t׃z Ruh$\h%PHD$$P$Zh% tRj$tKl$$UhIj$\$9t3'$\h2"h%h2"h%h2"h%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$RQ Ph%V$X8uDu4$\@hԙ%PED$$Pl$$+ɍl$$t#%@tD$$PhQj$t$D$(P4$01ۅ~ tVhv"jj$vPY WVjhc%t*VPy uVhN%W}hc%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQ u!hV%h %S j^_[]Ã~+ajjji ˃ph%h%hg% 1m>h%h%hg%W <Phϛ%>h~%h%hg% 111dh{%h%hg% @+X1BWDP h~%hw%hg% 11G18 4 ى48rPyWeh%h%hg%L t0LvPhכ%-Vt$VںtVh{IjdjQ^jQ^Vt$V蟺tQPh % 1@1Pd^WVPt$D$uPhn%h % jP,8 tuIhn%h8uM,z ,5dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS# F>)^_[USWV$lt pvhM%PW; t=wM$lDP 8thM%h$h$u)h{%hM%hha% $$l~>1ɀhL QSP ƍl$hUPt$ U? =wfD @PUhhM%Wudh{%h%htI{>tA,$fEC(ffEEK*S>RQPT" C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht hΡ%8~>t$fF(ffCCN*V>RQP! F>4)mC Ph%$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0M 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@kNt3yu%ytzy~ ~yNхuFiPv`v\1PPvX讫D$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR u$hv3Wh$t$ hv30> (1ND^_[]á`v3ËD$`v3@PW av3F SVt$  hjh`r3h3`v3 s1fà =< jSP  t= V1H1@^[ fVt$tYVV8VgV1jVB VzQ6v|`^W^SVt$ V葆1Kt=jhj7 t!jhj 1ۃۉ^[ Vt$t'PYdžtPdž^D$t$t$t$ SWV$hjWe8 C jPWv WhiP 1NtF$$T$ !fD$f9t hWhi  t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv \; 7 O; V1H11Ʌt|y $BD<IG9uލ|$$ ^ F>L$jPWV uF>*PWV" 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0ے VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV%5 Fjŋ$@V1 $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP* tًv\$~;1$D$0Pt) tF9u19D$$"$8ЃD$P1~11TjT$4R4[ t GP9|PX~11\jT$4R4  t FX9|XD$ 9D$H$~11LjT$4R4˿ t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVh6%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV CG$C D$ jt$ VUd C yQPD$|PG D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0' R`~/1djT$4R4̽ F;`|ӰD$|$0WQt$\yWhb% $_w ɺ@r <t5<(<$L$ 1@ut$hb%$1@fG(FG>O*VTPRQ $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh%oW$7t)|$ jVW+ w_ jVS r2 1N^_[]j:S t/@1UQhQQj QP? G8mt]2 (G8GjSP O t 3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS- F jPS WSh~i tD$Đ^_[USWVP肖!D drR `rR `rRdrRh%FdrR `rR $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD hm%j,jHt ǃL hm%j,jgPt ǃT hm%t$$WhȨ'V D$9rhm%hy%[H$|$ 7D$PWݒD$t$h/#D$P:K ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$S  J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0hm%h5# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h/#D$P4I ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U hڢ%U h#U $D1)h%Ua 1Ʌ<$t$V{ H9t- t u!H\Ht$9u1@$D$$<jPS豱 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSo $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$ `Dd<t A`Nhm%<$Dt&u"t$ $<' 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U ' tu;uHUh%$'D$uuUh#t$$t$$P,'t$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$( 3|$$t)`#L$# $ 1CƋl$ \$18%s%ShP'Pt$%hK%P|$Xt$1VWhWWWWt$t3 L$PA 9>t$Xh%j|$XYt$1VWjWWWWt$t L$P9>t$Xh%%|$Xt$1VWjWWWWt$ṭ L$P9>ut$Xh>%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPh fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$t辠 L$P9>gt$Xhq%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\W  j,D$Pt$X=hv%V hh%V Nhރ$V Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh#W( t$P^h%S&W -hl%W hq%W Why%D$PD$PzD$Xt$P jP#h`%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\W( Ê@tC< t< u CCu1j h%W j h%W 0jhħ%W ojh%Wl ejh%WT Mjhڧ%W< 5jhק%W$ jh %W Kjh%W jh %W j h4%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjPI 'L$ r L$rL$ T$t$XV%1I $j/V uD$|$P jP L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;\r3t P 11j|$\WtdƉD$"V[ jWt>thc%VJ  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb hѢ%b|$XD$Pn<a't$Xe <PD$P/|$Xh#|$\WG  t$1VWjWWWWP6 L$P9>t$Xhu%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/Pd 1|$Pt@j/PN tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 h%|$Xmj,|$\W 9ƀx-9l$Ps%ƅ |$1WShSjSSt$t ,9h %{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP   L$ j / % < t< nGG|$X{t$P$t$X $ h>%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU  8ut$Xhw%t$Xh%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vh%pD$PR |$XG D$P2 D$P" |$X6t$PhҨ%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV2 9+aVh`%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t- L$P9>t$XhX%D|$Xt7t$1VWjWWWWt$t L$P9>t$Xh%Rh% %Pb|$Xhʨ%T Ct$XhM%W à \$S ƅ|$PPhZ%SV$  j Vflj/t$\z G1|$P# 1 t NOGN|$XC1j:W t4A|$1WVhVVVVQU 97Xh% j=W FD$, hq% @1 t  H@Wh%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQ HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh%ZT$P   Vh %)D$,h>% h %aƆ }h% D$Pǀ`h0%f 1H$Ta Vh%rN D1DDD DD.u hX%  12D$,1h=$W>h%W(1h%W(hB$Wh:"Wh%Whd%Wh%Wh{#W7 h%Wvb h#W`X l$ho%|$WBX h9%|$W(l$ h@%W f hF%t$W hN%t$k hU%t$ h]%t$ h"t$ h%t$s h%t$Z h%t$A hy%t$( h%t$t h2%t$b h*%t$P h%t$> h%t$, h%#t$ t$h%t  t KC  t KCWh%Ɔ  gt$Pq1pƅhih %ottC< t< Cuh%GDžh>%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉he%W t-h_%W th\Y%W t hH%W t@Ch&Vj thN%VX D$P@ tsFH t t@@1 t  H@ttC< t< Cuhө%ƅhh%sF< < F1$SUjS tUhb%t1C CC"$f8l$1USjxSjSSW= $D9]$ƃWhA%- # t KCƆ L$P1SnF D$ PV G   7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hE9#1E1؄t  H@h%%1H$$<^_[]ËD$PǀǍ0PVjeP Zh3%F -{L< < Ch%11_Ho@@V ыD$ * * h>%2 C]{/< t< tCCB؄t  H@h% yt$1VWjWjDWWS覀 L$P9>OSh%%L$ 1SK 1I $%谺S1C݉CL$TrT$`t$\_s.NE*>ԉljUSWVL$D$ T$114Ér GE9u1D$P$tj~>$ 1W4L$ Qg 9s: $T$э A@)E9uы,$t&hݥ%h7%h h%F 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P蝏 T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vE 71M^_[]USWVՉϋRڙ j=Pe ,$|$D$ V 1ۉ\$t?t9D$ 1j=S# )9uWVS D$\EuVͪ4$I t5ƍEjPt$  4DL$h«%Uh«%hΫ% |$$t#4$ט tzSAD$h% D$tHTNPRgh<%hǬ%hh%j WVt$ t)1WWVְ tL$@Tt8QVW ^_Vt$t$Ƙ^h%h%hdh% SWV1SSQm t&WV}W荢SSVI Džu^_[WV|$ t^ǘ1PPW" tPW2h蹑ƅthjV- ^_h%觭1h%h%huh%; D$t L$tHTh<%h%hhR%h%hh% Vt$t61tpT^hR%h%hh% WVt$D$ L$zVP~9tV 1^_ËD$HTt1Pt$ h%h%hh%H USWV\$tF+1PPU諮 t.jVU虮 9^TuVU訫VWu^_[]SWV D$4toHTty9|$0uPLjPW>t<Ƌ\$8PWJSh%j Ww VNV ^_[h<%hϬ%h h%hϬ%hh٬%hϬ%hh%9 USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t Etu D$tBHttu#xðÃxux uxux} /1h%h%j}h% D$t>Ht4t uxjhp'P] ! /1h%h%hh% D$tEHt;tu&xÃxu x uxux /1h%h%hh% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^> Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=hrRuD1FFFF FFGFhrRSVrVW_uPhrRމ^_[]Åt 1u19[:Rt1h%h+%hh% h7%h+%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=hrRu+hrRW9u!hrRs /1N^_[]h]%hO%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQY ^_[h%h%hh%h%hh%* USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQ2 ^_[CPh$WV' 1t߉h&hw%h{h%hw%h|h% D$tL$tf Hh%h%hh%&h%hh% VD$t&L$ t/fqPp QPI H^h%h%hh%&h%hh%o fV$'Ph% u^USWVD$t$V`1Ij0Vy1|$/ooo WV5't-1C 'I?r \   DE9u֋-'t/11C 'I?r #   DF9uWt$V  1ɉt$\T$\RVQ2PVt 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP) tbL$1tHh0%h %hM8| /IG?uWG9rD$^_[]h%h %hhȯ% USWVl$t$|$t1ۅu>t7NLC%t\&L{#tÉS1ۃ1Ct:tVtXtShD%t؉8txt@HtPt؉CjVat.Vt!thL%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t 1NA~0jhY%W uWC" W G9rhd3F ^_[USWV |$ 7u ;l$$Ujho%UQ \$C UPWht%;S$t^DžtnjSW  8th%h#z9h^%k1HzSlt$h%h5#? tG11CGt0WD ؃uh^%h%?Ņu1 ^_[]Ë$t|$u%tPWh %h% =mQPWh %h%論KUSWV֊B D$L$$t WT *QPyNjD$$4$7@uMh%#蝉Ȱ%tQh%W Ry Ph%Wb |$t$h%W= $D$ D$h%$U t$hD%U|  U |(6hL%UR 1,h%S8 hL{#S" 'hC%S hw%U h\&U h%U h%U 1ED$D$AtG~DtAD$D$D$D$D$D$sjSȉD$4D$, ED$D$KD$D$D$D$$1D$D$D$1D$|$t<$ Ph%W u4'h%W W$7$@|$L$ uPD$@tEL$qPt$hT%WAT%D$ |$t4$hT%W詰 |$tJ$t=8t44$t%D$pHpDt$hT%Wj|$t4$WND$ t7t1Ph$W D$ 0uW W輭ǀ|$WD$(P D$ T#tϱ%Ph%W; $HL%tE$K&tRh/%W Y$pHh<%W <$@PPhH%W $p$hV%W 4$覞Pha%W ${Pt;CQt$(stPhhV tVhj%WC t$Pht%W tt$7@#ǀ\$(h@'S{$t0ti~ tVt"PSo9uvhԱ%!hԱ%1OĨ^_[]1D$D$h%Ws t1VVS t]VVS 9th:%h$W9 {ET Ph$W ]jUS覑 ŅuVSWV .h%$VN (h%V8 h%V" hL{#V hX#V h\&$ڿ hC%$辿 hw%$袿 ϱ%tt|$"D$<u D$xuZ|$t4$euD|$"D$<u D$xDu*|$tjt$uϱ%T#(T#T#D$ T#T#tϱ%Uh%W_ Vh%WG 4$?%tPh%W u$0?%t@ $ t1tV>%u vuPh%W #V@th±%W|$"D$<uPD$@tEL$q Pt$hf%W;f%D$ W|$"D$<PD$@LAL$qPPt$hf%WXUSWVl$t2E1Ft/׉˃PWh%StEu11N^_[]fUSWV\$l$|$ttUPWu 1tk<.tgh#W tUh$W tCj h&%W t/tj.W= tUWo 1t^_[]D=|Vt$ 'Bءl3H l3;|3hd3j d3H d3 Fut$l3H l3;|3hd3j d3H d3 Fsh1% Fsh)% FshB$ F sh9" F8%?%E%M%T% \%@uwxn%rh"r]n%rR% rGx%r<%r1%r&fz#r%rc%Q F sh% F sh% Fth<$ Fsh%j Fs h%T l3H l3~d3H d3 hd3j hd3 ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVhL%h#%h%US 1N@t+9w');@MQP'At9w :)߉hL%h#%h%US ^_[]USWVD$<Pj t$ $h#V ]NjD$@HD$?1jh%W ujh%W u|$D$4Njt$0tNF tA.t;\$SP耸 D$P1U1HPUUUUSoH 9l$u9t[,OuD$,Njt$(\$Sv + t-D$P1U1HPUUUUSH 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#V Dž4$z14$z 1H^_[]4$zo USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ3 t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$K V > "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DHJ \\$ $2f\\ $$x$T$$x$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1 T$$t4<$t s%|$$u1F 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl 1 ^_[]ÿ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Vi 18U 1H(D$ ʲ%t%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS C@G jPS^ fC $4CCD V$4PЇ UShip視 C O*W>RQP虇 UShipo  1N^_[]WVPRQ ~u~uF $uG*SVP3 tu@ 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$Ü V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS薘 |$jjJ`Ƌ$(@h@hߴ%ljFuJ1ۍl$Sh%j UY h@UkFuCڛ 8tǍ\$($PhqB@W~ f<$f|$ jUSE ShlBW} txD$PhpBW} tZ$$VЃuBD$PhfB@vw} t(D$FP?F u+ h%[Ft PiVP1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ m FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP| ^USWV L$@T$ 1H^_[]Ël$ |$ $9;l$ tWj Z L$tu!s^+9ED$tSUD$ P(j ݋D$1P蕐VPh%W aunPhu%W߱ $P3Wj賾 1Ƀ HJ "USWV$ vS$$AKtGu4|$QPhW"1Nt8Wh$S, u!"ѕ 1t轕 1F^_[]0耏Ph$V 1Ntҿ9tB$Uj 辽 t$487Ph$U訰 u$j} HVPL$ uEt9BSu3 PVjp] t<$uffDw D1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  tcp#3EoD$T$Pht$  D%L$T$ s 1K41ۉL$$$ s09t$@OōGD$ t=VPǍD$Pg 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PUEL$QP谶8L$QP蝶Ut$@!t1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ VhH%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PˉPVh%S'1I/ދ$0$4Wj$@U t|$r $,84$HP\P$0Vh-%W说SyGPVh?%W芴$0$4|$WjU $,t|$w1Ћ $ QшPVhQ%$4'$4#]S蟈PVhi%$4T$ }ltE$u?ClhPhhWzWVh~%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhVt$$@$@$L0 >}k|$`$0PJDL$L$QWhPt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VQ] t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$螉  葉 V1(^_[]ËL$DtD$L$tPVQ\ D$ƅuF SWVD$ L$tT$$w! .11t$|$X+9s "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`F`^SWVjh0jJK 1NǍ\$PSPhWhtrjSjjWht]jSh@hWhtBD$$1ɉ $L$ L$L$D$fD$DtD$jPW^ t W^_[USWVt$+VjU=Chu,$t#tVhPjJ=^  rZ%s%PSh˵%薀PSh%G 1Bh4 ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVhl%F ^_ËD$$PL$1Bh4: SWVt$tgw]VhKja<^ w$wPSh%E GLhI ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGH5%_0wF SPhX%?E _0G89+\$8D$<l$8 \&|$ D$ fD$l$|$Xl$ D$XG8N PQhx%D w$}w(3<PSVh%pDG0GH % w$}PVh%@D G0GH.%c1HG8G4 w$~}PVh=%D 8\$0D$4l$0 \&|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( (&|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ (&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pc|w0PVh%B w$D|w0PVh%Bt$6u$HujGtGht:?%tP#%I%GHPu萪j19c@O;Au<t %?u%GH0ts]ShKw4Q 8Shi#w8P7Sh#w0P7C w8w4Ph)%A 1HG8G4]@uPD$u>C wiVPhW%]A wwhV3uVhm%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;thÓ%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh%7x SWVt$^ Sh%L?G0+G8PShٹ%> VhIj%51Gh0%WFiP7 Wh%>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3Vh.JjP"/uh1%h%=^_[]h1%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(h0%h$%h h%u PPV&5 tSE EdP $PEt]U$uu h&]CF Ph%c<6u%EHPVQ Vh%< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$h&VD$tF9tAtIdtI;u D$ th0%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V><ij'C'C'n w$sPUh;%: y1WVVWU0Vh'6SU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLih> D$ɀwȈGGV*QRPhJ T$  |$t t?t`t[\$XSjxhD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$Pb PL$|$)9 OGPSQ,E ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSP"C \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Php%/t$=$]tVSt$Dj`%e^_[]Á G AQSP"B ǃL$G)ˁ+),PjWj ,1OD$0@hX|$ 1|$CD$PjwǃSt$PA G D$G D$ GGDCff_f_1ۉT$SfGEh fGG@D$ffGScf f_ t$WhD$wK*PQt$ u)C Pt$h%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Pxdžx|tPdž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5T&D$\$$͸%&Wh<Vj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GH%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWhrYjPh%h%$sY EX>@P UB( A J*R>RQP6  ]rts4 t*Mq @T$hRQPPV]h;%2C>t2Mq M*T$hRPQPV]hQ%O# PjT1wLw !w wL$u]rruG XixiF SPh|%" D$h$PS61Rh%*#@uB3EpCP t: @ NH M plYh%"u Vh%"he%"3=u1HL$h$QP t=w:F h%Ph%c" wqa 1Ƀ8tmF SPh5#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQPs4 h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$XPVhѾ%; M+1C$wGKV*PRQd T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9D$ a%t$t$t$ V%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$P_! 6Vh4j|$XtVh#YPjh[Yj|$ GPG $9OsP4$L$ A t=|$ $OQt$P G@Vjj*h% D$ @\$ sCCCC C KCK1{ {%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$h%R> \$ t$t;ED$PEP $,uzhn% $,tKP; Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$D4$teSPh"Vt$Wh%t$(C "ۋD$t$0% P{D4$L$ t/PUVt$Whw%QSPh"t$Whw%t$$$PUt$ Wh%Q hn% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWPE +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$GCPVhǽ% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Ph% v 1F FFL^rL$h[YËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F Ph%lOhGL^_D$ȅtȰ (1SWV\$C rG 1H4t${GPhVC ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh@'|$,W8Edx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVP VVP ƍF8Pauv3TV[hVP SWVG| WD$,P\WjVP? ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0S tzVS~xF| uF|EhtF|FXMdQPeV$9tVTVGS1PP\$0S ƅu\$ C$t$|h@'D$P1PPV ƍC D$~gV_Vn8U_B1PP$ 9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j 81t7> 8t-> 8t#> 8tG h%Ph5#\ GtO9KuS ;W t u^_[ËK StQSP Svt9_duGhGdh%&h%hhQ%7 Vt$u.jt @h%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGhɿ%1lj$gL$$\$ G Gw u6 Ʌt ѹ )QPh%jV)T D$h @$L$tu"D$$06PSVUhֿ%WjtGt $AG8y-]< 8thɿ%h%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQh% 2C(K,QPVWutAhAd &; 8u0t0t 9Ft!6u Wh(%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$} b PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&9 G9 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u2L$( Ʌt ѹ )QPh%jWO ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]hC%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yr7 t$ $ q>YtiDD$ \$fl$Ӌl$ h9%WU( 7 8thf%hO%t$@s"j@{Dž@7u D>tSPjjS> t'O N ONWVHHN@LF |1 VUSWVD$1tW8tQ\$l$G@tjUP8 u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y 0 V1H^[ÍQF*v.q Au41USWVL$,Afw\l$t o*Sh'U贚 Sh 'U蝚 TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUf# V  1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPS衙 t=m<$hj.PSjbs 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p/ 4$U 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPUܗ tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$, 1H1^_[]SWV\${C KhQPWƋD$džևuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h% GdD$ D$1xG O4SQPl t $tsOdtYG p%t %OhQRPh%"Wjz[u!Z 81tP 8t h% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPh%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhQj苹D$ t;t$(h%j6hL%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  shL%V*^_[USWV] D$@Cxt$rj.VL$0QjW |$,wVhC%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPh%hf%9e^_[]T$rRQPhu%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPhB% RQh% \Rh%%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVP<| L$  uhj议ËD$CNC KFCF CCj.L$vQP` Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Phr%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh hb%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h%|$$HL$Xxp jP$P D$<t$hC%|$rst$h %$p΁Vt$ h%t$$蚻$x|$D$ƀt$h!%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h*%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h%e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h%t$TD$u%D$6jϬD$@`L@O|$ut$h%誵몋sLߋD$,9CPut$,t$V)q VqGPD$$t$,әGLtbt$,Vt$Pd wPD$(À|$$*"D$$ hb%s|$$/W̩!t$4q t$hO%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%Դt$[t$4t$t$h%葴|$$tL$11BL$jOD$(D$$UWV}u WYhw9 ƍG 4$D$,$5T&D$\$$%脳WhRVj覩e^_]WVt$ VhwW辩VhRW觩Vh#W萩^_SWV|$G Ph%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWP tF F^_[h%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh_%RL$jQW u h%許$BHJAWh#jj G Ph/%۰Wh#Wh iSh%,Yjt7UhjP*@h%h%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh=%ï t#@uUh%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$hm%賮j봋4$VUh%Ю Wj`Du!@ 81t6 8t hC%L$o@G WQSRPUitDD$GdՃGdD$ j.PUjC t'OQPh%j.V hV%z)h3  WhڵPj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW i uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuhL%PhL%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h %藬 jSWR tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh% PUb D$C,9r|$t"w 7h% PW, ,Nu^_[]WVt$ tqwgVhVjW1GGG G XGt^_# Vh %h5# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUj? \$wWh%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVd t0 D$ PSh%̨ ^_[]h%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PSh%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh^%觧$ WSh8%8 F PSh%y t){4t#D$} t*tu Vh% Vh\%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]E %f<'9t Qf9Au<< <\$H $8'|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p Vh% D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPhe%D$`$T$BWh.W˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Sh%P o1@GGG,G o$ tq?t/Sh%%h5#Vh*j jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPSh`jPAh`%h%$1ۋ6<$tD$D$$t;F SPh|% D$$hPS6$Ch`%舜Jhe%3=u1HL$$hQPB Ã37@$:VL$QRP,$ \$\$TSjjPs D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%КT$E|$wD贏S(GDtL$$SQP輭 _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u2 8tn 8tdD$ Phx%h5#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh%讙t/OVh]j j`1Wh%h5#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$J4$h(%h5#_ 2%1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 t"%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5>dž ^_[]É ^_[]L$1jSWV|$Wh.j׌txWhS豌WhRS蚌WhuS背WhqSlws^_[SWVt${Du ?~ Wh;%P͓ 1@1ɉKCCS(C|S KtHd sHdit xtR^_[WhY%h5#諕 ^_[ønL$xtRBL$q4SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O Wh0jPuh%h%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vh%P\ D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0g D$ L$)1H] t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$'a   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $Ĵ'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ Ph%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N ؘ(H Ԙ(H И(H ̘(|$ t*G>r!D& D$H<D$@- VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPhl%S D$P4 uOt$ pffBfBpɋ<$tXQlR{ ڃ p7t$ffBfB<$tD$WVPR9 ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP聝 |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPdtKWUP譒 D=l$_D$ fǀ<+ 1fw ')h<%R|$Qh(%j WK D$l$ f9<t1}~ QWhP%P(}t$sf<葾 fu.Whe%~ؘ(ExԘ(EtИ(Ep̘(El6tjsuD$0^_[]USWV΃|$$w Vh%~1H׋ 1ۉt$$S1ItUս $]h]d]`\$,Džu\$SjIƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh %&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh%f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%t|},WVh%} ^_[]V΋QhRjr1ɉHH@@ @ @$t (^D Vh%h5#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth(%VP6'uVjjq-wx9Dth,%Vku Vh5%|{^_É1j9VދL$t1Bh2%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1,%8WjjpD$$Pjy<$w$'8uJ%=ǃ8*%8u+/%8u6%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%y ؋?ut$u {`<$uhs`t$ h%y 1CdC`<$t%sT$BUD$PD$(Pم L$8,t (1f9Zu2;t$ t A9u19uAuD$7@u.j D$\PjD$,PPt$ hV%Jr T$Qfua1D$(D$$t$$)L$1UVT$u D$ ƀ>1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$hw%q:fD$D$D$PjUVD$0T$4)̓w! t$h%qfjPD$DP% D$LȉD$LD$PȋL$LD$P9v)衰 t$Pt$Pt$h%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%oخ t$h*%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh=%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%Ent}u^_[]8Vf6!^_[]SWV΋y Wh!%0n 1CCCC CC$t^_[WhG%h5#0n ^_[Vt$F PhZ%2n1B^L$Vt$?N Qh%Pk 1B^_L$(}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjvb1CC C XCC~ ;u Wh_%5l Wh%kt^_[Wh%h5#l ^_[ËL$Vt$VhjaF Ph%k1B^]Vt$?N Qh7%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPhm%h % k tjS0 tD$ WSVn hm%j`^_[]ËL$OVVt$?N Qh%Ph VhOj?`1^L$L$@h%P1|$L$8jQj*j)5rT1}u ht%rTrN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5rTe|y h%QrTt+DŽ$j$Pj&j)5rT'|uK1ۃ|$$pv3D$,tD$t3S?sTuh%h%ƣrRrR|$$tF1FFFFF  F)F.N,rRrR9rF t$ƃ|$t.t$L$Aut$h%+pv3D$,|$,tF)F/pv3F rT@;DŽ$jjj&> y h%rTrTrTrTrTrTrTrTrTfrT'urTrT|$tjt$ j.j)Vz=pv3ujhrTV yPh%UPhpv3Pj)VDzuY=pv3tjhpv3j j)V#zthd%$PhrTV yh%h%%hB%VDD$ tv3 | h%]$jPhh5rTyt$8jVj$j)5rTfyy h%E0 jVj%j)5rT@yy h%0 rTH H r8r tv30 s~|9~ h%tt$jVhh5rTxy h%jVhh5rT|xh%d8tv3PQh2% rTЃ1۹pTPSSQVRhrTypTt"QhM%譯 rTЃPSSPVPhrTyt"VQt$0tWNuVj Vj趓 1sTsTL$?V1Fh3Vhh%b V: USWVX rT,sTt91ɉ rR rR1GH ,sT psT ,sTtI TsT9~h$ 0D$D$L$d$ ,& \$$9$ l3H l3~d3H d3 hd3j h TsTrTtzXsT$$`sT|-hsTxv3@sT$\$\$\$ \$$%5 $hd3(J hd3J USWV $$919gՉ $t$ $;8t$hhs%$,&# =&GШu+$ ؃?9?)9K9si 3LA ($s\t%PQhV =hV$," =GC~ 9r9$$ul&hhs%$,VC" =wDG$8:$ t-؍L$VSthV$,! 1 ^_[]USWVP։1|$4$u9|.HPh%X %wS$h'W )1@1sC9uÅu.PhH& t$߉E1 `^_[]USWV4)ȃ'hh%诎 :։ϋ ˉ h&%fˉ $Wf_oUSRQt$Ph %G Gl$j.UPj2uj.h"U Uh+% Gj.UPjuj.h"U _U迿()|c؉<+<'uehl%0<9#<,uthy%褍 '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5xTt$PV;hD$$HL$L$ 1x1PPPWS jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$|TD$PVPL$@D$D$ 1 G|$<$D$=v3$TD$j=hsO&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hsO&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPm SVUb |$|$t$ "+Hj=hsO&P Ņt$,]"m 04$Q"m 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H e dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=Tu t11jNtT1TTt P襍1@hx0#h@%蟀 T1USWV1=TMT$ l$(L$DžD$5ThhT׊  |$t$5#j hT/ D$Th5#VTtUPV uTWVTWVt7j L$QPo x#L$9uT;D$ D$uL$us T8 TAPQ~ PQT  T tuQhhTՉ  |$uT1^_[]TTT1Ҋ+~,u"1t$L$t' t" t΅tAL$=ȞTuȞT t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=Tu#TTtP#R Tt T1^TTtPQ TVtJT$1Aj<ƃ=Tu#TTtPQ Tt T1^t Tt D$T1@1USWV D$,L$(l$$~ )$1H$`t T1A\$9|ωL$ tgp9tX tt$ PR t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$TTtPP TD$,L$$ ^_[]f11f11Ã=̞Tu /t(ОT11hhTPjNtОT1T̞Tt P1@hx0#hK%{ ̞T1USWVT$1=T+\$0L$ D$D$|$(D$5̞Tt$8S l$,D$ D$D$t$j S* \$1 h5#VQ~E|$tt$(P:Q u~5#WV'~EWV~t^j L$QP~ xJL$9uAE;D$ D$<u/h5#V}tj L$QPe~ x L$9t[ ̞T8 ̞TAPQ~ PQO  ̞T tuQt$8S E h#VL}Eth#V7}wh#V!}ah5#V }EHh5#V|E /h5#V|E$j:t$ @) 1@|$ uT1^_[]WV=̞Tu et3t$|$ 11t$t$Wj1tЉ^_1@PPhhThОTt$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=Tu+T̞TtPL$L L$̞TD$$tˉ01C؃^_[T̞TtPvL ̞TPPhhThОTt$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=Tu+T̞TtPL$K L$̞TD$$tˉ01C؃^_[t Tt D$T1@1fUSWV\$l$t$VK PVW UK PUW~ SK PSWj t$ V}K PVWR ^_[]WV t$uRt>DžtA= Tt ^_Épxj Ph" ؀=Tu1F1= TtZ 1맋5v3SY cp#QQh^%Pփ#L$Qht%PՃ*Tv3@+Tv3 $TI9@v3 $TI9@ TT T,T(Ty)Tp*Tgv3 $TA9~WHv3O+TFv3|t%ƍC!t2)É$)t*TL$ T$)PD$p xPhhT=*T=,TWjD$hpj Ph" 5v3P cp#QQh%5v3iP cp#QQh%PփRN 111{PZDWhVM ESWV 1L$ |$ ru\95dTs(>tGǀ=*Tu.;=xTrN;=TrDT DžtVjW:M = Tt^P 1ހ= Tt& ^_[À=Tu1Ffu]pxj Ph"葹 뺋5v3O cp#QQh%PփL NUSWV|$4t$0Ë dT9s&TT9 8Ս1ʅ/LT99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95xT95TH_ŋ TT!9r؅ 0T9s9s_ T 8!9t.M9wI9rEHT8! v3!9u!=*T=,TTRf ʼn9rPVU!  8!!ōD$p hTPVL$Q D$PVt$8_XTPt$jUVthŋ$L$Ai QhhTd =*T=,Tu= TM 1= TtM^_[]t$hhT O=T1GDu3t몍D$0xhj Ph"Z 5v3K cp#QQh&%PփI 9U7)SjZP)MPjS?I :9/ $)QjZP)PjS I tƉ111USWVˡTT!9ta)‹ $Th t u9=,$)<l u=*TOE$)ÍFu\wl;'xD$X hTPWPW- =*TN VT5Tw(' w;'1É;GsG1B TGHO;Mu9}tAtDEWP 5u%E9tt9sMxt MPQ}-E $ut=*TtGV^_[]ÃWU` VjZS2G vjZv G VjZS G V t$= Ttt ^É01ɉHHj Ph"荳 ҋL$SWVȋTT!9t+)֋ $T| u 9t%)D @A QhhT1@D^_[USWV=+Tt^_[]þcp#VVVh%v3Vh<1#h"h%v3C%=(Tu2%%=*Tuc&'{%=)TuH&RQPh%v3j5&= Tu%"=Tu1#[%= Tu2L$%=,Tu$VRQPv3v3$ T|$gfff̉ҍ4މ劄1s#GO wһcp#<1#SUWh%T$t$|$f4SUWh%v3v3$ DTGgfff̉ҍ<߉劄9s#FN whcp#h<1#Vh %T$v3$ 0T|$gfff̉ҍ4މ劄1s#GO whcp#h<1#Wh%T$v3$ PT|$gfff̉ҍ4މ劄1s#GO wҸcp#PPWh,%T$v3$ v3|$gfff̉ҍ4މ劄1s#GO wҾcp#Vh! $Wh9%T$VVVh>%v3USWV΃=|TtPt TT3!1P0eǡPT TT!)ȉ9r1U e|T9tEuótP- T!1PPjhjUP t(TtT=T=T-T1ۉ^_[]V΃?T ; Tv$1uTƉ T^USWVP9uPX;TFjWV^ *1ۡTt  T8TH@; Tv@jTH@ T 3H PTHPhTPT9rWVS u=9 j@S0* -v37 h<1#Sh]%PՃ=(T9=PTu]Tt  T6TH@; Tv@u,TH@ Tt=PTp xPhT@^_[]9|Tu)|TT4 fv3øv3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áx3D$t$P_WVL$T$ ‹q~y ;q~ t 1~9 QPT ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'W6' tF u1^_ËD$t w$'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ cp#cp#tƀ>tt%+4 0DPWVh3&h3oO ^_Ð1|$w L$t9tøv3f|$3$G#tcp#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]I 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PS `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P. t F;'tm'D$'D$'1FthPt$$VZ V" Ft$N tVD$PS0 |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-h1 01H^_[]Ë' r ,$'t u‰,$''<$t9rPQt$g 1t/<$t9v0 |fL$%9 d(v3fL$%9 (v3føÃD$L$L$ L$D$Vt$ t$Vh3O hĐ"VAt"R0 0kPh$h3K 3Vj xXV ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t. 0 . 1$^ÐWV|$ W4'8 tFu1 ^_D$ftL$Qx'1USWV$п$$ u V  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#ʄ4$Y(={111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$TL$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$(' j F H @(N]_?[\;^r~uFFTTC><% ^q{t|~F~F ;^r~uFTFF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFTF^9րրw t$rI{i9s <$=3]D_\,<$t~uF FTTAu~uF TF>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF TNPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF TF"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF TFЉL<$USWV t$ ^h.\u/;nr~uFFTTEMŁ'$~]$T'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFTFF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFTFωωD$$xt~uF T.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF TN$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF TFVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFTF~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj tCKf<T$fTAKD$8 T$j-^9H8]D$8L$| 8tF @tL t$0l$ 4)81=x311E1L$t$M9؉L$vL$ 13^vыL$VtGt$u>3TXL$21@u"3TXL$1t$1ɅtT$T$1=x3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uTF4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA TQ^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FTFUSWV\$1=x39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh x31҃9v1B x33Dh1҃9v)1BuG TG^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFTTT^_Ã~uFTNUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFTF1^_[]É؉D$@%'t$t$U0 u U# t/uՃt~uFG롋$USWV 1=x39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytSx'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq tF^~uF TF1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=x3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ s ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$,'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4誦 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ N ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t VͰ @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhT`Tø%Vt$1Ʌ1t э^fVYT$$ws$^ÐUSWV[hl$,D$(u1T$|$;D$ T$$75,/PW辦 EPW覦 %/PW莦 PWv tPWb |$D$ tH /PW) PW /PW iPW tPWͥ |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [Å$ @$ $ ,1,9r 胼$ t+$ $$ FhPW[ D$D$D$j1҉$ xfD$4D$d /$$ AfAfI,QPRhWqt$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ VhPWYZ j:WN{ D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP#t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.qqPh$P9$$,$9s|$$$,$9s|$$ yYL$ɍ$ P1,$ L$LZ9s T$hBJ R 2RQPUh$P $$,$ 9sL$4qqPh$P$j$,$o9sD$l6$,$/9s狄$ @qPQh$P$$,$9s狄$ @<h ,$9suF9snF9siF9x|$B$ yH,$9s%NM9D?<$ @<L$|I t$xjhQPRt$Ph$P$$,$9sL$tWqQPh$Pd$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ N,$$ |$jj Rjjt$,$ $,$$$49s獃=,$$ gQ,$QPh$P$$9s獃@,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP@ pRQt$Uh$P%D$hL$HL$0HL$,HL$$HL$ PH @ _l$(PQRt$,t$4t$@t$Ht$,t$Hh$P诽,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@& l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$P謼XD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH} l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P薻`$,$$_9sjjjhRt$,$ 諆$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F)PQhWo1ɃD$D$ D$1 v fffUSWV`[èt$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?rM  l$8D$UPj tCL$HD$ QPV t2VY t+jPjE 1ɃىK'輡 (jD$LPV譠 襡 (l$8蚡 0jUj 膡 0`^_[]fffffUSWV< [5D$yXXD$/Xty$/dev jPt=ƍD$4PhFtHVk V t|$4l$8$<D$ oD$ $<T$${PhQRV=D$ t@D$D$D$KD$ p L$T$ t$F 9t$D$0l$WE?tD$pD$ jjR tkD$t/Kt$PD$P  ut$D$P uP ujjD$PG k6諟 8[ 萟 iŋ$\ $X $T $P :)tt$ P?$` tVjQtp 1tWhgtQm < ^_[]ÐSV[L$t$ t$ t$ PQft+9 ƃt;u"t$54$.1D$L$4$ ^[fffffffSWV[<(t>!}B 9u8jj( t!PA 1 4 0ǃ!(wǃ(ƃ!tڝ 01^_[ÐUSWV[Å$01!uut!j/Vh uS!tƅu ƍ|$+ VPQhW誴=r9 ?h@VǍD$ jPWC D$$WjtLD, L$Pjhjjj QD$(Py Ƌ<$t'Vu D$8 t蟜 8 葜 L$^_[]ÐSWV[6!ul'P6ƃ!$tj/Vg uA袚 Ɖ獃+ VPQhWT=r ?(t"!VP袍 tEF(u7hh%@V (!hVPE ? !jj( t=jjj(} !ƒt"4!P(J 1u 0 0^_[ 8#uVt׉Ϛ ƐS[Î>[ÐS[nt$[ÐUSWV[@u }Z D$<$L t$u$$D$PZ2ut=k<T$JL$|D$x$L$x$PQn$$$Pt$mlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $,,9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$踗 D$@j PW0 蛗 8)L$@DŽ$DŽ$DŽ$F $$1۸ t1D$$$$L$$L$у uӉD$ t$l3$ $$$L$D$hD$dD$`D$\D$XL$L$@L$L$D$L$tL$xL$l$L$pt\$$3t$ \$HD$D$LL$PD$D$TTL$ \$$D$p5L$t u31t$l$t؉‰T$`D$@PBktD$`$˓ D$@PjkƉ!Ѓt0<D$pkL$t<ω|$ltv 8t#D$;D$TuGD$ ;D$Pu=D$9D$Lu3D$$;D$Hu)D$9D$DuD$9D$@u!ЃD$u4$ 8D$$ 8 $$#$1-7Gƒ|$ ;$|$t։\$$T$L$b L$T$wD$ T$L$$PD$Pf$D$$鋜$ȹʉ)9D$ D$$@YT$ ΋$jj VT$R言 ˁl$11 qRt$ )։$1҃u?ƃu4i)\P(\wi)\P1= ף‹$s( 9$~$ $PRhÉ!Ѓ1D$L$L$4D$0t$,\$($t$@VD$4PdD$HD$ VD$,Pd\$ ؿ*4RL$H)|$(+|$0t$,t$4R)i_11\$x$ T$ \$L$T$8>T$\$!L$몉\$ $裏 \$ 8u$$>$0։m D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ c|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6ЛW8G4jjdv6Mm jjdRP諛WPGLjh'v6%m W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJ 0|$tPWe jPWe F uˉ鍅 @PWe F u|$dst덅 j PWo D$5mnL$f noon3D$L$ midd3D$day3L$ zyear3D$L$ omont3D$L$h a j VW Rweek3D$L$ G|$day`hour3D$L$ Uminu3D$ute3L$ F|$min@seco3D$ond3L$ .|$sec(Wb D$|8sD$Dyear3D$L$ Gmont3D$L$h 6D$j VP Zweek3D$L$ O|$dayhhour3D$L$ ]minu3D$ute3L$ N|$minHseco3D$ond3L$ 6|$sec0D$Ds鍅 `PW1c JF u|$uBD$ L$DHt0鍅>`PD$Pb F u1h \l|.tt@ꍅ xp,h<`t,鍅 @|$PWa tF uFN$JHP 4$VHfSWV[Ì|$jhat WQ t3jWjWjW1rW^_[ffWV^t4#T$ ;t%t ~;Vu^_ÐUSWVP_Ǻ\$ف tЗtE4$!ڍ̗!9t2G t%݁t9u t־ω$^_[]SWV^,@t=L$ʁ<1tF t>t9u1^_[ÐUSWV[˫L$(tEׁ$u$C t+t9u11ՉL$!։1^_[]ÐUSWV[K|$GtB#l$%t$Pr9t!G t7t9uӾ^_[]ÐUSWV[۪@tC#l$< t$P9t!G t7t9uӾ^_[]ÐUSWV[kЗtC#l$̗ t$P8t!G t7t9uӾ^_[]ÐUSWV[t$0t$, ǍVPF‰t$D$(%D$1퍃$D$ <$l$(tg|$ !RP7tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tR][ PUW/ >&t1<$W9 ^_[]fUSWV[ût$D$hEt'1PV6t%D=u1!u VPjD$@ 8^_[]ÐUSWV[8|$ D$hEt$1PWe6t%D5u!^_[]ËD$@ 40tMi D$jPt$V ŋD$18txi r"u##!uB"tt$!a4$WPjуH WPj~SV[ t$ v_v TVK^[ÐUSWV[ȦD$,8tD$,1퐐8@ujt HƋ|$(Wg F$"jUF D$ D$,F>D$Pt$1}nu1ɀ}ouL$D$j=U3 tǃ|$D$,t1PU%4tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8!t 4$V1^_[]Í UPjUSWV[$4$,'g 0jPU uj:Ug2 6jPU tKt$}/3t$UhV jV5P#UV P< t$UD$PR|$ jjWjjV2mt$ jjWPjV2t$/FD$PVOǍc*D$t$j%Džjt$WV uj$4$4jWMtƍD$Phzd@VG VD$(Pt$@W uWP$0>$0VPW FD$ GL$ jjQPjR1tqVUW Rd 03$0Xd 0<kd 8uj/UFŃt$ $0UW d 0QPW 111ed 03$0P$4 11,$j$4V$4WjUPPWut$t8HPQ։&c 0<$0P$4  1,$D$PUc 0^_[]Í\,$UPVWz1kc (WP$8$8zVfffffffS[D$D$ $L$T$jjPQjRm/yD$[fffffS[ÛD$D$ >$L$T$jjPQjR /yD$[ÐS[;D$D$ ?$L$T$jjPQjR.yD$[ÐS[۟$L$njjPQRyD$[fffffYT$u`ÐS[^t$jqSWV[<|$Wt$t$  9rAa ?WVPj^_[ÐSWV[|$Wt$t$  9r` ?WVPj^_[ÐSV[Ýt$ y ƅuPj^[ÐSV[]t$t$ ƅuPj^[ÐSWV[|$WƅtuWPj ^_[ÐUSWV[۝l$|$UWdƅttuUWPj^_[]ÐSWV[Ì|$Wt$Eƅtu=WPj ^_[ÐUSWV[;l$|$UWt$ t?_ 0ZUWPj^_[]ÐSWV[|$t$Wzƅu}WPj ^_[ÐSVP[ìD$L$T$$RQP誨 ƃuPj^[ÐSV[]t$t$t$a ƃuPj^[USWVP[Pt$0t$0t$0t$0t$0jt$4: Ɖ׋,$t1 ^ (t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ÚPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1] (t$,t$,t$,t$,t$,t$,Pj ^_[]fXL$"wÍoffffffUSWVHXD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjs~D$ |$4R|$D$811|$<,L$4L$0 GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjjrl\$Pʅ~D$ |$\$0VRD$ Pjj;lT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjjsk1҅l$D\$0WRD$ PjjGkT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjIiD$ u|$,L$ t@;L$s3$ >"\$0Q L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[Njt$t$t$t$t$8[fS[L$T$ Pt$t$t$[ÐUSWV[؍|$$t$|$0t$(aD$ j/U ,$t|UPt$ WVt$8IuUO 8uFt$ t$Pt$t$@t$]t$0[ÐUSWV0[]|$D:D$Hx,p-L$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|ut EGDT$H@$01JƋJrc1L$'0L$D F9t3ujT$L$@$t뵉P@t1t$Dt ȉFHFLNDL$D$ fD$fD$D$|$Wv|pWD$ PT$DJ~iB1T$DJ4$9}L~J,4$<119}ƋOD1tQD$ PD$D@jR+W0^_[]USWV[ëZ8t1l$}t'uUW^jWV1^_[]ÐUSWV[KZ|$t1l$}t'urUWjWwV1^_[]ÐSWVZYttL$pH9@?t;:u1PDQAP|1t$:^Y|Rtqv^_[øSWVZLYD$txL$pH9@?t;:u1PDQAP|1t(:^Y|Rtqv^_[øfffffXXƀ!ÐSWV[ÌX|$0 2, 2 2t 2 N \ N$ NT` NX N\ N`` Nl4 Nm Nn822,22tG G$\GTGX`G\G`Gl`Gm4GnWG1Ƀ2QP辟G GdWW ^_[ÐUSWV[Vl$uP,Ņh4j61ƋD$L$dž3Ndž2dž2!3ƃ!fFddž2dž3 h3,V*5VU2@xpu xhdž2jjjjjjVVFjjjjjjV6FVZV耐jjjjjjVF tdjPVGVNV% VlHIt 3t VdVk@Z2t PDf2tuc29ʼnu3V1^_[]ÐSWV[|Tt$2t Pe2t7Uc29lju2VBZ3}3o90uVV^_[fffUSWV[Sǃ!<ǃ!^ǃ!vǃ!#ǃ!:ǃ!'ǃ!#ǃ!#ǃ!#ǃ!-ǃ!-ǃ!_ǃ!|ǃ!oǃ!-ǃ!-ǃ!<ǃ!>ǃ !*ǃ!!ǃ!f2Ot^t8tjtfx !؋tvQjPW 1,!QTpQTtQTxT|=u^_[]ÐVYQ1,!T$tpqttqtxqt|1=u^ÐUSWVP[êQ(!l$j+GG(ujjQPe uoPjhj3~aQPej>d!j 44L$ 4H 441;4f !f1jD$` `4rփփ19‰4 4f !fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f !f1yPjj!Q jS[N@t$j[ffS[.@0t$ [ÐUSWV$[?|$u2t P:Q2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQUY|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(PtjjP ,GTPִtjjPU GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V< PƣD$$<$$u$P# HuǐuU PMD$$鐐<$$u$}P Huǐul$Ut$VVXUO$|$~"14苮;>|vVm^_[ÐUSWV[6fǃ4!h譝u$ DHDHDHDH uǀ2ǃ8!ǃƈ2L$ȉT$ D$D$ D$t$%fG t%fG t~t-8!19@!f4!D$DhhA@!D!Qʃʃ19@!8!f4!^_[]ýG @tB 8u8t$3t)\10 pǀ3g 룸?Pjj Qù jISWV[+|$WWƃuOG @tD 8u:3t)\10boǀ3^_[ÐUSWV[Û*tt$339}3AP3t' 333343;33PQRP1 33t331^_[]ÐUSWV[)tt$339}3AP3Mt' 333343;33PQRPa 33t331^_[]ÐSP[($tT$ 2Pjj $[ÐX( tT$QT1øUSWV[v(TAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhXto DHDHDHDH uǀD$ FF^_[]øPjj,PjjQh jP袴jffffS[î&0[ÐUSWV[È&|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQpuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW&"W1^_[]ÐSV[ %0t$t$V t VN^[ÐSV[$t$ t$t$V t V^[ffSWV([É$0Wt$<3WV0^_[ÐSWV([I$t$8Wt$@2WVt0^_[ÐSWV([ $0t$2HvWjP2HvWjP|F@:t2HvWj<PUdž3^_[ÐS[~[ÐX_3ÐS[>0Ԃ1[ÐS[13t)PtЁ3QP~ [ÐS[þ13t+PtЁ3QjP [ÐXo3u1Ês3ÐX?3u1Êu3ÐX3tD$s31ÐX3t L$u31ÐXL$31fffffffSWV [iD$ D$D$$ t$VWj9 XD$D$D$ $jWj9 jj:jVjq9,^_[ÐUSWV[13PtЁ3QP, !u!j ƃ!!~:Pjjt $;!u!jPjQ 1!}t&jEHjjQpp@|t0QjP@ Et"@:t@0Qj8 @0Uj @UjX pH jjjp腪ǀ3Qt43PjQ胢 ^_[]ÐUSWV[3!uPj !ƃ!!uRlD$D$D$ D$D$D$!L$PQj ǃ!@HtȍL$Qhht@P螲 tBL$t9D$t0\9 t ǁ39tǀ3\(8$9hu9xt WUPwK 9hu9xt WUPZK Qt43PQ It3PjW謠 $6@$0d^_[]ÐS[ !uPj< !ƃ![ÐS[þ !u!j ƃ![ÐSV[Ê @HtȉQhht@PӰ t!$tL$t\!Hwtǀ3^[t$ЃS[ !uOl$D$D$D$ D$D$!PQj ǃ![ÐS[{ !~:Pjj $;!u!jPjh 1![ÐS[ 3t[ËPtЁ3QP艩 [S[ Qt3PjQ [ÐS[~ Qt43PQ [ÐS[> ^[ffffffSV[ |$ ta@|$t|u7x1t-0QjPM 3p褝 1^[þfffffffUSWV[Ë T$2tt6usRRt1u8]RuARt'20PjRz pݜ ^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%20PjQ p8 ^[fUSWVP[:t$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,t3tt$ t$ P? [ø[ÐS[t3tt$Pc[ø[ÐS[þt3tt$ t$ P [ø[ÐS[~t3tt$P[ø[ÐS[>t&3tL$ t$Qt$P&[ø[ÐSV[0t\Ɔ43t)2Fpt9PVPV袾(3tP蝊3V^[ÐS[nt3tL$jQP [ø[ÐX/1t T$~93|4 RDÐS[t3t PgV[ø[ÐS[îD$t3t P+V[ø[ÐS[nt3tPUt^[ø[ÐUSWV[+0Ɔ43t)2FttrPVVPVܼa3tR3~>11;3}:tt3PT^_[]ÐS[nT$t$t$ [ÐUSWV[893|$0t$,T$ $uoXMDH@utl$4D$ U 鐐t$ D$PL$ QD$ Ppx)t$輈tL$9D$)<9u AT$)RUat( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[ø8D$ $4VjPj芆tSʼnt$UMbƅtMD$ $t$UD$PVNtT$t$$V Vzr^_[]ÐUSWV[|$3t P 3~/11퐐440r0;3|4q$3ǃ$wwLJ3j0jj4tW2Ht<@xX3~3PL72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448p0;3|4p^_[]ÐUSWVXXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W 1Ґ$t$V|$(WD$0Pat$$贃ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V> $4D$)Džu |$ $tR1VT$ * 4$)tWj V T$L$ (^_[]ÐUSWV`[X14t `΋43t42NzRЃPWVrPVhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P2D$T$3;4}D$PRjQD$PRjQNj$D(PD$$L$ ;47&ffffUSWV[[|$$D$hjjU褀 t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U^ D^_[]USWV[ë|$$2t$Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U 1^_[]ÐWVYMD$T$ t$w4  p@^_fffSWV[t$V~~tyы9uv0hv, h9p9p 9pt PmgVg1^_[v4g9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P gffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[Þ|$ uT$[ø[ÐS[n|$uT$ L$[ø[ÐSWV[<|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVX~t9|$ u2AX2#Q@Q@p1~8tt$ Q@^ÐVL$t9|$u2AX2#Q@Q@p1~8tt$  Q@^ÐS[T$R[S[îL$T$ 6[ÐS[ÎT$[S[nL$T$ [ÐSWV[Lt$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[t$|$tCGX2@TtgAWFW=@x8tg@ 1^_[ÐUSWV[[΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt Vdt"G8tt V1t$׋NX2#N@N@Rz8t N@^_[]øSWV[ì΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[t$8V/ PVW ^_[ÐSWV[üL$|$t$x"1t%<t9u Wɖ PWVN ^_[ÐSWV[\t$|$W蓖 PWV ^_[ÐSWV[,L$|$0x1t!<t9u W9 PWV ^_[ÐSWV[0t$t$V苑 t|$W PWVn ^_[SWV[|t$t$t$V? t(L$ |$x#1t&<t9uWr PWV ^_[SWV[ t$t$t$Vϐ t|$W- PWV ^_[ÐSWV[ü0t$t$V{ t$L$|$x1t"<t9uW貔 PWV7 ^_[USWV[E$AL$I,D$$|$@1 $D$HL$D$ $[UT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PPkxNjT$u$^_[]$USWV[5$$AI,D$$|$<1 $$HL$ D$$hUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$$P9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZžL$1~t$ ~9J$u9r ^ÐUSWV[[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77>1^_[]ÐUSWVP[ںt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [xt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV$1 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[T$L$ Aq D$t$jVPt$ ^[ÐUSWVXض$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQDE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ûl$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Xt$D1Sl$HGL$L$T$ jt$t$t$8[ÐUSWV[t$L$F +A F(~~Xn01N,,NT$+JR, AEQUM vP<E;~}F(^_[]ÐUSWVD$XX2h P8ցp8x;{ umueP8x[$u9uxu p8x9u6q ~t-Iu!ut duP8^_[]ÐD$t @:$1ffffffUSWV[ûD$L$Qq +P+p yijUWjjVRQP$^_[]fffUSWVH[h|$\|$`L$lT$ht$d!1D$xt$t$p)xՉ!)D$xL$T$x!$x4$)t$`v9l$ ,$)׋t$\v9| T$ 9|$|P!)l$tD$`H9͉L$)D$\@9Ɖ|9~jt$d1H^_[]Ë $ًD$ D$D$D$l$!|$Fl$9tD$\@,|$x|$D$L$D$ 9w,$t$)D$ Pt$dt$;|$ w|$|tXDH@uUVt$h\W D$(GD$ D$$G tqt$$T(@xL$$ rjfffffS[0[ÐSWV[t$t}19pHt.1F:tVtFxvvv vP}u- F9u" Q+Vy1҉VI+N y1ɉNA^_[øS[^L$1qqq qj [ÐUSWV\X(D$4|AX1xrT$D$AQ8L$$T$tD$$ $l$p|$t\$|Aq;D$9DD$@T$tt BH8@A8࿉A8j#E8E8 A8E8A8 T$!ؘD$H9"׉ЉT$(9UD$p$|$8׉|$D҉T$G:uo~G,D$ 1fу9~ƋD$ 4t',$E,D$G+E݋\$t$C,W+S&륿\^_[]ÐUSWV Yx|$4t}\$\$0$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p!F!fFV!!k!!fN! 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp0QjP-ɋ$Rd0PjQQ f~$~gD$@u]D$$t$Fh2u&@9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $0jQ Btdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9!!!$Pq|\$I!BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;!u!D$PD$1r.1!$Ph V\$ ǀw !$PQRX\$ D$@!L$P!D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 0UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄!$h QP \$ ŀ=rv4l$G!$h WP E$h Wl$ P \$ w荋!$PQwo D$PGD$H$Qjt$HVP訂\$l$,KD$@, /D$H$QjVPf\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $0$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 0UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a0QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$0WjPA D$l$|$ l$ t$L$$0VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$0t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$0$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$0QjP%? L$$jQVjU\$bHD$ $jjt$RVh$0t$@$WjH>\$ uL$L$ T$9Q|$0$VjP_>\$ |$4l$l$,@$VjL->\$ ut$`PQhtR$: $,= USWV [X~D$41\$t$LL$H\$DT$@|$4!PQJ t*NjD$9 MIIlttt$ jQh+ j D$uǃ$,D$8 $<t$u;8!} t$Ћl$)$t$@@9 9<$,PjQ0) @x@!H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$,Pjt$( ǃHlt htðuu냹tt u1ÐXb@ xÐUSWV [aAP8p|$hD\Alt huu |t$r/ǃt!4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";|4t!fp"6fr"8t"ǃl!ǃp!21CdD$L$ /jt$ZD$L$ T$R29t9tT$t! FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p t!p0!0 t!0(9uD$t4$L!L t!Lq1tt  ^_[]ÃttِUSWVP[]L$9 ft$9|$ 9l2uCUw$-4$t$skwx|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX[2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYY|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[[YL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZœXL$x?9J\~2D$t$|$ Irftf>vf1^_[S[>Xǃ4ǃ89t%t!DŽp"DŽt"l!tt!1[ÐUSWV[ûWT$L$l2uI~w-ssw!ff fff4f6ǃ8>t*t!f0p"f0r"DŽ0t"l!tt!1^_[]ÐXVh2ÐUSWVP[êVt$p!t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[|Tl2tu6@t!|$0QjP (!G@f@d^_[ÐXTf@dffSWV[SD$ yOQW~ ;O~ t Q WPA4W^_[ÐSWV[|S|$D$OQW~ ;O~ t Q WP3W^_[ÐSWV[SxWt$eW^_[ÐSWV[R|$Wt$,W^_[fffffffUSWVXRtLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Poxl$tD$  dl$lыUE)Ѓ9~t$67T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j bxŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KЙ~ ƃQWT$H ^_[]ÐSWV[@|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[~@x!z!jt$t$t$P1[ÐSV[=@x!z!jVjt$PJ1^[fSWVP[?|$t|!t9t QD$PRL$QjPWaaL$N|$kK)l$kK) ";"i)$PUt;y t0q$t~fuUviu1 q (^_[]ÐUSWV[(>D$$L$t@1D$D$>D$P/L$QjPW>`L$kL|$kC)l$kC) ";"i? )LPU~t7q tAy$t+nuUwIu APy^_[]USWV[=D$(L$1҄t@1D$D$8>D$D$PL$QjPV_l$-?L|$ ) i)ʼn) i)k2#{2#lj*SiŠ)ǍTPD$PDt1D$HX<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WP#uVEЃ^_[]ÐS[~;t$ t$t$ [ÐUSWVH[H;t$\lD$PND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPU\L$ȿNt$kK)kK) "3"i)$PU$D$$(ED$j=UtƉH$$D$<$|$WL$QjPW[L$Ƚ-?Lt$) i)) i)K2#s2#Ɖ*SiŠ)ƍTPWD$5tcL$f <$|$WL$QjPWZL$ȽkLt$kC)kC) "3"i? )LPW"tD$EXE!D$PDW $$D$TPUPUPUPUu`PU]tPUItrPU5tePU!tXA4PU u^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$L$uD$ 9D$ tf, UQ#,$t'UW|$BUC4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQV $4D$ H^_[]1|$t4$葬1USWV[5hWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$Ч 1Pʋ$H $$$H $<<$Rt$WK /$//$H $>$D$^_[]ÐUSWV]/2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[K.1l$E<%uEpuEπ r?.уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[Í-L$ T$D$$Pj [ÐUSWVXU-$1h ։ͅu4$!u'$h!5 @0t$E4}0u"$hɓE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$Lσstlu7D$ ~ ~$"DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,補E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $\)ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $*$t"A$|t+H$D+$L1$uՋ$11ڃV$8,!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,&rE,u0M4tڍqu4 $P1$P$0$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,tRE,}0M4$V$0Pt$QE4E,M4},$ 1^_[]ÐSP[ý!T$ D$$1Pj= [ÐS[Î!t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[M!T$ D$$1Pj [ffffX!L$<ÐUSWV[ |$(t$ l$uPQƅ>l$$ujhj4L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F49Pk1D$tGuP|$(Ax |$(tF|$(meV|$(Phht@U t$t$tL$t RB(J<tRJbP評tjjP(z IA(UbP耕tjjPy IA1t^_[]ÍPj zVSVP[ìT$L$D$tRQPVƋ$t P.^[fUSWV[[t$|$t$jt0ʼnVU膕|$T$VŸPt$t~Pt$tkPt$t[Pt$tKPt$t;Pt$tuA1 @VK^_[]ÐUSWV T$L$[ǃ!P\Ņt'}/u{L$$ t$  P /PlPVǓuU<DžjWWW蕓tpL$v u\D$ VP$tIT$ L$$ Pt$ BV`'u1V='P$|$ $~:s1퐐Nt:t됐tÍMwUPW蹰 D, L$$ t$ [tuiPntG T$ PQhR`~)T$ L$$ t$ $t$ $:uw1퐐Ot:t됐tÍMwUPV蹯 D, L$$ t$ [tu$ $ȁ ^_[]Í!USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP+jj!訉G(hhPW|$ Gt\$h(jP8|$ "\$jhR|$ G9ouG)o\$UD$pN|$ Go\$UVP W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PÌF$ދ\$P訌~ F$D$\$jWDžF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V}t.)9uUt$VO t6u0,1(V9ſuUt$VO ^_[]fffUSWV [xD$48H L$@ 1퐐/t <,tEPxUWP豦 .,v3l$4uWsEED$\$cD$OD$|$j|WXtD$4@ T$L$ to17t<,t\$RT$D$P&wtDl$VWQ趥 Ut$P褥 +1<$W:Njt$D$Pl$8u蝁EW|$WV< W D$D$D$ Džt$\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0舀\$<u3D$u'\$Umu\$8C k$K($fC K(K(|$T$ t$47PYh>p1\$91\$-4$kK\$CPhD$P<D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$D ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q ^_[]USWV[Ø D$t uyoO|$ 1퐐/t <,tQL$蕾$Pst2ƃ$UWP诡 4$t$P蛡 11^_[]ÐUSWV[ |$ t$FN,9vtU6~}uCu;U{rt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[: |$ l$WPW*uLt}D$x@ȃǃtVot$ U)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$SWuPt$D/W葼prnWuPt$D1TL$4xT$$s$tntfuσ1} t WPV蟛 l$ E|$f>t WPV} }t0EfEfF}WuVQ f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ |$ t$FN,9vtU6uu]uUUjtHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[\t$FNy9vtW6uuCu;Wjt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|U蹥D$tL$j|U衏t L$UH=rUPt$P 10^_[]ËD$tPL$ =r"D$t+PL$=rQUPt$T^jjPrtt$ $@ 1D5t <,tFPhD$4 VUP訖 D5$(L$tSD$HtJ11t <,tFPg Vt$PN D5$h|$t+D$Ht"t$f $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0k$@,t'<$O 1҃ ҃f91wуu0<$O G$1҉L$‹O(Q9T$0RD$p j$D$t$HjjjPjfWjQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[Ê|$!$!ftGt @1@WG(f!hwU[ =wb,ŕ!Ƅ!|)ƋtVPUo[ 9vD|ŃƋGtVPUK[ 9s D|ŃE$^_[]ÐSV[Ít$ tavevevev ev$ev,eVe19!uǃ!^[ÐX!@ÐY!@uoUSWV[$(E$$4D$$0j:W{tjQP t0V$0W  NjE;$^_[]Ã`u 1DtMhuLt6puTtxx\f$O:t @t@uS4$l$w$D$j@UP"Y <:t$EF<:uEl$4$D$D$Otu@P0^`P^Hǃ@drD$O3/$$,PQhW* t" ǃt蝭\Oj@@Djd`d)XPY+XPP6atj/Vt|$u/$jPRQV'/T$$jPRWUQVVPjESV[-t$ j:VwtjQPM tt$V[1^[ÐVYT$փ1uDt^1`^USWVH[Øt$dl$`L$\D$Dȃ=Du`<$yL$VPj@QT$tLT 9 $ƅtID$\WU`R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\`QDBDŽ`DŽD褪 $;D$Du ЃH^_[]_LUSWVT[8|$pL$ll$hD$P=Du` $t$ uL$WPj@Q_t$t$ T$Ijj D$Wt$D $t$j ަ9<$u-;D$PuyL$T^_[]WQU ;L$PtNT`DDŽ`DŽD@;D$Pu T^_[]KUSWVD[L$`T$dt$X}|$@uMDu `t9ƀRQt$dPj@W tRQt$dV M;L$@uD^_[]IJSWV[,|$=ujDu `tVw;/}tL!`DtDŽ`DŽDWQ^_[ÐUSWVP[ÈD$hT$dML$LL$pL$t$lуucDu `tOz=m8@tW=mP/T$ vPQj@R蚾x. VPRd bk<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l`  4()uT$ff׺r$σߺfDfu,$tу$$1賥E;D$Lu^P^_[]Ët$d`D DŽ`DŽDX,$1,$GS[D$u&Du `t-[P[ÐS[îD$u&Du `t詤-[t$ P[ÐSV[Mt$ j:VotjQPm tt$VL2-^[ÐSWV[|$t$j:VaotjQP tWhVU  WhV ^_[SP[ÍD$ L$ $L$ƒu&Du `t}-Qt$P  [ÐS[D$uDu `t1[P$[ÐSV[t$ j:VFntjQP tt$VL貢-^[ÐUSWV׉[dR裒jj 襟D$UWt$D\ t$j |19tG4$` D DŽ`DŽD^_[]ÐUSWVL[öD$D$H1,<jU` u} t @u D<@u^` D DŽ`DŽDPD$;D$HL^_[]Íl$ E< us{U8|$jW`! u|$ u}Fu`; D, DŽ`DŽDIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:$"D$t$DRL$D$"A @`? 19<$$"D$D@ @`ƒ?91$"D$D@ @`Ń?+9$"D$D@ D$@|$`D$?;|$  ՋL$$" <$‹D$Dp$"D$L$ D1 <@4$T$<`Ń?|$_u+19QL$ T$D $L @`ʃ?|$_u19 l$ D$L(D$<_D$$D @`Ń?+19 ՋL$ T$D |$_$D @`ƒ?9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;D$(Q,^_[]É<$t$D$0$"VRPQT$T$L$ t$ ?3|$D/? D/ ?D/D$/T$T$L$ t$ ?3D/? D/ ?D/D$D/D$L$ < L/ ?L/ D/D/ $"<$<$;USWV[$D$$! ǃt$"ǃp$"ǃl$"ǃh$"ǃd$"ǃ`$"ǃ\$"ǃX$"ǃT$"ǃP$"ǃL$"ǃH$"ǃD$"ǃ@$"ǃ<$"ǃ8$"@8$" e3Le4t2tkƷ< sԃ1@tt8$"tlj瀍 ;!1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ8$"ǃ<$"ǃ@$"ǃD$"ǃH$"ǃL$"ǃP$"ǃT$"ǃX$"ǃ\$"ǃ`$"ǃd$"ǃh$"ǃl$"ǃp$"ǃt$" e|$| t!qtAD>1tBD>׹@8$" eD,|t.tkŷ< s݃1@tt8$"tр‍ !1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃt$"ǃp$"ǃl$"ǃh$"ǃd$"ǃ`$"ǃ\$"ǃX$"ǃT$"ǃP$"ǃL$"ǃH$"ǃD$"ǃ@$"ǃ<$"ǃ8$" e|$| t!qtAD>1tBD>׸@8$" eD|$t=2t$Fi%I<<fw1@tt8$"tlj瀍 ;!1ttD~t?$"e  fABe w~4ABe w~4ABe w~4ABe w~4ABe w~4Ae wʼn41 @tt8$"tlj瀍 ;"1ttD~te$Qe$A8$"e$B8$"$u1 @tt8$"tlj瀍 ;"1ttD~t⍃e;$"0pQPQPQuO$"D$pN$"D$lM$"D$hL$"D$dK$"D$`J$"D$\I$"D$XH$"D$TG$"D$PF$"D$LE$"D$HD$"D$DC$"D$@B$"D$<A$"D$8@$"D$4?$"D$0>$"D$,=$"D$(<$"D$$;$"D$ :$"D$9$"D$8$"D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف4fр3ʉрUɀʈǃ$"ǃ$"ǃ$"ǃ$"ǃ$"ǃ$"ǃ|$"ǃx$"΀x$"D$x$"D$xx$"D$tx$"D$pw$"D$lw$" ʋD$hw$" ыD$dw$"D$`w$"D$\w$" D$Xw$" D$Tw$"D$Pw$"D$Lw$" D$Hw$" D$Dw$"D$@w$" ʋD$<w$"D$8w$"D$4w$" D$0w$" D$,w$"D$(w$" ΋D$$w$"D$ w$"D$w$" ω D$w$" ɋD$w$" ? ? ։? T$ځ "$T$ 1g$"uw$"Ew$" Quw$" ƃu %?? lj%?  $T$ @D$Xƃ!$ ΃!! ! !J΃ ! ! ! !J΃ ! ! ! !J΃ ! ! ! !J΃ ! ! ! !J΃ ! ! ! !J΃ ! ! ! !J΃ ! ! ! !!!ME!4$l$T$ L$ Ń4!x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[])USWV(]ŘD$<X%UUUUʁUUUՍ4P᪪""x " "x  "  " x  "  " x  "  "x  "  "x  "  "UUUU " "$؃""x " "x  "  " x  "  " x  "  "x  "  "x  "  "T$H ݘ "l$ ݜ ",1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y!$$!D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 "3"3 "3"3<$t$3~3"3"3"3"3"3"3"3"3"3"3"3"1#t$t$D$|$811t$3= "$3="$3= "$3="$3="t$$3="$$1L$t$|$l$3l>l$|$l$ 3"3"D$35"35"35"35"3"3"3"3"D$t$D$D$$7֋T$ Bl$l$l$$xl$ ""$x " "x " "$x " "x " "$x " "x =" ="$x " "x  "  "ȃx  "  "x !" !"x !" !"x "" ""x "" ""x 5#" 5#"x #" #"D$@P1(^_[]ÐS[D$1ɐȊt tT Tt t t4 uP1[ÐSV[jD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[`MD$$D$DD$@D$9\$6D$L$T$@jjPQjRLqD$HPj }"ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPD$0Pjup\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjpt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]WUSWVd[5$|D$<$`$"hjD$@P DŽ$@D$V $@8$u H$@D$$@UV輛ljD$Plt;uHWPnWP{nuD$WP]nD$UVIljD$!jPWqm D$,u:|$$@PW#x$@L$,UVD$l$0t$\$UVϚD$ D$D$ D$$$@&D$ \$UV耚tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DW袙D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$VI.1$xUi$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po--PQR_h$DUt$@VK j jW hjU  hj$P D$@hjP D$<;$`u`d^_[]D$RWߖD$tT$@PQhR=l$ $fffffSV[}D$ h`rƉP臽)Ɖ^[ÐUSWV[8l$0AjD$PUfh th5h`) $)D$j PU薖 $l$1}$K1D=t<$t h`tt$,fōH&"4$t$L$QWPjbV&"L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃Qt$ Wt$t$Pjbt$(V薍&"&"&" &" jQPR ;&"&"&" &" jQP ;&"&"&" &" jQP ;&"&"&" &" jQP ;&"&"&" &" jQP ;&"&"&" &" jQPS ;&"&"&" &" jQP  Ƅ;&"jjt$h ^_[]fffffUSWVD[h|$\w t2t$`tD$@jPV NjD$@9t8tMtD^_[]5t8"u trgD$YD$ KD$D$;D$<D$8wD$X$2a$\WQjP0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$D$ tKWV(tD(1t$t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[xt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Þjt$t$t$@[ÐS[njt$t$t$[ÐS[>jt$t$t$[ÐS[jt$ [ÐS[jt$ h[ÐS[΋jt$ H[ÐUSWV[èt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Ȋt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wÍ!ÐUSWV [؈|$(l$$t$ D$4;D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[>D$ hPt$F [ÐS[ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[}D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[Ø[D$pML$LjPt$lv D$h|$df$D$V L$)L$D$PVWD$ |$$v=D$t$.D$lp8L$ QjjVjV |$)cƃPD$2PL$Q( ? $ $$m=|$D$lp,t$ jjt$>VV |$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VV6 |$)Ƌ $PD$2PL$QL rg $ $,p=D$D$lp0t$ jjt$>V$V |$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7芹L$R)уtuÐWVt$  r!̐cw^_fffffSWV[Tt$|$G@hjP4 yj@PWB g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[R$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$VQhVU< hV1;$u Ą^_[]LUSWV [(Ql$(16t$ %T$$NP NT  ()`N`L$$WRPC ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPt 1 ^_[]ÐUSWV_ǾO$hRP. RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$yL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P\ g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]謣ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[=|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[+<D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*|E E(}$uM$뉾1^_[]ÐUSWV[K;D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*|E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]9$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$"4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$"$FQ? T$‰ً$|$D$G<uD$ $ " $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? nM" T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E|BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍j"FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N #FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q蓾 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj &"&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B !Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?|ፅ}GPGX GTG\GG?$L$u aD?:"FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  }#FL$Q? h#FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$4#$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tJ#D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$#~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $="$FL$Q?P$!$NL$Q?D$T$ ߋ t$"$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $xUSWV[æiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPƩ )t]D$)WPu8诩 }43M(U,E4E09w)RVP~ E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Üt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[+L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU\ F4n0)Pv8UG 1tN0^_[]ÐUSWV[Ût$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[xL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R袢T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVX D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$(#L$(4#É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+(T$D$tq01t ^_Átփ*tUSWV _xL$ y y$q9NQǃ8|$ |$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[Xl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP( )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wHԍl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw | o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw ){ o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw Ex o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQw F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw Pw o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQvL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw 6v o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw u o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw Dt o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw s o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq .r $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq p $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv D^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv ] n on)n)ouGGD$8xt1$^_[]ÐUSWVXH$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu X } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu gX } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu JW } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu V } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XϾ4ÐUSWV^ƨL$4t;T$8\$0Ӄs3I͉у1&Ӊi9134ƒT$4zR134ƒT$4zR134ƒl$4M1ʉ34xT$  1ϋL$ 34Ã1ؐ\=134\=1349uЉЉ̉D$ ,׃}l$D$D$D$11|$ $34343.434 $3Q4343434 $3A4343434D$ $3A 4343434|$D$ $3A43434Љ34|$|$ $L$l$11D$D$3343434343W1343434343G1343434ȋT$343W 1‰343434\$343_1ˋT$ )343434É34ϐÉ134W134W134W134W134W134W1Љ34O134RЃ^_[]ÐS[^t$t$t$ [ÐUSWVX($D$$tz \$׃vND$t$41Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVXH$D$$tz \$׃vND$t$41Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXj$T$tfǃvEt $41ف 1υt1Mu밸^_[]ÐUSWVPXڶ$T$tfǃvEt $41ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Þt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXÐUÐXT$J r ,ù)ы,ÐS[~D$D$ PJ[ÐS[Nt$ '[ffX/L$ T $ h, | 0 |8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ǛT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXxD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$4PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +l )9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[lt$xƅt|$7V@G cP ^_[ÐSV[t$ )tt$PF@F1P P^[ÐUSWV[ȍt$ԯtLƋ|$$l$ $P?D$PWU2 1uO(Vu O(^_[]ÐUSWV[;|$GtE/D(U8]wUjt#V譡=yarau D$0VS O1^_[]ÐUSWV[û|$GtE/D(U\wUt#V-=tcidu D$0VӞN1^_[]ÐUSWV[;L$A1t3)D(U6\NjD$pUdt D$8"N0^_[]ÐUSWV[ۋl$M1tMuD1V[uVt(WJ=yarauD$8M W1^_[]ÐUSWV[kl$M1tMuD1Ve[uVt(Wڟ=tciduD$8EM W{1^_[]ÐSWV[Pt$ t$ ^/ t6D$t7<$D8WZt$WtD$ 01LL^_[SWV[yPt$ t$ . tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01";LVq)L^_[ÐSWV[ىPt$ t$ >. tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"KVћK^_[ÐS[>L$T$ jt$t$ [ÐUSWV[QƋl$$P+;D$PUWG- tgV"D$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6J 4J8Vu 댅t D$ 01_J^_[]ÐS[L$T$ htcidt$t$ [ffSV[݇t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[Ët$t$#_P=loobul$VEloob^_[]ÐSVP[,D$Pt&Pt$t$` D$VbD$1^[ÐSVP[܆t$t$Vt$t$` D$VD$1^[ÐSV[Ít$t$t$!^VP8^[ÐSV[]t$t$t$]VP9^[ÐSV[-t$t$t$]VPg9^[ÐSV[t$t$t$]VP9^[ÐSV[ͅt$t$t$a]VP':^[ÐSV[Ýt$t$t$1]VP7:^[ÐSV[mt$t$t$]VP:^[ÐSV[=t$t$t$\VP:^[ÐSV[ t$t$t$\VPW;^[ÐSV[݄t$t$t$q\VP;^[ÐSV[ít$t$t$A\VP;^[ÐSV[}t$t$t$\VP<^[ÐSV[Mt$t$t$[VPw<^[ÐSV[t$t$t$[VP<^[ÐSV[t$t$t$[VP<^[ÐSV[ýt$t$t$Q[VP<^[ÐSV[Ít$t$t$![VP=^[ÐSV[]t$t$t$ZVPg=^[ÐSV[-t$t$t$ZVP=^[ÐSV[t$t$t$ZVP=^[ÐSVP[̂D$QP0t&Pt$t$\ D$VD$1^[ÐSVP[lD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[ D$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[ìD$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[Lt$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[D$QP.t&Pt$t$Z D$VD$1^[ÐSVP[ÌD$QP.t&Pt$t$IZ D$V輒D$1^[ÐSVP[,D$QP0.t&Pt$t$Y D$V\D$1^[ÐSVP[D$QP-t&Pt$t$Y D$VD$1^[ÐSVP[lt$t$t-t&Pt$t$-Y D$V蠑D$1^[ÐSVP[ D$jP.t&Pt$t$X D$V@D$1^[ÐSVP[ì~D$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[L~jt$.t&Pt$t$X D$V肐D$1^[ÐSVP[}jt$-t&Pt$t$W D$V2D$1^[ÐSVP[ì}t$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[L}jt$-t&Pt$t$W D$V肏D$1^[ÐSVP[|D$jP,t&Pt$t$V D$V0D$1^[ÐSVP[Ü|D$jPT,t&Pt$t$]V D$VЎD$1^[ÐSVP[<|jt$+t&Pt$t$U D$VrD$1^[ÐSVP[{t$t$+t&Pt$t$U D$V D$1^[ÐSV[Í{t$t$%SP=gntsuVj!t L$1^[ÐSVP[<{t$Ht&Pt$t$U D$VtD$1^[ÐSVP[zt$t&Pt$t$T D$V$D$1^[ÐSWV[Üzt$t$4RP)=atadu,VImt|$L$tVl1^_[ÐSVP[,zt$t$tkt&Pt$t$S D$V`D$1^[ÐSVP[yt$t$jt&Pt$t$S D$VD$1^[ÐUSWV[kyt$t$QP=gntsu?VŃUt$UPVi t D$8 Wk1^_[]ÐSV[xt$t$PPz=gntsuVt L$1^[ÐSVP[Üxt$t&Pt$t$aR D$VԊD$1^[ÐSVP[Lxt$xt&Pt$t$R D$V脊D$1^[fUSWV[wt$t${P舌=loobul$VbtEloob^_[]ÐSVP[ÜwD$Pvst&Pt$t${ D$V҉D$1^[ÐSVP[Lwt$t$Vt$t$k{ D$V莉D$1^[ÐSVP[vD$Prt"Pt$|D$V6D$1^[ÐSVP[ìvt$t Vt$|D$VD$1^[ÐSV[mvt$t$t$zVP(^[ÐSV[=vt$t$t$yVP(^[ÐSV[ vt$t$t$yVPG)^[ÐSV[ut$t$t$yVP)^[ÐSV[íut$t$t$QyVP*^[ÐSV[}ut$t$t$!yVP*^[ÐSV[Mut$t$t$xVPw*^[ÐSV[ut$t$t$xVP*^[ÐSV[tt$t$t$xVP7+^[ÐSV[ýtt$t$t$axVP+^[ÐSV[Ítt$t$t$1xVP+^[ÐSV[]tt$t$t$xVP+^[ÐSV[-tt$t$t$wVPW,^[ÐSV[st$t$t$wVP,^[ÐSV[st$t$t$qwVP,^[ÐSV[Ýst$t$t$AwVP,^[ÐSV[mst$t$t$wVP,^[ÐSV[=st$t$t$vVPG-^[ÐSV[ st$t$t$vVP-^[ÐSV[rt$t$t$vVP-^[ÐSVP[ìrD$QP t&Pt$t$v D$V܄D$1^[ÐSVP[LrD$QPP t"Pt$xD$V耄D$1^[ÐSVP[qD$QPt&Pt$t$u D$VD$1^[ÐSVP[ÌqD$QPt"Pt$]wD$VD$1^[ÐSVP[,qD$QP1t&Pt$t$:u D$V]D$1^[ÐSVP[pD$QPt"Pt$vD$VD$1^[SVP[|pD$QPt&Pt$t$t D$V譂D$1^[ÐSVP[pD$QP!t"Pt$uD$VQD$1^[SVP[ot$t$t&Pt$t$s D$VD$1^[ÐSVP[lot$t$tt"Pt$AuD$V褁D$1^[ÐSVP[oD$QP!t&Pt$t$*s D$VMD$1^[ÐSVP[ünD$QPt"Pt$tD$VD$1^[SVP[lnD$QPpt&Pt$t$yr D$V蜀D$1^[ÐSVP[ nD$QPt"Pt$sD$V@D$1^[ÐSVP[ìmD$QPt&Pt$t$q D$VD$1^[ÐSVP[LmD$QPPt"Pt$sD$VD$1^[ÐSVP[lD$QPt&Pt$t$p D$VD$1^[ÐSVP[ÌlD$QPt"Pt$^rD$V~D$1^[SVP[NL$1t91t^1^ËAQ^ÐVZML$1t91t^1^ËAQ^ÐSVPYMD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY,MD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYLD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY LD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YKD$t9u@H@ty1ËT$ BÐSVPYtjPVl tu L$e^_[]ÐS[nAT("jP5qp("PQO1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[M@D$0p("VPV菷1^[ÐUSWV [@t$4NswD$8tO&@ta@uppQj WGjUVEZ tWVWWt UVI[1 ^_[]Í&%%PQhR WVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[>PQqT("Pn[ÐS[þ>T("Pn[fD$w sÐS[n>D$ ;D$uPt$t$[| [1[ÐUSWV[(>D$ t$tP[D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPz 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔dNx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í&&V&PQhR#USWV ]h;D$ \$$p1}<"$N<\u< $1ۃރST,$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ&&V&PQhRUSWV0[57$Du w|j011<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p''D$-'D$Ews 搐<<}jt$W tfjt$W tS<'jPW E $AEtLt@<-Eu<-u}>u$h\t u94$蚪10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$UD$m$hō6'D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[/jt$ [ÐUSWV[õ/$j $hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjۓUYtjVU_^ |$t'jjjhjt$P藓|$t-$U~jWU^ WUlTVUkCS[~.jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[ -j@ƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[Ù,t3Pjtjj@QDžuUţOj@61t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[+t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[Ú)|$oU[1tIp9u?$jjt,HWs;~$9uGt1t$$譓U. ^_[]Í?++F'PQhRS[Pt$ [ÐS[jt$t$T; [ÐS[ÞPt$ [ÐUSWV[kt$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(''F'PQhjRgQGP5LW1^_[]É.''F'PQhhR-'F'PQhyRJ('F'PQhRS[L$A4tPQ4I,Dt*Pa,[Í}(](F'PQhR}J(](F'PQhR^USWV,[ØD$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jj草tt$ At$DVL$*L$ql$$9.|$FWUP j:uDžt!PW> Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Utt^Ut$D$P: U;1$D$jjtt"WPt$ED$E E^_[]ÐZO L$1t 9tËA ÐZ L$1t 9tËAÐSV[ T$ t19 uL$t r ;t$v1^[ËR1ttVRQ3 ᐐUSWVP[Ê D$1t 9t ^_[]ËHh t( $tDU0st؉Ut$Pơ ąt+++PQhR+++PQhRZ L$1t 9tËAÐS[î D$t9u L$ t9t1[QP: [ÐSV[m L$ t 9t1^[ËT$19Q ut$tRVq>I ֐USWV [ t$(>t~(t  ^_[]ËFMjQvPgt҃~$tD$jPv ` ʼn$u 8"tD$N N$9u8"t=:,#,+PQhR1jPj N,$U&q7ǍFPD$PU tcD$;$uZCejPV tD|$u WV1,$jpƅt-PVF~n Wt WD$$0USWV[È y1D$4$G=w ՍjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[íD$0FuFt P~V~1^[ÐUSWV[hl$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í&F,+PQjtRjSV[íL$t$ 9t8V 1;Q u.FtRqPB 1uyu"^[Ío,],+PQhR,],+PQhRȿffffSV[ PQ6|$ u("("V^[ÐSV[ýt$ 1t9u V^[YD$t 9t1ÀxÐY_D$t 9t1ÀxÐS[.D$t9u L$ t9t1[QP[ÐSWV[t$~uo~(tiͶjPvvMt("!ҶjPvv*t1("|$PQf5V7^_[Í-,,PQhRSV[=("VPƃ("("VPƃ("1^[Ð1ÐS[D$L$ yt0@QP`[ÐVZžL$1t91u T$ t92t^19^ffffSWV[\j@0hƅtEPWV4>jP2F,F0F4F8F<^_[ÐUSWVP[t3Pjmqtrj@gDžuUxWj@g1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[(|$1tvP9uloU1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[*։ $|$?uwG8]u<GcjjWr tCF jPwwt,t1 jjPUt$t1U^_[]Í100r-PQhRRбS[pPt$ þ[ÐS[jt$t$t [ÐS[þpPt$ [ÐUSWV[Ët$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%7..r-PQjmR诰QblGP}&WMl1^_[]É...r-PQjkRc-.r-PQj|RGS[ÎD$H4tH4[Í..r-PQhRUSWV[HD$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jj>dtlAD$0t$PL$T$rL$9Al$ F9(u:G@jt$t$ [ÐUSWV[$4$0$,D$P+ tD$$;Et$L$QL$QL$QL$QUWP$0$,u*PD$PWUV tr$,$0렐4$t$$8$8V t8|$ $,l$$0D$$1;M@MI$4t*$4$,$0PQjjWUV u1^_[]Í10{0PQh#R*S[nD$P[ÐS[ND$PP[ÐSV[-t$ vVv`^[fffSWV[t$NtFt\V9wqu QPZtFVL$z~ ^_[111g1PQj9R411g1PQj:R11g1PQj;RSWV[<t$t$|$PWtu^_[ÐUSWV [t$ F|$$2$/wضbg\tbwtRt$jD$P D$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð&2g1PQhR赡SWV[t$~ t 1j Vt ;~ r^_[ÐSWV[ü|$t$t0t*PVtuj Vm^_[1SWV[\t$F|$uLPVujVm1^_[Í&<2g1PQh$RSWV[<t$F|$uEPVtiu]jV}1^_[Í&Z2g1PQhERUSWV[Kt$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í&v2g1PQhdR蓝USWVP[D$1ɅQh Dt$7jH1Ƀ#hmH$GGG wtHt$WՃj W=tjW$$<2PWtiu千33PQWq tDj Wt5D$h VPW`tj WZ7WWW $ȃ^_[]ÐUSWV [U$($$WtEPxx=ŋ$$t$t`?t[WUt.H|/t+1]$,9/;9sfD$ .t$ VH r輡?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ 8t$h t UӠ8̠8VU輠8$ ^_[]É,$9tG9t iy/t)rD$ UWPs D, ,$S[jt$t$ [ÐS[jt$ [ÐfffffD$ǀǀÐUSWV[ËT$$L$ |$l$t$u2j@DtUhxL$ H L$$H*s3uFˉ,|\T ^_[]133O3PQjAR莘33O3PQjBRrUSWV[ûT$t]D$ |$L$tKutUtMtM L$$tEUSL1Ht t L t L |$$t L2 ^_[]Í33O3PQjZR舗ffffUSWV[D$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PHbl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Øt$@|$[fffffS[^t$t$jt$t$t$8>[fS[.t$t$jt$t$t$(>[fYXZQ̀QQrS[t[fffffffS[t$t$t$t$[ffffS[Þt$t$t$b@ [ffffffS[n1;D$[ÐS[>1;D$I[S[88t j葐1[ÐS[88t ja1[ÐS[þ88t j11[ÐS[Î88t j1[ÐS[^88t jя1[ÐS[.88t j衏1[ÐS[88t jq1[ÐS[88t jA1[ÐS[Þ88t j1[ÐS[n88t j1[ÐUSWVX;("?) R4("ѐ>t1 @u~1ɍ(">t 9u#;T$t$ Ƌ4m=|$l#D$,D$ltBL$4$t$$Utx u͋$|=uU =39l$}q)t"uDur;MDMDMD MD9uA1 ^_[]Í;l]7$7PQj>R蠀wffffUSWV[%$ÑL$(roL$,>'L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPj-S[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[ĸt3T$8tOl$@to8VPt$DR88I8PQhRt멍88ՍI8PQhRt뉍88I8PQhRwtT$HkXODH@u zD$ j PWڛ $T$y8"u,y"y0HUPVQt$HT$ 9L$<lзD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)8WVPQt$H苏11҃^_[]Ë$T$|$(9ыl$,}8|$09Njl$4}9UWRPVQt$Tt$T4 맋L$8fffYimNA90%ÐX_L$ffffUSWV0X8$t$DL$H|$PL$%1|$L$WD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$H T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ &1$Sq0^_[]Ë$9u9&9PQhRNk$9u9&9PQhR$kL$XUSWV0X$L$Ht$DL$1|$L$WLD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPUA T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U 1$j0^_[]Ë$9u9&9PQhRdL$XffUSWV<[Xl$X|$Tb D$\}  |$T  D$u D$4tǃ ǃT$PT$$9L$$oT$,lT$0\$|$ <$D$(\$ǃ |$ l$XL$1L$uHD$4;L$$D$T4>-u FD$,t$0E<+<-~L$  XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VWSD$\(pD$D$ 1T$ $ $.T$tf\$QURT uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:(RQP \$+ L$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tARQP萇 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP1?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tiRP~1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8oD8t}:t4$P $E<-t<+u:}:1<: :999PQh_RZw999PQh`RYD$l]999PQhaRY|$T;9 :9PQhRY9 :9PQhRqY9:9PQhRJYn9:9PQhR#YfffffUSWV[ëT$t$+"ǃ+";D$}? 9-u7yI+"t8--?o^_[]Íoj-R)tǃ+"--9t:׍':PQjRRX(|:t:׍':PQjSRW+"+"::tlQR(tXx:?u'1x:tH;L$|鉻+"oT$?u?::~[:UPQR4xǃ+"?tqco:D$8:E?3[:fffffSV[-t$ tj jV  ^[Í::PQj/RNVffffSV[ݙt$ tjVQ^[Í>;9;;PQj/RVfffffUSWV[Ët$l$tyjj 1trj7tkNjD$oGG ELiLh|gPjQRjWtKjPj [1^_[] [8l$u5EZ8Z(W|$7Z(릐USWVP[zt$ l$ME 1҉s9r J9sAEOQ0 t`U)ƒQjRD$ V E $}E T$)9w΋MVRPt- E E MU9r‰^_[]ÐUSWV[ëT$L$t$ D$t0tUyy;;L;PQhR SpxA)9}8iYTi t?;;L;PQhRRx3rH HPp 9r@ 1^_[]X䐐S[ît$1[fS[ÎXt$ t$ Pw [ÐS[^Xt$t$t$P[fUSWV[+l$|$t$t1UPWV>1^_[]Í_;;PQj4R:RŐSV[͕t$ tjjjV0^[Í_;;PQjARQfffSWV[||$t$t1hPWV0^_[Í_/<;PQj6RQfffSV[t$ tjjjjV̑t^[Íu==PQjN>P?FFHQNF )PQj,,^[ÐXL$x94~ Í6>ÍN>fffffffUSWV8[ȌL$Xl$Pt$LD$4ut |$Tu>VPz@?VPb@C?VPJ@j?VP2@?VP@?VP@?VP??VP? @VP?t,@VP?fR@VP?Xu@VPr?J@VPZ?9@VPB?@VP*?q@VP?`)AVP>Oĕ` t9uuh/l$t'j2pU  >QP { t>>e>PQhR@FL$h@F>>e>PQhR F l$qPQj2UcU;ƋD$XtPUt$\ ;D$4u 8^_[]IffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[<|$t$t2F)F31uF FF^_[ÍAAlAPQjYR7D뭐SWV[̇|$t$tg~uP\$wGN QtAAlAPQhRC~uр~|$^[ÐSV[Ít$ t ~t/FAAlAPQhRB~uN .wu^[ÐSV[t$ t41~t^[ÊV u.wL$~9|ԍABlAPQhRB먐SV[ít$ t~t0^[ÍABlAPQhRA~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[ |$t$t@1u6T$L$9w"QjVBC FfFF^_[ÍA0BlAPQh.R@뜐SWV[Ìt$t>~u/L$Fy |y|9IL |F1^_[ÍA@BlAPQhMR|@랐USWV[t$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍbBOBlAPQhhRA?mBOBlAPQhiR?SV[Ýt$ t"~uDNu;V9r1-AyBlAPQhR>~t^[ÐSV[-t$ t31~u(NuV9rT$x 9v ^[ÍABlAPQhR(>fSV[ýt$ 9y ^[ÍBBBPQjTR=אUSWV[kt$|$t.l$tGMϸwG)o >1^_[]ÍABBPQjbRj=뱍CBBPQjcRI=또USWV X؀$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ>D$0 28t p׾$VPUx 7+D$p)t5u+VQA$RjP> 7D$)smH1 ^_[]Ë$AC֍BPQhR;D$4$2CC֍BPQhR;g$@C΍CBPQhRQ;D$a$-DL$DՍBPQhR;L$USWV[Ø~l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQi< D$ }+$x)t6u,WQARjP< l$}<$)s8O^_[]ÍAdC֍BPQhR9@C͍dCBPQhR9렍-DL$DՍBPQhRf9L$;SWV[|t$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9AxCBPQhRj86CxCBPQhR@8)뒐SWV[{t$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1ACBPQhWR'7CCBPQhXR6VL$t"T$ tփuQ^ÐUSWVP[Jz|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP7 D$$L$(l$0O}^_[]ÍCC$BPQhR5T$L$8D$4VUCCՍBPQhR_5\SWV[x|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[lxt$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Xw|$$D$(t9D$ L$,ň̍ DL$DL$B $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[Lvt$|$D$VPt$  ^_[ffffffS[vjjt$t$t$t$[ffS[ujt$ t$ t$ t$ t$ t$ [ÐUSWV[ÕuD$$$$$ $$$fht$pPQj VND$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6|*t&6P)UPVQ\ D$@t%+"hPV $0$$ڥtbōD$ PVqx\#D$=uXUDL$ QPxED$$t $;Au=D$E0=ODE1CYErEE-"UWBt$Vl$E;$ļ^_[]$$$$U똍EEJDPQhRƍDEJDPQhRqEEJDPQhRYKUSWV[(_D$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[å^$D$$D$hP!$S$k$$UhhWED$ D$$GƄ4$$$UhhW~Ej WKt$X8D$1$0U t u뜐44 w$(|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&PԽ$@|$L$ t$֋$^D$PjL$Q$&PbD$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP裼+JtD$Hɋ$@tD$$L$Q$jPI؅$U$1$$׋$$Pu\~$P$1u7Yu,N$P$ t/t u $Uhh$$W1A11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύEEJDPQhRNEEJDPQhR'nDEJDPQhRV裼USWV[ÈXD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]+USWV4Չ[XD$$0qƃ-"-"Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ ĕPQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/u-"yGPRQj(14$ D$;$0u4ȁ4^_[]ÍEkGJDPQhRhNUSWV0։[!V$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$ĕPQR$P uo<$1t[l$l$* t=D$*jjjhUww uU$/P u$l$1P+ E;$,ue0^_[]ÍEPGJDPQhR$T]GPGJDPQhRxrfUSWV[XT|$,D$(/D$wl$GQjP G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#G΍GGPQj`R!D$,H$$t$,F $)ʃr# HGGPQj}RF$)N)!r s.^_[]ÍEGGPQjCRz/HG׍GPQhRQ몐USWV [Qt$ ~Nƃ$2"V҉$t`L$FшT$?r?鍋1"$j@UPQQ\$+1"~t0|$>L$:$u 1"uL$>͍ >T$1ҍ$2"-9si$:\EU;L$s>t 9sE.9r9s34$\Eh9s맋 $$2"9s$1" ^_[]fffffUSWV[{Pt$|$lUl8PPWVHUL^_[]fSWV[,Pt$ W!PPV W^_[ffffUSWV[Ot$tLD$F$V~nF׹%2"PUWRt$t$QjV)$^_[]ÍHLHPQj3R 듐USWV[HO|$,L$T$ |$l$捃HUWRQL$QVPt$H 1uA$L$72"72"82"L$92"L$ :2"L$;2"L$<2"^_[]ÍHLHPQjBR [USWVH[xNl$`D$ D$D|$\SrE$MUu}mHUWVRQt$PjD$JP'$$sHPQ+jjjjPrƍ0VjjjjWqƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$JIPQhR2YJ>JIPQhR SV[M/t$ t3#EgFFܺF vT2FFF^[ÍnJdJIPQhRH멐USWV[.t$ T$l$$JȉBsϋJȃB?)1@x@)ύ jl$WVPՉL$  t$Ul$,$19s2l$D$ PU@;t$$rt$ l$$1T$) UVP~^_[]ÍnJ{J׍IPQhR%I{J׍IPQhRUSWV[È-t$,D$D$|$(FȉD$FȉD$ JjPVU F!=t)jWV' F!=uD$jPV l$($tH11Ґ׃4>$l$(L<>4LuŋD$;D$uY^_[]ÍJJIPQhRnJJIPQhR$8ffffUSWV[,t$0l$,D$tjuj)ВƅtRUP1 F LFuF(;D$u6^_[]1ꍃ[IJJPQjFRurnUSWV[E+$ $$Ph@VT1$|$$ $ u#D$P|$WbP|$`l$d$$ʃ|&jQPt$ 9|=P$Pt$S ƅ~.V$P$P` |) uC84$T18|$$uj)ƅ~$$QP1F LFuF(4$W T|$;$u^_[]1hSS[>)jjjjt$t$[ÐUSWVt[)$D$p$U$$U uj)蕏ƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃIJJPQhRG.fffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP['t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP蜼 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWb ;D$u ^_[]tfffffL$$Yai qyD$A(tQS[èRjj#9 [1ÐT$D$ Zbj rz $z(t RPS[XjRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj>8 [1ÐT$D$ Zbj rz $RPS[~jRj7 [Xt@ffffffSP[MD$ L$T$$RQP p[fffS[jjt$jT7[fffffffS[jt$t$jb|[ÐS[þht$t$j/|[fffffUSWV [Èt$ D$D$$|$jjUVjW1D$D$ $jjUPjW軜D$D$$jjUPjW脜D$D$$jjUWjPKu8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR1u ^_[]ÃtOw OsҍH;l)KJPQj81^_[ffUSWVh[ } X6"uj'>]X6"D$Pj9X6"L$@B1lj1L$ED$$1Mt$ƉqD$PjxxX6"L$@B1lj1L$EHD$$1t$ƋEp jPxu(X6"L$@B1lj14$e^_[]ÍKpKPQjHRX6"USWV[Ø l$wjPUx u @t tQUuKjPU@x t 1^_[]ÍupjPVx DžtjPVx 1uú!?E1u<-ut<+uXMDHt$}D$j PWc L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ>L$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[ét$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVJ ^_[fffffffSWVP[t$tB\6"PQhRZx>L$ $\6")QVWR\6"PQhR\6"\>"t@\>"^_[fffUSWV[Kt$D$D$I@t NQw <ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]ÍKKKPQjbRsUSWVX[D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ÍLKKPQhtRSWV[Ù|$t$t5$D$ WVjjjP1Ƀىȃ^_[Í;lSLLPQj:R葷ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[Ht$(l$$.PT$(18D$8t<P)ukt4)`vD$(8rl$ ugPt$Iŋ$t$bֺ0/vD$8t<P(Wo4$&#t$#蒺01UPt$ŋD$G6"oD$ G `>"`>"D$8t<P(G^_[]ÍL`LPQhR@ïL`LPQhRT$(#>'roÑq9jUPQRVjUUSWV׉L$[b2jeV݄j+VЄt-1|$WjPj%eyFu<$|$1jrVqtP` $UW`ft1j]u%07\!wQ!ɸ01^_[]ÐUSWV׉[w`>"tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8t<P%gt/D$08rL$ ubPt$ŋ$t$]p0D$8t<P9%Wl4$t$101UPt$聣ŋD$G6oD$ G `>"`>"D$8t<P$G^_[]ÍL`LPQhR߰ïL`LPQhR走t$,|$(T$0VWU jUSWV[t$8$8t<P#`>"t9ut>mt9uu+$8t<P#Եh1V菥Eu`>"$8t<Py#|$jWu ƃu v8tUjtt$^_[]ÍLL`LPQhRffffffffUSWVH[D$`|$\t$$UVPW]StUVt$aǃu.ƴ8ujD~;$} VPaǍD$9tLViA$jD$Pbt&UPt$hWR{D$$oH^_[]ÉƍLLLPQj>RQfffUSWV4[D$\l$HSt$XoL$`uotu.ut덻 tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ toFL$ VR 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$蹠Ń|$jt$ RU蜠|$tUjt$ RP腠|$t>jt$ RPnl$t%jt$ RPUtjt$ RP@T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQwщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP!Ɖр|$ul$эPM4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0Hw0赟L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$vL$,T$$ Q[M4$Qt$(V0WRUt$h]$[4$|$2jjdQUѝыT$,t$$rPM4$Rt$(QPVt$dVt$d 9wijt$ QRtщ9|$}T$ 4$T$\jt$ QR?щ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRݜщ9}T$ 4$T$\ijt$ QR謜D$ ы4$T$\B8-MPQj8R讧D$lEM-MPQj9R膧mfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í1NύMhMPQhRm>USWV։[$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ} D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í1NMhMPQhR蜢[MMhMPQhRr4MMhMPQhRKUSWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVHuD$t @ t$?D$ h |$t$($iPYt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPH)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPUt$FPUF^_[]ÍMMhMPQhR蕚USWVY+T$tht$1BtBظkw+<tրztЃːt *u1^_[]ÐUSWV։[Ô]F,F tv芟FUPOl$~D$uNtQjP聛D$ L$$t$ F1퐐f$t=tsAuE @u1$P$-$hPQ? E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtuה$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YMNhMPQhERًM lt$10脑D$/ Njt$$E @D$uP PUu 78t E u;$6Ĥ^_[]ÉNjt$몍M'NhMPQhRM'NhMPQhR|1N'NhMPQhRÊ$c-N'NhMPQhR蕊OM'NhMPQhRn7MNhMPQhERGL$ MANhMPQh/RL$1USWV[ÖT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍;l΍hMPQhRKN΍hMPQhR蕇T$8WN΍hMPQhRcT$8ffUSWV[$$c$$tuӌ1D$$tŋD$3l$ vh@PD$(D$$D$ iL$L$\QPhtYD$|$D$0t$\ d$<0fD$PPjup] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tP{PWuk uh0D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$NjPv u|$1D$Wt$7Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$NjPD$p ;jPD$p D$ |$t$ztG$`L$tZNjPq@jPD$p /1ҋ$tNjPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8ͅ< 貅Y1D$ D$l$t)萅D$D$\PjuV |$n8|$ $%|$tHQjPu> |$t&/D$u|$8|$ $tt$Dtu VLt$jl$ U 1$u U9;$uEČ^_[]Ë|$|$[|NN{NPQj_R~yA&S[.jhjt$t$t$[ÐSWV[h>"t-l>"jhjVPt$$t8d>"0jF#l>"d>"tP}(h>"u^_[ffUSWV[{|$t>"jjj t>"l$x>"tUQp>"à t>"t]1i p>"9x>"wHt Q[8 x>"W'p>"t$UWPh t>"u 1T$ Ɖ^_[]ÍOONPQj"u}>"jP[0xƃ|>"1}>"t }>"1W2^_[ÐUSWV[ XW|>"u}>"jP/x5ƃ|>"}>"Ur";D$wUt$ŧ1Ɂ0W^_[]ÐS[~t$:.ƃ|>"[fffffffUSWV8[Cu }D$D$L$$jjPQjRMtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍhO\O$OPQjERz*xO\O$OPQjFRzffffUSWV [OP4ot\ƀ8tUT$D$j PV tŋT$t|zt)OVP蕥1ɿokP&wA4@ʹ&.uo@9~ $OjP,$OVPT$t$$D$ t O>"RUPjQQL$ t>>" ^_[]ffSV[Ý>"u*ǃ>"sPVl>"tt>"}VPq1^[ÐSV[-ǃ>">"tP9sPV>"u}VP1^[ÐUSWV [õ$ǃ>"ǃ>"ǃ>"ǃ>"ǃ>"ǃ>"ǃ>">">"hhUD$ 1Ʌ$t$;L$\ $t$ >"L$l$<ǃ>">"hhU耢D$ >"t$P/_j\WVO t8t剃>"8#tj\WVwO t8t뉃>"j\WVWO t8t뉃>"j\WV7O 68t牃>"ǃ>"ǃ>"j\WVN tD8tP>"j\WVN t8tPU>"h>"|$$W& |$j\PD$ P}N ǀ8tWku͍;UWPmth'UW"E5xxMf l$<$j\WVM 8t牃>"8#j\t$VdM t8t艃>"j\t$VDM tOǀ8t扻>"PW#l">"PWltbc`>"D$0P>"PQ諟 >"l$tэQPku>"<$j\WVwL t8<$tP>"j\WVGL X8<$tP>"t$t$1ɋ;$u ȁ ^_[]SWV[ܶt$ǃ>">"t P蛡&sPW蓔>"t*t+V>"{ju䍃>"}WP1^_[Í;lPOPQhRrZSWV[ t$ǃ>">"t Pˠ&sPWÓ>"t*t+V>"iu䍃>"}WP1^_[Í;l%POPQhRqZS[>>"tP#gǃ>"[ffS[L$T$ j@t$[ÐUSWV8[ִt$PT$$t$,ZT$LXD$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$hPt$t$t$ [ÐUSWV8[uD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$yXDP@Ӻ\$%D$ D$$OL$ۀU|$ɋĽuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P<Pt$t$M ZD$x$Wr<Pt$W" @D$x$WG<Pt$W )D$x $W<Pt$W D$x$W;Pt$W uD$x$W;Pt$Wv zD$x$W;Pt$WK `D$x$Wp;Pt$W <D$x $WE;Pt$W D$x$$W;Pt$W D$x($W:Pt$W D$x,$W:Pt$Wt 1D$D$$T$EHL$D$D$D$ P`:Pt$t$ D$@D$ P/:Pt$t$  D$@D$ P9Pt$t$  D$@ D$ P9Pt$t$z  D$@D$ P9Pt$t$I D$@D$ Pk9Pt$t$ D$@D$P:9Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ BQD$ KQ|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$*@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$TQ|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VR2D$Pt$V ID$ V#2D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$hQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$|A(|$€´|RRRPQjIRH&USWV[il$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[Xit$$|$(9jVPƿgLjVt$,# t$(<D$l$,L$ t-|$,RUT$rT$t .l$(RRl$(T$tX$|$  tQpT$ <$EFt P!F tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]Í> TSPQjKR[?eT TSPQjMR0?efffffffSWV[ì^t$W衎L"PVpW舎^_[ÐSV[m^VfL"PpVN^[ÐSWV[,^W%L"L"PQpW^_[fffffUSWV[]t$l$Vv]Vt$Z^1u<$Vt$2^DžtpU7t]wtуUPYt u막t$~utQ^_[]É1ԍ;lkT-TPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsTUTPQhR UU֍TPQhRUSWV [(SL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$uc:t)2ĕUTPQhR_' ^_[]Ël$ u렍΍UTPQhR΍UTPQhR S[nQt$t$jt$ [ÐS[>Qjt$jt$[ÐS[Qjt$t$t$[fffffUSWV[PM"|$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉM"uj(EƉDl$UĠtwn$Nj 0Q輼 10M"utjh=ʼnM"0ƃ0M"LtMjуM"@1t*n$FUQj PA)|$z^_[]ËM")USWV[kO M"|$i)Njtt+~%L$9N$ut1Ƀ|$tΉ$M"uj(յƉDl$U̠twn$Nj 0QL 18M"utjh8ʼn M"0ƃ8M"LȠtMjу$M"@1t*n$FUQj P'|$z^_[]Ë$M")USWVP[Ml$U(Nj(M"$tOs;1҉v4M"ljh=5(M"$uƃ4M"D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0M"tuR:t!jуM"tiE$SM"uj(fŋ$,tIEj |$WP WРtE@E$L$1E^_[]t$Рt@ϐUSWVP[ Ll$U8Nj,M"$tOs;1҉v/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[;Et$tD$tdPV$xaa1ɐ΍,?UQƶt&UP$y.w8"tV* 1^_[]ffffUSWV[ÛDt$VDM"PR@M"ƃHM"X tj~V:u^tVtDi@u\uRDQ@u말:u~u'@M"t Pǃ@M"ǃDM"1 ^_[]ÐUSWV[{C|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í8Z~ZPQhR ]ZZ~ZPQhR6USWVP[zB|$t$t#l$ t?tajUjW^_[]Í8Z~ZPQhR빍ZZ~ZPQhR]u;lZ~ZPQhR7xUSWVP[õA$L$d$p$l 2L$|$$h\$T$8u{@M"tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh蟧$p $L$1xjjjU |$ `J[PQhl$XUjjjh@Ujh@6i D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ 0i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$;lZ~ZPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPT$ )ʼnl$‰$L$\$(l$$|$ t t$ht$,D$l$ tEF4$ hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$o؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU衭5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP辠 Wt$DU谠 t$$t$ t$0ղ/L$0\$|$8T$L$ D$ɋ,$tt$T$eT$Ћt$ 9v8)PUܬ|$u(Ub!|$ |$L$1|$04$0rDM"PwK@M"P"DM" L$ <$14$豱$lyD$0P||$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW莠t_WVPǞ UUx~1L$ ȉŋD$8L$D$8B\$W̰ |$ t$cUUf |$;$LP^_[]60WHZL$ZՍ~ZPQhR9L$,8>[L$ZՍ~ZPQhRꋴ$tL$,ZL$|$ZՍ~ZPQh R|$L$,;lL$|$ZՍ~ZPQh R$|$L$,Ń|$ \$t t$b4$Y;lZ~ZPQhR,$|;lP[~ZPQhR$|Y\$U|$ t\$t$b\$t$0ǮdXO7L$ÐSWV[,7t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í8Z~ZPQhR};lZ~ZPQhRVSWV[\6|$t$tGtiLM"tP1ǃLM"ǃPM"ƃHM"ƃTM"WV^_[Í8Z~ZPQhR?uZZ~ZPQhRpS[î5LM"tPǃLM"ǃPM"ƃHM"ƃTM"1[ÐUSWV[U5$,E$$$(PM"uPM"ȋLM"u!sQ0LM"@M"t%1HM"LM"PQA4t $D$uz1LM"VgMVVǃLM"PM"HPM"@MsQP"LM"u<X1DN@u:t#t TM"<|\TM"@M"HM"$ƃHM"l$L$L$ $Dt\uULM"3uًLM"t:tuT$ T$V@tfV3ǃLM"ǃPM"ƃHM"ƃTM"l$=ǃPM"ƃHM"ƃTM"D$:l$VǃLM"l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5LM"tP9ǃLM"ǃPM"ƃHM"ƃTM"GV ǃLM"ǃPM"ƃHM"ƃTM"ǃPM"ƃHM"ƃTM"1E;$^_[]À|\u ƃTM"ƃTM"AZ~ZPQhR$<EZZ~ZPQhR$<8USWV _1T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd4XƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW.ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU覠tL$(U$W" ^_[]Í8[֍~Z$PQhR|$Z[֍~Z$PQhR|$|$(S[֍~Z$PQhRv|$&8Z֍~Z$PQhRA$ZZ֍~ZPQhRUSWVY-T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd贓t]ƃdNJD$$ƹdEt#<:tu)FdPWVu`)nu N$UW%t1L$$8$ [[~ZPQh`R$W{^_[]Í8[֋$~Z$PQh"R9L$VZ[֋$~Z$PQh#RL$|$$&[֋$~Z$PQh$RL$8Z֋$~Z$PQhR$ZZ֍~ZPQhR]USWV[*l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPڼ F(N8D} '~wF^ FPE^ uWv$qQ )tƒN ~?:V|@uH)ƒVԋ^ q9FF$BBQWP uvvP K~?:uFV;~t^ a ^ Q8u^ DF,;8u e^_[]Ë^ S[%0t$t$ [ffUSWV [á%} F FEFUVzRu)ʃԉF:FJFx9u0RuO N ;Nue^_[]fUSWV0[$D$(}lPQWXM"t$M L$ML$f|$ L$T$|$QRj WPDuOt$ rF|$j WPxb u0O L$FD$D$ PjL$Q 79_t$} ur\Q"tgM9uWM % ['QPR}Wuj19r"y";L$(XM"|jjPC PMD$t$L$ WLt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V\ uEPVu腏 ;EsD$t$W;KL$%D$"T$ ;UwRPuF 1ɋt$;D$(u ȍe^_[]覆S[Î"[jPE>XM"h PKA\Q"[SV[M"\M"hVt$t$t$%t1^[fffSV0[ "t$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[\t$|$jWj VW( jW؝^_[fffffffSWV[ t$|$t Ps(]PQ ~^_[ÐSV[ýt$ tP袱FtPvFFFtPvFF^[ÐUSWV[H|$(?u s(]PQ!t$$o;D$t U_vjjjj|$87 #Gʼnt$Pst< t< tt$Wrt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ PF D$ 1L$ &8ukD$ $FD$,t$UrmŃzAA jj t$\F ¿8軿8tq豿0|$(tPo$tPtGGGtPtGGS01^_[]Ë$fffffUSWVP[l$t$D$ $ t t@u$]t]7]PQj8R @QUVwЃt 躾0$^_[]ÐUSWVP[jl$t$h$ t t@u$]t]7]PQj8Rx@QUVwЃt (0$^_[]ÐUSWVP[t$ l$T$D$$$ t t@$u0]]Ս7]PQjpRt$0@$QVURwЃt 艽0$^_[]ÐUSWVP[:t$ l$T$h$ t t@$u0]]Ս7]PQjpR@t$0@$QVURwЃt 0$^_[]ÐUSWVP[Út$ l$T$D$$$ t t@(u0^ ^Ս7]PQjyR袶t$0@(QVURwЃt I0$^_[]ÐUSWVP[t$ l$T$h$ t t@(u0^ ^Ս7]PQjyRt$0@(QVURwЃt 觻0$^_[]ÐUSWVP[Zt$ l$T$D$$$ t t@4u3k^T^Ս7]PQhR_t$0@4QVURwЃt 0$^_[]ÐUSWVP[út$ l$T$h$ t t@4u3k^T^Ս7]PQhR轴t$0@4QVURwЃt d0$^_[]ÐUSWV[t$,|$0*T$>t .$ tEt@u%_^7]PQjJRE@NT$RQjjjuЃ>T$u-__^PQj[R迳T$,$ t|$ tEtHHu0U_<_׍7]PQhRh|$0EHHPVt$0t$0WRUуt 0$^_[]Í^^^PQj}RS[ÞhPt$t$t$t$t$S[ÐUSWVP[Zl$t$D$ $ t t@8u'__7]PQhRg@8QUVwЃt 0$^_[]ÐUSWVP[l$t$h$ t t@8u'__7]PQhRձ@8QUVwЃt 腷0$^_[]ffffUSWV[;t$l$PQW t"t$ VW WjjPtU+PQWZ t$fffffffS[îjt$t$t$[fffffUSWV[xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]XUSWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr覵 :T$$EjPcD$tk|$jWcD$,D$ tND$1ɅujWct3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWO|x9!xt19)u|$T$(l$);$Pw|$$XD$0PNƃjPbtQ$1 T$|$$T@uX$L$0PVQWG|t5W~D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ J|‹D$$t $uCr.P|$<1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Vx DžL$~9t/;$WVQƒL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j蝮|$l$t$D$Pct$ cUcVcl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$6ct$ *ct$c넍`4``PQhRA~`4``PQhR"`4``PQhR@`4`Ս`PQhR蒧`O`4`Ս`PQhRgꋌ$hRn`4`Ս`PQhR52`4``PQhR\`4``PQhR=NUSWV[xD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]NUSWV[l$ |$t$t V*1L$1jUWPV^_[]ÐUSWV[ël$$|$ t$t Vڛ1L$T$jUWPVp^_[]ÐS[^L$1jt$t$t$t$6[ÐS[.L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[èL$(T$ 7t$T$L$oD$L$11jUt$,jP`xD$Ƌ;D$u ^_[]LLUSWV[(D$(L$,T$$>|$T$L$ol$L$T$ jWPjU1xL$ȋ;L$u^_[]KUSWV[ë|$t$t Vޙ1oL$1jUWPVp^_[]ÐUSWV[[|$ t$t V莙1oL$T$jUWPV^_[]ÐUSWV[ |$t$t W81o1jUt$$PW^_[]ÐS[þoL$1jPt$t$t$[ÐS[~oL$T$ jPt$ t$ t$ Q[ÐS[>oL$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WquGكs^_[!t_t$t%<FF ^_[ÐUSWV[{|$ u ^_[]l$ t$Wqt t- t(WqtWP5 u뵃!}/=<,F,F ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVeot^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ o$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWnu#XDxuGws>4$$^_[]ËD$4  !rfUS [ÅE$D$D$D$PQ' D$e[]fffffS[>t$ t$ [ÐUSWV[$$%= uRl$/[4$Gƅt1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u ёG OJÑD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR8l$ǃt$<)l$ D$8D$D$14$D$Lt$78DžN( u" .uGt<.utʐL$tXw PW5ōG UTD$t1 .YMPNQPT$ Rc u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HR~?4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$h1Ha`PQh1RlD$u‹.(1F)EHftf },$FtpP @u|$t$u N)$xDuW@8/tOF(uIjh@P tFFU<$U<$u~yljF^_[]FUSWV[ t$tf8}t v$>V }t!v$v$v$?V ?WJ^_[]ÍaaaPQjBRփvfffffffS [[hPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[L$T$ hP[ÐUSWV ׉[ôT$4xtb=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWVC/=uD"كlTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[ÞL$T$ t$[ffffff̀rS[dt[̀rS[Dt[̀rS[$t[ ̀rS[t[SWV[|$t$t-9t!t F9u1^_[ÍbaPQj*RfffSWV[||$t$tt1WVjx^_[ÍyRPbbPQjBR藀uύRPbbPQjCRt뮐SWV[|$t$tt1WVw^_[ÍyRPbbPQjBRuύRPbbPQjCRfffffffS[~L$T$ hPt$ [ÐUSWV(T$ [BL$<\$%t$@|$t;D$<|$"v+61t$ \$VP-q\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXȷD$|$tt$ht&L$ptCwm\$y\$nc8cPQjxRs뵋\$Ńnc8cPQjyRs$vl$l1 D$͉L$4A\$PgD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$ŃF8cPQh&RqV\${cF8cPQh'Vq=cPQhrVt$xbq$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP  \$R1T^_[]Ë\$Ńc8cPQhsRd$\$Ńc8cPQhsRd$LUSWVTXD$ L$pT$htwL\$ j ֋\$ nc8cPQjxRd$vl$l1 ШD$ʼnD$4֋\$ P_:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ {cF8cPQh'VOb=cPQhrVt$x/b$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Qm1T^_[]fffUSWVP[|$88tqw$G$t,GO4$6tV1‹n1 uV ;WujnƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUjƅtF PVWo+ u$*jU7t@ PVW<+ 1D$t01^_[]f̀rS[Ät[ḃ̀rS[dt[SWV [It$ |$t[D$D$4$JW0L$jjPWjQ#1u#W9 u W01 ^_[Í;ldcPQj񐐐9t uD$))t8t)Pt u+D$ PeD^_[]ÍddPQj@ROND$(SddPQjAR'ND$(7fffffSV[íL$D$T$ y9dRVQPR6Q4P 1^[ÐS[ND$y%9dhQ"PQj@R{R hQ"j@4R hQ"[fUSWV[t$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JyR9edPQj?RL눍R9edPQj@RLq1^_[]fffffffK̀rS[t[USWV [t$ D$P,(7$4|S_ NL$ 9t6ʉi)iAi ˍ $8@04L$<T$ o9s9s}$?9r|t$^uA$t209r9r։@0t$^_[]É݃t209r9r֋9s9r9r봐USWV]H(|$0||$4 D$P&,t0()1ҋ(P1T$,ރ s;Dž,Dž4Dž8L$0A(<Q1@t$ sAs(1ہ1)L$,4$8D$0Hމˉ(|l$<Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉@0)D$L$0t$ͻ^_[]ÍeeFePQhXRG[USWV[xt$(D$.̉)ō $PC,t0()1ҋ(P,D4X8(t01@<4$轺D$^_[]ÍeeFePQhRFUSWVP[j Wc,tI@0010<($9r$9r$@0(i0mNA900W^_[]ÐS[Ήt$t$t$b [ÐS[Þt$[ffSWV[||$t5jWt ctVW(1^_[Í;leePQjARxE몐USWV[ l$t{jUt=ǾtUWUt1l$UPt$ L "19s#JJ8^_[]Í;leePQjVRDaffffSWV[L|$1t,zPWzt |$t=t=tƉ^_[ÐSWV[t$t-ġVW tPW V,^_[ÍDf7ffPQhRC믐SWV[Ì|$GPZtƉx @ġVP1^_[ÐSV[=t$ t%ġVPMt L$9H 1^[ÍDfSffPQhRFC뷐USWV[؆D$01t:>t41 |t$t$ t$ W9 uD$ <=u.|$$ Q"9ttD$0Q"M9u;Q"s|9v9tfPwǃQ"ǃQ"$jWP H0H8uyPD$0t$C )$jWP` G0G8u4)  $PjQC $Q"L$Q"^_[]ÐUSWV[8Q"tQ"1t0ġDtPVtQ"Hى|$ġjjD$P tE t5jVt$ F:Q"tVt$VŋD$Q"9tPǃQ"ǃQ"Q"UjPB ^_[]ÐUSWV[81tR/tL,t4t$t$U(7 uD$|=uօt D$1^_[]ÐUSWVP[Ú|$1|zPWtfƀ<=t^tR)tI1 $ $lt+Vt$Uw6 u|5=uمxD$8.1^_[]ÐSV[ԡPfƅtD0^[ÐSV[íԡP&ƅtD0^[ÐSV[mԡPƅtxD0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ʁD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[hD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[hL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[è}T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$sj[fffUSWV[s$j(j$hjvljt$VƢn"u<\n"ln"n",n",o"Vxn"$B z$HOHOO J HJ@BGGD$8jPD$8D$ED$ E D$ED$ED$ED$D$`t$HjhPVp D$PVvD$LVPƉGPj<GVL$dQP O4$NGFL$ jhPQ VD$$PD tp VD$$P/ t[D$$t$ VP\zfhfPQ,1zfhfPQ4$=1tffPQXL$ D$$@tQЃt$$@zfhfPQ4$Gt PW1t$;$ue^_[]Q.USWV[&ptzn$EjhPW VW t$ VW tD$WPffPQWD$@tWЃ^_[]ÍfffPQhhR+_XooL$\ÐUSWVH[EoE$DD$ChP;t]Ƅ$CFBljPjx6\9PQWVD$SPM;$DuH^_[]q-ÐSWV[Ìnt$|$ttAG$NPVQ ^_[ÍfffPQhR*ugffPQhRq*뛐USWV[ml$0t$,}~$juuPXo GtPGUD$P tEFEMN,$UD$Pd GONGF^_[]ÍfgfPQhRw)7.ggfPQhRM)}뛐USWV@[lMq$F9AFD$D$,jvPW$D$PW1t_D$0jPaD$0D$$D$jL$QPD$PD$P?tNjFMAVQ$D$Pt$VD$@t VЃ1e^_[]ÐSWV[kt$tF~$wGt Pv$Ft PV^_[Íf;gfPQhMR'fffffff+̀ffffj̀rS[$kt[ÒrS[kt[SWV[j|$t$t{WVVt_GhPV谤 tIGPVt8G PVt'GQjjWPVnu1^_[ÍggLgPQjGR&fgLgPQjHRw&BfffffffUSWVP[it$ D$8Vt$ 1;L$$wD$(q D$8 $t*twWt$T$4;4$sc|$(uVD$tcutZD$(PjNjD$8ughfPQf1"D$8ut$6^_[]ÐUSWV[h|$t2t$l$VUT$,tt$ u1^_[]ffffffS[Þht$ t$ [ÐUSWV[uh$$$t$Mtd$)VD$D$l$PUV q D$$ht$jUCL$u$1ҸD$D$MEf}T$ twPUV* f})D$9 $D$PU$jp ) ${).|$D$D$L$PQ|$WRVy x4D$jPWt$V@ xD$$|$33Ƌ|$+͍D$jPt$t$$ y((;$u Ġ^_[]fffffffh̀rS[tft[WV^]fD$L$|$T$ :trJJ B^_ÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ A ÐSWV[Üet$|$O1)rD$OVw P w ^_[SWV[\et$|$O1)rD$OVPw _ w ^_[ËL$A +AÐVL$Q qt$ Q1)| q Q^Ð1ÐÐ1|$uD$ L$IHÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ Q ÐVL$ T$r1)r rB J ^ÐSWV[c|$t$t0tOWVjtGhWPV 1^_[ÍgggPQjWRuZggPQjXR됐SWV[lc|$t$tt3jWV蘗 ^_[ÍgggPQjgRu͍gggPQjhRb묐USWV[b|$l$WUA1toGOhQPUtUo UPtBEtD$u-wPWGPl$U?tWU.^_[]Íg hgPQjwRvC9 hgPQjxRO$gggPQjWR(ZggPQjXRSWV[Ìa|$t$tOtqWVt(t%uGPV>t WV-1 WV轔^_[ÍghgPQhRgu1hhgPQhRAhUSWV[`|$t$tLtnWV虍t3oUV(t"}uG jQWPV蔘1^_[]Ígt1^_[WV轌tGPVLtۍGPV蛌tʍG PV芌tWVy묍gWhgPQhRmAWhgPQhRFUSWV[+_t$|$Gt/uTot^REwnl1o  u-GFGFFnFn GFG    AdhgPQh$RnrhdhgPQh%RDrhhgPQh RGFGF^_[]ÍrhhgPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[ô\t[v̀rS[Ô\t[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[[|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1RhhPQj:R]hhhPQj;RqVAUSWV4[Z$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFhl$0PQjUa3U $\9ȋ$QU$`- FfN,QPR$`U$`21Ʌ9$Fx$P$T)hPURQ2*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L,QPR$`$`2l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`x~$PEDL$oNiPQ|$W$`U0t;$Tg$P$T)D$D +P|$Wt$L$QRb0L$)D$D Pt$t$t$R)0L$)D$D Pt$t$t$R/L$)D$D Pt$t$t$R/L$r)D$hD Pt$t$t$R~/L$9)D$/DPt$t$t$RE/L$)D$DPt$t$t$W/19D$F$PED$1$1oD$ +D$NiD$׋D$ tD$ $ 1QPt$t$U.H)D$>Ń19t$un 1f$PL$$T)fv fD$ hVQURt$.L$ ;$T$ڥT$0L$RQPWt(8W$\9vpD$0Pe;fǍh$0PQhW-W:$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGhT$ PQhR(= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í5ihPQhR E5ihPQhR $$b}D5ihPQhR ;KfffffUSWV[%N$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPRMt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP谊 uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tOfffffff̀rS[$Lt[USWVP[ LPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pg 8^_[]ffffff̀rS[dKt[SWV[LK|$t.jWG=tjW^_[Í_iUiPQj@ROfffffXJL$rÐSWV[ìJt$u8kiiPQhrRVtF~tP^_[ÐUSWV[5J$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W賿tGotP蚿܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$)mmiPQhfRF HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$13A<tY<uyYQuy uyuyt{wqhQ)t9uGIu *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RXNjD$$fxxt$ T$@>P\fD$>P\fD$>Pt\ f|$fD$f|$"D$<$$!|$hVWt$8R$XgD$D$$fxxVT$@HVNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$@VWP$Pj%^΍Gfwhj$PG DŽ$DŽ$DŽ$DŽ$jND$$%ND$WNHlPt$t$t$DQ$Pj%譧T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWlYfD$FP[YfD$FPJYfD$h$!Pt$ Vt$8W#UfNjD$$fx$!xVUAV=*h({L$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~Vi<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u y0o"T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V;L$tL$8$tYt$`~l$(u2D$4t$%Ut QkvF Ut$`)L$8uBffT01l$(E;$%b%^_[]Q聇TǍ+l΍!l׍iPQhRE:l΍!l׍iPQhR$%]k΍!l׍iPQhR.E΍!l׍iPQhR$% kύkiPQhRx$%~ύkiPQhRC$%MTrWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[6|$F$ jP~Ņtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P" ^_[]ÍkliPQhR@lliPQhR|$EliPQhRoUSWVT[ 1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4;D$ D$$L$j L$QtL$t$ t$膀e t tt,…tt$ PHu$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RJqT$GtItu܍kiPQhR}T$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1􍃼llύiPUhk RklύiPUhl R~USWV T$[B L$8D$ l$4"t$@jV1]F1t 1Ƀt Du`1<$L$D$ Pl$ U,1lPU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ P 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UnGt!D$881<$;D$ ^_[]ýWt‹GwtP܍k͍liPQhR{E͍liPQhRMkmiPQhR$kiPQhRkfffUSWV([u$H$<$$E UPM 1U4$Um$DUtڋ$D0Wۺt4$DptPW蹺tu뗐$@tP$Hp 腺j$DW訸H1$@T$t.$@sT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$4&t$$DPG D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$CT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$BT$L$ ut$t$$LU;lmjmPQhRBhfSV[-t$ t,FF#EgFFܺF vT2^[ÍnJmmPQhR/밐USWV[øt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ј L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPs^_[]ÍnJnmPQhRnnmPQhRUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW~ ;D$uY ^_[]ÍJnmPQhR<nJnmPQhR]ffSP[ÝPt$1Ƀ $ȃ[ÐUSWV$Yht$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RNWjPP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W| Pt$l$ U| t l$ /D$D$<F\$hPWf| |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~{T$ \$WjRFT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R{ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$zT$ L$E E$\$l$TUg\/4$UT\$L$$9sD$DQ3\1ɉȃ0^_[]D$D捃nnnPQj]RW\$@SV[}t$ t V[^[Í^nnPQh/R蟠fffffUSWV|[(j$ 1tGljPW节t)l$XD$\|+W Ws1|^_[]jjWjjUjcHWHt҃|D$ l$<$D$ƅuUW 뚐USWV [H|$$(rl$ NBCD3EB 3M tI1 ^_[]Ë|$,jF4~F:F:t1F;pS[~t$t$[ÐD$@ ÐSWV[LT$|$9W v#wG,ʃt$<u0 Ћ0<L  )r;GvD$Ot$1^_[ÐUSWV[Øt$,~$ED$\$Pv(t$Q 9qud)$?jD$(oD$4$iUu2藈 t$ qL$$D$4o |$D$ l$=oD$$$$`$ttl$$;A&$`t %"l$ mo$D$D$ft$H D$0Iut"l$ vo$D$D$Sft$H D$0 ut"l$ zo$D$D$ft$H D$0tt"l$ ~o$D$D$et$H D$0tt"l$ o$D$D$et$H D$0Itt"l$ o$D$D$Set$H D$0 tt"l$ o$D$D$et$H D$0st"l$ o$D$D$dt$H D$0st"l$ o$D$D$d$`t|$4tyivL$DL$ oL$,$D$t41Nt yI u6J qL$$D$ D$ L$@L$ D$o|$,$軲Nt yI u6ڄ qL$$D$ D$s讄 L$ L$8L$ D$|$,$$`t% tl$$ )"l$D$$t$H$l$D$ $vl$D$@$Zl$D$$>|$Du(f|$@u f|$<uf|$8ul$$ !x^_[]ÐSV[mt$ tLtQ 9qu/u' qVQjP謬 ^[ÐSV[L$t$ t yu bivtXt4t Q 9qu'i qVQjPL ^[ÐUSWVHT$[a$`$DL$`!ƅteT$d8t3ʼnt$ 4 t$v6 w.*w&?www:w^[ÐSV[mt$ )tYj(PV;t ytYhVQj(P躝sY^[ÐUSWV4[$D$0D$I<u t$HFL$j.QPjuFfwT$PQj.R;$tEL$PQVQ D.0;D$0u 4^_[]'USWV([Xt$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXh1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$xx֍wPQhRvqːUSWV[}dD$|$D$ D$P0LlHHPP1x0ppp RQWjV$r D$ƀe^_[]USWVP[jl$PU΅0PU超oPU螅PU膅oPUnoPUVRPU>vjPU" 1uRXMDHt?uj PU u8u$8 L$A.&L$0t9^_[]ÐUSWVP[ڲl$OPU)txF u6[zjPU! 1u[XMDHtHtj PU xt8u $8 6D$t8^_[]fffffffSWV[|$t$jWMGHO~;G~ t H WRIjWLO^_[ÐSWV[ÌT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[9|$(D$$u$PccD$D$D$D$ jWLG0u ǀD$PW.@jWqN^_[ffSWV[ì_Ht Jt @t A ?t/t5GtPWu0: E49s%z`zjQjhRE4M01U0)E41u;D$ / u E P#yPL$Qjd$+Wp~9E4>PWu0X: E49s%z`zjQjhRE4M01U0)E41u E PrPt$jd$+W}9E4=PWu09 E49s%z`zjQjhRE4M01U0)E41u E LzPQjd$+Wi}9E4=PWu0Q9 E49s($z`zjQjhRE4M01U0)E41E4u0} MU $PVu,W<CE L$)T$X$h*RQPID$ .}4$V<E0f (E4w($z`zjQjhRE4M0QU0E4A$yI.}$$u M QU Qqu I4$y$QRPVjd$+P|\$9E4;P$ +Pu07 E49s%z`zjQjhRE4M01U0)E41E L$)T$Xh*RQPG"}4;ƋE0f (E4w,z`z$jQjhR\$E4M0QU0E4AyD$"M }4E0T$WPo<BzjE }4v:E0 E4u($z`zjQjhRE4M0QU0E4AM }u ;L$:T$$WE0P;$( E LzPL$Qjd$+W%z9E49PWu0 6 E49s%z`zjQjhRE4M01U0)E41E HM @Pt$jd$+Wy9E4J9PWu05 E49s%z`zjQjhRE4M01U0)E41E E PE Pt$jd$+W%y9E48PWu0 5 E49s($z`zjQjhRE4M01U0)E41M AE  L$Z$$L$ L$zL$`zL$)M01U0)E41E E |$$V$Pt$jd$+WDx9E47ƃD$PWu0'4 E49s$jt$jht$(D$$E4tE ;D$7}0 $zT$zT$ `zL$ M0QU0E4AE ;D$77T$$E4PW 9 E E ;D$sƃ}4 7E0 E4u$jt$jht$ D$E4t}4u0E WVu,P6r}46E0 E4$u,z`z$jQjhR\$E4M0QU0E4AMU WVu,E P},}$u E LzPQjd$+Wgv9E46PWu0O2 E49s($z`zjQjhRE4M01U0)E41$E HM L$HM pQSE T$(|$$JzVPjd$+Wu9E4?5PWu01 E49s($z`zjQjhRE4M01U0)E41|$$^E L$ L$zL$`zL$)M01U0)E41E E D$$$Pt$jd$+Wt\$9E4a4PWu00 E49s$jt$jht$(D$$E4r}$u4u0u jM t$)΍VUUUЃ=7E43}$E yPQjd$+Ws9E43PWu0/ E49s($z`zjQjhRE4M01U0)E41E $E  8;L$T$D$dD$`D$\D$X)*Ƌ$P$ +Pu0& E49s($z`zjQjhRE4M01U0)E41E4D$E0D$<|$rv)$L$zL$ `z$E0 E4ujt$jhVD$E4M0QU0E4A}4s$@RD$|$XWu u$Q>E4u0} PVu,W()E L$)(|$1ҋ$L$L$ zL$`zL$$+р਀tpRPt$jdVh9E4u(PQu0$ E49s $jt$jht$$D$ E4M01U0)E419T$ (ыE $+$[}$ $u E E $PE  $~y|$X$PVQj2W h\$9E4'PWu0# E49s%z`zjQjhRE4M01U0)E41M u4}0T$VW)$ E }4$'E0 E4u($z`zjQjhRE4M0QU0E4AM T$$VW(s$E }4&E0 E4u($z`zjQjhRE4M0QU0E4AM T$$VW&($E }40&E0 E4u($z`zjQjhRE4M0QU0E4AE MU $VWu,P2}$E LzPL$Qjd$+We9E4%PWu0! E49s%z`zjQjhRE4M01U0)E41E HM @Pt$jd$+We9E4 %PWu0i! E49s($z`zjQjhRE4M01U0)E41E E ;D$$ $T$T$ zT$`zL$%M01U0)E41E E ;D$X$$Pt$jd$+Wd9E4E$PWu0  E49s$jt$jht$$D$ E4zE4u0} PVu,W $}4#E0 E4$u,z`z$jQjhR\$E4M0QU0E4Au _E PB#yPL$ Qjd$+Wc9E4S#PWu0 E49s%z`zjQjhRE4M01U0)E41u E PPt$ jd$+W/c9E4"PWu0 E49s%z`zjQjhRE4M01U0)E41u >E E P)E E PE {yPWVQjd$+Pb:}$u E E PE E PE {yT$XPWVQj2Rb9E4!PWu0 E49s%z`zjQjhRE4M01U0)E41E4u0} MU |$XhWu < WS:9E42!PWu0{ E49s($z`zjQjhRE4M01U0)E41 }$E H }$ T$XPRVQ1-o}4${ ƋE0f (E4w,z`z$jQjhR\$E4M0QU0E4AyD$$T$X$PRVQ,D$ T}4$E0f (E4w($z`zjQjhRE4M0QU0E4A$yE4wt$(M0fA  QU0E4A|$XVWt$,u +9E4$$VWu0o E49s($z`zjQjhRE4M01U0)E41L$$M M E4;L$s\}0u $M0fA  QU0E4AMU E4PWu,V&E4L$9M r$[E0f )E4B$z`zjQjhR$zD$+E }$tozVQPRjd$+P:^c9E4$V$ +Pu0 E49s($z`zjQjhRE4M01U0)E41E t$9$QxL$ )M0\$U0)؉E4} } 9$Ƅ$ +fDŽ$+ )lj|L$|$L$D$Pt$jb$+P*]ƃc9|$tGE 4+d)8$Pt$RQ\}ƃcvn$|$9u4ZV$ +Pu0 E49s($z`zjQjhRE4M01)U0E41$0}4E0)E4u,z`z$jQjhR\$E4M0QU0E4AM4E0.szD$L$.)E0 E4u,z`z$jQjhR\$E4M0QU0E4A~`}4sf E4w,z`z$jQjhR\$E4M0QU0E4AƄ$ +fDŽ$+; |$~.L$L$D$U X0}1b\$1< +9t4 :..x DN.ẗ< +L:xDN.t뼍G$D$t)D$:x DF.t.D$+9E4Pƍ$ +Pu0) E4t$9t$|$b$z`zjQjhRE45}BD$E4D$E0"T$FL$D$L$zL$`zL$D$ ,M01U0)E41L$0ЉȉL$9L$ $t$ 2\$9E4Pt$u0* E49s $jt$jht$$D$$E4M01U0)E410|09u4$D$XVPu0 E494$jt$jht$$D$$E4' FL$D$L$zL$`zL$D$ /M01U0)E41L$0ЉȉL$9L$ $i $t$0\$9E4Pt$u0 E49s $jt$jht$$D$$E4M01U0)E410|09u4$MD$XVPu0 E491$jt$jht$$D$$E4 NjE ;D$ HM 3M01U0)E41D$ $+$L$ɃtyL$u2E4׋M0A  QU0E4A D$ yRPjdVV9E4XPQu0 E49Q$z`zjQjhRE4$}$ }$LzPL$Qjd$+W0V9E4PWu0 E49s%z`zjQjhRE4M01U0)E41E HM @Pt$jd$+WU9E4UPWu0 E49s%z`zjQjhRE4M01U0)E41E HM @Pt$jd$+WtVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s'D$D$Q@(D$ 9s$z`zjQjhR)))x ^_[]1))lj$zz`zPQhR_!뽐USWV Չ $[dT$8D$4 D$L$D$"u$z`zjQjhR|$4QA$93<$779$xzD$D$zD$ `zD$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$z`zjQjhRMQUA+<$- %$D$4L$D$ ^_[]ffffYbT$4D$#ѨѬÐUSWV[kb|$ l$t$~Jt$~2UV1x(ƃ|$tލF9wȉ9v-$(+t$^_[]ÐUSWVP[a|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }#(^_[]E ffGftC,$RWxǃ9w,$)xD$ hHGftf,$RWšf 8 9Xσ95,$)5|$ oGwtc,$RWS 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [X_|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.  ^_[]Ð~34$U菟x(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quu賞]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[\|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.a^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu[U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X(Z\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōT{zPQhR[|$ ){T{zPQhR._{T{zPQhZRfffffffUSWV[ËTD$$L$1w|$ u o0{PUWVt$(t$(QR1 XTL$ul(ÐXSL$w1USWVXSD$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$>;{{PQj>R7;\${{{PQj?R USWVP[ÚQt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í{ |{PQjgR 1fffffXPs"ÐS[~Ps"ht$ P [ffffÐ1ÐX/Ppu"ffffffUSWVX[Pl$lD$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: r\MnYL$"jWRPj2Q) 9D$"PD$tPp7D$p$)$iǓ$))ŅtVT$YT$"jDPQj2R()D$"Pt$t$V64$t$ T$T$D$@L$)L$tOt$ Y|$"jHQPj2W()D$  W|$W}6D$t$ $D$kTWPڋ$+D$pffffffUSWV[Ll$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[%L$$$hWP! x3l$hU$( xUW<1Ʌ;$u ȁ^_[]襯ffUSWV[ËK|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[ K|$t$l$tt$$PW%t ^_[]VW t W LJWVUF ͐SWV[ÌJt$|$jW1Ƀ PVW ^_[ÐUSWV[KJ|$tt$O#PW$tG 0l$VW/ t WRLJWVUM ^_[]ÐSWV[It$t5|$r#u#jV#tjV$F1 ^_[S[nID$tL$ ttu H1[i [ÐSWV[It$t_|$G?wSL>1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[ÌHt$tAjVq"t2|$jV"wsf~ 1c ^_[ffS[HL$T$ hP[ÐUSWVT$0L$@[GuD$\VD$ Pǃx\$D$t6g=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$T$L$H$D$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5QV t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$#t$,PVD D$,\$VPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[(|$  7 >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[<'D$HrM %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Í&t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[%D$ L$t9u[Íw}i}+}PQjpR9S[~%D$ #L$t9u[Íw}i}+}PQjpRD$t&L$tu1u 1tÐS[$L$ D$Qss)ǀ[Ãuu ǀ[Íw}i}+}PQjpR5S[~$D$tL$ t 1[[ffUSWV[;$j 1tQ@@jjPl &(8t(WF(^_[]ÐSWVP[û#|$tcOGQ9u0$jQPHl 08t  G $GT$pw1^_[Í}}}PQjZRySWV[#t$tRtC|$t3~t-0X~r4?;~rP,V#^_[ÐUSWVP[ê"t$t@F$t*.1tt$Vt 9<$u1^_[]Í}}}PQhR뜐USWVP[*"T$J $Ћ*1|t$Wt94$u|$ l$tW1E$F;$} $)Qtu<|uprP $كU|~֍g7PQj?R*S[L$T$ t$t$[ffffS[L$T$ hPt$ [ÐUSWV,T$ XD$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E vdy"udy"PP t&D$j.PWV!tl$t$dy"D$PL$QRPD$PWUM  $t!Ql$|$TG )|$TWT4$Ѐl$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j"6D$0$Do5Vd5HlPW|$t$8t$HQj%UT$T$@t$$P6#tt$6Pj%$D$@9F f|$0u D$(8gt$|$u$L0V葮ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP}T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRm l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V =~ $!D$1$D$$1D$\$|$$Rq1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<$=(ƋD$L$,)9Qt$@P7e D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURP踍 4$ol$l$$T$8)ƒ)19s@QZo1$X;$(,^_[]Ë$LnRPU5 1‰(+l!l֍PQhRֳ:l!lT$$PQhR詳T$4z?|$46[USWVT[$h>Wt1T$ T$G j(]¸hl$D$D$ D$$D$;$1|$ D$ l$Pt$ Vjǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tPW5jt1ɀ8 L$L$D$D$L$ t WP賩tT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]Í̀PQhRw]̀PQhRPBMUSWV։[_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUEw$T$ E ulD$;tM ǡE=t܉t$L$4QP~t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP}L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tRTD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQTD$e ߋD$)D$Uɐu E;D$UqtjUzİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QSE0EEEe jUz1뙋t$uyb)Eۍ_s=PQjGR菘{s=PQhRhD$D$ D$Ns=PQhR1EtfffUSWV [øt$@|$4u5>FD$FD$\$jt$8w1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$PQhRau>PQhR;dUSWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]Íg>PQhR衑u>PQhR{dSWV[ |$t$t:t\ttu FWVPFWV1^_[Íg>PQhRu'>PQhR֐뀐SWV[l|$t$t:t\ttu FWVPFWV1^_[Íg>PQhR\uł>PQhR6뀐USWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]Ígт>PQhR衏uт>PQhR{dUSWVP[ |$l$tStuEt8tu-$EQUPEQUt$1^_[]Ígނ>PQh%Ruނ>PQh&R軎dUSWVP[J|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Íg>PQhERu>PQhFRaUSWVP[Ê|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Íg >PQhdR^u >PQheR8aUSWVP[|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Íg#>PQhR螌uA#>PQhRxaUSWVP[ |$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Íg0>PQhRދu?0>PQhR踋aUSWVP[Jt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]ÍgQ>PQhR{TQ>PQhRTg͍>PQhR辊4USWVP[Jt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Íg[>PQhR{T[>PQhRTg͍>PQhR辉4USWVP[J|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Ígg>PQhR{Ag>PQhRTUSWVP[j|$l$tStuEt8tu-$EQUPEQUt$1^_[]Ígq>PQhRAuq>PQh RdUSWV[ë|$T$tL$t )ŋt1tXuQBWQRP t?t=G"UQWP%BWQRP ttG8UQWP 1^_[]Íg{֍>PQh*R@FT{Ս>PQh0RL$(,USWV [Øt$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}uPQh^Rn>PQh_RGs>PQh`RLg>PQhR4>PQhR̄ SWV[\|$t$tt=hWWV^_[Íg>PQhRkuÍ3>PQhREUSWVP[l$t$D$ |$$=_t"t4uuFQVte$EE$FQVPtFOt+E9t, t W9GuL$(t t$ Vу1^_[]Íg>PQhRAǍÃ>PQhRу>PQhR݃>PQhRłgq>PQhR蛂q>PQh RqzUSWV[t$ |$m7$t1u$Px1tLt-l$T$BL$QRPt)T$BL$QRtll$1;l$$D$0tN1 $uPj5D$ tuȾ)1Z $UL$Ql$$U+ ǃu=}u7u34$(<D$ 14$<D$ ^_[]ÍhfPQ1܍g>PQhR豀q>PQhR臀JSWV[ |$t$tt9h(#WV ^_[Íg>PQh?RuǍ>PQh@R룐USWV[Èl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Íg >PQhWRL& >PQhXR~%USWV[xl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Íg>PQh{R ~L%>PQh|R}%SWV[l|$t$tt4WV^_[Íg2>PQhR}u̍&2>PQhR^}먐SWV[|$t$tt4WVJ^_[Íg=>PQhR}u̍%=>PQhR|먐SWV[l|$t$tt4WV^_[ÍgJ>PQhR|u̍&J>PQhR^|먐SWV[|$t$tt4WVJ^_[ÍgZ>PQhR|u̍%Z>PQhR{ffffSV[mt$t$Vt$t$t$x~>.u^[ÐS[.t$t$t$t$t$[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[޻t$ t$ [ÐS[þD$t$ P[ÐS[Ît$[ÐS[nt$Z[ffYO ÐX/L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$8t$4D$0<D$|$щ9t9}E.L$ D$D$$<@t<S3A6D$!t  9$<@A)ߋD$t‰T$$lPWL$Q|$9L$ 9T$t$|$D$)$8RWQPݒ|$L$Y9OErt$\$t$X( ;!ЋT$ )$pPWRQH݋\$ƀހ:w6$<u9E\EQ~߃^r}};|$tE\<< $:(ukdT$Ɖ*t$i $:(|$ui (Ћ4$(Uh|$9EQ\$( ;!ȋL$ )$8PWQRL$9D$\$t$;)$tVRQPӐL$xW9sQxMl$ŋ|$݋\$\$ҋt$4L$8T$9u ~n.9s E)$ y(^_[]Ë$xᐐS[îjt$t$t$[ÐUSWV([x|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ Rn0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[L$T$ hPt$ [ÐUSWVT$[òɉ$t$4|$ |$0t=D$0|$ "v-f1T$VPR\$u+t-t$0u#D$ D$t$0t@D$u20u- iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF #:-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F #:-00u҉u #11Ɂ<$)ȉ #^_[]USWVP[qD$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[Üo88tW ƅ~102jj!jPu Wɠ^_[ÐSWV[,o88tW蚠ƅ~,102jj|!jPfu WY^_[ÐSWV[ünhRƅt(T$jtV081^_[SWV[lnt$08Vx08^_[ÐS[>nt$jt$t$[ÐUSWV8[nM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3 #11uPz,R\#H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF #JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[j8}tl<$PQ軝 #$t`#ux`#KDž<$}t+Pƅ,$~,01K #,$|$1jPUjW/DžuP躛^_[]hmPx`#jQWRFUSWV[i88t PIƅ~+01Rl$|$ #u1jP UjW[DžuP^_[]ÐSWV[D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[9a|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ lDPQȓ #jPo|$x ,^_[ÐUSWV[Û`T$D$t$>O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[`88t+P舑ƅ~"0 #u1jPI4$t$|$t6BR lP~;yQi|1)΃<$uP^_[]ÐUSWVX8_L$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[H^88tV謏Džt> 8 #ujj}l$(D$$$t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$V蕎$^_[]ÐUSWV[\E$$fBt π?:t ?:uʀ/\$ uuPW%|jPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ WuD$HhPW蝄 ,D$(WDž$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xW5}t$D$(0W}DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[ÑNtK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9u <;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$ip/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףiQl$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$iQ9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[F +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍè1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƜ1i4Q9uB ^_[]ÐUSWV0T$ $X@D$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ 1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[þ9x`#PQ`kt`#[ÐSV[Í9 #j}tj^[ÐUSWVT$4X<9D$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[,l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í~PQjFRqʆ~PQjGRj|$$b9~PQjHR@>ffffUSWV[+l$t$|$tU6^_[]Í*PQhRʐUSWVP$[e+t$`#UR[t,jtPx $Hp `#`#17"`# xuxt)txu8u밾UZ^_[]Ã듍L6PQhRKUSWV[È*`#D$ P}Z`#`#`#$`#L$b#L$ǐ|$$tD$$9G t GtO`# tGwЃ GЋ`#9t`#DžuZ`#u';|$r$;|$s<$$<$C<$1`#t$ nY`#u#t7W衠u^_[]ÐSWV[)t$`#W Y"`# xuxt&t xu8uj蜏u $p@@ `#`#1WX^_[ÍL6PQhRIfffffffUSWV[5($$$$$tD$$DŽ$DŽ$ $$jPW$@jPEXDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^YPQjPRh\YPQjQRAT $ ;$u ^_[]踊S[Þ&ht$t$Pt$t$7[ÐSWVP[k&D$L$T$t$ 4$hVRWQP^_[ÐSWVP[+&D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[%t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[l%L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[ %D$ L$ $XQPRv[ÐSVP[$D$L$T$$XRQPV`D^[fffffUSWV[Ø$T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQK_O֍PQj=R8O׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]ÍOPQhRL$8AffffffSP[m"D$ L$T$$RQP[ÐSVP[<"D$L$T$t$4$VRQPA^[fffffffUSWVP[!t$|$PV13ht$t$ WK x=|PCLfF FfFfn vF$F,F(F $tjjjV|^_[]ÍE? PQj>Rq)ffffSWV[ |$t%jW聼w jW}^_[Í_RPQj;RfSV[Ý D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[[t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]Í_ÈPQjL$aD$L?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P]\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $LXD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $ Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$Pă\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$_Kˈ$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $tBD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$_Kˈ$PQhRUD$뀉׋$tG|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$_Kˈ$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$dB|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$_Kˈ$PQhRBU|$뉐|$UD$xT$ Ӌ$dClj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZht$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P;E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PK<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [D$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$eI$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[ãEET$@t$DT$$dpU }\Tj]jD$܋tT$\$8t$<EΉ7tƉP1t?D$|=WjP0 )ĕjRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[m|$hE t$p |$<$ MM$UpTj]jl$l$܋t|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )ĕjQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[0Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$TjuL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$]j؋E\$ĕju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃|܋|܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋\|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػ4|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋\|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك\|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃4L$T$vث4v؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋\|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU($t?$L$U9.$1xL$^_[]þTx0ffffSWV[Ìt$|$ty8L$tu1 1 ^_[ÍaPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[ðM1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1FTj<]j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃|܋|܃$ۄ$܋҉t$$~@CM ~O$VRM$U ĕjQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$كt|$tT$L$؃ݜ$$$$$݄$D|$@ػ4D$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكtD$!؃|$8=؋\كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋\|$XD$X fD$hl$h۔$l$X$$ڤ$t؃4D$D$9ك\|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ث4v#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋\|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ܞD$1r 1 9vW<t8Ɖ^_[ÐSWV[|D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[SVH[śD$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQjT-D$$D$ D$D$D$D$D$jPj-\ j[j[S[ޚS[þfffffffUSWV[Ût$|$tK1tƅtUWV/ .^_[]Ír:PQj?R}VffffUSWV[ l$t/UBLƃVDžt VUWc/ ^_[]Í{PQj:R Vffff̀ffff̀rS[Ät[S[njjt$t$t$t$[ffUS[5Mt6C$D$i@B)iD$jP1e[]ffSWV [٘|$ t$t=D$D$ <$L$jjPVjQG'1Ƀىȃ ^_[Í;lPQj;RTffSWV[\t$FN ue9rF;F|@FPh6tHNjFN PQR- V<7GHND^_[1L$AQ u9rÃÐUSWV[ËL$t$y9~}V6W5ƅt\ȉ1ɃFщNt2 V9w)yQhP}U >t (h1^_[]ÐUSWV[Ж}uu \$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ#t$(PV'T$4D$(VPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[e |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[eu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[dt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX?cǀ(c#ǀ,c#fǀ0c#ǀYc#fǀ]c#ǀ9c#fǀ=c#USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ bD$H~( 1u 9r1$PƉ^[fUSWV[ëaL$8?tP蓑 wc#t{c#?u1>P-ƅD$t/Fn?tP3FF ^_[]1?tPd#)ʉʁ oΉoUSWV[ë`t$tbF!r VO8}t3W}}Fc#c#tW[c#c#^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[Ø_l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P-}T$,Bc# c#ti4$\8}th$P1}Fc#c#t14$轍$c#T$, c#D$TG^_[]Ëc#c#1␐T$1Ɂsrr@r"y(6s@sރx @tS[\j,tL$H@[ÐUSWV$[ø\D$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU/<8?t:V轇?Ec#Mc#$t#V蘇D$c#Mc#$^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[VD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [CTE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[eQ$t|1q16PQjERx P$1D$jjW;{ ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[Pt$t$jt$0[fffffSWV[O|$t@jWqGHO~ H0 WjWR^_[Í_=>PQj=R 럐SV[mOt$ t%FHN~ H V^[Í_r>PQjIRy ffUSWV[ Ot$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) p1^_[]ÍPQj>Rw fffffffSWV[M|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:_ˋPQj8RW f  ^_[f̀rS[Lt[SV[íLt$ t;F0u ǀVNuFH^[Í_<PQj;RfffffffSWV[,L|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WhG GGfG u WG t'DV|LPV|GOQPwW$ GO fO 1!t Gf@f  fG ^_[Í_zDPQjJRSV[íJt$ tF Ш u Vk1^[Í_DPQj;RSWV[\Jt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWP覈6@VRQWPL^_[ÐXIL$lAA A AAAÐfffffUSWV[uI$u hj1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVp VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC?o(1Vٻ(1^_[]14dž$j$&tJpHH\H H HlHH8 8oUSWVՉ[CjqRlj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[IB4jQ@# t T81t>0trPtB_t u8~)1 9}8tQ݋t P,lVܸt81^_[]ÐSWV[LA|$tOW蒸^_[ÐSV[ AD$ p|$s t.jt$ 1dž,dž,^[S[Þ@L$tAt[[ÐSV[]@D$ p|$todž,1t$t$^[ÐSV[ @D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[È?l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNA͌׍PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wOύ͌֍PQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRԳu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[\<|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[;|$(o(o(OG0!D$;G9} $wD$D$ Pq$L$L$D$QPt$荠 $L$QjP t$襲$D$ Gjw« $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$WY ^_[]ÐSV[í:t$ t$t$ #F,;F(~#F0^[ÐSWV[f:4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nft`=uf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBryo7PQjbRrUSWV[)D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Íyo7PQjbRPfffffUSWV[ &|$oEtjPu7 EjWu,EtP E EtPDžDžtPĜDžDžU衜W蘜VO^_[]ÐUSWV[%|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[#D$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_Ǎ#D$tL$ P1d1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV["L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$yo7PQjbRT$(L$?yo7PQjbRZT$D$yL$ o7PQjbR*D$L$_yffUSWV([èD$i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W + $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ju9tC;D$$uL(^_[]͎tPQh<R0j$jU0 볍̫P"VUSWV[Õ$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$1PQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$1PQh|RƐ\$T$\$yo7PQjbR蕐\$T$\$1PQhRa\$T$\$1PQhR-\$|ffffffUSWV[è|$8D$,hEtjPu_ E wJrr G&E(uI1GXT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZcyo7PQjbRɍIyo7PQjbR虍w8yo7PQjbRn;E,jjuK[ ǍyD$wsZtvG GtfAjWu\ jVuZ DžuEo7t$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tyoT$ 7PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPFE EE($}fu E(jQt$xsB t7t$t$jbP臈эyo7PQjbRdD$yoT$ 7PQjbR8D$T$Ǎyo֍7PQjbRUSWV[Ë|$l$t$FtPBF FF($nf~ F(^_[]USWV[6t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7yo7PQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍyo7PQjbRR!fffffUSWV0[u~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍yo7PQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$yo7RQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ yD$oD$$7D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$PPPPP PP|@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^ƘL$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[.t$t$t$ [ÐS[t$ t$ F[ÐS[޹L$T$ j[ÐSV[ít$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVXE$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[ t$ tA|j@PV{D FPhjPHm F@FDFHFL^[ÐS[ît$t$t$ [ÐS[~t$ t$ [ÐSWV[\t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[ÀMD$$&ydḰ ~? gL$] \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <m#1D$D$ D$D$L$8T$jjPQjR=8tD$8m#D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$ۏvL$L$ΏL$FL$L$L$)L$phjjjPQRCD$L$8T$jjPQt$R6L$81 ujPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR<6t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR5D$XL$: L$JhjjjPQRuMD$D$ D$L$8T$jjPQt$R\5tD$8he^_[]fffffS[~ [ÐUSWV,[Xl$@D$D$ D$$D$(L$ D$QPj8 8W1|$D1҃|$H1‰|$m#2m#m#m#m#m#m#m#m#m#tm#t}m#t{m#tym#twm#tun#ts n#d1`YRKD=6/( !    s#4ÁƐm#uH< |$9T$vQ׋n#jjjhjPj! m#t+f@n#fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tTuXT|$Dt``1|$Hthht$jWj ,^_[]þ |$ $n#jjPQjR1<$n#ȅUSWV[8WTtV6udP7ƅt3\tUmuW0dtUmujW.^_[]ffS [;n#uoD$D$$n#T$jjPQjR0t1n#u,Ð}PQjAR'^n# [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[ l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPFOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[ÉD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [8T$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[HL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[8|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[tt[̀rS[Tt[S[>t$ t$ jt$$t$$t$$t$$t$$  [fffffS[t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[H$D$D$huET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR.(ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$|$ W $Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ` $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PWo |$ u9nuqF$hPWN nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0v $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP7 t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWP, t$l$$t$|$t$P@E$$8$j`+t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[ tM΋uA~8t:~4~"`N4F8 I9rP#F8^_[ffffffS[ÞD$L$ AQ jQ0 [ÐSWV[L|$t$t+jP6 tH  W6,^_[ff̀rS[t[̀rS[ċt[USWV^ƥ$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQwӥ1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[vt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø&Pjj%Q4SWV[ vD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[Øu|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,谣L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[Íst$ V PtHP tQ P V1^[ÐSWV[,st$>gthGt tww$Ѓ gpNjPQwe;u<tww$Ѓ œ4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[qD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[hqt$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[Øp|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Í_LPQjGR(T$4LPQjHR}(T$4USWV[ l|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW ܔP=W1fu- O @1jW^_[]ÐUSWV[kt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]Í_БPQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[Ìit$8uEN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[Í_ّPQjVT$B=sD$ DP[Í[ÐS[UT$B=sXDP%[Íf[ÐS[ÞUT$B=sD$ DP%[Í[ÐS[NUT$B=sXDP[Í˔[ÐS[UT$B=sD$ DP[ÍӔ[ÐS[þTT$B=sXDP[Íݔ8[ÐS[~TT$B=sD$ DP[Í[ÐS[.TT$B=sXDP[Í[ÐS[ST$B=sD$ DP[Í`[ÐS[ÞST$B=sXDP[Í[ÐS[^ST$B=sD$ DP[Í [ÐS[ST$B=sXDP%[Í[ÐS[þRT$B=sD$ DP%[Í.[ÐS[nRT$B=sXDP [Í%[ÐS[.RT$B=sD$ DP [Í-[ÐS[QT$B=sXDP@[Í7X[ÐS[ÞQT$B=sD$ DP@[Í?[ÐS[NQT$B=sXDP%[ÍI[ÐS[PT$B=sD$ DP%[ÍQn[ÐS[îPT$B=sXDP%[Í[&[ÐS[^PT$B=sD$ DP%[Íd[ÐS[PT$B=sDP[Ío[ÐS[OT$B=sD$ DP[ÍwC[ÐS[~OT$B=sDP[Í[ÐS[>OT$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[Mt[D$t8t9@€tuuuuH+D$ÐffSWV[\M0t1bjWQw t u1^_[ffffffS[LRPt$t[ËD$1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[Fl$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍϞxPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[MEt$t8D$ t|$tT$t121Ҁ9 11^[ÍxPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[ED$oЉׅtGϋ$tRRWPQ$$$4UhVH$yPVjl S[þCt$jt$t$PUSWV[ÕC$$$$oЉՅtG$ tR$RUPW$,$<QhVt$t;el$VPQhUJPUjk tWD$ hjP' D$D$DŽ$DŽ$ L$VPQj$;$^_[]ǃP趸҃¿+w狔|у̃ǃƒӥS[þAt$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[:AD$ D$D$$jVji n#uƃn#tjljj0jVjSi jIjfffffffSV0[Ú@t$̀rS[>t[S[>|jPt$t$t$[ffSVP[Ü>D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[>t[PS[=[fffffffS[=88t3[Ë[ffff̀rS[Ô=t[S[~=j1[ffSV[]=4n#u#,n#V>u1,n#^[Ðfffffff1ÐÐ1Ð1ÐX<Ð1ÐÐUSWV,[x<l$D|$@ p#|ƃT =sdf,p#Fw%,(p#=uɋ0p#뿐$p#QUhWL$L$뀋(p#|$@l$Dt1,p#t& 9s8u+p$p#ƃ p#D$D$(D$$D$ D$D$D$$p#D$(p#D$ ,p#fD$0p#D$D$Uj(P׃8^_[]ÍTPQhR]fffffffUSWVX:$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$L*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$lE8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$\ED$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$\ED$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$WjjPVM9\$ WPuu;SD$08D$V迦[PQRt$4D$t$@D$u`!u(X̠PjjQ蚣]D$u a t-L$@U9ȋXQPuuV:|$D$„u%uu+])D$@Puuuu t$hуuE˅R@u*]C L$h9L\$ ;D$00)8D$t$V85[PQRt$4]8uV:*߉D$D$4yD$80D$t$W̤[PQRt$40뒋Ճb8[0D$t$Wjܠ[PQRt$4'0D$4ߋ]D$4 D$Mt$,V0 uV0)D$D$4qD$t"XPQR uV((D$4+f|$8]KT$HT$H9W؉P(|$D$4uA|$tJ8<D$@؉Pa(<t0j=Xf|$ ~80D$t0\$ WĢܠ[PQRW|$ s0u'8uUSWV,$[E$( 0GD$|$'j j PhW$\$\辵tbhPWŞ Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@虡mPD$PWt$ QRK0E;$(u ,^_[] tffffff̀rS[t[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[äuD$ PjZt*jPy|x/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[ uD$ Pjt*jP{x/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [5 $0D$$$ $fEt$\$,$,$,PhD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVUy ƅ~s$4WVD$PU<ƅyvE @t73$t'GmPڢEPrxEtLGP 8$OfWfw fvVRQt$ P2r߾WUOD$;$u# ^_[]ÉGffuXnUSWV(] D$$$$@$<jVdO1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRF8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jPLD$;$$uL(^_[]þ|$t؉j$@KÉ뿉j됋$@D$L$/jUSWV [$ M$1@ u tE;$4 ^_[]Í΢P|tЍsQPetƄ$T$X $D$1PhhRL$$t$ T$DH@u u{F$$R詹T$D$u$DH@utD$(tDP@u Vu$,FPQW藓 D7t$fiiUSWV[E$$$ $$@t-tȢ$,$,PUQtRL$kWUPhQU=s>$4$4$4$4U$0R&U׶=r,j$ ?I;$u;^_[]Åt|.u|$`UPQhWf,hffffffUSWVX[$L$p|$lGtG,t$x<t$|H<PVt$|UQ$$E$ 5BBWXfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$vCxnNj$L$|PQG$L$xPL$QG$ǃ$fB$) $W 9$A A L$|PQ G$L$xPQF$PjF$PQF$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPBƅxՍ7Pj 9F7Pt$&F7Pj5F7PjF$ 1۸$IUSWV[ël$ |$t$D$@tPN ) l$$FPj)uEF|PQXEfFD$@ u1ftP VPEVj EG fffG )^_[]ÐUSWVP[úl$0t$$T$ |$D$@tɣPX T$$։)͉ $9L$(B99t$4D$,WPYDGPl$UHDGUVP誔L$4 )΁r&~m1PQh=RCL$8QPC+l$ ^_[]fffffffS[îjt$ [ÐUSWV[Å$ $D$0$jU!CEt U uEEEjeU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhadtkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUAD$ djVUp PQsƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w 81҅tމ8D$ Ϲրwr tt$$D$ sP tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$P1$<#t<;t΋$doma1$in $sear1$ch #j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  l鍔$P% $< t< 0$< w A< vhQt$8 ƅ_Pt$NnD$ kc$< t< H$< w&@A< vhQt$V襇 ƅ_j VtuDU`1aL$ t ut1P&;L$4r$< t< L$;L$ $F< t< tPVd< D$<@@@@ @@D$@D$8hj5Pj $PD$PD$;t$ s E$EtJPEDt%uH PWu퍃 PPBitbsV[ML$0 ;$u ^_[]VUSWV[kt$xPdžft91 9s)tQDŽͅtMtt|5X9utvxt PbWidžtPhdžf^_[]ÐUSV[dEu@p#jP<_$D$F$FWfF e^[]ÐUSWVx[EL$ L$pu@p#D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]TUSWV[kt$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[DD$Att$0UP EO $L$(T$ L$@L$GL$ F< t< tjt$V TjPV lj PVҡ jPV踡 &j PV螡 Fwj PV脡 ijPVj  jPVP jPV6 j PV 4wjPV jPV ʤjPVΠ ҤjPV贠 ۤj PV蚠  jPV} xjPVc $`FP5d$/FP|Gt^]GddGtAPt$'F P;|GGtvPQX7< < {$H׋$ut$0UP $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$];PVV?r?D$PVt$y D$L$Ƅ|$;PVV?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[$$l38p#h34p# p;|$ t0oE1tVPtEuv|$tT$D$D$L$ 9AD$$A D$(W街)D$ QPt$z |$|$D$ @1tjD$#gRKǃ)|$ KWQl$Ukz L$l$$XD$ @TȃuD$D$+D$L$$L$;ED$ @ ;D$ |$ OP1Ry L$l,G )D$ L$D$D$l$$X|$#44$#p#t{NDDDDD DDp#.j 3p#tǃp#ǃp#^[ÍAUSWV[j02ƋD$F P2FFЍ(Ff~FF,p#t p#1ҋL$9uF(p#thp#9tF F$FNj(p#p#rp#Rp#p#p#p#^_[]19u뫐S[>QPR誦 j0SWV[ t$8p#t3p#9t^t,p#p#zp#p#t7p# 9u p#~t vq?Vh?^[19uΐS[t$C?[ÐWVXL$ tsAQQBQQAA,p#tDp#49u4p#4~p#vp#p# p#p#^_19uSWV[,t$trTp#p#t/<t)p#p#zp#S[ffffSV[Ýt$ tjV"]f jV#_^[Í_rPQj5R}ffffffUSWV[5$t&j$$PY$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjr诌Njh$t!A3APjhjjet{Njh ʁʀ $4$!jjjVd!ƒu.8u$$! Pށ(p$t u|! D$$Pt$^-D$| $WPPt$m @ &l+C8(ɀ GGBG G GGGjjuI tTP у1uP VPuJ $tMtH! u?jUu.r(W*$t 4$M(1Ġ^_[]À!SV[ݽD$ pFtjP6 J F!u^[ffffffUSWV[{t$ D$hEtjPuI EwL$8uLPE(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUa !@uEIBj7uH 1WUƅur}$O^_[]ffffffUSWV[ t$ D$hEtjPu3H Et~^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPUG !@uEj7uG yUSWV[(l$(9s$QP,D$ L$t$;t$,w D$,D$1;t$t$jt1tKjutWVx $$t$jD$PVU7u&<$Q;t$,s!^_[]ÐUSWV[عL$,|$(19D$t$ity;D$touF$WV++)L$(žϋ$E/it ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$6L$uu D$,91^_[]À!USWV[Øt$(9s)QP@*$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Qv $jD$PUVf5u;l$,b1 !^_[]ÐUSWV [HL$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,4u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[{t$D$xGtjP7B Gt\u^D$tR;wUjPW, t=(@PUW 1PU7BB ujG(ux^_[]ÃtRG$jPW tՋ(@PUW? 1PU7A uG$ 1랾뗐USWV[XD$$L$ l$DA4DtFPUL$(>A)VPP.T$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍PQhRoL$4T$0^yL$oPQjbRyoL$T$0zL$PQhRFoL$ffffffUSWV[˲t$nEtjPu> EjVtE 1t u1@u)6d1Ƀ Vt^_[]ÐUSWV([t$@l$<}GtjP71> G ujU躌0 81qujWjjjV 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP%` u !1(^_[]fffffUSWV[|$ t$tGw#jP!džL$G|$$1D$@DA,Du!@Mu:O}GQWPUV&u^/|$$KQ;v RP !t2MQUQRPD EG/1^_[]ffUSWV[|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$yo׍PQjbRi\$8=$oD$L$,td;l$tX14Eju77 t%MLH4jP7^9 ;l$u*oL$1 Gw)f_ ^_[]ffffffUSWV [Ȭ|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$Re $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍVPQhRgT$믐USWVhXhD$|$|G =tŋ\$jj$W_{$jj$W;\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$o ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ# DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$W臅O t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$j_T$ VPQhTRQbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$kVPQhRa끐USWV[6D$lAB9w}) >P2Q7 D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$zj1Pj. &`1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V/1Ʌt‰ D$0L$ЃVhP|[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$ƩVPQhRX\$T$ D$4@USWV[(T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJDHjWPVfi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P] L$,1TEMGDHjWPV.h t&dž(@f8u$dž  ^_[]ÐUSWV[æzA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVf t׋@f8u$dž wSWV[,|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[ֈT$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQLetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[Èt$0l$$D$jPj |$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleanersegment %d: bad seguse count %d%s: inval seg %d%s: rewriteseg returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALLusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ... bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: failed to read cleaner infoRead cleanerinfo: %d clean %d dirty %ld bfree %ld avail flags 0x%x%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: must clean%s: enough clean%s: dire straits%s: busy clean%s: failed to stat ifile%s: idle clean with fs idle %d%s: failed to get load avg%s: idle clean with load %f%s: default no clean%s: fcntl returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segments%s: fcntl returned %d (errno %d, %m)%s: errno %d, returning%s: reclaim failed with errno=%d%s: wrote %d direct and %d total frags to clean %d segs (%d%% recovery)%s: cleaner not making forward progressSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such error%s: coalesce: LFCNFILESTATS: %mcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodes%s: coalesce: LFCNREWRITEFILE: %mbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpwritepseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lld/home/builds/ab/HEAD-llvm/i386/20260502072300Z-dest/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystemillegal inode block size: %d cannot specify inode block size when version == 1 %d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblockidx < lfs_fi_getnblocks(fs, fip)%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedexamine files in%s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:202605020723Z SMALL REJECT_NULSLINENO#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number`%s' is a block device. use raw deviceD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-30s %40s%-50s %-10s%-30s %-10s%H/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist