08ci<  ci]p?N[t [tci@@<@T 08ci<  ci]p?N[t [tci@@<@TU ci[t  `Acicici$h ciciciAciciciA.ciciciAciciciAciciciAciciciAciciciAciciciAcicicimD$cicici (08@HPX`hpxp$TciciciN$ cicici (K$/cicici08@HPX`hp+M$,cicicixFAciciciCciciciAciciciAcicici!cicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici4!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici B!cicici B!cicici!cicici"!cicici"!cicici"aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici!cicici !cicici!cicici!cicici!cicici?\!cicici>\!cicici=\!cicici<\!cicici;\!cicici:\!cicici9\!cicici8\!cicici?\!cicici>\!cicici=\!cicici<\!cicici;\!cicici:\!cicici9\!cicici8\!cicici:\!cicici7\!cicici6\!cicici5\!cicici4\!cicici3\!cicici2\!cicici1\!cicici0\!cicici7\!cicici6\!cicici5\!cicici4\!cicici3\!cicici2\!cicici1\!cicici0\!cicici2\!cicici/\!cicici.\!cicici-\!cicici,\!cicici+\!cicici*\!cicici)\!cicici(\!cicici/\!cicici.\!cicici-\!cicici,\!cicici+\!cicici*\!cicici)\!cicici(\!cicici*\!cicici'\!cicici&\!cicici%\!cicici$\!cicici#\!cicici"\!cicici!\!cicici \!cicici'\!cicici&\!cicici%\!cicici$\!cicici#\!cicici"\!cicici!\!cicici \!cicici"\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici \!cicici \!cicici \!cicici \!cicici \!cicici\!cicici\!cicici\!cicici \!cicici \!cicici \!cicici \!cicici \!cicici\!cicici \!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici!cicici !cicici!cicici!cicici$!cicici4!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!ciciciaciciciacicici!cicici!cicici!ciciciacicici aciciciacicici aciciciaciciciaciciciacicici?\acicici>\acicici=\acicici<\acicici;\acicici:\acicici9\acicici8\acicici?\acicici>\acicici=\acicici<\acicici;\acicici:\acicici9\acicici8\acicici:\acicici7\acicici6\acicici5\acicici4\acicici3\acicici2\acicici1\acicici0\acicici7\acicici6\acicici5\acicici4\acicici3\acicici2\acicici1\acicici0\acicici2\acicici/\acicici.\acicici-\acicici,\acicici+\acicici*\acicici)\acicici(\acicici/\acicici.\acicici-\acicici,\acicici+\acicici*\acicici)\acicici(\acicici*\acicici'\acicici&\acicici%\acicici$\acicici#\acicici"\acicici!\acicici \acicici'\acicici&\acicici%\acicici$\acicici#\acicici"\acicici!\acicici \acicici"\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici \acicici \acicici \acicici \acicici \acicici\acicici\acicici\acicici \acicici \acicici \acicici \acicici \acicici\acicici \acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\ !cicicii!cicici!cicici!cicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!ciciciaciciciacicici!cicici!cicici!cicici B!cicici B!cicici!ciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!ciciciacicici aciciciacicici aciciciaciciciacicicicicicibpf!cicici $ cicici$cicici$>cicici$cicici$scicici$ciciciAcicicim cicici$cicici $ciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciAcicici Acicici!z F 9oqA5] _r/ܠ <FG-Xe3 M &+F =x1~blp}! iKv85xHnwJ+)MV&GM#JZMlkXm\% (JGfF<,%W#Ulxo*j?J)_)@tqpyP*@q\5uPb 7qo6W%oUZLvP~Ab!R"w!&~[ d).Gc?ZyH8Rw#yL!1HB gEJUi[v~zkgK4mxxj\9qxE97jc{Mg *XZu"=keCi>eW%8hmm:eGCDrSLm;yigd-]>+v`ro tLv"uKnZb[t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4$4 (##<#('Ԗ'v''u''p@-8@@4PPUp(P`0/~Д'\'0H- @ P@P0/T0(u'8'A-@TpP$`/pP" @<#@P@ {P PQ  )@$% @ @0S 0 A/A-/ )@@$% @ @A <Q#@`" P@"@}ypPPU: P , P P@H-O-M`PK !@3>v Ԁ@p@)@)@)@@)@X b@Q            $@0)@)@BP0@ )@ )@)@)@p)@`P  P A p8 a)@P !@)@Q)@QQ)@Qk  p)@PU h @FzP )@!@P @ PP2 px)p@`)@P` `PP7p Y P  X V @`@@@)@P)@P X( P| @ ; @ X X* )@P8X@* )@P`pP @P` >XX^= )@Pm & @! @ @ )@P^`pP @P` XX$Q`O$v p`I`pP @P` !XXM ^b pu `pP @P` X `XI^IN  p`W^MF pY `pP @P` XX--4 pG )@``P@`pPy P XX&  p!(`pP @P` XX^^ p `YA`@?Qp Qp Q X` X  @ )@T!@j)@ ` `@ W [6x)p@` T!@P)@`pPUE6P)@}J @* Ѝ)@Qp)@OPWp)@U h @xP )@P FpPvJ ἱpo (  PzPwPʇPpUb +ppPZ)@vWpm Q@`V ᑱPZ ` V `P  @Q )@` P@ ͯp=@Y P@y )@T!@)@OPU p T!@)@`PUhGկ @S`V V` @ !@O-M`P !@v I p@ (@@  0QPd@Q) HHHHHHHHKPP HP 8LP PP: RP 0@   XP!") @0Aq@-T@P V PX P pRpP0p)@ R&p[pZp x Q @@RX `P @ Vp @  @@P @ `IIP#@PKP{PU~p`@ P2h\\P ^KpPbt !@D)P N $ `b !@2`T XZ XQ 9/P [ T!@O`#@dH-{ )@' @0/O-OM@P[ !@Bg )@ )@$u)@ )@`@)@)p@)@ ePH@ Q,x,lD| )@)@)@oP fP6 iP9 lPF()@pP/ rP2 vP<0)@aP. )@)@)@ )@)@)@ )@)@)@)@,)@p)@@DT,%)@) @ RQ' %)@) @ QR Q )@Q)@Q  @ @ )@Q )@Q4)@'8)@#pDi (`@Q$1d P @ htPQ/U P  A A Q Q/R @y )@PᾮǮpzP'T{,)@P )@P! )@)@ ➮p  P) T^p/U$- @ T!@ ␮p T!@   P,)@)@p `V @ PtP:@ /R @ @R: A` @/R `V  <)@/O-M` PpHGP @IPm ⼹ ⛊(@P!@p@PtXXXb~  C @K ZX 0` @@ P ` \ @<HIpP-LPPZ, P/j@P!@uP 0,/QV/Q/P@ E0A P: @V W  P Pp/Q  PP )@P ᵭᥭpP2 X 0`P!0#0`(%0#P @Xp  P  LZ  U+ : S  @PX Z 0ZE0P0%V UW`0X|XT)@PF uD,5)0@`5)0@P5` PSM Sg@5@e)0@)`@ Rupc P  P) PS  @e  KL)@P  P P LP  PPPpU 0P)@P( B @ "P )@P LP@%) @AQ,@P)@P X  @pHӬPp(+xPGЍI s) {9 @ @0@6TvI ) 9 @ @0@?Kv T!@8#@3x @- M@0 `@ *` @*@PP @ ЍO-M-MP()@P (@@t ]PF T  p<} Xp)@P )@P`)@P )@`V`Yk (@+p8y , (p P@ p4` x 0<\p  P$`: A)@8P< (@)@`p@0GT# ሪP`P  0 A `$ @ 4 00@p  R@T`T !@Y$)@P  H(@)@@  @;P@sr )@PP  (@@Ἣ+^p8p (@T!@pt`xL 4<D)@(CZP8 ADU㼹 @ 0@ P(@Ѝ`H-M*@  I @ 0%&* @Ѝ*@$/H-Z @% H-M p @ 0 &* @ЍH-| @ H-M*@   @ 0h%* @Ѝh*@$/H- @ H-M  @ 0h%* @ЍH-M  @ 0H%* @ЍH-`F*@*@@P! AP R0PPPhU*P@aQ8*@ h%* @/H-T#@ !@ H-T#@ !@ H-T%!@# @ H-T%!@# @ O- MP@f !`@w p)@@<F*@@$P  #@!@8$( @X  #@8op($ ?*@*@ (@P: n @9 hUE*P@*@@$P#@(8 @$# #@8 !=p(8 $0 !3/ p( $ T!@ h*@{he*`@U*P@@  BP XF*@@p PRp3WP P U*P@#   Q 0p@(!S#U*P@1#1/@*@@@@r@rP*@@ @8@- ( @P@ @Y Pv*p@P*[  R qqsq80 ($03/Pu p?!p 08op@@? 0 `)$ PF T!@=g  8p!( p1/ $T!@,p   0@`P0@ 0 p@8 0@@ 0 @ 0   B H*@U*P@1/wh*@@ 0iU*P@ kW @ H-H*@@P D@PC @PM*hE*@*@@  aR*Fp! U*P@` p!`Vp `(P 81/pqP 8(1/p !@  @ O-MhP*@ E丅*@@*@pP P*@ m  80( @0004/ @p  PpP/ 8q P`8@< hP*@!T# 0@#   *"@ hpEP*@*@@ '%'  `*@Q ``$*@ + @ɼ  S pWPWQP p Rp0pRp k*h *@E*@@" " AUH%* @  p`QT Ѝ "@ ЍO賣$ O @$  @$  @ $ T!@ H-MPP p@`*@ ᝣ8 ((03/@opP 㐣ipPЍp@-(PUp@8 03/p`81/(`p @y @-M@(8 2/P$8  P 0( 8D3/P ( 0 1/p%pP  Ѝ$ T!@D @-M@SPЍ@蠦 ፨PЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-MHE*@@ ^!@ Ԣ ^!@ ̢09븕0*@(^^@@- 4 @,dDPp$8@HPpi ᪢-2 }?N}SbAW(/ P,$PbGS"CS?0n~ @c/"p@`@@   @   -  @dWi x   @    .  @dCi d    `C@` . d @0i Q /0Gi؃`Ge 0!R@@7.  @d` P`i 2ЍN@-@K(ףG-Mf*`@ 9 0pWE @] 㨕T(P@*@!@8 ($0 3/PP 7 Z$!8 ($0 3/ R!:80 B($0  @T@pGW0p@(! pS#1#7/p Ѝq @$ T!@B-MhE*@@ 0P`*(!s# p1#7/p#C P`80 ($03/PP`U: 8 0(0  H3/p Ѝp8 (  0H3/p U* !#P"`P $ T!@yO-qMM`} !@d(⋎  0@@lFhV*@@*P@  G@-QhIJRRRRHJIR(JRRRRRRXJRRRRRRRRR8JIIRRIxIJIRIIIIRRJRRhJx*@ p*@t*@*@*@ *@*@*@|*@*@d*@*@*@*@P 0@@T nQ QoPo@o@*@,q^pPP ,i^PP㬧P*@UP @@W ,qT^@pPDpt*@P *@Px*@P*@x&*@*@* @ RP @sP )@P뤆P*@ AT F|YP  T㏟ ʣ`!@@ @ġp @  P @P@@P *@!)P *@PI E*@P*@ hP *@P1 Ǹ- *@P*@Q! *@P @ ᯸ @sP *@ *@P @ 0ᘸ@TZpd*@*@Q *@Q P *@PDp>`GpȬ @&*@P +P *@P  ,E_뗺%Z)Z GP  ,6_pV d @*@`F꤆*@ppP*@P(@vk R0"@+1Vp*@P*@[ 0t *@@Ș`$T Q xftfP`U7 $ `` Dg a1;U0\0 ";@%+![ *ar A  a1;U0\0 "; P@ $@+! *`r*a @0 `@r*b A `r ` B p[tU*@P)夆*@Q' P :PL| PpU:pt*@*@PtU*@P`*@`U (rqߍۍ@ @@C @r @ @ @H-jk )@@iH-M@P P|`*gP `PU FЍ @0H-@*@P Q P gP Q*@*@ 0O-MM*@P  0P * R @ R $U8LxP*@p0`P&0R 2@ @XhW @3a@PL xP#@H |0@B !!@` X*@㔦 *@Q lF*@㰶*@@*@P P#  P4 BN@@R*@@  I P! (@b@@ @=  B(0@ 77 @ @0 (@@ AX@$h*@Q  *@  (@  @*@&* @@P= P(0@  B m 0(`@ R0 0S P` P@+`*@P%2@0@10@ @  *@P*@@! P@ @0@2@ @0@Jf 6"I2@ @0@Kfl@@-M|FP*@@ @ TF !@@@@  @ ЍO-MP*@@U *@ `*@'&*@  pFvP*p@U*@8*@*@  U  "`P; Q`L*@KL0 P JP &* @@4h )@ @ @&h )@ @@@g )@ @ #@PL*@Ѝ NK-pbP @PP Pu*@[gĬ )@ @ #@rP*@*@P  `LpEY`*@? 0 XP JPh*@`*@ ,O|0*@0 0 p  @  @*@pgt )@ @i8@"ἣ`^gb )@ @W@᪣0H-hZ@*P@0|0*@0  @ @0@-8(*@* @ 0(@Q|** @@ PT*@ * @DTP&P* @  Q @ QQ  AQ SL*@'iH-&* @P00S S P *@R "@H- *@*@?㗚@!@LOSPP@PaPv*p@P/PU*@@a*@@ qP O2p P@`*@PT!@@n@M`Zp@-F*@@P pV`*P@`P Ѣ`*@*@p*@@ifm0)@#@ a@p0H-@*@P cV*P@P 夢4H-,)@*@ ipPP. `*@*@ H@ Bd P  @-*@Q@*@ @0 0AQ00////O-MxZ@*P@` V V@ЍP Q1tZ*P@p*@` QʔPA*@rP pP  0  0PoP2PJ`PUp@-@*@h@*@8X@*@*`@@ *@*P@@@PpL*@p K- xX*p@*P@@P*@8*@l*@  P Q`L*@#Aaee )@ @Z #@PL*@yO-MPx P*@P (xH`* @*p@*@@*@)@` Q0PR+h`*@PJQe  PJP  R R `PʌP ^!@`(P @* @p P@`(P* @] jPu p*@ R*@P#8XH*P@*@@0 R0002@UPa 8(P* @*@P*@@PL*@me wW( @* @px *@PPt MP9J~`P0J h  *@P,Jx *@P( @* @pYU< p*@ @P^!@8`P PP8`PJ@'Ѝ P,`ade @\ #@8*@PL*@ @wH-*@*@0S*@ P0^A-P(* @*@(P* @0N^`pAT V@@pW@`V@@P@PA-@!P!@%b!@ PP >`P9Jp!Pc0)@#@ @`"pD*@P/)@@ h *@`@ c0)@#@ @nO-MP@m**@`* @ 08*0@| *@pP h*@p@@pP)8 @*@*@P8 `T ` @P, PL*@X- VpPW(J@ `TY [VZ*@*P@P" FT@  P-L*@*& !4Z@*@*P@)@m0p*@ 000T0PW pT` Q`ЍAO-M0H$ h8*@@*@*`@*@P PP@:Pu U4`3pZ  Z  "3 fPJ $8*0@ Q `L*@`O P *@$ *@R R,P0p001P $*@`PPL*@VY  'b卧 )@ @ #@;P8L*@71 @Z+  *@ *@** @ QR P  @ LbP )@ @EX@ЍnA-@P!P  @Y`@`P  ;P6Jp!Pb0)@#@ o@ pD*@P/)@@ HUPa0)@#@ @PO-Mp`0*@P @W( W&|@*@cP) PW *@P*@P P PJ@AP*`p P0*@P  ЍH-0x@P`*p@T Q @DPpʆa劦 )@ @@8O- Mxj*`@@pp PW.@P' ,*@(88*@W*0@!  W  ,PܛPy 8@*@PP L*@ @p Ѝ@ S @@PJGZ(hGP*`@UI ` *@P PBpZ8 Z*@ pᗛPo `pP  `L*@`  *@SU5 @P. (hJ*`@ @PJxPPZ@`ԥ )@ @ #@8@*@PL*@Q} QpZ(*@@C8h(*`@*@ ZP/P QP% @+`噥 )@ @ #@GPL`凥 )@ @| #@5P:L*@@ -O-MX08`@)P@*@*@*@pP p @:Tp`E`` R R,p000徚P; QpL*@J D` *@@ V\  *@ ` @@@`Tx*@Ѝ_ @ #@@PL*@ R O-M`@P @xT)p@ (@[ `Q A` Ep Q? P@<ZX"@|` A` \P @^RQ*p #QpQXX\X\`V @ RP 4@@0@`p Q0A`0QX8X X 3`p A`0Q&QX X X`p QQ0A`0X X Xp`p QQ0A`0X X Xp@TPu`P@`XX X ЍO- MdYPPr@o<TpT)@@*@P@)@`0p@*@ 墸oP p EP% SPH*@`xP! sP& pP AP! -PD*@P``@*@` @ 0OD*@`@PTP @M^P@H^E^P@A^X *@`P%[P*@QP P $PP @{P @@TP@{@34hq*`@P 4+ @* @iQ T!@XPPPJ `*@P P3d *@PJ+ P0JP h *@pP$Xz*p@PN D*@PI@q{@PSP. P`@`Pu u6 u( @P{SPX P*@P@B{@SPP \ 4*@4; @*0@] #@P) kSP\ 4*@4; @*0@pWSP !PD  T*@G=4+ @* @OH-ML@*@0 h D\P JP #@"(@#% P #@"(@#%ЍH-8*@QL@*@0  H-8*@QL@*@0  0H-P<*@@P !P !@YP /1NP d@@0A-lZhpjtJ*P@*@*`@*@@PJxz*p@ 0 0 ;R,R ;Qp R R  QpO-MxJ*@@)@ 00@ P  00@ R @p=0G=SG`(D0D$$D\ ȕ4@ D$Ddd*@P; @0 W$ !WZl *@P PP%J` QpR nR lR   `l*@Q 0l0CS  QP`| *@PPJG@okPJVW`GW`PpQ nQ lQ`9@`pQ nQ lQ`l*@QD`pQ nQ lQ`l*@Q.`pQ nQ lQ``pQ nQ lQ^`hz*p@kPPzJ`PpQ nQ lQ`hz*p@PPP_J`PpQ nQ lQ`X** @ R D(P* @ RA l** @ R@ PP3 p`PpQ nQ lQ`l** @ R@ mPP !P@l*@Q`pQ nQ lQ`pZ*P@Q  ` pR nR lRE   `h *@PPJ`PpQ nQ lQ9`p *@P P` pR nR lR4   `h *@PPJ PpQ nQ lQ" h *@xPPJpzt*p@*@`P~Jl *@P  XJ| *@P V X``PpQ nQ lQ`h *@BPPQJ PpQ nQ lQ h *@'PP6J PpQ nQ lQ @ l *@P| p*@*@kPP p`PpQ nQ lQ1`匊zP*@*p@`0 A R*vZ PPkZ"Px ` QoQ Q gQ`pQ rQ``h *@PPJpjt*`@*@pPJl *@P= XFJ| *@PA`pPpQ nQ lQ`l*@Q`pQ nQ lQ`l*@Qt@pht *@*@ VPPeJ1@PY !m (`@PY"PI@ H` @$@= P6l| *@p**@* @Q  "@D P#d *@Pp *@uPP |l *@*@b PeZ ht *@*@ PPJp  *@` PDX*@*@`qW`P`Q` "@*@Qn xP Pd *@Pp *@t *@PJ9P Pd *@Pp *@t *@PJ|  *@0RQ Pd *@PiA P Pd *@P[p *@t *@P X  QuP Pgp  P P`p  P PYp  *@t *@" PpQ nQ lQ P P: p (@*@|:*0@0SB`P P'VGGGoogPPQ" P4*@q. P T 0@- *@( @0 Q S   P4 *@P )@4+ @* @x PPJP 0l0CS  P'@P Pd *@PTH*@@Q opP*@p;PJ |*@PX *@t *@p *@PpQ nQ lQ`P PTH*@@Q  op*P* @0t** @ !@ @WWPwJPX *@@d@gI@b "@X QY ^Q QKJP*@@ btD*@P^ "@7P P5| *@IP8J 1P4JP7JP!P T*@ ATP*@ R P@pPJ (@X *@@ (@P Pd *@P  P@8X[*P@ FP ** @Y P k *@“** @ *@PL*@n[ *@*@" PJd*@ RZ  " QpR nR lR   h *@PPJ`PpQ nQ lQ`P PPY  *@ Y!P  @o oRQQPPhL*@ka _DX**@* @qY QR`h@EP P?d *@P ` PpR nR lR   `!P  @o oR]Q[ @P P P T *@y@T*@a!]@JV ]@DPЍ`PK-P" P| *@P3`0P hp*@@P  0PP JpPW@ "@@O-MxJ*@@)@ hz*p@P@ Y  @ Y A|*@ I6Ru0瀪̩4̩8̩8vU *PPgU"Pcinl:*0@;Y p** @PPR.YPGI/Io[PHJPY7^YC 0 @ S @%^Y-YPU ֿ`PU"P f^Y`-Y`P ]PP JJ "@I@/PЍP  U"@JQPO-MY7 h|*@P*@pU W!ppWpW  `P @ *@P  0  0嶦P pWI@ЍH-)@|@*@HO-Mhjd8xx*`@@*@*p@*@P PPA  Q PMJD `*@PQ Q=P.Q& P# PT  @P UX*@PL*@  Q PL*@ ЍP)@ ` H-l** @ R p *@t *@p** @t** @PP| *@ Q "@6O-M8*@`  v P% |*@P$@Ip Pd *@P (h *@ @X *@P pRPL*@ЍeA-MxZ*P@ Rj㘊*`@*@ QG8xL*p@  壎P_ Q@7L*@p0 j)@ @  00@ R R @@0s@P) !Q)P JJ*@@ ^@ 0 S0 0pp pp 0p WP@P@Ѝ PR@qS嵘 )@ @ #@c@PL*@ K-(k@*`@p W 8$*@*@\P$ QPL*@50./OW $ G*@ 0\S00S@ Q  YS] )@ @R #@ PL*@qO- M@| *@`P@ P6 8㰚*@*@PP p*@@Q Q@  垍Pq ** @Q@L*@  E` P `*@@Qڰz8X Q*p@*P@@  mPR  *@@R L*@l f *@ @KPNJhZD*P@8H *@*@@P  P X*@ P 4 /P+#R垗 )@ @ #@LPR北 )@ @ #@:PL*@  ЍL*@ H-/) @ |@*aA* @1S *@000O-M|ztp*p@*@*@@ 8*@`PBP0`UP00p`@7 -P P $P P P` P1)`Pp`QPp B@dh *@*@@Q X*@ P L*@ЍDH-P*@Qe|zL(*p@* @0@`S,  @ @ up$ !@v7P PKP` 3P @P/Q/Ke .Fh0 p@ @ N)H-P*@Q L@*@0 X *@O-MtzP*p@-@p *@`0phV*@0Qp0  BPQCS8x0FXP*p@*@P% `U ` CPP PL*@@HX@Q PL*@Ѝ?O-MH<*@*@   d@@g {x@*@P^ p *@`8㠺*@Q*@  Q  "`dP ** @Q`L*@AB!P !Q" Q %QU YA Y `;P ** @Q`.L*@' W_ @U U`P ** @Q`L*@ PP \R  PT*@Q pJ*@`QD  Q (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ,`يPv ** @Q`1L*@* J*@@QQ z*p@ R( R `᱊PN ** @Q`L*@  A Q P A Q   P 0 Q:p/J*@@UJ*@@L 吊*@ U  "`kP Q`/ J*@@5OԔ )@ @ #@PL@O )@ @ #@nPL*@" "L*@J*@@ dB*@P!@oBЍ@@@-@ P 0rOv )@ @k #@$@- *@ R :*0@AT B R@Q:H-P  q\Ro MH-M 4  0*@' 0ЍH Ѝ/H-x** @ P P@@G00 QQ \\*P@@T<@@78@P3 \lP*`@z*p@P Q㑅P @@*@@ ͔P 4+'1* @ԬE@@ N )@ @ #@O-MxP*@`@ P P@ @\P [Pn@P] P]  PPd`D*@V` *@P8`*@*@  V  "p0P PpPL*@:+ YA *@@P)  0ЍO\}N偓 )@ @v #@/PPL*@ @@PЍH-  ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-xp*@PPP` Vh *@P @3PP PPP1 @RNPP ?PM"PI@PgPPO-MxZ*P@p%P R lLPp *@*@@[h Y8 Y*@ p` ,PGP  QP @pP L*@p@P  \Q Q'Q# Pd *@P h`J)`@*@@P P*P P ` @Pp *@8X [*P@p `  "@P  Q@ @$(lL*@@P"@@MD )@ @9 #@PL*@,@ h*@ ЍM# )@ @ #@PL*@  @p  *@+1O-Mhzp@t *@*@*p@Q oI@uP 0s`VjJ@V2 XP_Jt,8* @*@@`P6 @V ~ `P( T8@*@PL*@8&t p*@*@AXW 0%`PZ8*@PL*@   PJЍO-Mp`PU% *@P  0/ @` 0ϝP t `*@@p[B ` V? x *@[#88t*0@*@  [ , p᪆P 8(x*@* @唚*@ppPL*@P  0t<*0@ > @Fx  `*@pW#8 W*@  , jP x*@ P唚*@L*@P  0 >  0PxJ@`pQ Z Q  0 P] `@x *@ Rt R8*@*@,p000 P4 x*@pPL*@jQV  P @(P  05t|*p@ >Z  FKJ )@ @? #@P ߍ2K6 )@ @+ #@PL*@ K )@ @ #@8*@P6O-Mh|*p@x8t@P*@*@*@0ll*`@ \P3 &Pm P`D R0 R 00< p`P ph|P*p@L*@UBF P00@81@Q70@P3R`D R0 R 00< p&P ph|P*p@L*@UF P00@ll*`@(T  T P  "pP= ph|Q*p@ L*@YZ@IP]T  T P  "pƄP QpL*@12)$J( )@ @ #@PJ )@ @  #@P@L*@Ѝ+mG-逜\*@*P@p`P|d*@  P  )@ @ #@)|L*@@q   0!A-\*P@AQ |*@ 1S@pT 5`V@AQh** @ |(@ *@ (@O-M (@p (@p@.\|**P@* @h:*0@PX *@"8*@|P*@J 0PCpa@FT:V, V<!0 0 10`'0CaP`!` ` a!P@ !`PP` p`! 0 1p0``Sqp'q0 /P0 1 0C @P`p` 0Cp d *@P 1h** @P  |** @L*@ЍHO-M`@P/:P`#@DP& ! @[p)@EQ3|p g|㌜㔼`@*p@*@*@ <ePrPf@Pb(( *@KPLP PPMsP vP wPE *@FP *@ *@ *@ *@ *@p$<*@= )@*0@R-RE ,* @ R R<|*p@ *0@ aP P P @  "@ E*@@Q |P  PH |P  PPP `P PPT!@ H-G )@@0O-uMM⠜*@P`P U7  +1 QP :*P" @0 P;G? *@# @ @Q  2/P   PGT !@㰱puߍڍ?|P   P *@P $|P   P PP, *@P' /P |P @@+L1P :*@0" @P{P -@ a{P`P *@PVz *@PVH P( z0 BP /w8P @@/q8PppBP D [G X Tj  @9 e *@c 0Pc zPJ p*@P\ *@ 0 {@<Sx)p@X89밀`@ P@`)@8` P@)p P YP *@P   PzR{Pz Tm @ 0p7 .NNA{PZW  h9.0{PI 8-<="#A H-L="#99 @ W\\8B\ \4BH-XX0Dd T  V H H0S \\HBH-XX0Dd T  V H H0S \ \HAH-XX0Cc T  V 8 80S \\HAH-XX0Cc T  V 8 80S \ \HAH-XX0Ee T  V X X0S \\HAH-XX0Ee T  V X X0S \ \HAp@-X X`p@tPp`t0 T  V  p\\p@Ap@-X X`p@tPp`t0 T  V  p\ \p@jAO- MP@ !@ĉ`3;발P*@ h DpSzPP (@ p*@ *@`EyP㼬@h*@p`@ 1@GQ> (4@dp| ,h<8 *@ *@ *@*@ *@  *@ *@ *@ *@ *@p *@ *@| *@ *@ *@ *@ *@ *@@ph *@ *@ *@ *@ *@ *@~ *@ pJ  *@q *@ *@ ? *@ *@` *@] *@ *@' *@  *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@ *@  *@ *@ *@ *@ *@ *@ *@  *@ *@ *@p *@)@,* @*@PP k !@)P wU (@P 㨼*@-*@* @`q =  *@*0@V`*@*@`R,0*@* @`S` Y` ``^`RQ X*@ *@/Y*@Q pP P P6D @0pP P P, @&d@# *@P @X@ *@P H@ *@@ @ t*@@  @R$*@E*@Q H@*@Q H@*@Q @x,*@ @0T@S(-P* @  (@  *@ ЍH-AC )@d@V@O-Mp *@@p& @P P P` *@P ЍO *@pPbP\ C J㬬p@!@@*@@PK(   $  8LP \.P *@P*  *@P, *@P @8 \ ƎP @,, *@DJ *@PX  pPB@^B@BPЍ#@ 5S \ S \ \  S / S ,* @ RL R $-* @ / S \ O-MQ \*P@*@`pL *@PL @(P$8<4T HD@0, ` PP $T \!@$p *@pV \.P  *@P *@Pp0PPLPP X`40@Ppt Xp   R0RD 40R03PP @Px0P|,pD  U  RH pP,pS0P H * ) R ( R4 S"60 S 80P< p0 80Q< l *@P gP0$  # @PP *@P [ 0$  # @ )P ;(Y (;p$W$ *@P h @;P `&xP pp *@P P }\*P@p `TT@TTQ PLP㈠ l8*`@<P  ,0*@ 0B?e;s@{*  @;;*@Q V%@U%EQ$s@,  @D@m;H0$ # @d;Q @s@{* 4 @S;@ *@@P VDUEP@@( P sp!@ 06;` 0-;QڴD@P( *@1/, *@ Q  #}ZЍH-PUh@)`@ p   $`P@`XXpX *PUH-MPXp `*@P  @@@ *@P. *@P p   !@pH  !@x*@ 0B?: *@0@Q@ @ *@*@ e *@P q@*@Q @Ѝ *@P  Q @UO-4MM@?-0=* @*0@ RD PU9 3p2`)@ ) X*@P $ @F *@P1 x*@Q & ! @   ; $6p  !@ &*@ 0B?9 *@h0`@P@  `ᚑ0( @  *@P 0@  @ *@P  F@   P(8 40 &  P$@`p*@Q  !@` p , !@  *@P 0 *@P@P *@*@ o *@P { *@P  *@P  Q  PJLP :*" @0\T%\0! @ +Zrp - @d *@*@ "?0  @  *@P  *@h`@,P@;cT !@6`P@`XX X gPU4Ѝۍ@0H-MLQ ,*@* @  *@Q  0F  0;$!@@@p @Ѝ0,* @I0,* @ P S@@@@B?H" 0Ѝ0H@H-M UXPP@HP`p)@@V`Q A` p Q P X X pGwX *@P P`U`Q A` p Q P X X `F vUX/p0 /O*@!` @0 p P \ P`U`Q A` p Q P X X `Fv*X`pP @P` XX X P``Q A` p Q P X X `VX`pP @P` XX X rЍ0H-@ *@P ]P "@YPP\T00H-@ *@P uP "@qPP\l0 *@Q \ : "@\T!@H-q! Q   D  |       )@`p Q0AQ`0NX X @GI)@`p Q0AQ`0@X X *6)@`p Q0AQ`05X X =()@`p Q0AQ`0*X X %)@`p Q0AQ`0X X | )@`p Q0AQ`0X X /X@ X* X=X%X|X/O- MpP *@P$P *@P *@P,P *@@ *@`>] (P@`Q ЍOFM (@@p8}*p@Q wPt   @Q  ! "     QP`|pV`PpuWEP)@ V* 8*@*@0P,$ XP@E`pP @P` XXX &@T@Z`P@`XX X P Ѝ㒦ptO-M@P *@P$P *@P *@P,P *@` *@p (@`VЍOpX)P@W9 ` / [`P@`XX X  $*@P,  PJ`pP @P` XX`X YpW`P@`XX ЍX ЍOO-M@ *@*@P$` *@`P P,` P*@x)p@P`UH ,(@ = [2`pP @P` XXX,J`00@`0 0 QPpP XX P XX X +X '$P,  PU`P@`XX ЍX ЍO p@-@ *@`5P RrP  V P@T!@wp2@ @ yO-CMP5@o:l:@T4∠pD  0 }p `p V ~P?P ?` D: Pl )@W:PU:? Cߍp@- M@ ` }Pp TR BQP  )@X0 +T ~P ЍpO-M@` !@nP"@0@ P qmP 婸P p5PwpPp)@ATe  @p"@ Eop UJ:HnpET!@㦤>`` D ` D [ pop [ U: np o:poP Jp  P[ /p]:ppT!@h`@T<H-1: )@A@F0O-MMP@r !@Y~giD@`@*@p*@ ͓hPfP hP< *@ vP iP:  H *@pp.)@PEU(A/L*@@9< *@PEnP  P `$# P !l@U=NP Z/P / `p4p/QP pp/ +PPP4  Q:l @㎅` P`X@H-9 )@@0P *@/O-M-MP@ *@@PmP lPs y9P 8nP 8`nPM T!@ @ tgD *@PmPd @X@  PMCmLL *@P pmP 8mPfmP)@ T2`*pX8 !@"0@ V0)@ @p 0@  P  Vlp$@ Olp GTX}*@*p@XF LmP @ `` )@@ h)`@P@p)@:pw W  AQ ) Pp `YPD T!@Т$글LoP $ kP;p㵋)@` kP[P `*@P  K0 A pማ Ѐ C0 AP*@  @ 0 @  } p$kPx.$ p @y$k80 `@*` @*@ kP @fTX kP" N8P @X@@PT!@OlP @G@C@$k k1@ kP @4 kP 8-P @& lkP T!@lP @H `*@PB @ DЍЍ Y@0H-MP@"lP=  ~p  8 @@㺃 , @@P$R W @@㫃Ѝ0lP7  \p  8 @@, @@P$R W @@H  *@0JP!'*@ @@@ q @v2 "0@T!@㦡_l *@Jq @@@ @M-@M~ @(p@p j` *@H d *@(@h *@l]pm'*P@*`@* @Pm##$H$$T5 !jp5S7* @0)9,T2 !jp;@T. !zjpB57+ @0 97 (@t  *@(@t  *@(@px*@Q" t   *@(@t   *@(@7* @08px*@Q  P J+@Q Np M*@@kp  P  P%  PKt :*@@ @L8 6t *@(+0 @@8j@ 8D{kPЧ`V  (@ +@+@( (@nQ?'&&P(&V# +@PU  S 0p-p6P Чp `VE:VE@1*}:0@P 0!QP+@~\V0P% \ V  +@PU ?  i0 ~\  0a0 \U [ V+@P~\ ~\+@P (@( (@P@ЍyH-M pP`@Qjp/e  p(@.P Vp9jkiiiV /jc`@(jc`@#jUiSi 0p Ѝ@@@K-M~ (p@pڈj+@+`@p*@- P* +@P X +@P @   d *@*@h *@ 6 XJ+@+@@ k@'l]*P@PM*@@VjP   Pt *@'jH N (@(@@P | +@P PhhP  P XJ +@@@R+@ 'dh *@*@0P SPR" Pz +p@ P$ (@     ZXJ+P@+@@Q P @  *@* P +@ @0P0 )+@+ @ p 0+0(/ 0@ PN'*@PЍO-MMHB "P"(@@`(*@ P+@ Zp00 )@㰠VXW P 0I`+@@# @ǿ@0 .2*~ @# @0ḿX"p @7U8b*`@Q 㠐# @ 㤿0F"nz" @囿. gP@*@0` ." ~! @# @0"p @"08'0y* @+p@@c $> `@(0@   e  +@ ] p0 x.2*n @# @0KH" @ "`0>U "N. \g +@"> !@ 8ߍڍA-~Mp *@P^ (P@P n @(`@~,[gP~܍0H-M*@@p *@P^ (P@0@Q+QJ 0xp3+ @5@Ѝ0H-p *@P@d5` *@Q +@@0 +@ S5H-@P`p gPp@DPTWH-@P`p fPp@DPTWp@-^ (P@@T9 p *@` (@f@VT d+@*@ 00T" @ ` *@Td *@t@$ e(@@ @4|3$ (@D,0 @P5pO-M (@@T (@`pP  }fP@pPE`UW@T d *@@*@p *@^*P@@Q *tC>3 P@@4@sP4TP  0p*Q*J P0PZ#3P 3P 3P t 3P 3P@@3EP@@T JT @d *@PTʰ@a4&T tP +@Q AQ >@$ e(@@ @G4 @2$ (@,0 @4ЍG-M@*@P_ (@PZ H (@Pp@Od*@Ph-0* @0p-* @`V!* *@(@Pp 0p)QJUpV` oR` 0, U0)QZP Pʟ@  (@ HgPJ@@3ЍO-MpPPPPC (@PU>pP*@@P7: @(@` 0P|)QJ *@p 0t `Qo(@``r`pP  0Pb)0 S P  P 2. @3PPЍO-MM (@`VJPp *@P PyU3@c3pV N `(@@p~,ePp (@Mᎎ@H/`H`fpm/H`fp~ ~,dP} `@~,dPpd/H`H`cfpGW` CtaQH/HOfpp p+@`@US  00$4! UM @Un (`@ 0(q& P 0s$ (@0P @o`p'X1" @``(pqL1. @G1" @ B1b. @=1# @81D# @3p`pߍۍ Hep!1/0 @1m#0 @2O-MM +@2dp 1*/ @2  %dp0D/ @2@*@P*@P$*@P Ѝۍ$k+`@P +@b@2t   *@(@P,P  (@,P p *@pWWWP S@62$ (@r@b2Ъ+@@\2@Y2l2P6JǁQaEp@P@`@!@@@@.P& P  P * P  12.2,2?2PZPZ=@2 @(@n$. ( @ @@W 2@@W2H ( (@ @^!@Q1ЊM+@@1s@1@1@11P9JMs@Ppt`@@@@P@p@*@.P) P QrPYP SP ?yPp7@sP3 1 11111PZ @(@@.* @@1 +@ N*@@P Dlgt.P*@* @ @1@1# @(@#@@@-@L (@p'pH-0*@P 0*@)0*@/# @1H-dp H/ $ @{1@-@cp/!$ @0m1@p@-MP.d@p/@PP NPP  P P x/` dp   P m/`@ЍpO-M@PsJPj+`@H0/PlJ 0/PgJ@p PU8r)@*p@̄㸔X @Q @0`3/P= 0P*4P3J%f"P!P*JP%J/P PP[) G 0)@@  0PP P (0/+@ b SЍ.6$ @0O-M 0N (@(@@P J \(@L B 0SPp\PfJ*@pL  PpWPH \PEJZH (@PN @&0   `(@PJH  2/~ p(p@*PJH  2/pPJZH (@P" @/Vp pF  A@/ LA P+@*@T ЍO- MP +@*@p`pPJ @P,PJ+@@$ 8*@2/P F R g80*`@ 3/P @ PG WH (@PB j@/ W@`p[ P P pWH (@P @/ bp P@u/ Ѝ@R <8*@1/P *@D@Z/O-M`P=JP+@H0/P6J 0/P1J6'P.J@ +@PP L (@UaP -G% @/p +@P $PJ@IP (0/+@ ``K'Ѝ8bp*`@̄㸴@P  @Q @0`3/P 0@[PJ P   0@`P t +@P bP +@+@& aP! +@+@QPP ` ` Rp RP~JPyJ # 00 @/P P@T' @ +@+@& aP! +@P+@QP ` ` Rp Rj +@P XP+@ 0= +@PP +@Q \ (@P P@@Q:P P   @P3 @+@P @pJ @03/0 +@P@ 0 +@P +@PH X +@P @ 9 7  0\t`" +@P +@P X +@P @ 2 .X +@  0 @39" @Ἰ0 +@S 0@PP L (@p 㡸 +@G-AMp8*@@/WP P`PP 00*@p *@'/P p% @0p-PP/P PW\% @0-AލO-MPj@+`@PPeJUUZH0/P]J 0/PXJ+@P "PPJ Y p#PIJ ㈪+@+@Z+P@ w+@@ X +@堷;P4 (0/P`!P&J +@J+@@P X +@ @9@P+@ ^@ J0@@,Ѝ8R㸄*P@P  0pNP P P !PJY #PZO-MPp+@ Z P2J `P/J,0/P*J0Ap +@P Y"PJ8b*`@ P W 40/+@ `.^$ +@P $ `ЍJP+@@3P[PJPT PP o!PJK_ Z x PJ P a.  ^p )Pap@/P LP %  T +@P  p  @P*-%0 @v, _ P ~ @+@PP XP+@ 0X +@*@1/pkP +@P +@P4 X +@P @ & " D03/ p~ +@P +@P X +@P @   㽶+@ ^  㳶+@WJ P P J P PJ pP 8B *@@8  8 *@1 H- +@P N P JP JP +@H0/PJHO-MMz`+p@,  P @`M+Ѝۍ@ /PPU/P /P@Z^p&   P+<`PJg PJ#PJp +@P PJ8b*`@i P +@ `\E#9 )$0 @`h+ @ℚd@P  p@+@ᰬP* +@  /POP  @*^PA  PJPJ M P  pڬ +@+@ ]Pb +@P X +@ +@'x* @+@Q  +@QP.P4` 4P(T@Q:P PF ;\p 6uppڰ pp _oX,` R p Rv +@P+@Q4P:` :(-%0 @*hp +@P_ +@PZ X +@P @   +@E` RV p R4L |,  0H-I +@@Y *@+P@ RP +@ ~ R@~< @<)0( (@+@ t *@ p,PJ +@,9+0@  ()+ @0@-H )(@+ @  I*@+@@Q R ~ RJ@~< x@<)t *@pPJ 0+@0 +@()+ @,)+ @( ~(@) *@+ @  +@/O-MP\ +@P @S)@Ѝ +@(~ +@`(p@R@PJ(,+@+@pA`? !X P0P0 RpPPCJ9PU+0@ U( p(@Q P. P:( (@ @}PJ( (@  0)+ @ Р+@000ZMPH SS(@S@SU@(G-,n @(`@PE H (@P @(;0yp+p@1P3J( (@+@P>P@ RUPpP(PJPPPjP ,i+`@ (0+@@ ,9 +0@@M-M@ @@L ,y(+p@+@ @00C`So``V``  /PP`5  +@ ? U P'J0)+ @РPU`U @APPJ  0P000S00PU `u @Ѝ@K-8+@Q (n Y(`@+P@P0,i+@p +`@p(i +`@0pp P0I+@+@@pPJP mpppP\ +@0H-,I+@+@@P0(+@PE%( P(@0HO-M@@ +@ ( +@(@ P  P@'.pd +@()pQ+ @a`T` +@`pPU U- PCJ p+@()W+ @?TP`D)+ @pV2(  +@,)+ @`V!)+ @@D` P,)+@+ @Q BQ \ +@Ѝ, +@pO-M`Q!,(+@+@p( P(@@HT]PJp@T@ ypPE`UpЍO-MQ,(+@+@`P@pKWpP`Wp R`@DPT`pЍHPpO-MPP$,(+@+@`@pKW( (@PJ`pWPpw$PU`Ou`ЍO-OM`PpF  2F+@P Yp/%(+0 @'X,y(I+p@(n +@@(`@ @RP-J R KXPXx YpH L0"# @k&p u@c&$d(0 @&$(+0 @&OߍO-M@`pQD J}YP $(0 @&ꘐYZPPP崐1,P+@`( +@ @RP) 0 R P*+ @ R  0` BRPZz``W J R PnX `` `+@P 8P  @%ЍO-]MPpp4 50pE,8 @ 2E+@㌄`P 8Xp)$(+0 @%`4`D`EXP $( @0%P[ө (I$( +@@(@  `Pl9WP&`P0$ R( ,[? 4u4 P( (@ W`P Pp .@)(Xpx |0" P#`$ r@9@ P 0%%`#`) @0~%` P #) @ P0Pq%`@0$Q(, p!R P4p`]ߍG-`@P   /R HIp+@@PY @$QQ  GVpYP+ L+@QAP8* @0App3ʴ8+@@A#pP$( *PJ 0'pp*#!* @0$X +@h0B* @$PPn_Pp~"O-M@//Q/P@ p` P`WP/pP+\p6 +@P    WpWP G 09/pP  ZWQ  PЍ/p@-Q$J@`PVpʤ"UPS* @0x$Pp2Wpʕ"v*0 @k$^L +@pG-MQjJ`P@T@Upw"S* @0M$ +@P $( QP+@Q P  pQXT+@t+@PVVpIT P (@(@ P`p pHP Up ("* @0#Vw^L+@ЍH-`p@VPP UP X +@N"+ @0#P@-@UPX +@:!, @0@#H-M@`Q0 `3Pb TR (`@(P@PP* vVP !+ @0# Q 8 =b0A0R``pBQ H =b0A@R BUP !NPP aUp!+ @0i#Ѝ/H-M@(* R $ PRP ` V  P Vp   P@ " 0ЍA-MpP@UP TP- J! `6P X#, @0@#t +@Q "#!"#@ "Ѝ  P  "@P UpUpX!, @0Q/ 0 0H-M@P UQJt+@Q   `' &0 0`' &@ @"ЍO-MMP(P!08@P#`E($pEE ,( $p@P~ +@@VP  +@P C5UP8  P Y% L#Sp; CUP8p P p,j,j bT(SSP% Y T T lP Ze +@P 5pl@> *$ @0" +@P  PB* @ 0!8J+@@Q P l< P;Q$lT P (@P(@D +@ @P< 'Tp0PP,P. (W@%@ a!@5CTpl? 8Q?"0P8 }+$0 @!0 .@ l@ @ o`@ $Ѝۍp@-M` @OTPPJt +@P PЍp  P "@RP SpVP [P@ TpX +@vZP@{ 0R!PO- MPRa 0PpP4W@@@P `T V RQP z z84+@+@0,+@+@P Y  hP (ZJ?  nqP!U`P  `0PpWPEB@} P, @2, @80 Ѝp@-MPR ` 0@1Q JP+@ Qp P\P@h\P@ 0 PЍp0H-M@PJP R +@P `$P  @0 Ѝ0O-M Mq` V k# QPPp@@ PP  QP`8`9@Pp*$ 8Sp`HL  # ` 0`q8P @a(+0 @  @U,0 @+ `Ѝ ۍ@-*+@+ @ Q\R*+@+ @ R@` +@P TdP+@ @P J +@P P@C@@O-M|I+@@P x+@`Hd~ \p+@)@@+@(p@\+@+@Q P Q5`P@p PV P` qP V  `g|P+@ `Ѝp@-P@PG@$p `9TP P@P/Q`+@ f0@S  l+@ PPpb@l)P+ @Ppp+@Q  |+@Qt +@ +@Ql+@Q P/x +@Q |  +@/H- +@P ` +@pWMf)@P@@ `@Q P =pWO-M-HM@t +@|+@Q PPJPP P( p0xP ^ `+@$0 P@,4P @ Pč܍X܍x܍܍$  -PUZV @TN4 ϊX   @ QD0 +,OpN  0 . @$-  @0' +@P" X` P8@0 Pp8 <0 @DP"P $- @gPX  P8l & , #0 +@P  `Р  C $ 0 0 , +,(@ " +@ @PPp +@HЍЍK-hMP +@@P1 (``pTm Q p{ P!@0Wp : @  <PHL@ 6P$0  @hЍK/ W@ 0 "@ܧ<@Q*^ @PD @˧ ,h hЍA-8MP@0400 a0!4 @p`̅P>.0@ @ @0P8Ѝp@-XM@` P0`8km\0Df@ 8XЍpp@-MP@PP Q `P0 ^8QЍpЍp@8H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|*:H-A0\ Q: W \03#€A#2\ Q :A1^0Q:0AQ*H/@-Q0E\ 000SQR% PH* 00@C TB"/ A@CTB"@ a@CT1B"`   \& P"* 0@0T00C!\@? S 0! S@" P$: H-00C\ S: W \03!€C!\ S :C^S:0CS*@- @+@Q@@o@H-P +@@p0p@`Q` i+`@` S! Hp`U?`-V,+@``````V  P:V)@ @Hsy`+p@`:P)@Q ! `)@` )@@0 ?`/p@-i+`@PpP +@ @ nP P)@@ P@0 P +@@PQYO-dM/ zP+p@n`@`$|ZP+@+P@ T +@`rHo P p@(`@@  0B0@JQP缞Ȟ$$<$Ԟ$$$$$$$$$$$$$<$$$$ $$$$$h$$$$$$$ $$($ $̟|Tp|0$P[Pl$$D$$$$$d$$$$$T0@<H (@pPc}|+@xH (@P @H (@pPHbt+@]0@P+@7ڀQx  *@"@K4 @x*@E, (@@+@;0@H (@pPT" ( @*+@% (@6+@T+@x (@'@JSP  0@0+@+@p+@d (@n (@ (@ (@t*@  +@0 @9 +0@ +@x *@!@0@pʬH (@P*0@-QQK t*@ 4 +@P+@P (@+@T (@x A*@@+@P (@P +@P0@P hl +@P$ +@} +@Py\ (@u4 +@+@lt*@ eH (@pC 0 0#)@ X:X )@ +0@  R Q[q q8R+@0 (@L  ! +@P*+ @Pv -qt @`p p@@>  (0@n /PT0BJPD@ĥXئt@(TЧܥHH0P`h0hp ( (@ BP 焣Уģ +@RFx0@*@\ (@x *@!@| +@ivx +@`ph +@`jx A*@@dp+@ `^:0@zTB PR +0@+p@(@@(P@ lRmR oR pROaR eRX" ( @h,0@X p1c$t0@*@`k+@i0@@)+ @ p*,g +@f`0 0@(@ h @ L0PP+@ $h+@+@g0@p @tfP (, p(@p p@+@b+@a0@ pe+@dl+@`x  *@"@$*@0@) pb+@e0@ `+@P+@c +@@|lxl0@Opq{ +@aj0@pojbt+@@`\ +@jVR[k P@, (@p p@IrRB  P PX)@+@XH .0(@0'L Q P +@Hc㈉ `@+@p[ PK@T*@ @T # @P" PP P )+ @p +@ p pGp@Tv pp+@hp @yPP @ !@ʡ@P4 PP PA  aP QYW U pK @ ;PWU Qp QPP p  pʝWU Qh @P)@ h8 p+@ PQ  O @Pj+@eH (@'D" @ @Q QH -(@0 H0H -(@0 HH B 0(@O". @0  #Q0 P(@+@LP$:@Q:P7)@ PJ+@ 7p7b)`@ P7p, (@b)`@ P p @HO @B 0@ @  @6ᩝU0@ @&l @,$0@ @ ")@@: @1Q_ "P@ហL ᚠ!@10@ @  @r @& @  @p[ KPY P% pP!ʔ@Tw # @PYm p@PH @PPZ pptPh @P  !@JPPfX)P@P. HcKs@ `@ p@ P  P XpC@P y@T5EPZ/h @P  pP} O @$P .pq, (@ tM*@@PPP f @PPk @dЍ>& @ :7K-m@"`@Ppp m/"`@W Pp po @0n+@P  /H-)@ @0l@-)@@v @0s# @ 0m @ 0g @ 0aMA-M `P  Pp0 WA L: RI 0lS bS kS(k5xP;mS wS(o1xP.`k4xP# (f:xP  0S xS *SP(P6 0R!0 PЍG-PQ @nqP) 0I+@+@@PP" ,`P=P p kIP 0 S00PV @A @ @3OtG-P +@)@ @X @᪞U |リ @!@p5 oo 睞VUP@ڰ  Gp@-MPP P@P PPP IP PE` > 8+@`P8 +@`ЍpK-MP@PB @e`p\Q QY QppHPj  XP ` ;p @ 0 N<`\P P+ P``P" PP啸P6 P fQOQPQ SQ 0gQ sQ pQ*  GQP MN[ @ gۍQ<+@ R @+@ ټ 2Ny @}Ҽ +N @@*+ @A-PP @6p@PIHP `pp D 0+@H +@PR ``  @``H-D +@pW:Hf)@P @@ `@ P ႝpWH-D*P+ @Q# 4p@T |j0+`@`V l:+0@0S Q Q Q MPP0S  @P0S⼷P `P/`w  @/Q @d @PP/H-D*@+ @p`W P 00 /P P pWh +@oh |+@+@oQ`h p+@P aPCSUSK-P`>Q&?Q) [QS.QK  !R`!Bo  @`P? ]P# p-W pW]W Wpp#P @P *QSSP Q! QP R`*P P P  0P QP P l+@Q /PPG-MM@\ (@PP `p.W.P{ f @KWPyW Q@@QP.QP.QP/Pf < +@P U` PP^ P P2 P ` PLp +@P| +@ @o @! @C @PP0Jڅ!Cip!@ @ @ `@ 7P 7  P!n @L @E  PZ P/P @ JPЍۍ.P P @pP P @g` p,WZP @U P 2. ,:T+@pW7 P/P`P   @p.W o@PpW P /PP ` P    @ P.WPo@P~O-MM@< &p+@`P,&X  @'@P(P`'` [h 0`Pa V3Q V* V3W V1: Vs P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  _Q \R\&R Z:Jp '@` V Bp, P ZX   @& Ѝۍ V*' Q pP P   #'0 @ V ` P' P  ',W' P )@\'0 @ cF)@ @ [p@-@P` 0PJQp  0pp0H-P@P/TN@N T @ 0@ U:UNAQ:0Q0N0A-@MP@JX)@+@10BP<8400A0BP<8400A0BP<8400A0BP<8400A @*+ @@0 +@0 0 b @ @,0 \zp+p@P  PJ  pP  PJ  pP  PJ | pP  s PsJ m pP  d PdJ \ P\J V pVڳPYJH (@P  "@@L p(@SP\ (@P p@ !@P@POC@@PP PE/Q C`` +@V`'  U d*@+ @/@(*@?wH@ @P|P3" * @@Ѝ @~ k* @ x *@P  qP @@-@ +@ +@T % @ @NL +@P iA| +@P w᱕H-< +@P 0/C%=Q5aQ^ PU  +@P  /C#=1#aQI 0S  +@ R> `0p PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RA-P@`PVz+p@P=]FP8 #V \V `#P` VP`BP P/C!=Qh8BpaV Q PBP `P@t @ ~  @A @v A-P@`PVz+p@P= FP8 #V \V `#P` _VP`?P P/C!=Qh @paV Q PRBP `P@ @ ,  @ @$ H-P`@V6 @/pW PP`VpP0 F R :,VU .V,P (PA`VBP W`Pr @p bRCR MR mR cR5pN @ TR(ou p `Q G JpUP+@ R +@ ``*`+ @` @0 ! @ !p R @ 0 cG  @ | [G @v H-0@PS$ p)@ .SmWpj0S1`W "Qp!@`p@ QH ,\\\\l\PP!@k@d TO P!@P@P!@ P!@!@(p0H-[@+P@P  DPN @ @0O-M +@Y: 0@P4 \1: РPq vM㐡`aV p !  !  pP` @@P, `⭰P$  @ `Ѝ ,  AP Q dFbF^Fy @y H-+@Q 0$0 R: RC qN vAMDI%bAT0 $ P "P%  `$p% "  @T"FHFK-+@P y`AT PF FU@`V 0H-[@+P@P)G CP d+@#@ `ZO`+P@A@4` p(@ !>  @  -0 @V @0O-MMK+@@Ql p PG% t` (@AT `P  ! 8 tP7 P8 @T ?P ` 0QJ iP- 0+@p` a0P U @ #6N @@ - @ - @  `@ 0T N @@ QEЍۍ@-M @Q0@@B!S !Q 0@Q@?0 !`#!K0" ?^   @@@T: 0 Ѝ0H-[@+P@P BPw @* @0A-K`+@@P$ "@PqW [P p (?P+ pP# ` P qP @P `8PP DP  @DD @ PH-{`+p@P@P"_qW  P p )0H- [@+P@P =XBP @ @0H-   PM-` +@@pW# /PC!=ahP Р+0* R >P ` P@m @o O-M +@PU 0/>3C=a 3@0'sfp$0 "Q  U `p'`&p PS0 R^ @ PN PXZ J>PE  p  p P "B @ K ++@@+ @ 0%=R />3C3&3ᓌc1S ` p'`&` 0 0   "  PP@ J @  @Ѝ 0@ =P 0 pp ``  0H-[@+P@P =]AP @@0G-M+@P P=p aV  0 $@ P4(` Z ЍO-M +@`V8 @L@P@/8C<!=㐱hP ! # " # " (0@ }=P p dP ( qP @$Ѝ)C @ЍOBG- +@^ /NCCD%C=Q%dAT $ `Ёp)P(PPЀP) p(P (PU@  (00 BB/G-Mp +@PP/P` `P' (=P pP @+@0 @ `P Ip0< @ < @ B% @ ۍO-M[+P@@T, T P Xb +@(@(@p(`@P$P ;  p p@P {ByB@TЍ  +@ Q/H- +@0S ^Q $;+0@0SQ@- Q @P @ P  (@ (@q  @J @ 0H-M@P V `00?(P2*2*`` 00 Q*  ;00?( P2*2*`` 00PR PT^ @Ѝ0O-MP4 PbH (@ P@ `@(@+@p3@P-P P@P @ 0 2 @ @ 0@) @ 0ЍO- M@PS`PJpZ( KAQ:,+0;+ @+0@P 4+8;+ @+0@w d  l , t 0 |  p[ Pp$``  4P  KJQ1Q 2Q ,  KQ LQ ` /R5Q (,,(  `  ` b$   l b `/Q``@ Ѝp@-@ Q P`@peRe #p@tO-EMP`@Q |(8\HX\\eQ  @(@+@Q@P@dT @ p~ d =@Q:P P/ @O @x @ @ @12 d 0 |0 F `+@@@!| @idPЀQ :1qpA~1QSpPQ: A0 cA% ,\qlp Q :1QPA^1qSPpQ: A0 kA h 0\ytp Q :1QPA^1qSPpQ: A0 sAMIpJ: P Q :1ᒁA䅎1QSPQ: A0 A0s `  ?(P2*2*`` 0P eQPp pQ :1QPA^1qSPpQ: A0 A0 2 @@Eߍ Ѐ |pQ :1qpA~1ᩑSpQ: A0 {Ay   @h'@PJPJP P@ //0H- Q @P P @P 0W @ P$ +@P< +@Q_ @ 0H@O-MP@PJ㐄`(  lY!R ,`/  KAQ:,+0;A+ @+0@@5 4+8;+ @+0@) d _ |  p P`p$p`  HJn)H pt 9p ,` (}pl (Pm GJP1 @R 0 X 4< (  aK@Q:gPxP cl#xP"@ @  @     $+@QD KP  bC   1 ,  I PQ p @ /O! (  B  /R    c!KP @" @  @ Ѝ O-MP@Q :P P$ @+@P s @! dP$ +@P  F`dQ0$ +@P&Q$d@ApQ /Q @ @TT }T Y `/ P%  }d 0@ Sa`23 75pLHll,,p1p @ 4 Hp `q `OIVDQ :1A@AN1qS@pQ:./O B0 {W&FQ@p hqQ :1A@AN1qS@pQ:./O B0 \ 0# @ @0|` f$  QS:1a`An1qSH6pp0  |0 3PK d @ +@@`| @Q :1a`An1AS`@Q: A0 {A- #0 @ @@ p+@` pfL|Q :1a`An1qS`pQ: A0 {A  @@=rutF`$ +@P  0Ljd` {`Q :1A@AN1aS@`Q: A0 cA )0 @! @i,lrl@ @pQ :1qpA~1ASp@Q: A0 kA _' 0 @" @H0Lztp pQ :1A@AN1qS@pQ: A0 sAt $0 @ @( +@!@Aq:P@ @Q :1QPA^1ASP@Q: A0 AJ $0 @ @@ߍP0 ㇯f !`@UP P)X` Pj  `  ?(P2*2*`` 0+  ?(}P2*2*``P P 0@Q :1A@AN1QS@PQ: A0 A  $0 @ @}@PJ CPJD[+P@P @k+`@ P J @ +PJP P@xA-MMM `P@P#@,l U U D+@ @D+@@+@ mMލڍ @ ኘ0H-@P P @ 0HH-MM A0 S0Q /) @@ 0P `.p*V ?V.`pp\pp0` Q0/P @$0 @ @P$JP$0 @  PJ@$0 @ P J@$0 @ O@ЍڍK-M-PP  !@PP C*0 @ TX)P@=p` @P @ Q 0?k`P @@)@U ȷЍ0H- @1PJ @ @H[P+P@ !@㷶L +@Q0娷1p +@P $ @ @00Mp@-MP@\ +@X +@+@)P@ 0j+`@P  J P+@ !@` / JЍp@Ѝ/ M@-MHK+@@  P0  Ѝ@ Ѝ/p@-@QPL +@ R `AJP @ @P@@pMH-MP@\ +@h +@+@P)`@0z+p@P X lJ `+@ !@ ̊TB !@ RJЍHЍ/H-M@P{ !@BIb!`@p xWLP PPp?)@P:.? @P) @/P% @DPf @DPJ2p  "@D2p  0"# 0"# ܯ@PṖH)@@X@m @ᦖH-] )@" @r\O-MP@z !@pA3eXd `@+@+@ VeP qPrP vP xP8 VPPP RP fP iP)T +@ pWP dPP +@ ` +@T p+@h +@\ +@ p )@`VT +@PЍ@QpPW> Pp+@F@Q  /Q@ pPP/Q /7Pp.PP .PP PpW @HppQpWPp +@᱅VlY+@wp+@PU j㰥p@!`@ @、R1hP+@ Q  0PF T +@P PI ?PE PA T!@f;Q A ZH2 QP++ @ R' T++ @ R Q  !P   P  P \ +@PP0` +@PJ &HPU~90T; +0@P0hk+`@ `Yp P= @U@p[P+P@!PSTe㛺p!`@!@@ Q 0|||||@T +@Po X Pi 2aT+@Q X PV P Pg P 6T$+@QPG p@ ' = /PT+@Q/ P-0T +@P$P( P?P% Y Т @p[ +P@G\ +@PP 60PT+@QP ewpPug` +@Pt +@P t+@ v.vP r?P nP#@ᒔBh@0!@ H-? )@ @T>t +@/A- M@X +@PM)@ @ <H)@@P@'P&l `+@P5 P P0 I/P+ P' L\ +@P![ @F`)@cP P@Tp P Y@ob Ѝ`p T8 !@"0@ V0)@ @p؆O-OMM`@Q  p  P#@ .p P{/P Ѐ # "!Ѐ # "  PRp-P 0w pЀX` XzPp X -PX--P 0 ЀX` XzPp X s-PXf--P 0bЀX` XzPp X I-PzX<-q-Pr 0fj8W WjX`  @-PS  ApWPJW -A-PB 06:РZ`V`: Z `Pj ,PZz,-pp`f.P p p+@pT!@c p p+@pT!@c,OߍٍO-MP@v !@=$jxp`@+@ 0SvPppPp)@P<P5 TP!@h-p!Pg$p/`P PQ P O-p PN/ ]c Xc` P .H-# )@  @8"G-P2Pr  pRTJ+@GB<`'pd< < +@ aRX +@P GJ H-@Q  0SkJ+`@P@' `qW P `pP R 0S JA' `+@/p@-P@U  QTl+`@544PX +@P PpH-T\{+P@@`+p@Q `'VPX +@P HH-@PQ  0S`J@' `+@qW P pT `@-@P@K-Tl+`@K@;P+@ 1S ppW1 0'PR0PX +@P d400@ T;(t @(p@ `YadQ A _`@T K;) @cp@-kP+`@@Q  R @RP'UpO-M@CDU+P@QD `V@ , E( (@ @(@@P =P w `@,P p; @`dQ A f_ `VZ @ `>Ѝ0H-F!@@]CP aP@0DU@+P@P g @ A-M(l R+`@#P@@0A P* 0,p+ @   G 000o0 @ p+@  7qQ Q, QT&]QE AR0L%&''' &,&'D&P&\&h&&&'&''''''''''&'&&& '0 A R*@G8G@+@@:0\+P@ p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     @H-M@Pj: l+`@PL4P  IRNP  'pP  !pE( +@@$ +@@@, +@PPP:Ѝ @ 0H-@Z,\+P@ )RR0H-$ +@  @A-P'@2 " (@( @ W|UH ЀJVn,U+@K0l'@W+`@@P'WP{* @ @~M0 +@ 0o᠂@0 +@ 03Ѐ0 +@q 0(ЍK'FPb,U+@ Ѐ, +@`'V'VP{*  @~ ^ (Ѝ @{ @w7 @sO-M8,؄P`p+@#@(@0 +@ !  01@ DR0 0SR* @Z 0pD`PP PЍO-M G(@ @@7?peP PD+@@T' `V <+@pW .:P Pwpt6` E EDeD@ !@]_@P .P.PP/PX< #@ *Pf `p P@6'p  P[ Q up,XxP X r6  PP7  @&Ѝ @^P-PP@ <+@+@@P@@ @ @  @p@-Q+@0P B +@/p +@/p+@ / p +@ /p +@/@-@P(-P| +@QQp,@+ @cP@@  @H-Ml+`@M0DU+P@P @d(P9 +@P +@x\+P@pW'p b(ЍH-M@+@/P P%  P&  P) PЍ NP pP `P   P( 9PP "@}  @x @sx,+ @QU/H-P, +@x,+@+ @0 QSQSQ p0+@ //G-HM !@/8_08 (< p @@`PD( (@0  @ ` @PLHЍ H-MLP+@@`pW'`qp@g`+8+ @ @ `z@ {n6P0P p0Q P.R 0r0S !@ O@Ѝ N@O-MP@/p 0P }PP 0TGP U9  Pp;:ꨜ㘰`P+@WP 08U)PP $P  P p PPP'  9pG`P> ER:UU ~,@+ @_0!@ H-`@PApW pV V&L+@+@,O-MX+ pR%pPPP :PW B (@@`Q'Pb (`@U@  vZ/P/Ѝ 4,+ @WQ:Q:Q @ЍO1&O-M=[ P@p`@W.b@Q'ww|wwx|w|w|w|w|w|w|w|w|w|wxx x|ww(xp`@PWD5 +0@` RW pW P  DU+P@AP PxxxyX [ Z V pWi (@pi +@0z PPPQ PT P PJD%+ @pWAoTᬜ +@pPU P,z8zDzPzX[ Z V poPMP +@|Y:(D (@@IP G  @nIP PPЍK-T㬜+@r @+@(p@ PP `Q QQ`PP|U:PX +@P KK-M Rw{\|P||+@pP @ u`;%PEUY s  @J'Y,.Y,  @HT!@JTL+@@@V PNPX +@P i  @HH  @H Y  @H  @HT!@[J (D (@@P Q A H *Q A H Ѝ  @XH-`@Q  0SC|a+p@!(@r !!ApQU P# pPV Tl+`@E$P 2PX +@P P( +@p@-( TL+@+@@ 0 0PX +@P @O-M/@`P0KP  +@P`  @['P `zP+ pP P P pEP AP =   (@p P p (@p @P@Yp P (@ 9PN 娬 +@ p#Q  @(P P R  @(P /P  W YB P vp   PPj P P P p@ pY , `(@@0#@ @H: p(@pT㴐+@`W ppAo  pQ B0R0 @X +@P W    ЍTL㴀+@@`pPsp@op`P (@@D""UP pP($  @ H-P#@@P `pQ%V P Pp@H- P#@@P `pQP Pp@0H- #@P0@PP@P0H- (@+@ 0Q R RP U 0|S(K-@+@Ћ`pP @P P:Q :PPQPPQ %Qv5'P`:QPp@B (@@qVQ`UV Cq `A-T\+@+P@`@T pPS@p@T`|V:PX +@P Ap@-Tl@+`@pPP PS PpX +@P p@p0H-MT\@+P@2 (0@>0 03R P Ѝ0X +@P Ѝ0H`H-.P Q]SqO-M[@ P@`p)oPP VP`ppP vPcP  /o0"  D+@ 0S @T `#@ P`PZ! pZuEP `Q{P7 P=PE `ZP  @F5N  @UE1z  @QE uP!  @IE @FP (D (@@Q A \E Z  @F  @'Ee  @#EP@TPP ^0 zP8 qP|/!P* pP6 ~`Z,?C"!@`Z"  @DZ   @Z  @Z  @vF +@`P   @D`@T=$Z!@D+@P  &` PEUZ!@D @AF`P``Ѝ  @W@<& cP+  0@! @  @M  @IH-  (@Hy A-P0-+ @004- p+ @p@-+ @0P-+ @0)+ @" ( @ f (@r   Z:V@ ppW! T8  Z4*W @W ` `p)P' W #@ P ` Z*p P P #@ @ZT  `  p Z:P pU P U`R p pP  p ЍG-PN T]Tl\X@+P@+`@+@+@ >RR4 *R[R?R pP ! P k ,PP P P  R Pp@e@T0H-P0T]@+P@@U@Q@0H-@M+@@P T\Xl+P@+`@ppP P PP+@O-M Pv 8m(@+`@A:P:Q @ PPP3[Pq -Q PU ]U \UPY[44@ $ `8:>PJ $ 84P1>P]P9 R RX #@ X* RX 2#0@00 0Q 4X* @P  @Q: p  [`N[ `?<Ѝp@-M`P@P*PP@+@P< U9 P5P2!P (@@P@)0@@ P%%@@ b<`P=PPV P+@V @L+@U PP @ЍpO- M8}`0 +p@(@ R噠,S!PC UK@8#+ @Թ̾p̾̾̾̾̾|" ( @5-S ?S/ @S4 Y P+@Q0 +@ P嘀``P  Ѝ0C P :`P=PPV VP+@V@P0 +@(@`H+@  Y @00P /o?o T/DZ`PFQ*VX`+@P"_P p .P.V  P Z Q/@E\ +@-2Z/EЍ\] +P@0pCW:S000S P PJ  "@P R0H-@PTP+@ 0H-MQ)P`p pAQE@`Pppp`@TP@`PpPЍH-MPpP +@ 08mR (P@4" @+`@( @+@@  @7p@-Tl@+`@P( @, U/R (P@P,@P 4 +@  +@ (@ QpX +@P p@p" ( @ R/0S0H-R (P@+@0-B +@+ @(@@ @ 8 @    $0p@-TlP+`@Q@ +@P+@+@ (@@QpX +@P p@pp@-R Tl(P@+`@@PJp,P s PzP +@ 00 `+@`  +@ (@ pX +@P p@Qp (@/p@-R @(P@QQ `m+`@Q QQPp/ @]0H-B `](@@+P@P00H-P 0B `](@@+P@P P0 ,0H-a@+`@P<+@PTB r (p@p + @pW + @+P+@uPW.U i///8S +P@P hpW tp(| @ Q +P@P Np4 R (P@Xp# +///@PP pPUc @2 (@N<@ @ 37 @ *. @ " ( @0S/H- !@D+@HH-+@QG @PE T!@U3P _`p P@J3`pV(T (P@Q A ʼ1 2 (@p T\+P@_@PX +@P  @7 @3 @.*@- @!@@O-M !@+@PKDu+p@_(D @ P@(@@ B`P6 5 +@rD F  2P ؐ 2АXQ A ?1 T2PPЍ @ @O-M@Pg %P  P' @ @^P @g +@Q`!+ @p 0S 0S`b#0SS ApQKP4   Q) +@ @P<P+@p`P PА?PP P Wp&PE`UW%P -P +P &(@ @P J+@P +@'PpZ ЍE @ (@p  +@5 @5 @(p@-!52 + @r?D (@ @!0R00A+@@@T P`V P@T@@Q Q Qpps $@T %0s &`V 0 p0 pH-@PG PE T|+p@  Q `? Pu U PU ` Q`?gpLP=`V+Q 0`/PU PU0`@PPX +@P Hs5 +@rDD @5 +@rDD] @ D @|H-_@ P@kPP ZP@lP pP@@T D+@QP%E% (@6QP@@De+`@P (t (p@P P( (@-T!@DO-TMP(ؠZ Z P$ J? pQ` q@P @Q V V V "@R TЍO00 PP@ TЍOZ @ p `V G  @05 +@rD I (@0+P s !!P - !0 @0P 0 @#! @0@{ q P PQ4 S (! @0RinFg@ /QQ'   S 6 @ i @1! @g0 JF@. P@P@.@p:. P @Z @   0J`Z @ZP@.pP@.|P@.X `3.P@ # TЍO-M X`P QP (@NPv/Q+P@P(㴱+@@ `p+@P P T  Z  Pp`WЍB (@@W` V `4p;?  @j"O-MRP`p+@ @pPP TT\+@+P@+@`VpЀP PD 0S8`  `pw$ Wp P pW \  \ Y`Pp ppWp P  Q: `[`p RPR PU: +@`+@ T\0+P@pQ$ P <+@P  (@6 RP QP`  R , (@PX +@P Ѝ0H-T\@+P@P @P0X +@P 0H00\  L\ \0 R\ 0 Q/Q QP//Pp//O-$M_le@ P@+`@P nP pP[@ D+@X[  F/P 3P+@PXpDu+@+p@P!+ @0 `V ``@`0 P``P Pz`P PP PP pZ P` +@Pr$(+@p R 0  R Rp AQWW PU  Jpg pWPU  Pp Eo P  +@P3Go" [ Q 0QA & ! @09O pPUP& ZZ" [Q .pp[  . (@6P +p$Ѝ[Qpp p. @w  @r  @mA-O` @@PpiPP gPPjP pP`pPU*D+@PQQP|@W T 5 +@rDDP @ V P  ! Q "@,P/[ (t `Ѐ!P@(p@,Q A e+` 00V V @ @@-@+@Q P@`+@Q +@Q !+ @ A Q/0S / (@6Q<+@Q/, P(@ !52 + @r?D  @! 0SS @0 g,G-A㼡+@@㸑+@+@PP P`P`FPVT|+p@PP RA APQP `:@P`ƵT  0P RF:}P@ P 0P`0 @AVP%DQX +@P  !+ @ (@P  XDPPX +@P H-Pp`@P t  0 0 ] @A-P<+@@p`S u( L4"+@+ @ i(+@ W(@ VNPV5((UP+#P(, "@P , @"@UPPPV (@$p f'c'W6P \'Y'V'T+@ @%A-`<+@@PpPUU (@@V  X@p (@NP Vp pPpH-Q@+P@ (@`6 RN`P2`q+p@`P..p@-@BTlP+`@P oQ  (@p> P5 +@rDD (@Q , /P Q pTPTP RQ /PQ QHP PX +@P pW[ @%0" ( @N RQ Q  P ӈ@-A+@@Q+@Q+@Q!+ @ 0S 0RS Q n @(A-MPP0 @+@P* R0QP_`!P@!@ x|t$   @P !@"@7 PpW P P@P pWPVP o  @PS !@P!@[ @ @ @{P !@ @p Q P !@ @ bP !@ @ @TP !@ @ #!@  !@3 @P:P !@y "@vg @ro !@l`V  pP!@ p@ P@^  PV`V @@ @=K @86P P@ X !P@ P P@P P@P P@P P@0S `& ! @d)'%P  0s @& ! @S) Ph  @PЍ @ @ЍAO-M+@+@ QJIu #@@#p@` P<UځE Z 0  @$P \xP #U $U'U =UO \U U:F"UYP\P3`  P @ @ 000C S: P @ @IP@P `}P` @ 0 @ S)P!@ " "P0QPC[P@0U@Q V 0PQ P0SP U  "`=P:P `Q"AЍp@-Pph@P"`@T PA>PUpO-Mб@P+@ P \p+@+@ 0 S| p`P(@<#@ Pp pPe QP/QiP@ pPJء+@!0RITG +@Q PPP:PU P Pڨ +@  (@ppEq p@<+@Pʁpܸ&# @ a@@PY&,t (p@Q A T& XЍ۽O-%  (@y%({T +@X +@P $PQ $Pc $P W6P ^!@% (@Y% (@Z$$mp@-Q% T\+P@k@PJcPX +@P gTpHB P(@@P P `p``PPP P VUp@O-M P@xb , ؃ +p@(`@(@(@(@P #6Q T ? $^ P P ^Q!+ @AoT 1Y^PsP6P.P ~ @x$P P Ѝ0H-T\@+P@PJPX +@P 0HD  @0H-@P7P0U##H-P @H-P @@-@៶P @  @K- (@T\` p+P@W(@~W`~oP& `" ( @0@Q0@X +@P r`@FPX +@P _ @H-P  (@(@ 0B @ hH- (@(@<5" @+0@+@( @0 @0@-TL@5+@@ +0@ PX +@P @p@-T\b +P@ (`@@ P  (@ (@< +@0PpX +@P p@pO-MT (@(@+@b p(`@Pk@@+@U+ Z(P9 @<+@+@p Q 0D@ P0pp SDp@ p   P&PP ЍX +@P ЍO @@-T (@+@0 (@@  C RX +@P @t0H-B (@@P} (@ <%+ @0H- r  w  @ x   rw x  rw  x  0   @!(D (@@   @f Ѝ. @ꍸ m @O-MRf P@@bRPP HPSP aPi#`@pT  pP @D+@[ ZP  @Y@P5 @YP @0B P 0@L PS *0@B!PH0 @ R 0:Q@MPP0 ƛP:H%Z< в.~ @"p@ @  @P!@@ P % ?!Q@ 0㓛@ 0P1!Z  ,!Z P5~pD [ @P@ Pp?P 0+@@P@ P%J @ 0Q K!@0 (D (@@ U @`Ѝ  @ꇷ @1 @  @R0 B0S// R/0R/@-M@0@ P 㝮 RR @ R!Ѝ @0A Q/Q/p@-@P PsP ` "@ @P L !@ P V@JP 0@ P*pcPpA-DUr P+P@(p@@ 1GAq `tH+@`@ob6P V sP oP66Le+`@PQN6QNFQP -PF R  P QP L+@@P QP @ R00 P0+@ 0R 0 S AzK-HDP@+@+@ RX du+p@0-S +SAP-P P; PP,P< -P`c@oQT poP T rP1 APP TQ TPp RTT (@TP K2 @>" @_ @ @x0H-R (P@6 N4(B+@@P0vPb! P @!@ @ 0H 0H-P``Qi@P pPrPPppPU+P@@ p`A-@P PTJ T @oP @@Te  @UR tD"@`(P@ p@ @@PE0 !@`Fv(D (@@Q A Y垉 rD `!@p@ @@Q E P `Fvhr `(p@Q !P `V @ @X P  1 PUR@ @r D,U`(p@ @@ @ P@ Q  R ~`V(D (@@Q A   (@ 1pW`V PAPPU pR0H- (@1@T P @ @dQ R APUP00H-@P0P P-P0H'A-@DU+P@P Q-Qh+@Pe+`@P< Q-Q8H7CPE+@@QtT\A+P@P `pQ pG`WQ PNX +@PI G@DXX> XJJXH@T+@h @0   0pP!U:P @A  0 0S QB 1 Q PX +@P yC @2 @ @ @@-h+@0SQD+@ @T9 -Q60Q2 -Q@T+ P 'P% R@ R! @ :R  @ R :R RD+@ 00P l%+ @ @@ @<P 01!@-TL+@@9D+@QPX +@P @-0A Q  @PP+@ @H-MPPP+@0 \ 0 0ЍY @O- M0PQ`V R 0S -QpW  `-V0-`S @T 0 B@p@@1?`Qpf R 0 :R  0 Rp:P R W| @!@ Q@:T | @ `DQ8 p| @ @7 @@1 (@ @ 8| @!?`@0@p& @ @! @ U @,P` ` P  Ѝ:T  | @ `:` (@ @PP0H-C 1(@@P P+0@PP P!P P@ S (P@]@P0  @H-+@HaO-M؃ (@#@ @ T P @ T+ @,P) P!@p`Q*P pP P @P៬ GA@T ЍO-M؃ @(@T P   8%A2X Pdp`P@Q* P pU [ PPFP*pP PT"TV@TZ   8A1 VTЍnH-> (@   p@-@`2P P`P m`0 (@pO-MS (P@[B `@#@ P +@ d  @   B/o"V`8p  @ pQ    .[Ѝp@-@MP (@@ P`ᝫ P ' @ |'#@ @1 "' @ "0 `ᇫTU J|(#@ @1' @0 JA-؃ (@pP R @(P@PT5@DP pd9P}P @`PP%PhP` @W ! @H-  (@0 @NO-Ms (p@ ; @ P$PP@2,P>>>>>>>T?>>>EEL??EEEE>>T@EE|@E@ Q    Qo E P BP<P7   ,P,P! P% }PuP `P p `PP`Pp pQ P,QF  @P (@P Z> P 4P 08A P%0`P     `tPRP P @㺫PcQa #@     Rc   PQ< Q0yP`p  &P#p QQ;p`0\  P @Q* P QA P8 /  0P Q,QF 3  (0@ 0  @P%"%`P Pi`Pi P$PPc@ @ T Z P  @ Ѝ @ߪP Pس P(@0`p   `t PP p (@ @R*s P(p@@   @zH-S (P@$@B PU@Q* HYP$(`,P R R R @0 @BT:R R  r R"0`8pN     F C   P `C @@-@P  "# @0/0S/00/H-P@-@  (@    @O- M Q  س R  p(@#P@@`p P'0 @ V `W   @   p R =R    QV$@0`@Q 0XQ]POR (P@40 pBW:R R$  r R2 000- PPP{@08 F0P0 Ѝl/㋞P8A4 @9# @ "# @0 0S/=S 00// 0AS:Q Q/q Q/H-R@`P(P 02,+0@+@0 P P-PP US (P@0`8p     F 5 @PO-MR (P@@`pP|  (@<(@+@pأ  (@\[ V P ` v\ VQ P P  xQ P K VP F PpQ?  KT\V P@ʫp` V T`p#P@ʜpG P P@ʑp `2`pP 0 #@ P  P@lp (@@GE@AЍO-M؃ 2 P (0@(@(@<p+@0Ԣ (@8$#@`Q0` #@ "#@ Q `"`P1`@rQ LTPR\Q(SSRpSRSf8TTPPPPV @PPd +@cPbP_?PPTP~&U0@ET*0Q0P@0QS0P@ # @ P Q<+@@@pT v 0  "11  1pz(Pw`P(V-@A"  @T@ `0 "ap!0 a!@W P p@\( R} Q}< +@@PpP8 5TPU @DP( 0P @PAP  @Qn @P@PP{P #@  (@`@{U@#P#P}P@Q PPp T PQ [<0T+@0 000P !P  Cp Ԣ (@)Pp! B!x @) 80R8+@p!R\P`P "P $P }PQ p<+@@Pr x4  0{p\ ER0p@h]0i0i0i0i^Wp[0i[[0i0i0i0i0i0i0i]0i0i0i[0i[[<\0i[@_ T 0P@T @@ZPU_ @D#@Y p<+@F<+@@O@ TA xԢ @(@P@'U#@P @$PTj < Ԣ +@p U "U ` #@ @ 0F Q:O }PLPS PQ4 pAA\#@ QAQ A AApH0<+@P ! 1P! 00 A<+@SP< +@U @Ԣ (@D@ 'U sUUqp`Pp P?@<Pl*?U \U\PiPm   p@P0@ QR A@Q7P@a@Q)WP@pW% m@ @T `  !"#`@1` ` 1 7UP6 P P`PJp@%SU Up@ƕu P Px\P 'Pbr P pP+@?@ # @ P@p@%P%@%& Q Q@ƕ p B  SU- U+pA$Ԣ (@4+@ `@4` #@` B#@@<%+ @P@O`P!P"0E Q<%+ @P@;`P P0@ P3  <`+@@PP<%+ @P@`p=Y Y}U <%P+ @P@p# #U%U #UPPU WpC&P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @Q@ zw @= t0 @4P *` @- d @' @# @ @ @O-Mأ (@P  娑+@P J  r m](p@+`@+P@80P@j@T:T D P@i8k8kdj8k8klk8kkk> PpSTt 1\T1 P! R0m T T  ;;T# |T9|P&1p # #@ЍOt!#&P&P ;P    Ѝp@-\PpC R a(@@(P@+`@ P 80R 8 \P p@ p@p@-C (@@8Qph `@Lh `@O-[ML +@`  @&p (@h֠ +@P(@P DT@ @, A AP  (@֠ (@P L +@P +@PM PN  !@FL PPس P+@(@@``@ r #@Pa (@ P R R) @V  dV0`! \X1hA (@ @֠h T+@L +@P[ߍ  t R/0S /+@\/0S  R 0/A-pW EP+@@`pQ@U U p 0 PZWH-p@PR T%zy`W VU V (@Q@v ?C0  @ ᭲  @ 0ᤲH-p@P` @P`O-Me@ P+`@  @   U ,0+@+@pWWpP P P @T Q @P 9+@Q  R [N P QG  T<+0@+@ PC Q +@Q @pQ  (@T (@@TJ -@TL +@@ 0 0p+@  QX +@P ϱW+@ PUr?+@P QDP Q  R;  p8U P PP4+@ @pDP @P" @p@ @T ( (@(@ Q, (@Ѝ )  @ᔱ  @+@ R/0S /0H-U +P@@ NpQ  Ep  ?p   9p  3p  (@ P0  @N0H-P @+@P PP0 2/P0@- (@ P@ T DPZT@ (@ Pg fFP Q!+@ K-MT\`+P@@ T@P D`` pWJ+@P  R r0  @ ܰ`V+@P  R 0S T Wu!0pr PGK0  @ (@VP pxpl `p   P!@pp cPeJ`W j f pp !N`PcJ (@V`T   V(@ P F Vo"0p#PX +@P , 5P P ЍX +@P ЍKğ C  @3* +@嵟 * @#꫟@맟@ +@塟 l  @H-M@ p `(@pV`ϙP P x P   @  T'p@-T\e+P@+`@@PpX +@P p@茯p+@P/p@-@+@PUpT `V PJ`Pp@-P (@@QQQU i 0Pp`\  @rp@-e@+`@ R0+@R.  :PZP P R ( P (@UPU &@p0H-@ PYP0@+@ $0@-@+@P  R  @O-Mp)0@`)@ @@` `:pX Y P@0@pvP sPV` &pVG7 @ "@ HP p+P -P  | #@ᨘL P"@XU: P  Q @ "@PQo oᠢWi aQVr  % % p@P0P`PaPt0+@W,+@WjZ  01)p- P[ ! 0 0P P QWOr 9pK   R -pF Y  0L`VV!,R+P@P J@@ 0:T(D (@@ M  @ЍQs  @  @)  @ꝝ嚝   @ꓝ 9  @g  @O-Mp`pJ W(t P(p@  !@  e!@ `@[L; `| 㠀 @ #@@"0@!@"@"@  PU[ P[  UPP |0 @S[U  @ p^!@ЍOjЍp@-@QD PAQp`R P@`Xk#`@D>Q <Q  R  !@?D@Q:P Pa  @ rڼ !@( R!@pP@-p@-@P+@P QU0p+@P Q  R  p `p O pU  Up  @   @@-@UP @."@PP0H-P @tPP U& +P@! @ 0g'[[ P@0A-@Q P@5 Te^vP!`@!p@  ?U U P@P@UO-M@P PP9v "@PP4PK!@PL h @ߗPP&eT|XP+`@+p@+@@P fTQCPP L@@T@+@@%U` @ᰗP @㪗PpPU`PEv "@㚗P IA[  @( (@aPPEYU~  @@U)Y e`Q_^@+`@ @"P@!@p WWp@WPT T  T@Ip@@W}oY㠢+@Pc@YIP P ԵukZ @+@ `@"P@@P*pY$ Z P  @P Rh  @ P,  (@  @ GP @PnT+@P P WeT+@PX +@P jT ^!@UjQo^@+P@ @"`@!@pP P T }P T@p@Wp@@WT ^!@u{j @ p@"`@PP V)@@T@Ѝ-PPU@H-M@+@PP <U+@`Q U PTT TT (@NP+@P `P`UP TV T (@6`P`vT+p@`P PVЍ ep Q (@NQ= T;'7 9V V V\ @p U`VSPD ?Q @:J"1p  c (@6QH+@Q `6QP`H-TLU+@@+P@`pPP o`p W:+@ QX +@P HNK-P+@HuoTLX`R+p@+@@+@PP`P:FPP !XK+@Q/+@ 0S00S/ <R:/0H-@ᷙP+@TQ T+@+@Q- P+X +@'Q%+@P +@Q PT +@" +@( @6 R TT +@PũwP0p@-f@+`@PP@Pp8Up+@+@PQ /PQ/O- M+@wV% 8`+@+p@+P@+ @+0@+@Q@P.QAT  ሴPxzV 8%`+P@+0@+ @P  P tV 8%+P@ `+0@+ @@ Ѝ?+@ R3/1!@R/0H-$X@+P@P0# @0H-,+@(+@A--JM(,X+@+P@ P +@+@Q +@Q  (+ @ R $@PL +@@U$@PL +@+@@Qe+`@@TP;T $@+@PL +@@q `Vf@ BP @ϊLF?Qϊ:f"1` ԩ"( (@0H-@Q PP@U P, (@P00HG, (@p@-@Q0(+ @ 0 P /Q(TlP+`@ AP T\+P@ QX +@P ;@p@- Q @RPH Bpp Ӳ, (@G-@'PឈPPP #@`P1 P/ P@`'"$ @zPP@m"``EP@_`\'PpUWB 'W P@IpV P@<P@2P@(Z`P #P pP@`V P@', (@PG=0H- @#@RP'P @ U0P0H- (@$ (@H A-RP`p@ P P P  T@:pGWPH0H-TLS +@@(P@ P 2 P0X +@P 0H0MH-M  0 ЍHЍ/@-M@②P g Ѝ)  @" MH-M ( (@  ЍH Ѝ/Mp@-MP@, `,0 PP@X۶!@Ѝp@Ѝ/@-M@@)+@+ @ @ 0B@I-+@@ @W!ЍH-MT Hx#@P@+p@` &P p<pPWH +@@  @ P@5ЍA-P``Q=QR`V XJ@' `+@A@pW P FqP @PppX@p@-X@+P@``F`  @ @Tc<` !@ @T @ p@K-BMpLL`+@@PP   p*PBߍ0H-P0SR00S @#@00SS @0P0PSS@DR DH-M@ P=`P" pU ˏp@pPQ A =U `"Ѝ  @إK-BML|h\+p@+P@`@UP `@BߍA-M p(@@ PPTPPI `[ TT|+p@ R < 2/`qQ  Q  OP!p+@V \+@V P"X +@P 7 y  #< 0 `.`)  Ѝ   @<H- M! 0  PP -P -P+@P0H+@Pc +@Pf (@6QiFQl(+@QpPs   @ Ѝp@-TlP+`@U @2PUPpX +@P p@跤p0H-P0@PPU0K-MTP+@@-PP5  P p    ` 0R`` =Q  =P-  -C (@@  (@Pن P&+@W  =QD@(+@+ @AA Y @ +@ )+ @0Q0X +@P Ѝ0H- @P P Q 1/P @0p@-@+@ R 0`PU0=U=UV =tPp PkP ` Q 1/P 0 R=R/="o/A-+@ 0S p00S0W 0R: I+@@`pPU Q Q 1/P`PpW:H-Y+P@`@T p   {@ @p@T`V:HH-pW @ @HvPJUT!@r  @HN.]1m P@ `@'W W 'ƃP @p <@8@p"@H/A-@`PQp8T  @W  @(D (@@=P Q A ʌ 00 =PX  !@Q A r 1/P PPO- M⬹+@Y`@+P@P0 `+@`p Z T    V WpX:48 0@ W` @ 0mpW ЍA-@Q,  (@T\+P@6S+@ *b(B;;@;;;;;;;;; ; ; ; ; ;@TPX +@P @0H0H-MP @  uP   nPЍ0H-Pd@P#`@PK T(tTTTTTTT<T`` %  pW pW Ӆ  DžPUPU PU p@-P. P`#@@Pipppppppp4hxx``````` @G 6 P  00S) ! / 00S pP/0H-P0@P PU0p@-MP `@P`PU``Ѝp0  0R  /P/P/Q /P/O-M-(MP( (@܉i@+@+`@!U%_{P EQ Y+@+P@p\  q%P%P  @㛔*P !@㑔.X @*P@@ !@}@X `Xp/aHP4444(`P j q$ t\  +@`Pe5AHPZ4444P $'Q"Q  ( A t+@w 5p$ $ ) +@P  L q tQ +@p tL  J+S +@+S t 9 +@ 0 XX O`V< ;\`V P P cl  +@q t  00S +S +@+S  0t  @j+`@ +@P ᫃0 +@S0 pQ Q 8dddddd4a#&QQ "Q 'Q\Q /) @ P  n vbtfreM  Q^Q@^-psp iYt+`@+P@r x@j+`@ +@P E +@+@pP < P+@P +@P \R Rn P+@P0]S 0S MS ^R/ -R P+@P^S% cSK " d)+ @PP)@0@pp 7TQP+@ @P)P+ @PP@:+0@p t  t  iYt+`@+P@ +@ p@ +@T@ x vs +@0p w  0+@ 0  +@wp   +@ "p +@#+@pP\P PG `@]P 0P" MP^P -P `^P cP(   `#@ ?P ``)@ 0pp 7S00CQ`j+@ +@T!@.i+`@Y+P@Y 8 ᶒP \P! u(D (@@Q A ʍ! 00 ;P P3pp(D (@@Q A p pp(D (@@8 " @ ؘ=op"`@ !LPppi)@+`@E +@ @ , (@(ЍЍ8 @㘘%XNP " @BT  @A-P`p\@DV/V90FPF*@0PwP@P0@Aq `0Q Pi\F PnF P%`````` @T8````P``HX@EV9 "VD 'V '@=EV@9@7 @5R @E @+@) @' @% @#)@@0pU``  A`GaGV/`6`3PV`3ABq P RE @ +@P@"@`EQ R` @ +@Pp@-Mi+`@@T' 夆 "P)@ @U8 @ +@B A՗ +@PЍpH-i@+`@(T (P@ p R R0B0 00p5 pRQ A $ @H-My+p@@T 'P"PЍHJP`3 y}P`+P-PmЍ)@ +@ A@ @a +@K-`LPAU: @P P+@JpE+@@ )k@@H-MP@ Kp(` KpUP +@+@ A@ @ +@+@ A@ @ +@Ѝ0H-@P  P +@+@RA@$  @" +@+@A@b @ꒅ"P0 +@+@A@Q"0 @ і @͖ +@0A-Mp]@P@ #@ 0 P`P  #@ 0P`P7 pW3 P<U uUJ @P @P P P  PQ"pP ^U-P P?PPPHP,Ѝ( @ X @ @ M @Gɀp@-M@  0 @G#@Q R ` P@ : QP  @Ѝp@+O- M@:uP `p#@#@PPz =uPw  @ w.kXcX- iX: @sPW  "@mP./ !@ _.$ElX oX" @[PB  "@UP/ !@ G.(- @GP$ @>P( Q* PX 3P QQ/ !@ . P P Ѝ H-P@ @d% @^p@-M`P 0@-Qo@@@@( #@\ P ( R  4Q 1/ЍpU @( @<H-M$ 8d0 |ЍH-(Q @ $D0@H)K,58<@ 82D8<  < D,H-@ ,$"D0@ HK 5 8<@D @-@408 PMKD0,8C D/H-M$ 8d0 $Ѝ@-M@(`HP    H,ЍH-@ @ p㽶PJ8, Pᱶ`̶vsgh8h<h@hHPDhEpGwh\h`,@-@4宔8,( 8R <  <  8< ,/@-@4唔8,@-@(P @$D @H0K%8<0@D8@  @,@-@4l0&F"@SH-8 !@HKH-M H㹷pЍj @H-nB㬷ps @H-oB㠷p} @0H-'@@0(# @P#@!P(80#@# @Pp)D0#@# @P)<0#@# @P ,00A-P`Q @b~P  @Qp@-Tp`Q PQ~P QP-T`O-MP@pM`7VQ @  @ @ `Y: ` @ `T v @ `U  @ `V T D P+@P L H+@ @Y U @"Y @Y U @Y @@Y@3Y  @ !U @  @` &U @@ &U @ `& @ & @u @` &U @ & @`& @ &  @ ! @PP " @ !) @uY 1U @l@` &8U @bu&? @YY F @P  !LU @FY S @=Y Z @4 c @,Yk @#` &sU @ &zU @! @PP  Y @P @Y @ !U @`YVU @oUQ @ @PP Y @  @8U#@U @ ! @Y U @u`& @  &U @` &U @z &U @q! @gY*P z E #@@ @pW Vp` P@sd 0I F pWP X 7P O U`#P@`0S* vp @ p@Y P    <0   ` V ` 0SV p  Ѝp@-DZ@+P@`V HzIP: !@D T!@@  H  +@ !@7 Q"@2 p@-QPB @@$0PLJ& +@@! @ L +@M0S^S@^0LJ+@@O-tM`@ !@)@)@p[0 q! @ωPyU#'& @6a@Pp`ppp,4\p 0@ppʣp[pP a8@ p`upi#@B D p- @jdhD p8 @_$ D pC @UGP:W W Pk(  0p'4P0Q Np`p)@ @P%P =PpP   zP<!ZP0ppQ0P  &pF"@4P gH ឳpT @T0@!@ 04U @H-~ )@_ @ H-ʱO-M`@ !@~Tv+@4T X+@ p@(P@o@o  0QP ePfP hP vP; KP P HPRP dP )LP PP%0@p)@V QQ Q`Q` `X`[ Q``A+@pP\+@WX +@P  3ᶲp0 @ > :npP  .SoP \p+@ -ppP #P \+@-p"@\+@@ X +@P\4+@8 KP#@@MP}Pe ꛚ`!@ p@@ P2 $ $  $ $  $ $  $   U PPM`Pb p)$  gl p@\ Z+@ qXP Xr 0S   7/P P T!@{ P ^#@ @|H-MX T+@+@M7 WP)@!@ 0@0 @ E /@-@P#P UP W!@`+@p@-M@`&}P #PP`}P PЍp @ 0.T!@ 1O-MM@P`+@hp+@X`l:+`@ +0@p*+ @\x*+@+ @tp+@f @bP$/ @bP ` ^#@ p @xP QM @  :ng〪 `@+@0@ MA@6Q l,$4@xH@TT| +@e ppg Wi +@Xjgf ppN|"Px h +@S +@@POp +@+@E +@ gp >A +@&8 +@2pk!@wP)  @wP=" pp |"P: l +@ +@p +@  {"P t +@ps [= [; pt +@P: @   @  @   @  @P @x$+@Q0Q=0QX + @pjz+`@ 0+p@`00Vl:+0@0S` h:+ @+0@ 0S\ 0+ @ PAT o0(@ T (@+@ +@P Hoj< @+@)@pQp[PE pU|ڐ+@QWWta*;+ @Wp T*!@+ @x +@P  P  P+@G@PJ 04U; (!@`O3@:* @0@P0" @ Fp  P @$3PT!@@U| @P+@+P@ P +@P+@LU!@P> T!@U m H\pN @PP@ P& @ U +@QQ +@@ U+@ @P^+P@f/imPT @  +@@P @@%^*+P@+ @ +@ 3p@)@ 劭]Pp _z#PSG]PJPUt PJP poRUb !@ZPX P+@f\y.`F3V ZPo  @uXtlP@ {3 P@ l3p P NP% P)!@^)@X@*+P@+ @i +@ +@@Pd@T!@z P뛭K뗭묭 @_BP @@@ 0"@ ᱄4S @W@B #"@ @PtPpẽ0H-@ #@P @cuP  PQ @ h:U+0@ UPPPt:+0@ p: +0@ l*+ @oH + @00HA-H`@+`@L+@xzo+p@ PP k!7! @TP 0@T T  @7@K-MsVp P@6y@ㄟz)@`#@ @  0@`^p!P@W%@-M@" @YP d  @H#@ 11@"p30@" g@@D"tj@Ѝ0H-@@ P "P<$0HS0H-@ +@PpZ+P@P @P@ P +@0H"e.D+ @\p0ț @P@wP +@P +@P@+@PeT.QD+ @4P . + @-P0 @O- MP)@X@i0 @  R$/#@ @! @(  @,  @0  @}8  @x4  @s40 Pda `@d!f @ @!`@c4S  @ [f !`@4S  @ Qf !`@4S  @ Gf !`@4S  @ =f !`@P0S  @ 3f !`@T0S  @ )PG drb @ p@ `@ P8  0ia0p 0 0S$ !SH #@"@1 @ P"B @ ' @0"@ Z: @ ЍOjO-M@(P- ,P- 0P- 4P @P @8P,08<Q4<P (nsQ  @}_ @n @ @r Ѝ @jP (PsQ   @_  @Zt 8+@ R*F  @O8` a BR RpA @Q ``@p  @06v0hS pRa`P R v @$<Q v @< Q v @P PU*v` R 0 0R *0 Q*G b @p pR:ppW:rO-,MM(P +@  P $p#@\H #@  @caP{ @@XM :gP(R ({( @ `i#@V (rP   @rP> ! @{rPo C  @m PP t+@P+@V#@ `($o@#`@P ˺Pm `@ V:0  MP   @]pV. N @@P( g`( ᦺP  @㠺P  @㚺P   @ 8(p [+@XV @P T0  P +  @p+@\ @P(+@@(dV`(d.!@qPx L @qPv o @qP}  @qP  @qP  @qP  @qP  @qP  @qP  @qP  @qP  @qP  @qP  @qP  @qP a`@VP  @  0P:($ @ +@R  @}t +@+@+@+@  tP0 HPKPH QD+@(0 4P7+@,0 &P)+@80 P+@00 P +@<0 P |(4 @  +@40 P+@0 P+@{0 P+@m0 P+@_0 P+@PQ0 P+@TCt +@V*V:Z  @ 0: @  (+@"(T+@Q 4  ((dT+@V) { @~(VP H@#@`V n P P OP @[: P w()@"#@n`(dP' { @~(P0 $P   @4p@"T :  @ + @(@@@(t P1+1++p0+1++0 (( AtP P (s@T (+ @Q P  (f(T + @Q 0oz (W@T (+ @Q~ Pm  (J(T + @Qr o@ (<( T+@QpTp+@ o,Ѝۍ~  @㳿pp@-MnPW+`@VH@H>+@Q.j+`@P!f.H+ @7pʲsP sP&P m H#pX (@PH@P f.H+ @pʁ  @'@Ѝpp  @N @㉷H-T4 (0@0S H5ts@-@+@Q f/+@2f@ o@-@]sPP P , @P P  @ T!@@X  @T @@X m(@P H+ @O-MDP$+P@; * +@D+@R P @;`KS놔)@X @-pkE I ! D+@fQf/eP@㺶 +@!@Q  GP} JP @+@Q W%1V"HQ WVHPtp+@Q: P +@PY \ @ 0ᑾQ&1E'EQK0EEPF " @ 0}= +@P  @ 0o@+@P7 n  @  +@P @*+ @ +@ @? f/3e@+@ɯNP  @hߍO-M`p@ P+@P4 @ , P5U P:? QQQ Q Q8/PP@Z Y  Q +@P  @߽@ߍ +@P J @ +@P k @ǽH-P+@$H-M @WP  Zp q"Q @ l +@ЍH-M @WP  >p q"Q @ h +@ЍH-`@PkzP+p@ RR$ PR0* R v DD+@+@ fQ+@M @  H-p*+ @0,S P0H-MDP+P@ R@D4+@070PЍ0p @ s 0 @ c  @^ H-MPRP@ p`᳻p*q""Q  "QOQ QQ/) @ @Ѝ0H-PP@P0{ @BTP { @){P@PG-M@PPQ~ @  0/P  @ᵼT+@Ѝ /Pn 0+`@p/8pP 0,`pP   p@-M@PPQ~ @~T`  0`^P  @nT+@Ѝp ` Q 0P #:r/ Q 0P #:r/O-M-8MMPT @b{g8(p슟8)@ @X$ P p K#@ `"@@j kPD @T)PF(@aTC:aP?(a @ RB`@š⠀ i( @`#`@ @!P! p P) ?P` #`@ @" q`#@ AP `"V   @K0S  3/r @>`@- @ A B*@     @ p P( 9P8haV :aP8< |xP*  0qL-Q @<Q:;- @ - @ A B*@    f @ [pP P 0< A | r -Q @ 0<`00V- @ 5 ( JP  +@0zd+@PP @b R q R @T: +@0 Yg$ @8ЍۍЍM0H-M@P 0() @P Q Q  h`Q  Ѝ0HЍ/0H-H#@P"@ @@ P PQ` @0HFp@-fMMr0+@Dup <4< S  @2 @  @P yP<<fߍۍpp@-Md@L +@@0!!@ @Q3  @ P nP yP" @yۍp0H-@)@XP*+ @  +@ 0HO- MM1 @y*)@+ @X  \pZYk `#p@ P@ @P!Op P ?P @ᲲP @TP :  @J  @@@ @ 0(pX P  H  RY$y `@ P@#@ p@(p@ P  P Y$z `@ P@#@ p@( p$ P  P h(Z$Az `@ P@#@ p@, p P  P L,aZ$z `@ P@#@ p@0 p P  P 00Z$z `@ P@#@ p@8 p P  P 8Z$z `@ P@#@ p@4 p P  mP 4[$Az `@ P@#@ p@< hp P  QP </[$S{ `@ P@#@ p@$Lp| P  5P s[${ `@ P@#@ p@$0p` P  P [${ `@ P@#@ p@$pD P  P [$| `@ P@#@ p@P p( P  P lP4L$Ql Pp @@#@ `@T P : P QT Ѝۍp@-M@z @  0P  ۍp*+ @)@ X p@-Mh@+@@I% @! @Q  @ PC@`P NNNNC @wۍp0H-M@ @ PP yPP z @ 9l.z @ @Qwۍ0O- M@P P@X `@p`fPp@X P`P 10@ 5[H0P`H@gTQ:hP)`@ `pP @P` XXX Xp Aᑉ Z*fP@`pP @P` XX @T Ap`P@`XX  Zo Ѝo @;AH-M@p $PP4 ߬`PP_ bQJQ KA P[ QRDRRRRRR|RPRkA P QRDRRRRRR|RPRF `Q CQ GQ 6`P/gQ cQ/A 1 `. `a* `a a @  Q Ph+@`P8@0 eăp 4# PU00p T&Ѝ  @  @@H-P @@ RH#@ @! @z0 @ t0 @ n#@ 0f\X   @ 0]\X  @ 0T\X  @ 0K\ ᯷(  @E,  @@0  @;8  @64  @1< / @,$B @'$K @"$[ @$j @P | @T  @  @ 0\l!R@p\`ZQp#P@ pW!@ 0[H2]O-MpW `S 8@T,PU@a @ 0@ !R#@ @! @ @ QVWVWWVWVWWW< @SP PD 6 !0@  @F  @ =et`e@Qf/T @@ 0@x8Pp,@eu`eP;f@/ 0@ @P`@a @ T0N& @! @ ) @ X8Q reV @ N<P@PPW+ ᠶL8@ D eQ TTG*TTD  8@9ec @ @ < P @PP+8eQ @PP*A  @ 0ZЍ++** h dH-@(`i @Pz9 @ 0ZP p 0pW:H\@-W%@V"H0P f/{\ p@- (2/0Ͽ ? 0 b B b B P2/<Ͽ>3?( 8 2/8 < 2/< $/$$/$D 2/D $/$$/$$/$$/$P 2/P T 2/T X 02/\4\X ,013?1  Brpp 13?1  Brt +@0`2/3?HVXO>_ XH0p0` 0P@5_4OP@@4O@JJJOJ ^:p@-@ +@P xf/[ W5V2HR2/Rt*q+ @ R3G-MP-l0P +0@  L!㢘Hp#@@ P)@@ pa 1`9`P@`XXX _pGwЍA-h )@@L0 @ @ 0Y 4U @`#@!P@H0p`F vK-M`@ @ad4r#p@P Q Xdplp`+@  +`@  ;pTp+P@  `2/ЍK֛ @  T!@K-MPM@P LRPG* FR PG*^h  e`P@pPh "Rq:*w=Eh  P57h"P p4  p+@`yLp, O @jЍMw @ ; @ 5  @  @, @'  @!5 @l0+@ !@O- MMP@"@cP_  @cP q"@cPpD+@@叜p    P  ` @w L〜p Y Ġ (JP [(pD+@@Q 㾡P XZ 0p`P @Pp 0VH3l@ `}r+@@ @ p@pw+@ L2p Y   P `, 0(Y Rfpx+@Bp^l+@ rp 0l+@ @p{pDx+@@B p]  @nX? )@XP Kp9 @_P*;$U^ p h @0J,8 P!@ @q>YS @0 0V`pX Ѝڍ  l+@ i @ @ @9 @)@" @ @ @@-MP@  PP*p{+@H _pЍl0+@ !@z @ p@-Mpt+@ DBpB lP+P@   @  @ @F &d!@@  `@ @   +  @ S  @ w  @@ @ Ѝpl+@ @ bA-MPp@+@zD p  P`0 @g `C @_ЍBl+@ @ 7H-MP)pD+@@ D㿚p"   D㶚lpp+p@' @@0P ` _ 0C9 @ 'Ѝ l+@ @ p@-MP$`@L !@aPP 0 @aPop+@ wHupЍpl0+@ !@O-$M@duP0@)@ p@` 6qP p ePjPdp|+@L @ @@;p Pа Q P*PJ @p  #plg+@ @ Q) 100@ Tl  +@>!@ 0@R0 @P U` P@0p   |`@V: l+@ @n $ЍOlv+@ @ ;@-MPp@+@ Dșlp+@   @HЍ+0!@"p@-MPLPPI `@ @`P !@`P   @`P  @`P/@` h ``@@`Ut @z`P`pu+@ HppЍpl0+@ !@O-M-PMp p+@P$}Pˊ@`(D( @ ϊ @Jp' ˊUϊ@ @ U'l( +@#@ P XN /lp+@` 0>( @PЍЍl+@ @ , @ }@-M@P P !@`Pp+@v HpЍl0+@ !@Z[0H-*JTR0O-\MPPHf @@ `@0@p ᮽcPQ@Q:aPl@Q qvxqvqvqvqdP <p6)@lW E R*W( rGdWo  @p acWoW(PdWt lW 0 Q@PQWQ RWQ SW H@ M~ Hfp @pW] rW P$ 0 C @ @  DrMY   lMP@@ P `PpU@Pt@UD`@| (H *p @XH@ AM~H p @} @ 0M{H p @lpP@N'P @ @ᩆ  @ᑆ! @ h}$0 L%PCU}@ @oP@QyM @YPw Tמ@ @LT!@HWFT `C]y `)@"P@rF   i  dTP( @p \Tᰬ P tiFP Q@P Xp  @ Yի\Ѝ"& @ @ @ 2' @' @` @ @ H-Mnb  @ 0)@}gO-$MHP A@PXE  ILL p@ `P: p  p3 P5;X"@pP h"`@Y ZU @~-mT  0X}Y$Ѝ @C @>0H-PI @PsiFPtiFP rmFP# gtGP9ሌyrFP loFP.C& x" @ @P0Hlᰝ@T!@'0H5p K!@00HᲦPT @lP0ᔫ @O-cMPx@+@㐔|+@+@+@\d +@+@+@ @+@0@+@p4(`@0,( (RP"a@Qu{}}hh}|~h~hh,hhhhh4}\}h}~H}hh~+@0@Q-A@Qo|hhh||hh|+@$~80 @+ @0 PK8PF+@+@Q>Q+@|}}}+@ <⤫<QXp U+@+@SP+@zd h (@(@+@p`|+@/QPx pu+@_`/QPX @}PSH  PO` (@+@Hx+@$+@48V @+ @+0@{ P8P+@ P-ڨ+@(+@$"+@q l (@ R U33UE33CB @ @ P:`+@P ݜ/WQP +@ pP  p 0W> /?QP< `9` w(@: +p@"@0BkP 㔓PJ pZ 4`Vt+p@ V *yPJU P ᎓㐔+@+@\d (`@`P  pW ,V /PPP y pE (a @*c0IP#`@ @@0 EPEucߍ @+@T!@Jpp)@+@QE+@Q+@Q_+@Q+@QV|+@QN P9 @  @ @+@T!@+@I @ +@` @+@w @z |$+@+ @ R $+ @ R Q  @ \$ ( @  /o"Q  @WEQpt Q(p@!+@P-b? 㮣p P @b? ៣p@+@P @PH  P+@4+@+0@ +@d+`@T+P@0t `(@P@o2R  _p @cY +P@4 Vp _P+ !@+@fP+@QPḓp5 @eT'QD + @㯓p?r @'+ @ᤓp4 @" @+@%H!L1  ? @pP⨪  +@ Q< # @Q[@Aw+p@? <, (004'0g+ @+`@,p(P00?P4< y+p@y+p@0lt (p@Py+p@w+p@07+0@+@[7@+0@ R7?+0@B+@@R+@+@+@0 Pd (@T!Bᝑd p(@ +@T!@b娑l (@P U ؔP+@ @ g$+ @uP% +@P TD+@+P@+@@n/Po$U + @PO @O @O @O @&+ @n08'+@+ @Pfx+@P$7+ @ +0@+@ '+ @+@+@+@ P+@ P[+@@<7+0@?7+0@0@ 30@P&#+@ +@@P* ]b/a? P5Jt A 4 !$ t_/^? P Jxp!B$ 4p|1p"8P`RPP  06A@ &"[*! Y Q  t 4$!Xp] @+@P @:+@P@+@+@$+ @4!+0@+@R 0+@P( +@ '+@$ P+ @U33UE33C@ !//@!!!@!Q*+@d!+`@ 0SV*0qW WWG!+@@1@`!p0 `0,Pf0 T (pQ$ QQ! PP!R!RQ !С0 Z P  W p: @㗨 +@+@QP\ P( 㜇+@㘧堷+@+@P+@x+@P |+@P\ (@ +@ 0 ,00(008. @+@P\ (@+@P+@Qm +@P&+@P TD+@+P@+@@n/'Oo$U + @\ (@ +@R @i+@P+@P5 +@P +@P  @ 8+@P"  @@ @g+@Po 8+@+@   @ gi  @P +@8+@\ (@PU +@P @U  @8@xY+@h\ (@{tj؀+P@)`@ p@ @P \D (@@&q5 ^B @ @d ᫧P8 V@eEQeQQ  .@eP[3 [J   >\ (@ r  @ @P eit@?P `@ p@  @0@ @@@  0 @@ @@@ 0 @P@@ eP $P+ @QKJPU@+@P @ @P , @{XTidp P@ `@? p pppu @P 4+0@P! !T+@+@QQ1QFP `X (  +@0 P@ QP+@" `)0  VPor @  @0%,0PT @wG+@@P  P$ @ D+@@DЍTT!@O- M℔p+@ P+@Q3P  @+@Q4C @ ЍOaPM @aЄh P+@!`@P 0PUP%+@ Q  @P4  @+@ 0U  * 0 ЍOP@ s @IaW+P@P8唤л)`+@ @p W   0*P Q  @r@W  0   0*@plWP" RJQQ^ @`  @CP Ѝ  @ ЍO7@-Mp (@+@P* @* 0+@+@@ +@+@0 @0+@+@@ +@+@0 @0 +@ @Ѝ@ @ @`0' + @+@)+ @0 l +@(@@ @ pP @`+@+@@+@0 +@@ Pp @+@+@  @Ѝ@ M0H-MX @H)@@P@P)@P P p P@ Y@oЍ0H Ѝ/ @eG-M@+@Q4 Q1 pP`% 0+@P%& \ G p \7T A @ @% @ @ߠ܍M-Mt dt d(@(p@+`@0 P0Q8 $+ @p- +@PT+@+P@@LTڤ$p @W+P@P% @ؠ$p 0@T @ʾ m HtpT @ @㻾0 P0Q Ѝm H\pT @㨾p@-M@PT ξ`PP PT"PP:P`ЍpA-M@+@pQY  {] $!@+ @!P@PbP+@1P@DSQ S  @ 1b  @  s  @1  @  1  @1  @ z ?0  @s 1  @j1  @ d ?0  @ЍA[ 0ЍC  @ ЍAJO-M p0+@PQ @ߍO^ p pơP` P` P``$ @@#@P $0  P #@`   @ &   @! @Y, l (@[ ?M.  @ +@P  +@ RX 9- P1)t +p@Q Q=  @F  @ P F P!?0 0R !@@ @ !?0 0  @ P B P PPDPP=Pʨ+@ P7 +@P2 & @! @$  vPp% @`庖 $p `P!@  @ 0l  0`@pW +@PQP ߍQ & @! @ K $p  p $@\P @Q +@/+@#> @ 0@& Q! @0 @ 'R0 @ 0ot+p@#> @ 0@& Q! @0 @ P @ pPX$@U: R W*P& @! @ #>P& P @ 0@0 @! @ r @+@P1@P Q !P) p#@ 0<<& > @! @ 0@ pЎJ)P& @! @ f)P& @! @ t+p@. @G-霧㠗+@+@P@0 fL`  @VeeMT`X  BQ  BP  @G|TP R/K-MhT (P@ p- lD (@@`V-ږr0f!!  ?ZIp  RЍK?PȔ+@9PUF,\DЍ @ @ H-O+@@B^*  Qapa`?A aQpQP?QA@@DP@ ppW L aQ3O-LM4℀ v p @ @@0xY ($ o{+P@ @@0, D@P 8<4x |0  @=+@+@0 K0p8@< 0Kl (@  ? uKPx| 0mK } {PxY0 @+P@p @0儀@4(d) @#P  i[pHp$P P Q )@-PhH -HpD#@Z4P@PX  @ 4D@P P U+K #@ 4P  @ 4Pa xY{@+P@ @8l (@ "+@P 0J{ @e$+ @  @儀 p P$0000`PTPQ(@ 00T0 P@xY+P@D Z PxD0[| Tx | @J, @ @D+@{P8< <0<LЍ @O- M@QbQf Qa w+@+p@R KP[ @W0P4` P0R`0L8+@PQD PUA OㅄPEZ, 0>C$R' P `0p a1P0Fw [+p@R+@Q8Q t `MHQQQ  @ Ѝp @O-M,(0`Q4 0 +@ 0Pq p@q p@q+@@pWpW@PpPWPPpp[p+@Q\ W+P@Pr {Д+@@!R RR>Q QQ[!+@p@$  PQa=t倄A+@`Q V ! Q  0  R Qq\  @ |GFR 6QpQbG+@@` +@P\ PʋP$  B @ J\Z W+P@P 崋P$ @ Eppt0\ " #\p Pf0AQ  B p RprQD  +@0 @p Ajr p@CQ @P\= 4P9 U*   `+p+@Q% QP +@P @vRrP p@pq p@Q$ @4@q p@pЍ. @@-GP+@@ ! 2A b A 4$3@O-M⨗@+@`, P} Rؠ*@PU 0 p 40p0T0PRPP B $3dMUU  E 4p g+@ B`   D!!p+@+@ @|I` xIkV Pd jI`ᐺk eIJa  ?(1`)?'+ @Ѝo @RO-Md (@ pA l (@pB1!?! gPo 0WEp  R,ЍO!+@5P 0;E !  G+@P,@ PЍ@ @O-kMM.>x^N`-+@+ @+0@  p@0@+P@+@@  XcPd @RE0t4PP1 TPyP :P p \>P +@@T% 8IP& @^+@   & +@! @2  G +@  = p^+P@N+@@@; N"0@PQ nR R oR+@vF P!@@   @ "@jPp.+ @)@ V ^A+P@`  @P @/?>P@ @/8" @ 0@ P AP)  Pt pc @@HP  @HP  @HPf  0 P`:FY P@T. ;pT z D@\P e.DUpI NFPa@PC"PA*P#@ATA@@! +@2  @0@`kߍۍK @T !@ @ z@u @p @ @.p @ @.^>#@!* @UH-`@Pp p H-L )@Z9 @#0@A-`PV MFpJF@7$` @0^``p@-@P: Pc @GP  @GP  @GP' +@`V PGP `V+@P +@P +@`V PwGP `V@pO-MM+@0V @!P@Q `YGP `V@@c @MGP "@+@QqT k  N0%" @d @P= @ "@ ⯕P4 @[ @p@`"P@ F[`P -P = q<P p     @ q႕pP @ @ +@ a  0!!@ @V  3  @VT JpQO"@@P KW 0p @P9 P L JV @ C  @P = ;Ѝڍ np P PQP0 @ڴ/QP Տ !@ ᙖ @ P pFP= G6 :JCㄩ#@pP"0@"@@d"@ @   LJP [  ᘴ ᔴ0SJPPC"@ㆴ  @〴 I  @ P.+.+ @+@/+@/+@/ M@-M )@@   ᥖ*G-p@6J+@aVQ +@!@p^+P@P Q+@z  @b ᝥt!@UVP VP+@@I  @B MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    O-uMM+@N "@K~pB@ #|p ppJ<~P/JPJn+@@  P-  P -oL MpP T !@p pP*  ~PZ  @-  @*8%<5" #+@P P}p   P    @  @  @  @a uߍۍH-M P ,+0+@ @;+  @+@+@ЍH-+@Q 1/ }0H- I/@#@0 P |+@PHH@0@-H@=HHH@O-CMM@ (0+@00p $40)@+@㰀0 ,P  t`P 4/P 8P P0P j  @ 4PY   0(` 6/PT $P , P ,W WPYPYw C/ ; p z8DP 3}`{v ᐰ B)@H * @  +@`V P  DPP `` 0S0+@+P@  00 0`` PU  CP PP  PPG| @ @3   @;4PJ pW20P+@`V *LQ_ @@"P@; pW 5p `V+@P+@U@PUPUP ,`(P $Q V`@PUT8!@ձCߍۍ A _ @ @㔓,,` Cp  厛4 @C+@pW P p u p U `U4Q   0 @P UUPP PP 0   @r PZ +@P` ` 崃岃ᰃ3 +0@PQ @  T% +@#T+ @A'  `PP$ʐ+@@T@ Q Q(OP $Qc V (E@P $QX `X`@` fpi` Y, C+@@P%  )`P!@" @<  @ 0@PU ^qL!@!p@ @@0P  PU H-M `@p0 p4/SP+P@ Q  0p4/P QPЍO-MO|P` p@0@#+@+ @ BmPn0@ So@#+@+@+ @,#+@+ @PPfP pQ[ +@P +@P X  @H)@@`V< EP @E뤣+@P @EV$AP [  0p`pyq  @IpWH@PXPЍH- F )@ @! MH-BM@+@ !$1P +@Q^T\  @QWp> 1C+@+@@ 0L& P @! @   @4o:LhP @@)`@(X'8P@p.p W  AQ  P  mWNW YWyWnW Y@BߍHЍ/G-M⤣P+@+@c+`@ Q   @o x@p P  x@P J @ P  P txxPP\ [  @ @RAWP\0/`h\p P: P  0`] 0p 唁`R PU:P  @(P`PwP @P`Pi `bP6 @P U`UD!  @P  @0` D  @IFx AxPЍP3`xp0|P"%   @'up0  @V ( PQ @P `   @ ` `h  @ 0B`Q x  @O- M` DYyP pW P~ @p|p~PPB @p wpW!URQ  @ @À]lCH@TN PJP L A@@ $!1X(,`~PB @uW~PB @lpDQD% ၀}XY `@ P@9? !`z # @ @Ep Ѝ @e($X* +HU,0s80004p6; 00 J  wPBR"rBa!DAAFPPP N @"@pPY R"0a!D 0U:JA130p; 00 A  vpP80P<@5 @  @2 @ X $P, ,  RTT @|; @@>DPFQW* * *JL>q @10p04: 40   vPA A O P& 4 @ ܯ ` @0 R } `eV @  "L P\* @ 0Ph0dl Q* /L PUPBPP=PUP8pP4[| @H-MpP`}@PB @0 p007: 00 " vP0<0@p10q: 00  uP  2 @ Ѝq @O-$M` 0lp@P PR:yP A P PP: LP p0p@@ @@ @ ~0X @0o @6 @  @QPLCLpqD Q@>P PLp% P @P Lq @QP@LpPPPP@P PPPP @PLpPQP?:P P p 0    o@ 0  e@P 0  Y@P R * 0  K@PPPU:4~ -~$ЍG-M@XpPUxP  d 09!  XtX Q d @ } @ Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:L&0 0@ t` @ 01w @  @GP P  @/ p& 3 @3/1#@ @/O-MPpP:CD `p @@ P 2R B p:C q : p4 q5*& r! @ @ 1 @q "@nC p:S6 s&0 0@4:1 0@#@0.R9 rE*& @G; @R  @P' @+rs#*C & @@R @ r!#@ @  1SA s:*&@ @@<3 0@ @*  @P H# @& @ P P<=! @#@   @ P  P' @P )A @@#@@ @0  @P CD @@ 0 @ xCDP P @@ Pp`VE:Ѝ@-R:P P *2@T@PO-MPP:`"Q2 sS p @PQ`:Q*r@pTSPP`VP:Qp P@ RMZ:Z*0 b `V Q Z :AZ0:   z/Jb q:Z z*& @Z :Z *@ 0W   @P  @ # @! @#@ >  0EPpW:<? @ 0-  04`~P @ P UPZ *  V pZpGV:PQ *"0S 0@@Q@@PQ P@ЍK-@~p @P Y:P 0S *r` VP 2S  @`hP Y:P` Q*`Q `O- M`PX@ uP >Ul L q " Q&#  @ H0Lp/uPWPwPP  2 {PQG:/L0S s2Slpplp00rP'tppppp%r020'2Slpplp02#402Slpplp02St0pPPQ *RUlpplpp202#20P0Q: P @X !P 06!  Pq P  @ @ Y:@{{@ ЍO-MPpP@P<:`@Q  Q P`V:(   @ 0@P @bP PQ *"0S0Q@[0P. <`ql Q+@q PQ*lPP # @[+" @9 @"@.P PP:"R PV6@Ѝ @}"@`Pl`<@A-P W@Bt`+@V` t@+@T@ +@P   @Yz @T+KtP) +@K=D8Q:PQ*" P:R$ R 0S, r:yK @ @ +@ zz @y @" @ @8P #2+ @ pp p p@-#+ @@T +@0@00T@+@@Q #+ @0S @0S0SS+P@+@@@yc+`@y@@pG-`+@0CSp+@@+P@P 0   p O-gM@ `H0 1P SH:PSE*pP$ hP<,@p8D L`D lp\@HP 0C`!D@ aP 0U4S! +P@0p4` :p P Y XoHpX0lp`dP( Q Q ( pP` VYlpP d@ p3 @Z @PP+ (+@ (JG@l@ D0L@ P TP p 0 P* PdPpX @yPlpXPd0(((d PP@@] 8Q,P: P0<S`h \ R h `.KT`@p;  P P P QP@ P @Q|Q|p=@H Q. 0  p R0 PPOJ QMP PI @@+@ p<;P08 S o8 <`h`h\<hPpTC HPW<      0DL@ m hTPPXlp\0hP%  Zq0@ pq8\0TQXlp P <R`h` P h XhPlp\0Hh\0TXlpL Lq(   hP $+@, @x%P\0PTlpX8PXpt, p@Pyhp0<W   `  DL@ @tW <P\ TlpQHh +@R P  P P} !@ pPP? p<' @\@PhhTa  D+@ TdP, Q* +@0`@ APPpW\ pE@P?pT pEP0U: T @:U*P+@ 0 APpW@Ty pE P?pR pEP0U:R @j:Uh* 0SpWa 0pP?0W0X Q:Th,\0aLPP*@  Q 4 @RU pd@ u:@W  @pp!; @\@P @pPy (PPPLLpQpQdpo @lpPw Pt EQ*h  @h <R`` d\0TP  @ p@PY` `0HPhPhPXlppT+@lpPHZPH p@8 @ @PW Ld@L r!@d@PAdTlp)pdpPTlpAT!:LPT*@  PhP0TP PdpPTpd@p,T TX L PTT*@dT7*!> 0 @$ @lpPTP: $ A$$@0P  @ @P3 dP\0PQ/\0 d.DLd Q:f  @ @}lpPTP LPAdQ*`0P@p B PR:dP\0 Tlp.Q  !@@P4 d@+@@Tf h h P @Y @ @:P PTlp \0LLp"H\0PPhc TRlpb Q $B  @p @Po  LLp"]ppd @O]Ko@P  K/+#@+ @P oP #P+ @T@lpS @*\@Pdp7@d@@QdpTPzQ   @ @P LPQQLTplp\0Q'TPP`0@p"L`0TXlpPPddL\0dhhhPPHX0lpdL`DP<  @`@#P D@4P0`lp `0p/! l P+@R ykPb@L`lp\0P@ 2S:PS&: 0 Xp僒!\D@- @F`@hPP Hp-W<` ` `0D`P@ 00D` LDHP  4@0P 0Q/!  B+@ kP  @Mgߍp  @  @a'7 @ @ 0@6O-OM@ @ `P +@PG S+P@pWd[nP^ ȓ`Ѓ+@+@PW d pW*QQWM: s+p@P4:PP1*d0@` 0P" $. ! (d jdP!p+@PPU v p@ <3P PPU @ @] @ @`V @Q @NhKh ~6 $ # @  0PJ` d 0QP,Q 4* f `6P P @P0Lp0  44    Po. !  d +@ 7jd`P  @l`Oߍ@-C+@@P bsA-tP+p@@/`P `F>1 @DT)dPU@?dO-M@0T^:0吠 <`3+0@08 p PpTL*TDpWG@pP0D`` #!pV 0.! @0+@ p iP' [* p 0-랉! @ P+@ iP <`T  +@0BTЍO-ML@P HP P   @  @  @ @BP- DpX+P@P Q+@z  @0 ktz!@#VP VP+@@5  @᳾ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    xO-uMM+@N "@jpB@ #hp ppJ jP/JPJn+@@  P-  P oL pP T !@p ׷pP* iPZ  @-  @*8%<5" #+@P Pip   P    @  @  @  @a uߍۍH-M P ,+0 +@ @;+  @ +@߿ +@ЍH-t +@Q 1/ i0H-4`@#@0 Pgx +@Pd44@0@-4@ Y4V44@O-MMP`plXi@PJ   P)  P/%P rQ*0@ @p刿P{p `ȼ B0P `pWkW~h Upl~ iP `p -g@`PTVJiPQJ  !o 6PBJ040 #P9JgP5J[N* @ 0- tg@P#J~PH  hpN$4Pxg* @0 VgP@PZ4` P bpV hTJYg@ߍڍ   P ` P*_ @0@^`{F~}hPdZg@`oZ QP ^/Dhp P pX BzhO-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4q"X32/\c3?s6o7"X3\cs0  ??h  p  p , p $ 0p y(0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,eS@ 8p L< Hp ED`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@P* %! !0A-P $`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P!""D`6oD`#@`6o@`#H`6oH`L`XLL02/3?6o8<\1L` X`\p `` @p"%8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x #U @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+<$PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUOu ۍK-Mz,(@ p@QpPp  APh+`?0 VLB Dl# 5_ P FP PO'a` 0 p ЍG-P@ p`CF P =FP  !  @Tc@@'FP !FP  !  PF@pA-@Pp9[`K ` @0`AO- MMHQP(8+@ 0Bpop @o?*T +@4  P p Ph+@P1 N+@@ R000 @Y4/`+ @?+@P`6o`@`To`@p@p pW v`ov Q p p Rm0tPe `/+ @@T p` Vk# W4@+@1/p@ 4+@P0+@P`+@P.+ @ R000 |@@0.+ @@@ "8n+@+`@  *+@EC`+@P =  Pppp Ѝۍ  @A2O- M@+@ ؞+@`4  R000 -@p0P+@Q  P 0PU `?+0@`0 S< 0/?sP8PU  PP ? @P `D p @R000 ?`/+ @+@00` R  W M  MP0Pr `P@+@QU USVP  PI0P+@` pF0 PY6 ? @DPN+@@ R000 ?`/0+ @ R q +@ /+ @00 P000 U   +@ ЍH-M 0ЍH-AM`(p @@P1  0P@CU :+@P:q @'>P `+@Q p&R  @ P!@ "@1  @1AލG-Mp@PK `+@Q p`VX+@Z +@P8+@P` 0oP] ( PEUP -+ @ #"x (@ Q p&R  @!@ P  @B1pF  @ ᖹN+@@P8+@Q u O'  @1P  @29P=  @=P <+@Q P wp +@Ѝ @  @ ЍG P wppЍG2 O-|MMBNpX - ``+@PQ pR @!@ ZD  @0 +@P <+@P`<  @8N  @]=PR  #Cm+`@ `Pm H\Ip@-XM@P`P 08l   AH A A( A@`+@h0<+@H  PQ`p D@S  2/L Q t 1L  Qt P  XЍp@-d@ KQЀ`+@ Q 2/ 4/+ @ R M= ЀO-MdP."@tQ pp`+@ P p0@S1/0 B?0r 0/3? BR"p040+@t0 S =D @  W Q0+@QQ@ЍO- M+@p0 `/+ @[ 1 /r  4?@+0@`0 0@SO+@@`@0@Q@%*R# GP Q) pW(,PP^`S pP/P pW` `PH `+@P S  @ㄲ Ѝ`+@P P+@PJP PPp[ Ͽ| L@P 0 L @@p@W0 PQ` ``+@P P+@PZO-MMMp8 0(@(PS p00<0+@0p`+@W`V0  /r  : Sx * R.+ @ (%0P?n=+0@0S <PfRW h[ WC C,@o W0PVP 0 ( `o+`@ $ .+ @ 0 0B?5 p( PX p  <+@@+@(08#<0+@ @TR +@8% -L`T ? a`o0 Q+`@SQ(0T    R ~(0 P Q 0H $pR00HP/U, /@ +@ :  @(  @5P p+@1/ YxQ /   @0T+@+@ <(0+@p+@ @X8 R (00pOaP!C_pXX   `/+ @ R (0 P `+@Q 0$  0 PHPV / +@ i:  @i(  @5P [3 +@pt?#"(0`V $<+@P "<`/+@+ @ Q@@R PP @S0T/+@+ @ MߍۍO-MPP@h:+@Pb: .+@+ @ܮ+@  U :x`U?:k0 됷?#"1T9A'(\%R !p0ޝ'ܮ+@ r!V`x``p-  g 0W 0QS0R0000 5+@0x` U-+ @ 0<+@0Q0Ѝ  @0['+@ / O-4MMPH`Pخ@:/; @ ^Q3~@+p@@0 25Y,0 t1I $P(``*/*PA`0+S\1 U4KYc*5KV왢"p5#0 { !+ A a`0 T$P1 Q0kS q!(`#?$ P 0d/+ @0 X1S(* <+@P (,0P(@pP,0p@T (,0P!2/!(QP+@ .5P $@@ pPK(+@tQD(,4q<+@P    / / @9P <+@P ,, +@,  p+@tZP+@4$@ p(,0PXI<+@P    `/+ @ R  P `+@Q 0 Z&  0#HP#! 3@+@  }8  @}&  @)3 pP$@,0  1/,0$@ p[(`P4Ѝۍ.<`/+@+ @ QppR  P P @_.,0+@T/+ @ O- MRPP@pp+@ P P GPn+`@8Q +@P A A0  0 Q +@Q    @0l`? 56\%TAR 000U<6R pp 0p0 0S0T +@PN 6nR+`@ p p0 / 0 @ @&\5)S A0  G  @#6 0S0! +@P 6nR+`@ p p0 g  @0  @ 0 ЍO-M` +@-@+ @ p$%R: =+@+0@Р@ V <+@:`+@0 +@k@@  #Pᐇ/ !T)A'\P 0 ``?" ``  p p+@᷿@ +@+@T`p`਽+@dPx_-T+@+ @ 0j ` Z03L2Q  MS  0e+@+@@03u U rQS 0v3\ +@=<+0@+@P @pQ 4 Xs `+@@`+@YPQ p P hp* %oPp7PEuPp7PEu@lT@+@+@(EQ<@X5 `+@0`P+@+@P q QQ 1P1PP`U TJ P   T:MP+@+@@0 c3=<+0@+@,Q Ѝ  @0#A-`+@0Pp@ I -+@+ @P +@` +@` +@ȍ+@P8<H +@ pP +@WP5`ZFd,W +@=`+@+0@-+ @T@p P` fP  @0#  @#@-M+@@P c]O-M<@+@P`+@U Rp .p+@0 0B? P``0V8rWPe +@ ? V+@,` `#V*o $(p p(0 U 0?0`V  [:@X 0U p`pop0S`_ o+P@+`@Q.+p@[Q  d +@Ѝ4 @"0H-P+@@ ?+@P !# " 0S @0"p@-N+@@Pp_+@+P@Q`@\V*\\pA-MP@`pW`+@Q pR!  @ P! @  "@#Cn+`@P!  @ +H+@  R0Q  pL `P0` px6<+@P (+@, j @y/PP+@ 95 +@   +@ЍH-Pp @ 0@Ud:+@P8q@y @`_+@<4 @dSD>FQ 0t0"8PrPV p+@8aPE p+@<+@800 /Q0  `,+@<P   0倁, `+@P 8 0 4`(V& 0`F4`P@`}pDЍ`@+@Q 04 $Tlo @O @00H-^@+P@88-  0 *@0@0O-M@P+@@ NP EM}L +@p +@o +@p +@p +@ `@p0@+@ rTP"a@Q)礜L,P8PPPPPPHPPPPPPP̞ +@EP FP PP  +@UP XP BPpk!@P|  @P u +@   +@pb"@ 0  +@ @7 5 +@ @p PY 2 @PW 8 c @ 0+@P +@I @dx+@0 +@pq  m @0 | (@ R *  @`p+@Y+@P+@P+@pI+@+@@ +@p:+@+@/p} RY` +@P  `P @Ad`)@pPUa +@P+@P <@+@P h@@U6@+@QL뱾PP @ X 0  W1pp8I`sKT@ @T@q  @eTJZ@+@P@Ѝn  @H- )@ @٠p@-M@P` $Q QЍp  @ 0O-MMn@+`@P@ +@PP @@p PP @X/N+ @P+@@   @#P ! @6 @+@P P [ @l8+@P y @d @pP @iT P @bP @[P$ @T+@P PC @H9+@ +@ 8@ov' 0p  ^ @/+@@dDt!!/00b  0J 0GdP@0!! ? 0# @  @c ^+@+P@+@Ps +@o+@ +`@Q 0M+@@   @APW +@@`, ?P4?@R%8p+@O!4# @1!@0@?po p+`@0@p0Y`0 0   @^+P@P  @`V C @@ `V 㿡P  @`V :C @@ `V 㬡+@AH^+@+P@P 㪀8n +`@@04*+@)`+@P ^$ To+`@P +@( O+@@,P pQ R ,pW:RX+@  Q P A @1+@^@+P@P, P  @!P q @P  ("@ P( ( $0@"@"@$@JP P @$I@ЍۍO-M--MMx+@+@+@P,P=  T Az/:&\%R0 ?Z 00 0 0Z p`Ppop`PWPOPNGp@`W+@,Z:4@\HL$0P_`^@PPA@ UPQ+@pX+@n+`@+@ @t,P pP4P8夏 xD +@Ћ(<+@)@+@@0 qTyAT@4!\5S 0p0 0N +@@  ?Pp & `\+@+@Q P QP  +@<+@ QDR Tdp`,p= 0 @ 0p +@P 8 +@PP> U @P\ 4U @P TD @U @P X X0 P XA0TX@ 0pX@0gp` T劁 X` *AMKP p$@`@(ppp\u:  hpP )`l+@pQd EPS Q +@ Q ` 0`& 0#0 Q"+@`0``000  +@ # " `pW% @+@P  @` @`P +@M @+@@PP @`P  ЍP!חO-lM@X.@+ @+@ +@  @X,Qb )@+@@P Q d> p,   ᤿ @0+@㱚Q6 pT+:UP& `<+@`+@ P@pR P1\t0P\t`#P  @PpW:,X:lЍO- M `V:@A^Ѐp+@@+P@  PpQ   " * @F Z ZP Q `Vpp ЍO-cMMz#AP tp] @  @P, @P `/ Rr P.Q`VP) @ .P") @PPI 0 Q 0?+0@`V *39 0@00PB @ZP64+@P- Q 0PP Q 0P PQ 2/I P @0Q @(PB P @5 +@PPd @ Q 2/0  P; `P+@Q 0% Q /* R   * R   Q 2/p`GP*PvW\ @+@P8+@P IߍۍGP:WR WxPW0 S 2/7 0@PQ 0p0 P2   P 2/00z )  @ @0 +@P @B @xPP Pǡ4+@PQ@UC0 S 2/9 p 0@00 @OP +@p @7 `+@Q/0/O-M+@P⤟  /+@+ @@ @)@P P+@`K@d-  @ 0`P`(  @R@p00R >+0@0SX?+0@0S!@W, +p@P(P%J@P`  PT@8?+0@0S R @ p g:j+p@T/  @ N  @P\ PX<  ``+@ p<+@`\@PpW P1dt0 "P%,Pdth: @ P $ @" ( O+@ K+@@[(*ߍO-lM@X+@@,Q _ )@+P@+@ Q d @,`b @ 0`吒Q `PT:0<P+@ `+@0RpS 1\Rt1`Xdp7\Rt`XdpppXp0pAWi\0H0ppW *P! +@P= @%R0$   @/+@P+  0p0#p'0 Q P# +@P @ 0U  @ 0 p.+ @YB @ @`PUo:N_+@+P@,XB:lЍ  @0bO-,M+@@`p(P? .+ @P1\%T9AR !0 0刞 +@  ? x` |`\+@+@Q P QP XU @P( P(   @|(` Y$`H` "`Plx+@!D`] +@P P  "0* V Q$PU+@  ?fU @0P`?.1o(0+`@H PR L 4@P0A_!  $P(0 8 QU $4$ L# d0 4  `@pY .+ @[A `+@`$PV8N+@@*)+@V`+@P +P PN+@@ P,Ѝ(@ 8P$Ls 3 03p?`P e2! US Q0vO-M-)MM^+@+P@p@@ 8+@+@dPpXP2$P,N+@@P 1 @tpPK @ pP ,/$+ @@@*+@`+@P Np @XP$E0TT~T|ʜ @b @` PP0$0`pU"0.p0_~Ph  @"p0$EVN+@@P  @p`$͇J 0_P.1!`P@Ve_naA @p0P1 P@PL`+@@>P ,/+ @@@@*#+@P`+@P %p @0<+@Z `La P D!!H!`Lap؋$5_S!P!!T!]`@+P@PU B  X!!0Y4 \!_>!T!U @PBZ` %.8D|0< t00 @p ?.x0H 0o+@ PP0 XPUHP%~0x +@ B| B Bx 80 B oPR0c /0`P`OPN`q~``@@f`pPp,P TPT4lo+`@T\hXPXB)@pd+@L@Pp dx,P d 0 @P尀p1T9A'!\%R !0 0^ +P@  ?\o+`@ `+@Q P QP  +@u,+@P U @P U @P  @P N+@@V +@P @P @P +@+@! p$#\TAP  0`PdP+@hp p pe?2w5 pU7Q% SFv qTyA4!\5S P`00`^h +P@  ?n+`@P . @#@ h u`+@P |8 )A@\Q@TA\+@P5P@+@P' LX @P! p`&#\TAP  0`PdP+@hp p pe?2w5 pU7Q% SPl/)|p ORQ<@+@p@Xp hXlp  B%QJG,A\QJ P Z@Pd$P8 P`p(@ R  ! S0!T@!X!1 A xPhU @ QD及U @PLX PJLpU @P2 PAP" `$$U2 0@@QL!pPU:W:PP0UB @@/SqL!0AVx8+@P@ 0p_^pAP~0Cp70UB @@S0PpwQpq8 RPQ Qt1` U2 0@RP  01 2 x+@XPV  PD dU" @QD! !U" @QHPEPETd  ZPpWa P  L$P\@`8!818`V[$8+@P(`P% \0X` p Q $UQQPQP`U`Qp00V:Q $%Q! ! p / a t/Q x/ALs  %/  PP5 +@P · A( @ 0@C @sP * `+@ H!+@N`+@P # +@,+@P 尀 o+@+`@N+@@w p,pW: 가` PU @U"PD @Q\T P$ X @P ` U @U"P\T @QD  N+@@6 +@8P+@ +@Po P4 `U2 0@QLpU @Q\P @ U @P\  ! @1P @T`VTP4:`U @U2P` 0@QpPP @ U @P\  !0 @P @T`VU @oPL+`@U" @Q \38P+@* PO @fP$ U @U"P\ @QL   P8JLQ qU @AT` A&H@%^ PR +@P D$@p0<p@ 00H0`00j 0` @`0 04` plj @P! +@0  *+@`+@P B   +@)ލ؍ЍDF|  @0 @ @K-Q C} P`#@ p@w`@r@T 3P V:O-M~+p@!z n8^ @+`@+P@ @1(# P&  (@ F*CC(+@U`+@P *    @ @a P P +@@P, ( @ %, %*+@`+@P   P@UT ЍЍO  @! P P+@H!+ @D+@/D+@/L+@/ M@-M )@@  A IUG-p@aH+@aVQ D+@!@㛈PQ+P@P QD+@z  @㍈ XtAB!@〈VP @VPD+@@  @m MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ՅO-uMML+@N "@v1pB@ # 0p ppJg1P/JTPJn+@@  P-  P XoL xwpP T !@p 4pP* 81PZ  @-  @*8%<5" #T+@J~P P1p   P    @  @  @  @a uߍۍH-M (P ,+0T+@ @F;+  @T+@<T+@ЍH-+@Q 1/ 10H-5@#@0 PK/+@P'@0@-#@h@O-MPDPO+@`+@@` +@(0pgܽ+@P 0  P !@ @ PL `./Lp+@S +@PY +@P l @|  @P+@ 8n`+@+`@+@  H+@   NA@ IA`+@` BAp =AP+@T WV( @ @ F @@ Y @Նߍ.pP+@+@  @3 8P+@ R`.p L+@LR> pA$+@@(+@@Pd P+@T @\%R p. P!' P+@+@QYP @ %, %*W+@`+@P Y +@P  @MY \+@QKYI P`+@PfJ +@ @ !@R% @Y`+@PS+@PPLLr?+@ L@ p  @P fs@PW @  @ PO   @   @d".+ @ O @,0pp+@0 ` p @_?`P @XATl ࡝Z 8+@`4P [ Q v0p8S8Ė< \$ P$!+@T)A@$P ` @ P 0@ PE *X30\+@ `+@P ^<+@ @ RQi O @j @ P+ 5  %*/+@\ `+@P 1 P:" @G @j P  * +@9 `+@P  <dQ:V @G @G P < *+@ `+@P  <+@P:Lq1 QQ+z @|N+@@  Q F @PG @ P*+@ `+@P S <+@P 0 Hq,  @FN+@@ 0RaH F @HP @P*x+@ `+@P z 4 Lq,  @N+@@ 4RaL F @P @P*F+@s `+@P H +@Pg@度 !@F~ @ \4S+ R( PQQ PUQ P^ !@  I R  :  XIQ`8}P+@+@+@+p@% N+@@P F @P @5P*+@ `+@P } <+@Q,QS 0"!,  0 @iN+@@0Q4e F @lP @P*+@ `+@P @ <+@ (R xQ2<Q0 3 @1<N+@+@@x 0Q<S( F @/P @P*_+@ `+@P a H8%<5"#. \ @N+@@ HR?8<5 F @P @P*'+@T `+@P ) @L@%D5"#D  @^+P@ LR?@D5 F @P @JP+*+@ `+@P @ @ @ p+@P @8@H 0 A<+@4/+ @@QzPx,%Rs+@P>  @d?Lq QQ ڡ @UN+@@ Q  F @XPG @P*+@ `+@P ,  @ @P 0+@   ,84e00 < (%* @X+@ `+@P Z<+@  QWPULpQ+@P  @  @PP ,+@ h0 c L0Pp- C0pO$e>qV1 `@U_a\``@ LPp00   *+@' `+@P  P +@P*+@ `+@P  h P +@p @<PL  QW0P AH4Qd P8LdLL×+@  pP@ 0b432 R"1Q SP XX @: @P \+@P  8Hdd LP+@P` 0b632 R"1Q S`+@P  p0P Qp+@/!`@ ;xP+@= .,)0 P+@> C+@  TK+@ 0P @5@1+@ +@@ +@0P+@P0U]$o+@+P@+`@P  @0 @p @ `+@`8, @@ Q;P+@ 8/+ @ Q P Q` K QL+@+@ 0@PP p`L0ADP +@P  @` @ P ` 0``@` 1Q   @Rn+`@P  @XPt @P  p P @/n+`@P O @5P @P  " @ n+`@P F @P @P ` 0```n `pi@ @P @% @~PJ R@p XLuPu^+P@ * 8`+@P   p}+p@c @PP  @ P+@ @ @ @`PYp 0PRp @1Q/Q `V"*Q:Q @s~+p@P O @yP @P   Q N @Kn+`@P  @QPt @Pj  c@0p @ p 0SP @T@@`D   I F? 8@ @`P T P1$ T9A  R 0  Y SP T d K/ @ @ @&? /   @ @ @ 0@5^ @8+@+@ ]+@+P@/+ @QBP@   @!+@`+@+@+@+0 p0pWPO +@@?p+0@R  p03 ! @~`A-P+@P-U+@P_ @ +@l|O- M +@8PL+@+@U *o  0@Ppmp)ʁ  @$+@ #@@?gP` 0PpKP  X  @[\+@P +@P  +@P  +@P P @ @P: @`+@P 6 @P JN+@@*5P >80!9AT)A\Q\%@+@A<o+@h YM  @2@ Ѝ$+@d 04C'"}+p@p#%l ?W& ^N+P@+@@i\+@P +@P * `+@P `+@  o,qTyA @1!\5S A 0`^+P@ ?>@P\+@P ᶾN~+@@+p@ h `+@P 奾8 )A\QTA\?fP +@+@P 0 @A@h Q pg a @P0 R D|}P@pU: @m +@PxD@+@@E  @>  @9@/+@+ @ 8A 1\%T9AR0 49AR1 8C\5-+ @ R \%R  CR/ATA\/0S`p'`&p @T@T  @  0000 P@@Ѝ @A-M+@+@pPdpp ` @P`2q`SpT,tQ! P+@ @'L+ @+@000 0@n@`ЍO-MP P` `@V $+@ p堲&  V ! @ @ @ 0 p 0p p8+@T<+@ R6`0@+@P`+@pL3 BR@Q  v8d H4LĐ@P 0b532 R"1Q S P  \p0@ `RЍO-$M$`+@0p !?Hp$ @s=P 00P^  u 0 @z @yWK(P+@ @  M= (+@ R0 [Q    0 @%0 @ /) ? Z ?$0 +@ @ @0~y(+@  `Z 5y $ЍO- MPJ$p+@`0@Pᐢ!( <PH+@ Ѝ:  !@0P @CyT P< P ᒱ 0 @,y P`U ЍOxO-MP 0+@PЍ +@P+@P&J8+@ D+@+@P +@PH N+@@P @<P+@P $+@ ? 0L+@ @'P( P PJ$+@ 4 ? *+@`+@P Ᾱ`P+@  e^+P@`)^+P@Y)p+@@T TPM+@+@@.+ @PL H^+P@P h  @,Pop+`@.P))pU U@Q  @P& P%  @P$T$X$*@Q+@~`+@P S  @P @ @_+@+P@P @@*@%+@R`+@P '  @ +@P @  *+@1`+@P    +@P +@+@@dPR0U @ w?L+@ЍO@> @@-\%T90@R"-RH?>ˀ c C*l "BLŐ % E|0 %,@ 0P%0@P%,0@p@-`+@@PP pwl  @ 09 @PpBuO-MPH0+@p8^p+@ R/P 4x+@+@N`PC YJ@.!2 @pS @000 R@0 TPpUpP᧯\%1T9AR  !0_ 0N +@@  ?^+P@ `\+@+@Q P QP 効U @ P PyP+ `Y!ϊ0P @x+@~ 0a"!on P P `"@Tq !N `+@@P8p+@ ? W 0Lcp R "pGp`@0p00GQ$ CP$Ls A$ R?0 B 8N㈞+@@`o*p+@+`@+@P ᠷBP P PЍ  @)p@-^n+P@+`@ @ `+@Pp p@H-XM pP`X@NP` @IXЍO-\M"`pP&@! o'+ @Q@P*  X&%$H "@"@ \ЍO& P* !@`D<@ ! @@`@D  @K D/P T `+@+@ P+@& ?eH+\Ѝ0H-@+@ P:0+@P E +@ Ea1S0 (@0  @00H- Q(P@|WtWWtW@HPᄻT!@U+@P @[ @P 0 @+@/O-M@\PT@P P~JUQ PV Pv V.h +@P @$\+@P9 `L+@ pqqR `  X` Z LpWQ @ pW 5  ?>p(aCnHg0*/1 Ga]☠ȟLu C4 ʿw0*Fj0`\ 5 N P ߍ) @>H-P+@@paV Q PR 7 P P A@`P @? +0@00!R  R//G--`PP:@Pp5PI+@!% #^1 F7KR 9 # "7 ! oQ.+@Q) g0+`@<P  R   W+P@{)Q( `p @ P +@ w ap A @-.+ @0!% ^! F'K^ 9.$P% "  / #"o  O-8PU/@}$#p@q灰#@p> XA#@a pWQ\ 5_P5_pPQpH8Ph@`WXH-`0S ^4^ ^P^ 0 B @@o ; @ @ H-`0S^^^^  B o G @ @ H-`0S8_l_P__0010B0B W @ @ pH-`0S_ `_(`0010B0B d @ @ HO-M$uW Őlp|hh79ON`SQ0vvq|$p pWp!@4OW:0p[ P` N0AVU P 0f PPX@``U0@B D  Ep_T pa R  p NpG`P  W0D R| !  !P! B!Y @2/P 2/ ! !Y2/ B2/! |Y 0@0ЍO-MPR @Pq  @ ꨠ pD p P `P e D Jpu (0 c0< C0 $ D8(4 @ P` @ @4 Ap @ I0p4  @  @   @    @  + , @@  @ hP ^0`Y? z D p8e D p4 Jp) 0( @T!*piT  0 P  @Q0 *PP md ߍ  @ K-M@ P;pP*h`p @0 P+p1W ` 2!ݍO-MMP`plj@PJ   P)  P/P rQ*0@ @pqxP{p `ȼ TP `pWkW~h Upl~P `p -@`PTVJ/PQJ  !o HPBJ040 #ўP9JP5J[N* @ 0?q @P#J~PH  pN6P* @0!q hP@PZ!` P t"V TJk@ߍڍ   P ` P*_ @0pᢱ@^`{F~PdZ-@`oZ cP ^/Dp P /"X BA-M@)`Pt`p+@P  0~+p@0P  R Ѝ? +0@0@ 08NS+@@cP P*+@P Ʊh PO-MP`p+@ `@lhT  +@2<+@QTР P @`/+ @ 0 ?  0 Р `+@Q r p 0 Z,*P?p  pp` TP`o0+`@P 0XDP`@ 2V D@0@P 0 0RP, @% +@8@VAp+@0 PG, RC6 >ERp^1 F7KW0Su #3S @=,p+@#3 @- +@#- @ p+@P  @%j @P; W +@+@q  @+@P  @p  @P 4+@ `᪾ 0,+@0Z,pP<0+@`/+ @Q ppPRp !$ ? @`P+@p TP (p @1嫊 `媊J`$WJ$`Z:(p$ QZ :!p171(pQ p(pW+@0, `P`Hhp(0(@@ @PX( (,p 0@P((P( Py@$+@[0@`Pb: J! +@ 0L @:+@P F @@ @PK (@$P@ ^+P@00?0P0`Q((,`+@0`0` B (`+p@P0TPpW I, p@V @ @ Z @@( ([+@, +@4Ѝ0pSR z / r P{   @k+@#3 @O-M`+@@ 0P @Pw +@0 Tpp  0f 0RpPY?0@`p   6/  H` `+@ЀZ  %$ @  $ %`P@QPQZ @P` @  PPP@QW @ЍO-M+@Pp0@o 0&"0W$!/+ @ `pS W/p  3R` 0/+@>` ! (@Q` R5J`X+@P 0+@3?R' 1 n @ +@R  @ +@P F @ @PP pPTЍ p+@pO-M` 㿽 ~ @ @V+p@1/ /+@+ @+@V   FP 0]0PP W"@!@V @ZhjXЍ`М0p @Z ppPx `pW 0@P X Zm p `@X"  0@  0,+@P  @2  @P  Pp W+@O-LM`P+@ppXP 10P 0@ C@ (KP `ip8РW,$@ 0@P %0$ !,& ! U pW`@+* , @ P #"A p`, p @P` , p 0 ( 3 @ 0+@P F @ @3P ` +@P  $p$p , LЍ+@0H-^@+P@!8 ^! F'KQ#@ @O@+@P$ @@3, @K@# # +@P@ @@P 0A @.@+@P&iO-M(`@,P 0V` 0pP @h`0P " Z OP`pUЍA-M`p@%,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8Pk6 V  ``?k7 VPQpW#* `  @T pW*@`!C @@ X*`!F @!CC@`@T: G- 7O0@`pWT ?p@T s5T P@0S6 @T@&@T@ @@T@p@T1W1Z:@ PUpP*U p p@0p0@S VS(BK-Mp($D` 6 P fP$ 0!   PЍK-M@P$i' 0 !`  P  @`ЍMH-M  00 OЍHЍ/O-M p@P  @ၰP ` @`Ѝ  Q = #0@P`rQ "$  R)$HP  2ka 0Q XP PV % #@ 0pP`V0%1 # PP  @ 0P `P  * @ 0X PqQ $' q  @ @ @  $`  0@ `t P [ a g P`u [sP@`To T#@ Z+ ޯP1 pD 0 PPT$@T%! @ 0@Pk  @ 6P  P ) P7 P@ PZ:/Q  N @ 0M0H-MP@ 0NR 0DЍ0HЍ/M@-M@P 0 !@}_/ =_Ѝ@Ѝ/O-MPp`BPQ @HLd`@ 0<;84$$ T,(NUp P ;=UpQ   @pG p H  P PpW P&D p P p@  @=  @ Pp$tWP|px  0`p  @ 0HXV PO+{i/FP   @ 0` p@ 0 px  $L P 0Ppd  0Pp] PF V0RD p pWsJ @W @T3 @Fp[+( @<a @9간 T0O3   @ 0pw @1*<* "p T @#. P P $ R *0pi @ PF  @/ @p KJ@ЍO-MP`p5P$ @U P#? "R R$# P PP>  @ 0y  @_P   @ 0j`P Q  @ 0FPx  @ 0T 0 @IP_ 1SS@[ơʁn  @ 0P !  @ &1S SSH L0@  0 ip) 0 P @ 3  @ 0`A 0 @P`ЍP/@-M@BBQ  Dp v  @  @ ^Ѝ@/K-@`P p 㬟)@P!@ ]   )@!@])@p ^T @ K] K6@-@P P  QP - @ @ @NK- @-# @PT0V pPu0`V#%T  `VX 0psP`Vp%q#4'` p p] @G @ `H-$Hu @$ @-SN"@R0^\ T /$ T! /$  T! /O-Mp @P T= Pf)@`@0 ]@T-V7 @ 6 j !0@P)@P `@ ` @ 0\T: p@D!@  0  @`\@TЍH-(4$$,0PO-$MP@PP  @iP $Ѝ 0- $tX` H0!p *cga 0 Q0 ` Pp`PZ X0 00SPR  @ @ 0  P QPU`a  0Pp $ PW p 0` pPK pZ0 WE0 P0IBRE#8\    83pu $$Hp2`r"pTp`` H QQP p`pZ P`pV:LP PQ3 @JM @g r @C 0&p<  0 0  0 P  4$$   $@ ` @O-Mp@Q W#AW P@VB P@$ P PP`  0tP  @X    @ M  @ JPЍp@-M` 0`@@PR @6lp  0r  @ @!Ѝp0H-hRLR aR bR,%iR sR tR#P#@ ᢪ@P0@P@0B R @ ( Lp @ @@0H-M@PP`/pP0p@ P QP P  @PЍ0H-P@Q 00@uQ0  @0K-M`P@pЍp0p@ PRQ sQ bQ SQ  R bQ Q BQP KkPJ0 $t   $ # $t 0 a   @ N@O-M` o r 0R(Q0Qy @pPr Pn Pi P P^P[ (QQW R 0#"N R " 0#D$p@ T +0P p8$ m00 p P-#@ ㉩P   ラP @ @ 9/ p)    T 9/$ }p 40  @@PUpЍ@ r#@ OPypA-`p@1PP  7/p  7/$ Ep 4 + @PH- sR iR aR : p5 @uA-M@ P $dPp0  r  @ 0`^  @U, (p0P  ` @ 0CPЍW 0BPO-M0@@@ "@UP" q@ ߌ P#p@"@ @`3P `V    3PP ЍH-q\ @`#p@ P@ 0X`VO-$M !@ @#븱P#@`  !@ P !@ ݶPU  ` - @X!@ P !@Ŷ $ЍO-M`Q (@,p P   @Ѝ P P0S*  @  D  T)#@ P#   bp  $ 0 T0 У0  0 p Z  @ o>  @ Pp@-M@ P'`P0`@ ! 0kS  R z @0 iR  0bS  @R P ! ЍpH-`P#@ 㴧@P p0p@P  @@p@-MP& ` ! @  @Op պ @0WP !@W KWЍpp@-MP)@P:($ ,4 @$ @rW$$0(@,<  @0 @/P$ ` p  @XW"7 @#K @& P80! @^  @EWPp @AW H#@Ѝp@ @@ЍpO-DMP@P @ .q ` @4 p@ A  @8 s% rPBaB PC44T4LPfh0@ @ rP)@  !@WPO  8P7 # 0 W@4)@Z ᥄  dPsBP:3LR  p+kr%0S" )@P $  @  @ >  @ )@Z i @ \#@"DЍ 8$ ?O-$M [ LH P p@`Z` [T @ $Ѝ `  pWp tLc @P ` "0# pH L0 %! PP\+ \U& 3 \p 0@ #@ !Up#@1 @P@\ \T H 0L @TX $@(`P] @HTPLPX $$ . P 00R 00 P `p`8  'p00' @@T` P`&(PP! H0Z P L@*k !Hr`are B`Q H @@P/@-@$P @O-,MX TP\0R, `Ppb @ P 0YTPTP 0@O ` p 0@EV  0 0 $X(F P=@T9(P5$P (PR`p᪭  0ᣭW0 `P p  VV VX,ЍRV0 000PvO- MS9J4pw60P@9  0V @ P0M@TP p`T +X@ PR (pP+ V 0pp0X @ @P ЍX P D @VX0 P0  @  @ @ ` 0@P(  0`@T P 0 %$#@PK*h[!Hrare H @0T ` \ @@PPTe @0\ 0 @0T` 0`0P@T@*h  `Hrre5 Q Hv$R/0S  //QQ/K-P $ ` p@ PRPQ   TXp@-(M@(P`P - ` @ P `PSP   @4(ЍpO-MP`@<`Eg7 p @=P$p UPE(H@ p840,#  @"mP< [ 0@`@0PPyw )@@ 00@@@ ?)0@0 SR'<P!S0QW pPt*ᩫ+n@PIp88K0B S( HY?@%*@) uap HP> TPH0@pe 0}GR2Y*) @D88m88i< p [a $<+0r00UP0S * PO44K88G pY*@) z Y*@ Y* @piP bP@ bR@P D` 0DP P,qP m` 40p ,8 80\P, v  @ u`)@Ux (XUq (@ ahM#@@ Q P #@P@Q PPP[ $  H"@0 P PJHUD -Q M P`0( 3/p6 @V4 1<8004 0,00P" `[ ( ' *T$[$UP S0 R / P+0$+4!q# @Ѝ  @_ @ @ _  @_p@-7 @ @xP1$ N )@P3 @ @ 0@ Rk  @ 0ᤷbVAP#`@#@@pPEuOO-,Mt `P( p@(@ ( pPGp(ePp AP"fP sP)@P(@P`wP p   @#@$,Ѝ  $0@kp  p s#p@`` $RƱPʑ1Q PH% +@@@ @Q@  @ 0!RR'C 8 H0 @(P P  `VR R R  Q @ R  1D @ 0,mp vp{ $P 0O @O @O @O @d 6pi  @\]  @TXO-M `0P W8VHQQ .  @;   @7Ѝ(庨Z @ 0S 00S000S@P R@PN  @ 0%뺨$$0p{Z  P0#S:@X% +P@@ @FP#@QY  @ 0B<0 3/p 8 H0( (唠$DP 倀PT 0 R0  pW:@-@RR R R @ R R@@@x @p@-0@P R CP pPpSp#S:@h% +`@ @@O pp ppp#@a  @ 0bpQ K-M@P`P  @><#@| $R 0 "0# "  qN @* Q   @o/o"R P 0  @ЍP U0Zp  Q P  0P  0p ^Qp 0pf(  0pP# pOU  0 0 pp   @ @- @?  @M-M`@Q V*㏆AWp @ P@AVp @ P@ؠ  `P Vp   @ 0  @ t @ @ hЍO-M`PpH V V9&A @B @ A'㏖B @ @ @$$  e` p H  L` 0$@$p 0; @ 9   @   @  ЍA-8MP@ P @w ` @4 p@ A @0 p p )@P`$  @0P#@8Ѝ#@ a @/O-LMw P`D p@@8<@8,40@0(, bP p qP   0*p% i()@P8<PP 8< 0S0S @p"`!p Pd#@PLЍ,0@ D004,p pPp @@D,`P pF #@$P $$ 0pμ P pP pW @H>  @ B Y " # # T 0 0 ᢼ 0  0 0@!$ + !(P @P$p{  pr  9 @ PiO-TM(dx H`PL p@sH@ sP  0KpMp qP.)@P'HPL  0 PK@p5 T  @ 0D$$"P`pP  @ D @0 x#@Ph H L0 @ < P   @ PTЍ0 4 P, P)  $, p   QP @YD @0,'p! P @J @ @`p  %  哒 8Y*`p #@ ΜP  V  Rp`8倐Y:D p@0RV _(<0PV[,^@p  t  $  ^   D  ^D  ``Y PQ> @@pD <0tP(0@  `SpO  0  V00 P  4$$    - @^ @+ @( @  0 Y0`  `R\ c $@0 `P@ zp 4P(0$Pq#( Q0 0 0 9p @ @O-$M]z  @`P p@   DaP bP iPTP  ] TI TC  p=p NP9 lP3V#@2PP  0S0S `p"`!p P 0T )@P  0   @#@$ЍO-qMMZ @H@+@p` P@@H@D@@@ VPa@Q#l|@AP HP)`@@WP+@pʠ#@ S@ @ p~@L@ Z@pq+@P,k !@㠥P  Q; HDQ )@L PhDyPP+@ Z #@+@  )@@ @P6P! 4@DPP @D 0S`V Р 0" p!0i PH`V P pP pWG  @ #@9qߍۍ Z ( P@" @J r( @J @I  @ @ @0Y(  )@ばL$ ,< 0P wJ p  0qJ`pP @P` XX X K`pP @P` XX X KQ @KJ ``Q`4pP@`GXX DF @4J ``9`,P& $ QP P ` P <0+@ 0 AP6 B2& 03 @! @PJ`P@`XX X 1K PQoT%! @0V>`#  P xLP@` P ҷP` P ȷ PPUP?>Vk @o P S_  @H0$$v @F0$$ @?T%QO! @0>& `! @06 PQ#@ (| Q@ @ H& 0! @  @zH8O@$m0   @oH) @lH# L  H`V` @ `P?U?P# z (P p@" @8FHUr( P @

H @P p<XL8)P@ ` P 8 @"H P < @H`pP @P` XX`X FI`pP @P` XX`X 7IQ @GH @G`pP @P` XX`X I`pP @P` XX`X I `P@`XX X HpW(P$ xP @)p@  `C G ```P@`XXX HPUH-BMMP`A @@G L @G X @{GP c @tGPPf P!`@0   @dGT%p! @0 0  @SGǷP   @IG{+ P @0ⴷP ~  @6G#  @,GP3 @ @#G2+q @G @@#)@`Q A` X X X DH@P @& 80! @  @FBߍۍK-M`PPA0H @</ @ЍKF pk @F@g` @F @F  QPpP% p'pB `@V @FF @ @F@t & 80pP! @L @ @ЍKF% @F@ Q  ^ `$ m0I( @F@PPL @|F,,1{+ @0q< &  0@! @W "@iF@4@ @cF@W-+ &  ! @pP 0  @NF@p`& 0! @& ! @p`0  @:F@pV V CЍ`P`O- p$>P9 40,P3 pi@ #@P( X@ P #@ わP P "@P H !@P  P0 TPH8 LP ,qpP,o4$7P,  0Xpp 0$4P  ,0$S0Z8##;!  8P $$8, $RZ  @"P } "@P I,!㙦l @P P P ,s <%(vP@ @ d @8P , H!@EP   @=P  - @6P   @.P `i#@ %Py   @Pq  q/ @Pj   @Pb   @ PZ  r/ @PS P @  @PB  s/ @P; P,0U*  0u! + $$,@$P$$P @jP^ 8 0( $D`*i| #@TP |AP, | @HP |$5P  "@P   !@P  - !@P | !@'P |$ d , @\P !R$, @⊥ P $D0 !  4$,  P$8 @!1#!  $,  P$,@ ᪱h `8\ <$0( 0(4P,REEIB DPT4H 8 0 BL PX\0$$ᛩ! h $$,f$Pa,@40 <``8\$4#S#x! H $$,C$PAp @ pAߍD @p @  @- @| @ p,w @ @ @|  @  @; @0 @ @H (@O-$MMP @*P ^Y L#p`+@~P QQH4+@o    nP  !@$ㅛw  @<p P`fV [$0P 0oQ a` p(P  p !@<`L+@ 4   /P  !@$F  @<v` PpgWu  p $ @1<` 4   P  !@$  @z< P$  @c2  @n<V   -<YY$Ѝۍ_ m$ @ @:J @5JG--MPHpϊ @0`x @Pt H!h @pd @H ` @Ll@ D  <4,$H@p8`0@(@ P  ϊϊϊϊ1ލp@-M `@Pۯ ,  ` @@p ' Lip Ѝp % @ @I  @IO-M@`pp PVP pg c"@P P !@PP P  @P 6  @P  @mP PhQ @  puh @YP ohZ 0 S 1 pv P P Po  @=I[  $ Q 1  [sU  ,0(S 1Ѣ0P Y  4Q 1  Y   @IHQ 40L S 1PZ @ hP 1P l 6P 0 S 1@ `p$@ `p p R 2/p 8 Xyp Ѝ @_ @@ @'%  @H\ d T!@H\  @HO  @ HK-P! P sP pP `+@ P _PK-MG P @ @P ``p  p!@P@TЍ g  +L p !G @0 `oH-M !@|PЍ@-M@p  !@lQЍH-@PWP pxP?` `v ơDH-@P9P pZP *`` ᰡD߮ܮ?`H-M "@PP ̮Ѝp@-8M@  @P>PI   @P . `+ @+ `L H `+ @+P  @ `V q 0p@0 P P  @ b@D8Ѝp & l9 @ @"0@᤬0H-M  @ @P PP ` '`H @+p Ѝ0 & 6 @ @ 0@V9  @mG@-Hd +@@(@H+@@@@A-(MMA.P0 C Lp P(Ѝۍ@h& 7`C @+P V P@Q9M@P$@h& @Cs+P V P@:96@P@-M @@bP  Hxp @Ѝ9 - l9 @ @"0@@-M @@AP H Wp  @Ѝ9 . l9 @ @"0@p@-M@` P @ P uPP PP  @oP Ѝp9 . l9 @ @"0@Ძ}  @F% @? @.  @F@-@ @P  @D@9 - A9 @ @#0@ጫ0H-M @Pp  6  @P 6 @#@Ѝ09 - A9 @ @#0@j@ - @ @VFU  @HFp@-M @ @fP `AV*P P @ 0p  H`PPZЍp  @ F  @F  @ F  @FH-Mmxi `LPp   @Ep_P&  @E@ p~pL  @EQQTUp!P@`W 77p`W 75O-4Mp #@ `P+@@ T @@`P0ݹp @ET+@peq  @E `0`V{ ᬚ (@o@堲 PpW`VhQ pWQ   @ 0"0 PP1/PQ 1/P rP+@P p p `0  ! P<W90`VP0/FeDL`I KCPpp@pp @pp`W P `i0ú4 Pʏ: ;CPP @`W@`R#@Dp@-M`P@P  ^p  @ D40H-P@"@t@P &qPJP 09 s- A9 @ @#0@ԩ}  @D0H-M @P$p   @P 0 !@ @d@Ѝ09 - A9 @ @#0@᫩@ - @ @Dp@- M @ @P `P P @ 0_p  ``HP`p D` ЍpW  @fDl  @XD  @\Dp@-(M@ @PP. Pp$ $ p0  `q ``Q 0$` P ` @ @PD(Ѝp9 , l9 @ @"0@f'0H-M @@eP Y PH|p qڸ !0p@0 fpЍ09 - l9 @ @"0@C0H-M @P3P  @kp Te !@ @ꤪ@Ѝ0p@-M`PgP  @'p  @ Cbu3//// 0(@0 / 0(@0 / 0(@0 / 0(@0 / (@0 0/0H-@ (@!PP FP00D PaD"P# *Z (P@ၤ?Q:6 ADPP*@0H-p+@P0@ Q:a@QW@ A@Q=@H-H/O-M(`  `$ (@P P(+ @p@0PPU 8@ T wp`_0 0` p$P( C AP (@; p  @Ct (@1 p  @B\ (@ & p  @B (@`V u (p@ `VG+@XF+@㴺 H+@g  (@(@Ho `@P@  9pVP BWCW NWIH+@PaG QsGP(d[<\t]d]\<\<\T]M+@PGAWK ][<\\<\<\<\\<\<\<\\I+@PwWW0@!  T.+ @Q p lW+@P`WFCWY LWM vWFmWH sW t (@Z (@  (@ZK+@PL+@P+J+@PyO0@+@P!  žP.+ @Q F+@PG+@PYN+@PUaW lWQ (@NwW zWJ (@Z (@C (@@ܦ @(@; (@6L+@)@P   O>+0@0S0>>+0@0S9G>+0@0SF>+0@0S0O.+ @ R.+ @ R$ $P  O>+0@0 $0H$ 0(0 P P @$" @Ab 0@"@ A$ (`@ p  @A$PP PP PP  @Ey`p` p @P_ @ (@P V % $ @" @ R 2/g19 $8 @" @ 0@*SK-MP'P . @ @8Aj @(`@mܘpLؘ뺆 ~ xo P!@ @ `@)@㰐 W0 @0  3 (@pW 1/pmP ` @  0PPP PP30 (@ R/0S  /0H-M P@ܦ  @(P "@P $ pp qH > p @Ѝ09 - A9 @ @#0@ʥ0H- M @ @P P P ` u*` H @*@ p Ѝ09 , < @ @ 0@iᥥ  @@H- @]H- MP 0 A A0H p Ѝ  @w@H-M H PЍ  @e@H- (@ PO-MMQ 9@7TP * @ @>@\`pPn`L+@Y[  ^<0884@0H,P(X$` hpxp)@P`XL P[  ᦢPJpU ᝢP@ !@ 8P9 IP+@pP1 J+@P)N+@P" M+@Ppե LpK p P `P Q 1PpYH`p  \`(@Q P QD\`D pX NP p5*  @'  @ 1  pT"XL p Q @1  @[T "  Lg pQ @1 F1 p L@P 0 Z : P@ #z @P p c1_pP< :#[ X P@P pJ1FpP (@pW  2/pTP p*"f@  Lx P @#1 ` "L  p VP, X L䤍wp%  @0 Gp+@P anǤL > $&p R @#@ @0\T  @FG+@+@ DP 0\ 3/L+@^o !F+@L PX,^p P@ 8庆 n !@"@ `   " @ 0$ K+@  "  @!@04  " @ !@z0  "  @ !@j0  ' 0 @a00n "@ `? @" R0 K+@  "  @!@<0,  " @ !@,0(  "J  @ !@0 / (@`VD 1/` \P(@L`+@V 0 3/`VH`@PP /\`~ߍۍ @= @' @ @y* @=  @=  @=Fg+@ @  @R=H- MP @@`P  `*` D*Dv p L    `*` D*Dn@ @ @PxE Ѝ0H-MP @V  !P@P' .` @ @`  /Ѝ0"l ^ @!@ P@P!T @!@p/Ѝ00H-M P@@L poAoЍ0p@-M@"@OP @IP ( @CP @=P \X+@`>+@+0@ P 0``7L `{ p Ѝp3 @=p@-M@PT!@/ P @ @ /P _` "P@.@K "@@P Q I @.ЍpK-M@nP PP(p pP` @$ A8(L @p? Pb P @1p  @."@Q R !@."@)g. e.PJ ` @.X #@ 0SR2 R#@.3 P\L pm @TT P @u. #@ @ QRR TG P @b.<s @7! "@!@S. .mP& 堁㶑q P @ @ p@P`! RQ6. 4. -`V UP:5Ѝӭc  @; @  @; @;c @V! @;@-mjPdN+@@@2@L @;H)@0  @㣓@-M@Q @P\+@? ?@ ЍN"l9 @ @"0@ᾠp@-(MP`MP2 [@ @P \+@P  @$ A8 (LpaP[ @ P \+@(Ѝp @ n;c  @r;e" @ @k; @f;H-@"@zP! \n@+`@pP|HP P@}pO" @ "W9 @ @"0@?0H-M@P @0P;p@-M@o @8P" @dPV=HP \n@+`@ YPX+@P1uN# @Ѝp"W9 @ @"0@p@-M@9( @P @.P HP \n@+`@ #P`+@Pu N# @ꗡЍpA-@  @P \@+@pPGP P@p `"W9 @ @"0@2ᜟ'  @VH-`P V@Ppp 0p @AH-M`P p@ P 0P <P  0p ` P  ЍH- P Q   Q 1/pK-M`(P ( pBP@p:"Q P Ѝ UP֠"P , 0 qp `  O-MAT$' Q P Q PPH "@PPHp彟UpPW Wf Wh W ꎠPЍW WGP @ "@ X#@PPQ /㴑P( P $0 @0( DP,p@P `P$P( [ ߩP (QJ VH( ( 0"`P$Q? /9`_P`GQp0 :R Ru a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0@xP:iPP `V  )  Q QPP:۟"P ,UW U3>PT 0 @zIP3Q0 !P-P* P(  R$ %PP !` CRp P`VPP@``&P pP V$@P U`V  0pP PP `P Pt@T  CP{U P \{# @ @0`u8% @? @{# @k8A-PU `@p{P:1:P  0p `  O-M- MPPU͊J @pP%  0`X6/P' P)P `半 aP D  ͊ XP  0}pPPU[ [ ƞW꿞 P P D岞 ЍЍp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V @pQ P 0P -P)P $P `V^[Ѝ @(@Q QQ Q R-0t| MgP P0 0  0p 4   @/7p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP ( # @p`$@ H-`P@pP  p#@PB @0H-@PFP  R$ Q  0H/00Q /  Q /K-p@P`P QpU P `PUP QpA-p@(`P P #@ @p PA-MpP,`aP @$ ( ) $# @ 0 Pp@ЍO- M0Y$ P 8P J 4Q44 Q Q((8YP Ѝ`P$P Q(`HO- M@40PP*U( `@p HL 0[*  0@  4/PFPYU@A  겜@ 40 B| |LB! 0 [#*U! @Ap  0`6/P@ LD 0[ *PU, D,L 400 ЍK-R P@`V`V p6/y P@T p@-@`PP aP V  -P PT a ^Z7 PpG-FM@ @tP @oU`P  @ @` @(P R" pF`+ Ppp ͎ppPƘ ƎJH @p @Fߍ @ 50H-lN +@@(@Y_tN +@@@U|^8 +P@@Qc0HiK-NMMPH@+@`pF)e(aKL XW `p/ ) + P*(p) 4`l 14`JO a) 0P ,*0* 0Q,U1  @ @&Nߍۍ7)@08 @{H-I H4p @4p@-<\ @(P@n+`@P p T p T@ p@@pO-Mp@(Q0 0X /) @ xQxAo@X; `xPW P6Z )@   % V1* /) @  W B V)*@0 H)@W@0@@`X `p @@p PFP@ P @ @@Ѝp@-P@QU 0P )@xQ )@ 000  @UP $ @ @UQ p@%!@%Upa!`@%PUpp@- M `P 0 BP B P$P `@P`@Q@JV:Q `ᗙ  R@P P`  5gP ЍpH-p@Pp `$P   H   @s3c  @n3H-M pP`@Z @ЍO-MMMPi Ppg `K{pe @F> }, @#p@XpYI @ʕP= P9 pp Ɍ L $p! !@ !P H +@ 0/o004"  3 ⢋P3P 3 !@% @ @Y,㘨Mߍۍ_ @ @ @$ @2H-M`@>p pPȘ  pp g L Vp Aꑙ@+P "@2ꇙ@1P /PtЍ @H-L.+ @ R @H$A-Q P`p@!P PP`V@- M  @p ( @ºP 9 HqL @^20 Ѝ8D% @ @Q2@- M  @mp+ 1 @hP   P ( @ᇺP 9 HqL @#2 Ѝ {% @ @20H-N +@@(@[aN +@@@W^d +P@@Se0Hk@-M@ p QP %P @@ @ $Ѝ#)@0 @㰉H-P`@PM @sP ? @pRP)@UX @1:L Ep@-M@ @)P  HpЍ: @10*l9 @ @"0@Nᛖ@-M  "@@͹P  lpЍ @x1)l9 @ @"0@M|@-M! @@᮹P IMpЍ @Y1 *l9 @ @"0@A]@-(MP@  0 A  Bo  "@p L p(Ѝ @-1) @ @10H- M @@qP Y PHp  p Ѝ0y @1*l9 @ @"0@q Z @0K-M @<pp v` `Hp\PXj P k @Hf#EP@ r  @ s{PXp)@ :Q0@\@{ @"p@0 :P3 @` TP { @0 0@$P AAqX\PH 8H q @0UݍL_* @ @m0 0@-0M @0@Gp P  Hp0Ѝ @R0) @ @ @>0p@-N +@@(@P (@N +@@@^ +P@@yn +`@@w~p@O-M-MXP@Pϊ$ P8(LxP{p` h` dp@ⰰ ϊ 4P  PPLϊ ϊ NPPyp !R*  @!yVpL+  Dp P  @G+@P  @! .p P  @G+@P  @!  p ) Q  @!G+@P   @!I p ) Q  @!G+@P   @!P4 y A8pL  J IpP J! Lp^ 2  @z!PS >  @s!Q&  @o!PJ` ᐋ(f@px ĀXQ@ppP?)0@0   :R P j  @yP.  @TU!@ @@rP  @k @e`D@ pT P @"@ U뤵PEp @UaF଑@@FPU% ` @/ @P P /"@P' @' @' @+" @"@+`F@ @VK@[: @>G~+p@2Pm P@T:@PTF!@ @P  @N @ D pP eG_ `@ @@"P@,9 Kp[@,II@P W,` P@ @㬑@$  @P !@P "@P' @' @+" @"@`F@ @V,K$@Q' P @ @@T!@뺶 FhcT!@ `@ @  P!@ 0  @ @T"@>G㬑@] ;h#P@ `@5P % @7P 2 @0 j @`d J@@TPUUP ~ @S0 @t @L@TP> P `  @P ; @:Q PB@QNXXXXXXXXXXXXXXX(4@Lj @T:@PP2 P TK!@ @P  @|Py P @s@Qi H @lXԶȷԷQ @bP^ PY @[㬑@{P*TK!@ @PQ  @`V @!P@ 0p"" 0  p@T>uG~P `+p@㬑@,Z @%_ @"u @ @ @ @ @ @ @  @  @ @ @ @ JZ 74`0J`'ZP*3Q  , f6/O3s2"0r R 00 , C,L%"^#Aq, !ɠW%#Q:A, A,L"KUߍ؍5 @+ @ +@- M P@ 0 C@@@!H @Asp @@ ЍO-MY ppS   A^Q0S  {` V..@ЍO!@ {`W JP:PJ⠡@`!@  N`V*E@UPH-`T@!@Pˋ`<pfoWpfU W `EQ!P@oV `FpWP-v>Hs ` P "@/@ #@/ @+@` P "@/X #@/@-ME @@]P  WЍB)l9 @ @"0@n@-M @@EP  ?ЍN)l9 @ @"0@V0H- MY PH@p o @%P  qy  @ Ѝ0j)l9 @ @"0@,Z @*O-dMp  @;"@"p2  @b  @`P tp P < cXp <Q K @b  @PT (@@ @  a p@ P @ 0P@ p`R @ 0``H @ B4 00,( (@ $P`n <@P P @<`^ Z X `T\T0\`p XQ+@T (@Q 1/dЍb @T  b+ @bP0N @@^&(! @G> :. P @B  "@@ 0@hK  A-hM:P+@(P 0P @ D@(@ 0Qp(  @ @@P(  @T@؏ ԏ-sp5 @Pd T~ LP(p@o @ lWp PP8 P5(ŏQ%P Q Q% ( 㡏 㝏  @ >WP( ㎏ ㊏ @hЍ  @PQ P PX@d`\Xf  @UL @@PbP @PX A~ o@ @ @ P8BM"@@(  @i\! Mp@-M,Q, @P`A o``` `#QЍp@ Ѝ/H-+@ R00@-@3D  @-c\T (@// Mp@-M@Q P`A?Q:P"1QЍp@ Ѝ/ MH-M   ЍH Ѝ/@-M@+@P 0p @  @Ѝ@-@3 #@p Hp @v  @o MH-M    ЍH Ѝ/ MH-M    [ЍH Ѝ/O-Mpo x^@`@ P@0@ fPl@ Q! 3 P xFP RPR? Ph ` gPf#Q  zP MP&  #Q  dP =P  TP 9  EP  @*p[)@6 +@P\ ~TE+p@fPR!@@ @ @U+@`P ▉Pq q  P `XP PpGPG U*@}Q @pP cP bP  XUp*^ GP*U8p㋍    P}P! UZ*@+@[+@+@X%P X Pp ZpP P  ! @j&  6/ R Y@  @PW  0"p3PdPa P `( `W H`L !(   V  0 Q P np4ڸ qr p- @Ѝ  @ .  @%  @% )@u @% @%T!@ % @%T!@%0H-鋌@)@PE @ @ 0}7 @ }H-M 0X (@ P  +@R  0X (@P +@Ѝ3!@% @%@-P@@O tP ^  60S> #0@> #0@> #0@0H-M  @0` (@lPЍP 4Qqs0#4 S > #@#0@ Q 01> #0@0/H-P P&@ #Q \: > #@#0@\01P Qq0 0 S:> #0@ @ ^10 0@ Q 01> #0@0H-P0S\ > #@#0@\0> #0@0P S \ :>  #0@#@\1 #@/@-P@O0$S@q Q : #@ #@ #@P   #Q\ : > #@#0@\01> #0@0/P   #Q\ : > #@#0@\01> #0@0/O-qMMpP ( #@` P@0@ 0@ cPd@Ptttttttttttt+@&AP 0 aP# 0@@+@@@ 0P B[( 0p+@)@ GP >+0@0S~0C+p@000PY Pj PoY P cwP* p@ @ @`ᏆP  ኆP  ᅆP  P S"@P bPP5 @nPP(O   kP, 0 0000 000P` TP `[ @tP E!@['<PAU `P`P `P`P pc @P  @P  @ Pp @P U =P(8P( pP ` U +`P(%`P( ȀpP P @ ՅP p P`  P   A   ~(aP @PPl( P(*P@T`g#pp$މP}'P+s/{PPP q Qr'Ppp, _z+P@D sP e(D jPy PaP:a@P !P #@QPP( U#@ 4 0 0`qߍۍ @"3T !@" > @ @" g @" @ " ' @0H-MP0@U 5 @ 8Ѝ0H-M! \)@ @04G-P@pnQoQ Pp@ "@P @ @"@nQ`oQ ``AP @P\K-MP`Pp`DȜᰄP ᫄P p`VЍO-AMM p`@h:P $ ,(IQ $uT @TJ $f @PP/P@ 0 PC P P) @P9 Q@ ` P@ȼp FȀZ @PY  7PI @T ` p @7$ @$ #@7P`  $!@  c$ @ $ @ '$"@(Q #P@ZN %Epᨠ@P  @ P $L @P ! @+! @B 0(#@$L fs@( TB45 @ "@` HVP. @ 㓉ゾ@P@p"@ @GU`pP -P =Ax@T PA -@PPPP p`4n+`@+@po p0S0P  @u WQOpP"@@PW PPeZ (ʻp @jpJ @P $ P ZP- , 8iܺ ^Z`F( Pc ᲺP(`FP ᩺PVP(  㝺PZ)@X➤ Np P1 P+QTU- !@W$ P 0 @MPAߍۍP+@P+@P  @ 0 @pk/QPPZPP+@P Cp K  !@*  @<PƻZ ( NL, p @ 6 :Jㄉ#@`^ B~"0@"@@ @ pֆP  0SˆPB @0ጻO-,MM`ᨀp@5 @ 0RP !@OXU!@+@6  $(`o#@"`@@p Q Q Z PU f P:U  .E!@ @ HZ  @0(`$@pP ]Z  @ℼP T!@ !@PI 'kZ  @P> ZT!@ X`Php } @~  @xP1  0@,0 0  @ :P ,P , vP,  @U!@,Ѝۍ^A !@ @ZT!@,ЍۍOC0H-Q  Q @PᯁP Q+@ +@0p@-@P5 nQoQ2 S,P# P ,R RVP @P,vPP ``,vPP G#@ @@p+@ 0H-P@0H-MM @  P0 $( @0xp  0 @ @ @" |# @^OO-Mp`P@y 0@ )@PT|‰ P@0@  TPe@ Q$,<LhGP MP4xUPgt ,  0#@@PI 4p)@FQ: `V X  X  V `p!|ZYppXp Y4tZ8xV V Ѝ  @1 !@ H-~ )@D @} 0H-MP @ RQ pЍ0ȏ @ 0@-@ᒸPW!@@@-@GP"@@@-M @Q QpЍȡ @ p0H-P@5P /P0 @ @0H @ a0H-P@g0H-M @ P0 ) "@0p P P  9  @ @  @ (O 0 @O-MP,p()@ c 0@@ @0@#`@ |oP 0!P p)@EQ A O @H-雃 )@c @ 0H-P@95P /P0 @y @0Ht @ 0H-P@0H-M P 0AN ( "@0tp vP P  9  @ @U  @bf OA> @|O-MP,p()@ d 0@@ @0@#`@ oP 0P wp)@EQ A O @HH- )@c @ 0H-P@4P /P0 @ @0H @ "H-0H-M@A 0P"  @0ܶp  @ O-M, (f @pP @0@#`@ foP 0 P p)@DQ @A +lЍO @ H-3)@0 @s} 0H-P@4P /P0 @\ @0HW @ 0H-P@0H-MA>@ P +$ @0Tp 0 @{@ @( # @| ,<\! @@ $ O-MPp @0Jxf `@0@ LPg@Q!@ttttttttt9P GP9||||MP( UPw| |||  #@0'Pc ||' pp)@QB0Z S  S Z `PY`[ 5p( [<pY@tZ(Z PP$||Ѝ  @1 !@ H-K )@ @` J 0H-MP @ RQ pЍ0ȏ @ 0h@-@_PW!@@@-@P"@@@-M @kQ QpЍȡ @ =0H-P@2P /P0 @ @0H @ .0H-P@40G-JMM4P 00@ 0 EH!@0ߴpl Eh4@Pp+@!`@ـKPVP S QP0 P U0 0忴p 2@G Pʎ+ # @8P  p< 0 04pnrP mvq @{<0 @ `p @D L0 T T @Xp\`t@T$@p ` Jލڍ 0 @c p@-@ &P PP p@込_+P@``pG#@C O- Mp`H@0j (@H s녷l h  @+@+@ @P@A@7P` @   @ @ @ @  @ @ T @ @ @  @  @ , 8 @ @ L @ @ @ @ @ @ @ @ \    @ @  @  @ @  @ @       H @ T | 2PJ 3PQPeD0@h@ I0@^( R0@P, (@ 0 (@}a0@;8 sd +@mi eg0@#P;l4P Y@UQ 0@8 0#@P P d +@   @B P  P  @0  (@    @     #@'p + @  !"@ $  @     @ $  @ <   @ 8   @ @   @ ,  @0" r0@X$t0@J, w0@= ux0@30kP bp)@GQQ0`+wh4D  Ѝ @H- @0H-M@ PQPЍ0 @ 0H-MG~ 9 @ 0@ )@ @Z9@ @ @ 0@ O 90H-P@/P /P0 @ @0H @ _H- RR% @KA-M`PPJu 姲pPJ@@ RR0 s RP 0$pЍ% @H-M` Pp0@ 0@Q 0ЍK-M`p@PHp? 0 4pP< ` $0+@0p4O76oB048 AB<0<" A @`@I @~p P 1Q 2/R B R @ @}HЍ @H-BM@o^% 02/ 14 10>p p0@ 00 P c}g[  @!@Z}H<Ͽ BߍA-MP@` p$I} UP` +@2/R1QP5_U @4O.}@,}0g  @ @ nЍ2P(0/O-Mp 2렆P `@@ p{P`DH @0@3/pB|P=p@WP ` p@y+  @0 3/ qZ㋐r P P p#YR*  @ @0|<ЍO-MP `+@[ f@mP @:mPt @0 PPP0 A,p CE!@ 0yrP Tr  @a壶` PB`t@ $T`P@pp P/   p8 { vp P p! 0x#o D 0tp PQ 1 Ul +@P,` P2|Q p  @P/t +@Ttp +@Qyqp +@UDt  +@000  PߍO-M-MpPP$ A`0@0@ K @ F0@ 0@00@ "Ӛ) @ @ eg@Qo               /p  #@ 0P @- @ IwP 2 @ BwP  pn  @ qO 0SPk@ e @ cO 0SPf@ ]I Z  p)@EQ$A+(e@  ٯp9 0<S p@ p(00Qp0 ЍЍ'  @ @E 7 @? @ @ @ *f @ $Q @ 'BH-z )@ @0H-8MMNA. 0P$ (  @0֮p4 @- n  @P@ {  @  @(P   @ ((  @0,P   @,(  @00  @8Ѝۍ0b @0H-P@0H--M@  @0@OP  ;   bЍM @0H-MP @ RQ pЍ0ȏ @ 0@-@yPW!@@@-@.P"@@@-M @Q QpЍȡ @ W0H-P@+P /P0 @ @0H @ HO-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4qZ"X32/\c3?s6o7"X3\cs ZZ0 Y ??h Y p Y p Y, p Y$ 0p Y(0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,eY@ 8p Y< Hp YD`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@PY Y!Y!}Y0A-P hY$`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P.Y!)Y"$Y"D`6oD`Y#@`6o@`Y#H`6oH` YL`XLL02/3?6o8<\1L` X`\p `` @pk8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x XU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,2]0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+jPU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUOW ۍK-Mz,(@ p@QpPp  Pq`v VLB Dl# 5_ P_ WP PO'a` 0 p Ѝ Q 0P #:r/ Q 0P #:r/O-MM@ p[/+@@xw1 @&D P+@ PP 0 @rPpGPPY 5m @Q `@`840,( B@4Q (& . . . (% ) . * . . . . ( * . . . * ( . * . . . ( . . . . . . & ' . & ' ,( $) ) T) . . . l( 8+ <' & ( . + . l& x+ k0@!@@rP  @zrP 0@@ᏬPe m!0@  !@0p  +@@0@@ 8P !0@  !@0U( +@g0@@P? 4 ,! (@+ @0P  h!0@  9!@03\ +@E(0@ *!@0# +@50 0@+@/4 >(0@  "@0  +@c 0@  !@0x (@ 0@"@@qP W!@qPB< +@ P +@ q l0@@P P !0@  !@0` +@!0@    @0 (@>)@0  @@fL +@@ 0@R@"@qPT +@@  @0t (@ 0  0@  @0k @0@@(0Z !@,[X +@@ | !0@    @0Fd +@X:0@@4 +@@AfPf/>"@ @ 0@ >!@  @  x1 [? @㏨p0  @ zssp* PXQ +P@P T0h PA +@+@@ p R!㪧 pn' @ @ pt @Ez P"z?!@ t hA p+@@$ zبp7pxP!h +@@*@z Pp! + @;bPJpzԨpP @p! + @; X ha +@+`@ ?n@P@[ot"  pz 寨pb: @vX! + @ ?n@h P+@@t @  P  P *  !@0 Y$p<4P$pJA Q +@@+P@ $RQ! 8 +@Ph `+@, zPp}yP+pP*(X p+@R x  P&b @P$SX +@ ?!#$+ph +@X!@ $@X0p s!@|ZP +@$Pp +@ ᝦp$#ʇ @BLP P!@ w phrh X! +@+ @ b7 'P !@ 0P{$@V U   D`Vp V xp\+ Q8 +@P8a +`@P  R!@+P  Q9*!@־(a +`@P6P` +@[oQx (@P$Q +P@P }!!@!@! @0㰾\ +@Qt ( @0 R01, ( 80F@w W y PU B.UP @p41  @㭶 d!0B! @dp "@㵦X h +@+@t% + @ p @ Btx1 [? @qpsr_!B! @d0 ^@pfs@ȀB_<` >/p1 nPZ nP P  9p% P<PP AB/0!@pPP @!@R *B/ @XK 0 @F @ @ VMPT)`[Y p OK @mPrG@mPz  mPu `F[Vy pPPpD @ , [o+@+@+@0A +@@ ?R p +@  kp #@p! + @ X +@p5 Q+0@RQʽ @  @PPs  @ !@    @ LP8  +@ 0Q8 +@Qf[os@ PK  p! 6#@+ @ 0@p! @+ @ 0 [oP[o4  p! 6#@+ @ 0@A-DQ +P@@BqTH )@@Y7!@!0@S%!@O@!@ 0pEb僆` @P8 #@P` 8pPWO-$M p(q` ` 0 @Pp0S$ P PaSKC P 0= = = = = = = = p= = kC P0= = = = = = = = p= = \PBSP GSbSP gS ~!@0 (P`\ ` hp 0Xx 4 hpScQ7VQSVQ"R. ! *@PW L +@P- !@ p` 凼HL Q L! + @ R! !@ p`t$Ѝ 0!@ _!@ 0 !@p` p!@`  0 O-M-]MM1D h +@+@P? P +@P:X +@t +@T S`AP@` 0P P`nUp p 0P P`cUp ԤФD 0QUpp Wp  㲵|e P+`@| @7o 㧵 P+@q -o  +@81 t (@+@+0@P 0P o %x ,< (%(,| (@(@Q !@'L +@Pe @P !@L +@P[ @Q  +P@+@ B0 4 !@L +@P1 @4A )!@L +@P' @4X +@ QU!@L +@P @0 Q *!@L +@P @0Q ڮ(!@L +@P @04 Q!@L +@P  +@@TU3UE3CD @ @ P*0\PB\C0\@( +@PXP2@ U+@ XQ !@X80PP$0 4`@BRFPfLP_ȟpbHpP@0pS0PVT0QTR@P`@80pS0 P`1, !@BL +@P | +@4`a  0Pp8pX +@2ϊ`V @ T!@ h 㰁+@Ѐ pdY4 TQ?Q8T'QQY!Qt (@TYAd@Q3R:m !@L +@PA | +@X +@4K28$`<4 0pT @1<0\@'D00LPx |`!$ 0X 0p!( '᧑x 1\Uta F? h 0A0E HP? |hE_( P2`@ F $   y9!@P R!1R@|E +@@ !@L +@P d +@P x`8@HiP8<@P"` +@xpT` 8q0 0a2!# 0Q0#Q0Sr<8 # @P0hPao 0A@ԁQP 0 0PP*!0gPP0Aaq.W:`AhtP@0 $Q!1Q 0o.0!^ `Ñ!~1AQ1`  0R\b>B boQ"\#Q 0O.@0!.` ` 00 pP0pU0p0 AB06QQAPaqQ!ȁ!!! 0` Q PQY# W1I 0{g!0B@0tgW` p0QPD\@@ !?>1``PTf_nQQ 1 0 `1 S@1 AR> 7g 0P@ \` 1aT܁/ !R!!܁P!! !@7L +@P| +@p @8<$x`I`p!善e0gP18 X? $Um?H$U,0To`P`t0 p`(0@`0L S|尐4? @ 0@ @Qe |U +`@p+P@ 4k$  +@p\ +@+@( +@5 +0@PpH5 4`+0@L 5 x +0@pp(@@u<VPD QTD!h A? ABXD@HE 8`0 ,p B<4q 841 S!` 0PY2 `ɯQPYSQ@/8@p@/U D0QP@SppD? Æ $O0܁PSSP0S4qP DTD4t 0t(@Q H( p0 < T+@@ @+@P ^  FK P1A 3 Q dZ0 pa `Q 9w qSvQ!@ ! P `0+S|U +P@@ 8   !  X/+S,p% !@`0D +@  P05 R+0@\%5 +0@R| | @P 0+@@ @PP p+@e +`@ +@P  0@ @PP p+@  +@jP +@P{hA +@@ r _ 0!@L +@P  +@0RX! + @  `H#@pJPE@T`VA 8 +@P 4 !+@1LX +@ .+0| +@,` +@|>X +@@ q| Q+@ .L+0; P LjX +@ .+0 @+@V.P]H +@P @ PJ +@ iP) !@uP#aTiA, 0A/r"\uW A0 0d/ 0`13 0P#QSS, @X)P@z/PhDXP! + @0 QPPPSppGRpSq,@,@e T+@ `X\p@8<$唦Ϡ\ P0QPPT AX !  @Vaȑ |e +`@4 `@- TAX !/@ |e +`@QE +@@Hi EUR P@ P$aQq`0pt (@P tx R !x  PJ,@P ^TX\`$%R?8 0+@Q@h$l` R/dP !@tL +@P | +@  Pq W |e P+`@U @ P`$P 0lt (@QBddU" @QTT! !U" @QPeXPeVd ! ! !,e@pdta!q! E +@@etd|e +`@8P Z:aUR P@ q0R\  /0 A | +@8@% @4  4 |  F+@8pV*@ 0Q"`P1 !`$$|e +`@8p|e +`@Pf`7 P`h$P 0lt (@Q?dcQTT! !QPEXPETd ! ! !{d`PcVa!UR P@! |e +`@kdcE +@@8pPQ AT㨥 @+@44W* P`!p$W$:T㨥 @+@$Q+pQ( &p0P `  R $ER A@A @PTp@p`pUE +@@:|e R+`@ $5R 1015 % +0@+ @ a AQ.H +@Q U 4 +P@s  !@sL E +@+@@Px pU +P@u 4 +p@d0% + @4%g0P   UZZH +@P  G0x S00# !T P`\u4Wl`P\| @T+@ a/6'\%1T9AR !0p`% d+ @P0 p` 5w pPSQN| ܡ+@P\PV`x 82bPN` +@0p @D+a娕 E +@F+@@ `;4lP`P| a+@AT@AATIA&6#\Q @ 0`08d  h `X9"HFQbܡ V 0SapV@A +@@P| 㨥 +@+@ȑa\| ȑ娥 P+@+@P a+@PS YJ.DIYBf !Y!`@\uƒ2#"@aTiAW P`p0pd ? p`2w0 pP7QWS! w !@P PaP, P +@PF* `,Vu:Y P +@PK eD t +@(@ R P  0 0AP; `I ;Aᄛt (@ RA  (@(@ G@!P4Q@`PLP `@D5Lp0? d?O`A | `_p`l  A (@GE  @*@E @UP!4@'!  | +@@5DuL`0pdP04k4qa`0 0e03 0UQS4 <  0p 09SY` pp@ h ꇚP< +@0 ,AHA +@@ 00aqp`X ?F`p !@TP` XX 0X*F4 0 XPX#,Qp F`pTI ⨥ @@+@`d| +@\%R+!?0OQ? 9d\Tt0` X P tPLf @DuL / jL d9!1+ Qo` A;*A0 AtC!4 @ @DuL +4 5pҙld @ b4 RQS <a O 0CAc`p@#P D +@PP圕 +@4t 0(@Q?.; b*c "A包 4 +@@A*P`V.WVDV:dH +@P T P+@P8A\| +@` PJ dX +@ ?_ 0H |E +@+@@P 4 5|E 0+@@dpHd g4 L6 WQSr 0+@PH +@P 4 0u +p@4 dV +@V4Q(KЍ!@ !@o&%( '~!@!@qnkheb_\YV Sp@-M@P +@P"D `+@P X t +@+@  IX P+@Ā" +@$!  PЍp6d:Y !@ 0w$M-MM@P +@PZTX  +@pW | 5 +@+0@0 42'pX  +@P'h +@ P=| +@T' P*0/, #@ q`V 7Q  QW_`_ `F+@p|' 0KMiq'*0`KH-M@D +@`P P +@P! b'X p+@$% +@ T! ሲP c墨3 !@ 0"X t +@+@ !HЍ`0S Ls s s s 0/)@!@ s0B0B/01//p@-`8 +@KPPBvbt (@PC/DBpO-M|U +P@E +@@0d` p f7 VQScH +@P vU @ QRQU QM | (+@ 0P) @ S` `` o b @R9rUqŏQUtQRu u u u `@1 4G``@Q,`aQ%Q !!@ | +@+@8 _Y0 !@R !@| !@mP Ѝ Sဥ `+@R v v v w  0!@ G 0G !0|E +@@`$P0l a>Gp `@% + @  @P@  ?  0 t (@PLd ` 0P9QS?a\ QTT! B! QPuXPuW&d 0P  ` 9QS?8\먠 %b 0? ဥ +@)\ !?$\A0 P; 4p8@%0 H  8 A ? $ $8A4  4 | +@`8P `?@>p T`@`A0o~ B0"  |% + @`8 PH +@P  | +@`dp g 00o `WQSHO- M| +@E +@@`0dP p e7 UQSH +@P UrP p@ Q !@|lL +@P Ao"R \ A !. 0P 0dP p e7 UQS@% + @ P@,Z : !@0L +@P @؋ 0 Dy?`#"1T9A)%\%R !`Ž?#p2!P`x:\0 d`@ 0d `T036QSp 0ke 0s+`@ [0QS :|E T)+@@ @\Q(x 0pDH +@SQG `(!1pG2/ w( X `1qA3? qX0/x 0wDH +@TQ% @p`p@!p`X`p@@!p@W   iSF-l ,aS>-|E `+@@P 00 ЍO"s pp@-t` P(`@@P =SH +@P 0PppO-MPR @Pq  @ pꨠ pD pЀP `P e D pu (0 c0< C0 $ D8(4 @jP` @ @4 Ap @ I0p吁4  @ @ἁ  @ ᷁  @ᲁ + , @᫁@  @ ᦁhP `Y? z D ᤔp8e D ᝔p4 ^rp) 0( @T!*pT  0 _P  @0 *PP  Iߍ  @ K-M@ P;pP`p @0 P+pW ` 2!ݍ0H-P@ P /P0 @J @0HE @ O-M(`@,P 0CV` 0pCP @h`0P " Z |?P`pUЍA-M`p@R^,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8PP +@UP ZX +@P +@ r R+@ 0b  P#`@pG!Q! pW E +@@P!@dP  , +@ @  X)P@4 PhD㯍ἅ % +@Q+ @PP0P S@RSH  S i [+`@9 X@+@@P$$,PKLPd +庵  +@ +@orE~K +@+@& +@0i #+`@pK 0+@ +%S + @0 @%Bt (W@ P  +" @R*1p71 A W *PP:Pp p PW:P U:0 0( 8(p tWV EkW[  P0  0  YW(P P$P pᗐ$$$pdW:0 0 &(PU: +@P1,P[@p LPdQ P( +@Pg PU_. EUPPW[3:[` P, Q R) !b P Q RO@,P? U "@ !@w !@PP* +@P"   +@Pb[:[ P Q R !b P Q R P0[U  +@PLP \ VOLP  q" W!pq  d0 P808pl! CH0 C(0 CppXqP\ FvP$ 0@P VGU $fV<U*0 UQ*  6$ Sd( ,p':Pw U Q:QP YX h PYXRH* @ i +`@Q 0PR*A!V, 0v <G(P0U0*!!U:= !@! @m0 @us 3Q 5B0:V@Q%P %P@0@},AU1P\  0p'U*$AU $P  0  0ALP `  (@ (@`pV@U 0`N V `#P p l h d&ẗ|)P V0p :,pPF +@P PUI +@@+@& 07 (@V㴰 :,pF `PV1eU  I 0  㴰X pⴰfH` 0F0IULpP`M (@@PPdPplhxG| P+@  0 &+0@@` 0 +@Eo@+bUH&0#H +@Q 0%C0uiߍ (@!@,{!@ ! @!@!@!@O!@ w!@  !@%!@ ;!@ 8#!@ ^!@ }"!@! @0}"!@! @0!@!@!@!@!@!@!@#!@!@!@!@J!@@- +@L(ƞP d Q:Q0 @S RT 0Ad!SRT\  H-MP +@P p+@` +@%G!  PЍXx"!@! @'G-M@ +@PU TS P ,P@pWi +`@ppą +@PO` +@V8  +@+@P P+0+, #@ q`V 7Q  QW@uP  D+@0ۍGO+0~ۍH-MP +@p` +@%G!  oPЍ/!@! @G- +@ ` +`@p SW @ ` p+`@P @  .GPUB@D`Rq@ G K- +@`0FQR vWO:͊PK P 0@  T 0 Q0pW S Q @pa0 pWj`! 0F'6&0U0 A0 @ `% !@" @O-M @+@VplP| W@%:( N@0Qu   0`&q06&0 00A@(`WN*@W P0O7p&!& $&T0f?C7#0( 0 hx0" X pSQ $&?-7 @(@ᒐ(L%P =F P ((|||||| & d 0@ ЍO贏!@4!@ !@ A!@!! @gO-MPR @zPq  @ Tꨠ pD psP `P e D އpu (0 c0< C0 $ D8(4 @NP` @ @4 Ap @ I0ptt4  @t @t  @ t  @t + , @t@  @ thP `Y? z D ሇp8e D ၇p4 QVp) 0( @T!*pT  0 RP  @㯼0 *PP  r<ߍ  @ K-M@ P;pP`p @0 P+pŅW ` 2!ݍO-MMAn@Ph 0@!@ VPP`P``R`0 !@P `T$0 QP #S!  @ 8  P3Z8 W p RT: R5TP3 !@ A!@!@Tg!@ !@ #!@ @- !@o# @( !@ !@!@ vލЍ !@#! @ S  !@i 0 !@ bXQ !@\TPQ  !@U !@QT & !@KH. D !@ 0EU D !@?T|AM 8 !@5^ !@2$@T #@@o P@Q(e !@%Q@TP LQd T~X \ \X``\  @$pDPt  @CI< `Q 1 W`S0 !04 0@` aQ0R!@Y 0W00T@VAR `$pFo,r P c /oL0"d 4 &$`8 ,x ( t p ,l ( d `% %%| , (  D H   X    \z@PA\ )@$ ,@Pd A9D!@$! 0@$ ,@ @pP  @Z3@Z <T3P  Q ( +|p PTP   HXZ@ $P /P Z$#"!|DH   $ PP` @321x/t.p-8,(l'd&`%0p$p)Ph`gfF P`@h !l'0)@ PU `0P P`%`PP@ B rMP0&! @I0pW p@pQ`TPP\p 0S 00PP #@T :U WA Z:Z* JCQL ZP  )@0S 0 0 0p#p00KA q0 (0 00?O$(@ 1@/? Z P 4ZU @rAFRaDnLPi: *a/!`%>r#h"""B{"Bp@{"B""p@{p{*c!`r#h"2"B;"Bp@0@;"B""0@;0;*b!`r#h"""B+"B0@  @+"B""  @+  +*a`ph  " "  @ @ " @@Q A  tzp P  Z+ $!@T$fZ $!@T,_9 ,!@ *c  $ ,@/O-M-MpD`C {( p,@ {, p,@}!@+mzp !@zzp!@$K8!@@0@ ၠC@4Q(  h , T |   @  d 8 D L 0 ,@<}p <,@ P9@ 40 ,@0@  ` !@, @P<0P@ 彰<PzڼZ 8 ,@8 ,@m)@@8 }0 ,@P<0P@ 噰<QP4 ,@>P<0P@*@ <,@ P@  ` U0 ,@{@L 0@,@P<0P@ 婐<P X 9:P<0P@ Y<QpH ,@ '0 ,@K0 ,@F0 ,@A0 ,@<0 ,@70 ,@20 ,@@0+0 ,@0@ + P # @, @0 P<0P@ <QPPC 0 ,@0 ,@ M!@pS@@ 0 ,@@,@ @ Pm a  P _yPp a ZWyPrH ,@POyPo QY@P<0 AP ` x-@@ -@ `  PP 0@ ,@@Pt !@H4 ,@ Q8! QJG)@PG  !@' k!@#!@q !@ !@+S!@c`RMb@A !@ /!@{Gz?eA !@O!@JN!@E!@@2!@;GQx`  0  ,`@!@,0@ 0PPZP ` f,@ @ ,@@!z 8,@[Z``Z` P0 ,@P @q ,@@,p@`j{ P,@!@ @  V) ,@D``Z!L@ ,@@0S)@X6 <!@ V =r,@0 J-@-f D0wB@kKv"P"\P E8@ ! ,@@(` p- @,`@ D0 xp !@㕮,P ,P@ D0 xp !@ㄮ D0 xp !@u D0 xp !@f0 A ,@-@@ -@   0 '  x , @0  0 (  'c Q ,@-P@@( <-@6D0p pxp!@G` , @P@ ,@@ 0  ,@CPp )0U"  p   0 p  0 expd!@)@ 00 * 00SQ# !Q!H@ 8 400 (,00 0`,Pb 0 `PbBv0 @!@(0P4 @!@(0P* @!@(0uP  @!@ p 4 !@>!@ @# -@I /10!@=!@K!@p!@  !@-@@pp Y:Q Q Q$W!@pQ Q@PIT** P pI@WT@T"* p W, H 0  p p!@mW*D@f[!@Ax `D-@V -@ mPZ x -@ ` -@0b [-`@ !@&!@ !@YjIp T6:@`P@`XXX  U@DI T :KI T* p p`P@`XXX a 3@DI TIYK b [-`@ !@DH W `P@` XX "4 ,@-@X 2X4 ,@-@/X -@(R -P@pPqP0 ,@  j@M ` R P`?" 1 A- @  B* 0 h -@* ( @ -@b -`@+ p+!xb  -@ C(@CM@ -@ `Ͷ @/0 RU * X - @-@  -@Ww ,@Ϩ H 0  p  -@ BP (P -@PX0 ,@  -@!@I -@P E0 ,@ 7k!@O9!@L!@E!@B!@?p!@=!@6!@33!@0L!@-f!@*|!@'!@$!@!!@!@!@ -@@!@PUp  (@@ODqPU0 , @  p Dqp0!@0 ,@KU S(@S@Q0 ,@P,+ H 0  p p ,@p QX0 ,@S  ,@,@` G@DPC ! WP, @ PDPPWPZ, H 0  p  ! ,@, @`0ED !@ b ,@pP ,@-`@U !@ @{ P,@b -`@ p|!@N!@GA-@<\r -p@h)`@Q`" d - @-@P0P.P`p P0@P`0X X PX.~Q q`" d - @-@P0PPC`p P0@P`0X X PX]pT `B -@@P `P@`XX X Cd -@X-- -@ `h -@ @;@-@=;DX -@P@ K--@@`pu0 ,@)1!@ 0(PX O!@U!@@  ] h!@0+S  X)@Kȇ@@A--0M@<T k !@,@ B -@@!@XR -P@!@j -`@Q !@P P!@| @ ` !@ 0+So 3Qr 0p ",p@ @k    -@* R +` -@+`;Kq+t++ (@ R;@ -@ `;c3+SK ;d!@b; 6;  -@H  " - @P` 2 B* 1 A졛0H -@  * - @P`~  B* 1 A졋0@6!@@ +`` 0+S0ЍY@@@eA-C6?H-M0P0  -@!@S!@ЍH-@0 ,@,\ `" -@- @ 0#JHb 0-`@  h -@R(  B* 1 A pa  a d -@P@dtH<eA?333333?G-0 `,@P@p @( Q#<Qʨ -@Q W-@Z @ @G* !@- @dH-0@ `,@@p P\U U U 0/ 1!@ Q  b/r!@H8/pr M!@0/,1!@H"0H-M@0 ,@ 㲏P PYs% ! @-@0Ѝ0MT%0 ! @-@Ѝ0HO-M@ !@ Qᾐ`pD` {*!@ 0៖!@ !@ 0!@ @V: pPW *Aa!@@V`FW:ЍO- M`pL9@-Q @!@5P -@ !@5P -@W!P@@ l@Q , L  L   L L L L  L  L  dP -@P p)@P- qWo`` P`=3`PoW Pដ*3p W@mPZ T?`PlnP`h `@ -@P !@ }!@%}T !@ -l!@ -@P!@ }!@!@ }Xy !@ }xaV !p@#`@!P@ ~ 0~Yk888 88 8kp!@kp\8PYjk kp @T  kpA8P A!@ +!@W!@ k~!@@.8@qkp!@P*}0"@ A!@ 09}@-  -@F #@!@@Q@7 )@!@0O-MMP?`f @pP!@OP@@T -@k @U-P xFP\ D !p@0@!@@-P@-@  s MP!bBP4# p# # X! H# X! # " X! X! X! T# X! X! X! X! " # " # `# X! " # 0Sn DR MRP/  P-@ < -@NR@ RR ( -@ A̡X, - @QP  (@ 4 -@, -@0 -@ (@A 㧡+ ( @QP\ -@8 -@}@ -@ymP 1mPkJ!@] P @`bAP P- l1mP - Q Z-@rP!@& s!@ -!@%> !@Ђ9)@@@ -@QtP\ -@ @z6 PPt6 @pFo6Pj6H)@@~ ` -@| @cW p(@)qPOrPe tP xP OL |@-@ @+T)P %` (@P ]& 0!pWC 0 -@P _ !@ !@ !@!@Z rRP[ iP  EQ@arqh -@ 4 -@RIP X0!@ @'!@} L4 -@P  X0!@ /'| @0 "@ DCc R@ P@++(  0PpWOH!@@r% 5 ?P  X0!@ &4 4 -@P 3 X0!@ &| @0 "@p!@ Z   0 -@P 4 -@P O X0!@ &  @0 "@Q!@pᨾ0H-5@)@Po !@!@ !@ s!@ !@ ᆾO-MM| N @ @  D  @  @  @  "@: `)@p!@-@` -@uJ^P@ P LLH @-@@  -@ P ,P D -@@ Q/R;D"5뢏` t P!@-`@-p@  @2 x'    Q J^P@Be/@P Q Q @ԌQ:  :/`-@! @ p:*؀ >@" @ @@ 0p2,J>P!@u u uk "@ !@  p:!@`, : p!@`"!@!@!@ 0% J^P  ,@  P LMa@QD -@,/ l6 40 0 0 l6 l6 H1 l6 l6 l6 X2 l6 l6 l6 5 d5 l6 5 l6 l6 5 6 D6 @. #@20P+'P %@JL -@ (@P 0$| @  0 :!@ ?P-@c DPP.  !@0P0\ -P@P !@r@. #@/P& *P`J.!@0@q.2 !@/PlPzu!@ P[. @/PV =0 -@P H -@@@C.d !@/P> !@, !@<$.!@! @(M!@!0@,d!@0!@4!@8!@<!@!@'!@s!@ I!@k!@!@!@!@㾿O@- "@g/P] P[ P0 -@P  -@ @1K 4 -@PPD JN P P @ `P jP J^ `P(!@ %@ h@r#" @0_P Plf o `\P`0 -@P  -@ @1 4 -@PP P "@.P !@.P PP\0  P A!@ ! +  `Ph P@O-k !@.PJPL  @@<- !@6@4- !@.P/ wP'- @.P"4\ -P@P) !@ 0#@`@- !@x.P T@-R !@l.Pr  ᴾE!@ 0#>!@J 6  @, .'!@ 0#$ؐ },`,@ PP",  !@ 0j#sP` : V!@-@c l@2 0@!hV`T0 L XPPH@0P ` S` ^ P0T 0003S@ PH 10Y :/oHL2/oP`PT"X@4\ -P@ "0$ 0S|@ QL LL4 Q0 Q  ' ^~lOn 0@xQ -QT@t@pPPx`xdpPm 㘶 4 -@Q ~x !@Ƚ d PQ A  QC PA   NPQ A  Q. P,   |P#* PtP*t@AP @PѸ ڰP@TpPX }[: !@P-@ @P:@D }m`@0` (ЍۍK-P P& 4l 0| Ȑ -`@-p@-@@QQ Q  0B01z P p-@0 0 pJ0H-P @P 0 -@Q  - @0 A!2 4 -@QP @ P0G- "@`P,P h @ ,P /P.. +p+PR* ~ Q 0/S/Q Q P/R@P7 څI@!@ P  B0QS/SrpD0.S `FQ G,P@@ET@EPP/Q@@@ QAPp#)@0` !@m!YH-D -@iP -@P!@*#PF -@vA-@ R R  `)@P!`@!@!R"R'Rp?oQQ2 QQop2S +R R R  \RpQ  " 0!A-P@   pW 4 /-@) @`?0V`p`p 0`pW@0 -@ Q  -@ @1 _ P* ^ R\B xB B B \B B B B B B B B xB B B  P /= # ])@!@⫻ @%A-Mp -@B`+ ( @P 0 4 -@@)@P 4)! @Q!@XLX!@ 0pyUPЍK-pM (@B@ -@` 0! &PD -@iP4 -@PF  㐐(@P ! @d`P=Y  0 10 -@P, )@!@X 6$Z P p *P  0" P  0 PYT@pЍ@-  B-@; (0@@0 1 P  R  T@O-M4\ -P@)@P X0!@  p P-p@# @P X0!@ Ȑ P-@`A 1 0"   V@Р -@P8:0 X`݀@P-@-@!@ P$ p -@E 0P V ᎺP  $ppWP@U:ЍO- M -@PBa @T6P `P!@ pVPpp z `P PP P`PV W aJ 0 -@P  )@X!@,JP@0  P P PUI dL J J pJ `I J K 4L 4L ,I |I ,I `I ,I |I ; )@-@ !@0W  QA!@@P * `V )@!@ ԹZu B 0 -@pQ 0 -@Pi H |-@@I Dppp'8#@ p!@@)@X0 -@pQ H |-@@I DPPP'| NDFD@'8#@ P@)@ XWD z  0d @ZN0 -@pQ IP5 0)@2!@ Hpxy  -@!@Z 04 @ZLIj!@pp\Zp0 -@PP @ 0 0 @-@pQ> ?f -@)@ XX!@. C  -@ 0`$ @ 0 @0 -@pQ 6)@ -@X %!@0͸ Ѝ0H-PH |-@@I D '| NEAE@ &| NDFD@ &8#@ @0&H#@ @0O-M4 -@P)@ X0!@ Р -@P4:0 8)@X`@P-@!@PQP@U:  E-@ 1 pW P P  OqZ p -@PU& 0l 8V)@X@-`@!@!@ pW PP  sP  &H1 p$PUЍH-4 -@P  )@X0n !@ X -P@@T `p P $p$ `@TV -@@TR!P@/$@TO-MD 4 -@-@RQ P ")@X0 !@P )@X0 !@H -@ t а p -@-@P` Rf*H -@!@)@@!@P` U *pP  0=X  ᐷ %0&  pP(!@%> !@  1>!@ 0`~H -@P H -@ R:ЍO-M4 -@P )@X0V !@:p -@Y` -@PPkpM@`GP \pP P:H\ )@-P@0  P  *`mZ:gS*P* P Yq R0  RM`!`@ T *P}  !@϶@ T$(P:P[ v Q@` p P`@   p P t*ЍG-MM4l XP-`@)P@ @P oX0!@ j +2@TP ~X0!@  UР -@P':P sP `pV  {@T@ `PU:ЍۍA-4 -@P )@X0 !@Ѐ -@P8c@P!`@3P p RFP @pWP@U:H-P`ptP! @o"@/o"PPoR  !@0|RPP !@)@!@ µPO-cM@4 -@P )@X0 !@؀ T| -@-p@$0! @ (@㖴Dl -`@ rP  (@ @㮵[ 0,$(P@! @〴.p  @( P-@ T( $0! @ (@i rP  (@ @ヵO 0$(@@! @Up  @o, P-@ p| -p@!@P @$/   PJ8 (8-@ 0 -@Pc`P!@@/0 , @ -@-@0aS0+ $ C  4<D  ( -@p]ύJ`8 @h8 (A-@,QX8HPUL@- @ @ @D < -@0P@ -@ [eP P:0 -@!@ P H  P P"+4 P-@ (m )@!@㯴, -@P P (@SPcߍ!@cߍOC (@ (@a!@a!@@!@+ ( @@!@/ ( @O-CM@, -@PP' UP`p㰐Y A' -@P y Jy" px@T:cUa ㈟ 4 )@X`-@-@ pP 0 -@PP P `[:P-P !@ 0 P !@ 0  0SP !@P [t Z:P CߍH-,( - @0S P (@,A-@8h < -`@p @X -@ P-P@ ( -@ 0aP  pp p (@H-M !@㶑'P T D-@c8 !@!@)@!0@╳@- (@@Zp ` ^P p@`ZЀ@-pL -@@   PO- MM`@P/0 @ -@qW !  p0 01/ Ѝۍ0 01/P #" @ 03 !4 -@P _@P)@  "@"P !@ $w@T !@"P !@ f@` 0PT @ఐ`0 PC !@  $ 00 x 9`@ 0$@T`p@-M@P` 0@P `Fv)@!@ ἲ ?e`V +YЍpO-MP `0 )@㰠-@Q +YP/Q!!R 0KS p@T"@<"P$ -@T:P  !@ npP y !@c pP `!@ 0VpЍO- MM@wD/Q "@pPp@PC ӽ@< 4 `PbA/-0@-@"@ !R`P/ # "  Ga PoP pU !P apP  PPpP @@< /P-0@p ЍۍH-P /0`@ @ -@qW !  p@G@ @-@'Y@%bO-Mp4 -@H)@@P X0!@& Dl -`@ rP  T, -@- @0$ (@! @㞰 (@#P!@I0!@)  (@!@㮱, P-@ `MY0 P` @@( p)@@  xPU T TaxP[P@@0T q@  ᾰ@ $sxPiPZV P@N $ L -@PFZ @ -@P9p lP Xh Xx0ST '!@! @ 0 $0!@   Y VP -@P h0t a "@t X0` T@o K !@(@ )@0e !@T+aЍ$i@& !@ư1/ !@( @)!@ 0ЍO !@(@Ž!@K !@(@㹎!@ P 0!@ 0K-MMP@`/0p?@ -@P # " ( !@0P&p!Wp*4H -@@ X@PT@ `-@ Tp{ Wp& P qWp0 KTWW)@@!@ D?$Cir !@:Ѝۍp R-@!@ P)@@*'$+i} !@p R-@!@ P)@@$i| !@p@-/0@P`@ -@P # " `Vp@-x  (@#P O (@@0r}X (@#PK (@@0r@oXp@-`@ P-@V* -@ ?r -@P # " $@pp@-P` -@U: !@0K -@ ?K -@0P  " , $P 0@0#@$0$0 $  p !@0p@G-M@ -@PP/: -@P ? -@qW!   $p P@`@`TV/VPW P pV pWPۍO-M0 P-0@ Ѐ; K -@-0@-@@ `@p/@DZX:? P " $ U d P-@ T!@ЍO-M (-p@@PT` -@@Y`P !@@@(@V($@@Q`(@A$P $ A BZP `/n  ` @( D  P Y !@Z 7( ' -@P%: -@ ?N -@P " $ PP> !@2 @% !@('@ QЍA-/@/P PpPP `P !@PPO-MP !@  q-@`P` -@X@P !@  BT0aPU@ ЍOsH-`@p -@V:  !@0 -@ ? 0 -@-@`1Q$0A$@T [!P@! 8$@Tp@-@P j!@+P P }!@! P !@` " PP!@ U U PUP` R !@P -@ / P- @0@$0p R /R  R/!@@-@ -@ @p@-@P`P!@V  ` @/`P -@P `o pO-tM@4 -@PP )@X0  !@:@ -@PtЍ  @PHP +!/f )@&!@$' !@ -@@`P @`8P p 0@ p@W -@P`[*P; H `  P* p |||| 0 Qd QH` \  Qh$Ql(pW -@`P V *P` -@0 P{ D@`-p@0  0QD`V -@0`P X| -@-p@h -@@@ 0p0 `P8ps@ o se )@T!@h` !@  tЍOoK-MP4 -@)@P X0!@ NUa  S`p D He' !@? !@Tp 3 7e !@. !@x0p@CZ@P !@ ᠐SSPJ0 MSp  e} !@ 9 !@PZSD -@RQ0 rQEh, - @ `!P `@ Pw[ 0!@v  -@0 -@Y P-@ !@  "@0Ѝhl -`@ ( -@-@ p Q-@ O !@Z ` -`@  (A -@0{ C-p@RqWqqq R( R*0pS`1pp100qSq1p10 0S11 0$0S11$0( u 0!@ q]0H-LG P#@@!@cP P@0H-( @X -@-@1 Q-0@  M` x-`@)p@:pP P -@@P)'h @P @!@FP)-dP$0!@ @!, "@!@3P  -@P -@Hup d,-0!@" @p@-S @(P@X -@@Qpe -`@P K[UP @p&)@0*  !@ΧG-M4 -@P  )@X0Q  !@A -@@-@P  -@   p(@ʾc0)@! #@- @P  (@H -@X\ ( -@-P@ -@ 00/ Q-@0 `%`V P   %(@Q P "%-@ P I)@!@XlL -@@P ,\ -@-P@6 p-0@ A ` B-@  F P &)@0  !@EP , k*-@ -@Q!T)A  1  R) @BPD -@tP =h| -p@ - @ "@Rp?ڈ  B? P$ (@ B? PBL -@@P0 -@P  -@)@ X!@ !@ZP. -@@ -@@ -@PЍ -@ Qb )@!@)@!@!)@0 !@")@09 !@b )@!@㮩 )@$6!@!0@㣩)@0r !@ ᄦH-M (@P) H -@Q$ -@Q!@ -@ P  ЍH~  (@H 0Rp mqb )@!@fЍ))@0o !@ZFO-LMM@(}⟀9, -@<P' LP PP- d`k Vx L8X h04(P堐t`PT$\lPTAP( P"  `-@,pP 8`808h>8 2/ 0`3?A6o5_7<ϿL + h&0p P4آ2/3?70<` 06o؄ 89<`# #,8|Ѐ0<i1xS6o7 5_02/ |i3?xS 8`0p (-p@ `"p!phl -`@@ p'`$p1 $@\ !@# -@u !@0 -@P  X-@ !@ 0!@  H< -0@ !@0 0L -@-@@  -@` V  0-@ X!@(P-p -@PH -@Ps!@w o(P  PP(@xPEU -@b$ -@QV  -@ё`Z$ V -@pG V@Q 6 @!0@T0!@ ᑣTPG(@APEUʩ -@P`P(@3PEUʛ  (@P/A -@Q Jp@-j p\ -`@-P@P QP &6!@!@㣢@ @`C- @!@@P P@p -@kO- M A -@-@@pe -`@Q 00X -@)@P-@XQ0 U0SO W-@@u -@P    (@ FJQ [Xڦ R[ 0 -@Q 0 !@ [Q[ Qz  pGW{P)@pO !@0p -@P P P}!@p -@!@P ῢ p -@!@ ᷢf!@ 08 -@P!@t Pu   -@P  P Z]  (@?  pR [+4 -@P 0!@ |P1H P-@P pA -@@Q=.4 -@Q 5* !@_+! - @+ & -@- @0 Ѝ %*!@ -@+n59[ !@0O-Mp -@4@0p $,PLPP(`P<8H`@0P@ @(p 0, 0DIpP  @  P`@p | \ | \ | \ \  \ 0 4 -@P )@!@X @ -@Pg\ P-@P sJ Z?Ip  wIwIZ @@ P @ @   0 @t4 -@P <)@!@X ᫡@ -@P*\ -@P 7JIpn  >I>IZ P@@ P @ @   0@ Pd})@!@ 0\ (@P P  !@ 4 -@P )@!@X W\ -@P I@ -@P-H p-@ < -@-@PP@ ( -@1/_ -P@ `H pH OP . @D @ @ @|Z 0< -@P [  ( -@2/P pQ)@X@!P@`0 pW@ `-@P_ @-P@P wH8tHP -@P @"@0  @O -@@-@ P (  @ @ @P[ \ @-@P MI -@ `PU 8  (H(HZ 0|P -@P p#@ 04 -@P )@!@X {@ @ `c4 -@P )@!@X f ЍO4 `-@PL )@!@X TDPTY0)@!@0@ @ P ᑎ8ᎎP -@PO n  "@"@ Up@A(,Y0)@M!@"Y0)@n!@ @ @ l`ЍG]GG@ @ WU J8GP -@P ip!@@ 0oGkp -@@ @ 4p@-Mo @-`@ -@ P *P  -@PTJP -@UP @ -@Pp P-@P )@P !4!@!0@ P奟ЍpO-,MML  -@@A"A `Phpb~!@/TAP !@'j -`@P A" PA 0" p)@XP`P Q $ (@ QHQ A (2/pA P$ (@P&Q A (2/pA q A"@9/pA"@9/pA  pAAA P0 pA OPPPA 0"p `PV |.Q A (2/pA"9/p@Q 0 -@Q  !@㹞Q Q f ERPNPA PP9 0 -@P p  -@-@0P !@厞Pp -@P!@,z -p@Py P P`+Q -@ -@qP ,ЍۍH-M/ 0- @ P -@ЍHdp -@P )@0; !@-0@B,H-o @ -`@-@PpW8!@p  -@\pH-p -@!@P )@O-EM4 -@@P P)@ X!@ T 8)@F`Xp @@P PPz 0 ߜP  (@0`!!@ޝX X) X 0B  B   0E!! @& 0B  B   0E!! @ 0B  B   0E!! @p 0 -@P !@㒝P !@ P Y!@ P P m!@ 0u Yw:bX X& Xf jQ1"! @$X( X1 XV ZQ1"! @/   QL"! @   #Q<"! @pP   PL"! @   Q<"! @p0 -@P  !!@Y! @ !@P )@X l]Eߍq/p@-MP< -@@P  -@ 0( -@3/@ -@P -@ Dp Ѝpp -@@P`U)@R!@ 0`Мẙp@-M@< -@P   -@0( -@3/@ -@P  -@ 0p Ѝpp -@@P`U)@!@ 0`噜კH-\ pl @M -P@-`@p @@PP p MH-M )@  IЍH Ѝ/{Jh|.0H-M -@Q  13?  Q P *b Qb` 0 @R p -@!@@P)@0<Ѝ0K-M/@/P Pp/P Pp`P 0`PЍ0H-PP !@L@@ -@PDp 4 -@P0)@!@X 0H@T0)@!@ 0Hߛ0H-M@  2!@  P3a>a -@m }ۍ00H-@)@P u!@ᱛs !@᪛l !@ᣛP c !@᚛ P Z !@ᑛP Q !@ማ$P H !@ # @Q! @ !@t !@o-@ !@0H p@-MP@P`P ``PPPR!@O b(k8-@@ ! @!0@`6Ѝp0H-MP@ -@@PBp4 -@P )@!@X 0Ѝ0H"#T)@r!@ 0Ѝ0@-@P !@O P !@H @@ -@PBp 4 -@P)@!@X @S0)@!@ @ۚ@-@P "!@ @@ -@P\Cp 4 -@P9)@!@X @赚S0)@!@ @詚H-M`@PR@ -@PBpʕS)@I!@.V@ -@PBp4 p-@P )!@! @V )@!@X0Pn !@ eiS)@z!@ 0\pЍ MH-M )@  8 -@P#@P ЍH Ѝ/8 !@P  0H-P@ -@P 0@"Bp 4 @-@P  )@!@X  S0)@!@ 0@-@P !!@D @@ -@P[Ap 4 -@Pa)@!@X @ R0)@9!@ @יp@-` @-`@PU *PQP@ p0H-PP@:PQPU@u: @P0p@-PC|-@@ID``` X#@ `@  h#@ @ x#@ @ | EE | EDP@ #@ @p0H-@PPP !)@!@ A0  @-@0P 1A-@㓌p )@P @-p@ &lQ A  sp` V Q A  d P   nV yVG-MP4P 0@`p.P-@P/P 0h @ B!@ 0Fp`@٘YF 0g !@ F !@@0o @K !@ "@@ v!@ ὘@K "@@ }!@ ᴘ@K "@@ !@ ᫘@K "@@ !@ ᢘ@K "@@ !@ ᙘ@K "@@ !@ ᐘ X@Ѝa!@ᮥA-MgP-`@  @ 봇-@P -@_"@ @tP $@BP-@ ڲP| P@@+P0 Q /0) @  qpW`Jpp_Q-QY0Q0,! @ -@ kgP-`@HU;JX *-@ Q% r  0p p@p @  P@  0pu@PJP 0p pk@@ 0pb@ 0pZ@PЍ" !@W˔G#@!@ !@H-!@A-BM`P@+! @0᱖-@ BߍH-P-@@p` >pWHS@-G-@@P !@!@ H- MP+0@! @u @ PP w`-p@ E>P`U ЍA- M`@+! @0PW-P@p n> j> "@ ЍAA-BM`@PYE@Q*RV  !@@, @FQ -@ APwBލ@_PP Q@8 !@;@-XM@+0! @P  @ HXЍQC/Ap@-BM@+0! @ !@ 4BߍpA-MQw`P-p@@ >P Q `F@Vm !@D !@@ЍH-P N !@V  )@b7 !@#0@㬖ᖓO-LMPg ܧw@P#`@-@-p@ 7dcPRPSP TPn@QT -@LP"-@fP dP-@-@-@-@-@-@pm)@`?-@-@-@P , "@ ~= " > 0)>p "@:tpFPE@TP Y@ QX    -@P   S<"D D$D(D`,D@0 Dp4DX-@8  RZ VT WP+!@-@P   pLЍ)P /P  -@-@7-0@ 0   p -@00 gP =U-@f !`@p ` P``E@-P5 -@  P @P@-@PB ""@!@! @X#@*P@-@PB ""@!@! @6U`F@PO0@3S `pBI $ $ , $ 8 $ d | $   $ $   $ $ 0 8 t $ $ $ $ $ $ $ $  pRG 0A@ S3` , @ T h |  -@< 0 p@I @< 0Ip@` 0 Ip@ Q Q -@o|ypR < 0 pR  0pR  0'- @LpR  0 pR  0   (@ 6 (@ 0-@-@ +pR  0 `-@f'pR  Z (@ "(- @G `8 -@@ -@0 -@8  -@  -@( -@@hHX-@@`-P@-@P0``` XS-P@`   PR!`Wxf !`@ ``-@% aQ% -@-@PQ! Qo/op0"p0Wp-@`$p  PP@P aT gTb cT+- @-@P(-@P  Pwh-@ / (@AP @R p-@ `Q  PQU1AU0u QU  -@Px$ `x@@Ppp -@P p-@P!@-@Pp  @P @@ t-@P -@P!@-@PW-P@( @P @@ SW-@-P@P -@P(!@-@ , @P @@ 3-@P -@P,!@-@ 4 @P @@ -@P -@P4!@{-@  0 @P @@ -@P -@P0!@]-@-@ `KQ` P-@P () @`P@`XX X  p-@@P  9p7P |P `7P Pv!@P`-!@ i`!@!@hKy!@9R]3P-@P nSp@P-@P p@P <P RfgPD -@P?5P/$!@" @P 0 x "@qP m!@jX3$-@P TU 7U Uv!@$q!@N  i!@!@K!@? NB$LB(JB,HB0FB4DB8BB `p@#"@!@7!@U!@ 0H-0S @(P@P 0S (P@zPP0 O-4Mp-@`P-@@P,P9,0!  `00 P BP $PIp0P <P P00 Ip0-@P ;!@kP d!@㲐0pPz U^*` P, R  PyP-@P `V:@x  X8p87P 2QH -@ PP Q-@ /!@a0-@ @P   !@Q "@\AP 7P Pv!@i!@!@Iy!@Pp4Ѝ!@,!@  @B!@"O-\MM@-@P Q ,@ 0  #@!@!@\ЍۍO!@!@@P T 0(!@ҏ\P:( # @㺅)@X`!W!@(w #p@ 㨅!`!@㱏  㛅! x@ !@㟏7 !#0@\P/ \) #@P# @0P ~)@X!  !7!@くQ3 Q5 !@0& !@! @s\P( # @[)@Xa!\Ѝۍ7!@[dAP4 p | I!@V!@Ga"!@C]"!@?F!@ S!@ n!@ @2 `!@- Q_!@\ЍۍO8j@Q:g@P3;89 :0?@ABDPE @X!@$P(p4jP8 !@ \ЍۍO襎{!@܎ s!@׎ O-DMMQ `J!@Pˎ@) # @P峄x)p@X `P@`XX  p5 0W 0W a z0BR000`p WWQA-@-P@"p@ aVC [X Z Z/C^hXPTuW !p@-P@4n Q0 ."p@A~hX4WQ "p@-P@  .0[T%0 .! @ B [H)@@`P@`XX X nX.DЍۍO-M@-@p` V(@` `-@  GQ L p x W W` ` @`fP; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P  p | p l l "Pp p P@ P:2WW``/ i* Y /-P3 W1`-@P ͭp"`W -@0`Up @`Ѝ p 0  zЍOA/` P W-@P ᖭp6P YXP  1 m`P9`W  >z!@*!@ p@-@`5P-@ R-@!PU e0 Eop!@֚!@ КH-P-@0000 P<P<OP<P<3?>0 0ASR   7S86S80 S :S40 S44 ? O00H-P@U U l !@Ci !@ቌ0-!@ ၌)@X0H}O-dM p4"0<0(8P, $$0pmEp<P 7P <0$ \Ep&<@!@ Tn@ p@Q^WyQZY W y(@Q  (@{4 !@ !@!0@ !@ xp2 0`CS`0``p01 P@pP% H0 ``bD 0`\h @!@ () @`P@`XX X @ T:<&!@ dЍ,!@ᴙᰙl!@᫙H-M!@ 4!@ !@ !0@  㵋ЍP P Q !@!@!@@㡋!@㞋0H-P@Q  _0t r@ 0H臋T!@0H肋F@ 0H|p@-M@ -@PQk-`@ߦP  .-@P  -@,P `V VO -@ @,Ѝp@q $-@! @ -@0 -@Ѝp@-M@T T Ѝ@Uq $-@! @ -@0ˊ -@ЍH-(M  0#@ 000S  Q:!@(Ѝp@-MP  UP @P.}P `-@_P@T(k@E @@\-P@,rЍp@-Q R  RR@g@xg RL0%-@@! @ep@--@Q @5  A!0@.@R$B@@@@@P`@ BU: -@p0H-M@Q P5_5Uo P`P4O T 4PQ U  $P$<-@! @$ @ ,-@UPT$ $<-@! @TT$<U$! -@! @t % $-@! @ -@Ѝ0H-M00ЍH-M  0ЍO-M`P!,5E@!@@Pp-Q#P P PZPP@GQ *5E!@@P(PP@Ѝp@@-M@ 0 0 0?=  0@ Ѝ@nO- MP@{c3PXOe$48~<!`@-@-@-p@-@ -Xb@Q!                $      4  < 0@-@DP*-@-@-@(-@,-@ -@0-@DC< !@\p )@P>0-0@-@0 SQR0> -0@ >-0@0S ,>-0@0S ]!@ISQ   -@#@ #@R|!@IB h!@0BPBH"- @000P"- @@T' h @PP ={-@` #pGW:PV `@` `@T =-@H-@ @-@!@ P[ +P=)@ `Hr>A-p@@0P-@e!@݈RXBP-@@N13P @ c1-@PLPH pM!@Aa@)p@PpQJ :PP@PP!@O vP@ Pz    |  T  8  Qk@R@> 1#@ JBv!@p=n-`@@s)@PF HPP Q UP:P@Q= -@<d TO !@@!@ !@!@~wP"- @ r Hr-p@Pqʉ!@H- )@!@㸈ᢅpC-HBP-@@ЀKx2ЀP Pj @H#`@ #@ @X`@T @ 0P IEUPKpP`0H-E!@@ 1hU P@m//P0H" !@@v/P-@#  o/!@ j/=^-P@ b/0H/G-MM`\-@P`r-p@Q @& 6! @!0@  @O}P @X-@`&㺆 0 0pp! @!@ !@YVP-@ףg !@% 6 !@!0@A:<V v<&> 0@!@0* W !!@!@ 0@-@ R =-@0d-@uPP @cs~@ܘYЍۍH-XM0~$n-p@-`@P F!@@P -@Q G!@@ A!@#@@P@X-@!@0=-@ @!@(-@P$!@-@P @!@m/.PJJ !@P..dTb'-P@! @Q0bPH!@bV) !@㏅P@ %- @0@/UP ep-`@P  5 0UpPb X X ap@ pGW -@@T@DЍ P!@`T-@!@ XH-(M !@$5!@!0@ !@!@)@5!@!0@  O-TMME-@@<04 GP(H0-@@D?U,@`LceH P[ ⺆  RH }LP`!@"@"@@V 00 `[4xdZ8(W v V!p@ 8@T5 D/(0@TH0" @< R( "0@T L0" @<-@P (@Zf-@P (@Z+ D-@@P[ XQ( 8PV XP:-@P!@-@ɃXQ/!@u[  <(@V|T) [pW/@[= P;8E> (<p2 PP/-@-@e -@P` !@-@㋃Z-@PT (!@-@〃U`V 8 <(0 ( -@-@6/>PKQ:  & & @' ' ' ( 8` s8@-@T P 4@.P `p@0   I<pN4  P@.`pP] ((!@-@- @)KP L "@! h" <" H" T" `" g  !@ @#} !@ @ !@!@!!@(!@g !@@ !@〿P-@@p@pH -@@!@,R-!@,M@{ @"p@ppP X-P@,A6!@,<@{ @"p@< X-P@,0@!@,+@{ @"p@  X-P@, I!@,@{ @@"p@  X-P@,Q!@,  @{ @@"p@  X-P@,[!@, @{ @@"p@  X-P@,c!@,@{ @@"p@  X-P@,m!@,@{ @@"p@  X-P@,!@, @{ @@"p@  X-P@,q!@, @{ @@"p@  X-P@,{!@,@{ @@"p@ X-P@, "@,@{ @@"p@T @P  @ 0ὁH-@@,w,s (!@- @ HQ !@( !@ 㺁X(@ 8E>@@@:py @ -@ 0L8`@@(p E>PP PP:pP P4-@  Pm8P@ (E>@@@:pP @ -@ 0#-@P8(G E>   :p< P$-@0I(@ 8E>@@@:p+ @ -@ 0@a0r !@㍁PYW_ 8 ` 7 PP,P @E> x:pY:P (@%!@- @1@@J@T) h2&4\9`24-@pPp d-`@8( !   QQ 0"  4p`@W:0,TЍۍ-@-@ -@P !@@0$  ^.8p<P A pW:<(Q P 40;,40P $  j40 $<X 0 S-: -@!@w~O-MMp-@=RP @T`T`?Q`D@`h @PT (@.QQ_ `e-`@T (P@P  (@ e c$ -`@$P X 0Kp/ $ Tp P-@P )@ 00@R   00 S-@P% W,$ 0XNPK  -@PCTP =D @ PK@=PPE=P-@@P X``(pPP\T @ A A,\XTTTT$P@PK P` = P  @tlP W ,|P @@ @[P p@ C "@RPM  !@LP` i #@FPc r @@P  #@:P  @4PTt hBQ0/ 0 8 8 8 8 8 0 0 8 40 8 8 $0 8 0 ,0 aRp p pUTV= >`P" P.PP~PQ`y @T6!@P] u#@PY #@PW !@PU ;!@PQ @!@PM T  q>Q PP7 R2T` >PP P@PUT\PP ` ZQV`pb#@ PPX@ =PPR=P-@@P (PP 5 At-0@ @ AXcX p X`X Xp0 `\0X0X `7p -@-@gX@P[ #@!YX X06e!@ Po =PPj =P = P -@PO =(@PP  A 5 Bc-0@ B    p  X`X  0 AXXP\4`0 `<7p `P%!@-@* P( `V X0$ (-@  6/n!@ЍۍOD -@@XP0 PЍۍGP6 7 6 - 6 $P  PTTTP EPXpp\ "P7 #@*P P: e!@P) !@)n@-@X $P@pXW.P, w!@eYTX7 !@R!@3Pp .!@ AQ `Q Q _TPtT:"(PX `XX0 t6p X4-@ # 0!@ 7 -@!@L-@-@D #@-@=}=( @!@-@5}-@1!@QW V !@VQ `@h @E+p Zp y P.@@XP P> P= c  5 ( -0@ q ' P P -QMQuA `( XĔ-@UPQ`0 `5p -@-@e@P #@!e!@JFJ6 b!@q"C ! @"@ !@P   T X`(pQ(@ T X`(pQ(@ QQ @"Q! @!@ !@DT QTQTQ2T/QzG!@!@ AP= p? ? @ 4@ ` ;PP P !@ X=  5p P P. PE-@@ 00 0*V P E-@@ 0 0E-@@( 0X 0@( @}!@!@ }!@-DpT T*N!@ t/_ C$\RX POPA !@L!@SE`B I;PP P 0!@4G!@1@,PJUETC TP@PU*% o$ X\ PP$PPXP!@x-4 -@!@!@!@!@ !@-@M0H-M0@P00z0 P0P0AAЍ0HЍ/K-GMP AN `XpF 0 `@3p`PV`v  VXQ:+X`Gލ Q( Q &`O-$MUT (@-P@P-@/:P UF`-P@ -@@/pF  !  APᰰ `P-@$ЍO@O-\M@-@`Z`{ !P@#p@X: 5P -@ 0@P P /!  P@*Xp\Ѝ`@0 L!@`@0 L!@ 0 Mp@-MPe @(`@P !@z-@ R -@!@0z  { -@Ѝp@ Ѝ/@-@P @Q 0"@ -@-@& 3 -@!@@P -@-@ 3 -@#@T-@PzwA-M`-@P P-@(p -@@0 WЍRWP' -@XW tyЍA)@X0 ЍAW`P P& PP  X7 W W!@yX (@ "@y X  !@ty+ X   0!@gy     0  @     !@ !@Oy @$#@GyW- @ЍA@y ЍAyK-`-@P@-@ p -@P0 WRWP2 -@PW xK?)@X0 KP( U+aPE!@!`@P xQ P xU PE@W W!@xX (@ "@x @ xW- @Kx KxA-P-@P D-@-@@p  $`- @ 0 V PVR6 PV rxA-@-@'!@-@A_)@X0 AIW@3@#Ta!`@x@TW:Q!@x ABxV V!@uxX (@ "@nx0H- MP0@ 0g1p P%-@-@  0z8-@P!@@x 0 }P!@P6x Ѝ0c!@  A-M@-@-@] -@PX0PP -@-@ ( 0 1p pW4 R !@-@6@P2N ,O TO TO TO 8O TO DO !@#3#P `0 p0p R-@0( !@6!@^!@Ѝ(0H-(MP8@  00p P1-@-@ 00   0-@P PX (@@0\"@ wK!@ !@}w(Ѝ0c!@ P0H-MP(@  0o0p P.-@-@  0@D-@@PX (@ "@EwP*+P  0!@5wЍ0c!@ O-LMp@(X-@P @HH !@0 P@p@pap(`@pH`S"P Pw ( D0D`0px @HpD (A$PRvp% $PP P0 A$ C P0P @p`@(@ GJg`V(rjap*C Lp PC$(T `-@-P@Y T ,(0c'I(@ @`v F ( 0-@P !@vpF 0P!@ P0 0 PvT-P@@p (`Y$ol'LЍ( c!@OO-M⼀` `pW !@0gPA@@!P P0 @O/p Rm@W P  0]XWR-@P PI `T cvp@P(@ @ 0u 0P7`Y--@-@ 0& -@P !@uPo@!`@!@pT u u@pT u &Ѝc!@ ᨃO-M-@`PPV. xq x0 .pF 2p@h@,T (pg !RP8 !@ XPt3s` 0 `.p V-@P`T-@-P@㬐  V 0&!@)GoNC `@xp|x;p ! @d0t0V V#   0`x@|x ;@ ! @d 0t0  ЍA-M(p`P 0 .p8 >O P1 0 .p) -@PX (@ "@t `V   @Pp@!@!P@2 pt ` p!@V: t%Ѝ"!@ᧂ0H-(MP8@ 0-p P,-@-@  0-@P!@t M :!@@ 1+S*A;B++ +t(Ѝ0c!@ XO-$MM-@@PP? T9 ៏P `@:@ "@:P+ P@[ @p"P@ 3pl Wo QlPp*`!:pPP`@H 0.-p V-@P?t-@-p@L V00 *9o(@0V  %V   *0 @0  $$Ѝٍ"PWj!@P{!@ ᤁT] !@! @ᦁA- Mt@-p@`PPV #  @%P b ; R PSP !@ YP^4q``8 0`,p V-@PCTt-P@V-p@Q<Q  0oM+1  "" @ 0V PP  0n!!" @ 0 ЍH-)@  0 @000@0@0^S @CSG-Mw㑐`Pp @!@@`0 T  0 p $@`VT !@@P Ѝ!@ ! @ἀ!@O-dM`@PP T5 p !@)@ | ! J ! @0fr0  ]r  00 .[<RP qpT P F!@dЍOr0H-P @P8PU04P 4`P8U:#XP0P4PQ8P:|#XP00-@Q -@/\ %(@- @>!@O-MMP`@@!@PGv㬙 @I!p@-@-@@0@ @TP0U@%P@f h h h h h h h h h h h g h f ,g h Lg f f h h f |f Dg g g \g f h g g h h h h h f PAP DPcPP@Pw PoPi -@P` PZPT -@-@-@~ -@z-@P9U"@#Pn -@j -@fP'`p"pW )@ FP P:  -@W`-@V -@P -@P 2X WWK @P ]!@P U"@PWGPA0i @j k tj k k k j -@PtOWڀWS  Wb  WBX"@@!P@xPy `P P c!@)q WD @W )-@- @0 00  FWp  A-@ pf A `P1T!@ ~ -@P-OQ -@ )-@- @0 00  s=  bp!@O<P)pn r !@q !@p*㤡@!@pT 0 & P$!@pUFnK-by@P!`@-p@0@ >tPPHaPp-)@E Q% Q"iP@A-`@eP( P@:nQ@T K @P ]!@P@)@P !@q!@ qm0H-@)@P !@p0!@ pQ!@ pp!@ p!@ p!@ p!@ p!@ p!@ pmH-MM@P  _P/  RP*J !@0 !@0iy-`@-p@PP PP `-@P   `[pT!@N`Ѝۍkm0H-M@  ?_P P-@P   -@ 8pT!@rNPۍ0O-mMM(  @#@0@@墹P(  #@0@ 唹P "@6P P`堐 ;qep |L  p @ $PM P*P @x| L ppe D PoPl @P$( 8a" @ 0@PnX -@P w!p@_P w!p@p o@T:>P2  @P/p8" @ 0@nP -@wP!p@  n$аX:wP!p@ pP "@[5PPP mߍۍO-MM%vPdl`)@Hr !@@"p@P!P P  ^P P Y T !@VM  9*PY  !@/*P =p -@p !@"*P ` -@P K @Pi ,P P ⒉`, p-8  ` zP @opB6 }`V P Y x" @98" @!0@`m5P I !@./(!@.7)T !@L$% Z8" @!0@m@p -@PU K @o]!@xo Hr!@@"p@Xu`PDNY @P U g!@ 0mPw U !@ m !@ 0nHr!@@"p@ V  !@ 0rnHr!@@"p@P 5P  !@8.PP @k=kB@m{@-@ -@P @P   p e!@ vmE!@8LO-M-Mh `` @PpWWD%PJP  pP X4 0@J.PV V V NG @!@! !@! !@PbU @!@XN @!@P!   @!@(P4 toU0@@\ Pp@ ` pG@oY1W4P t0@"D <H: ?# @ $E R ) @+C R  @%@R @t0S0t@ *!@ !@! @@ z*\ r!@! @ p@H@ @@lDX<q@F l0!@@p` p,dhP`P Dl0 P po lp\p L\`@X PW  p;`$p`|dp $;p`pdp D0p$` <#}bdp E`x` @$;pSddp t0  !@ ?lZH } 0!@B ` -lLX \`@@C ?t0 d !@lD0/!< !@ 08 E 0` 0H@Z  80H@Q !@ ` kLX \`@@ @dHJXA,0P$ ;4$P F !@@ P0cpI ;$0 pcp?  !@k1 Y@P pP(4\`P Ầ ;P `!@X $`PTcp \$`;Pcp DP<0 `!`P l0#}cp `X`PPVT@\px$; wcp ~pP~0 A1{E }Hw !@t0  ` @_ 0 0 p !@(0 pp`0lR᢫4傔P= X @ P!@ 0TP@&cp ;$P@cp  XTP$;x cp  !@ x0ptq@V(4RPO 0  0 0( 0?  !@E`D @P9  0 L.@X? .0@op0Q00 W|!@!p@# .@P.@P @L!. @PP .@L.@PQPaHa.`@Q .@PL @ PF @d .@ 0   C @X? .0@ L.@p0Ro0W|0 !p@!@j# .@P!.@P @L!. @[PHa .`@.@PL.@@  !@%VaDPQ5 #: .@HЍۍЍH-:.@P .@ P^!@  -@SA-退 .@Q.@Q Lq_.p@.P@@`P@`O- MMPL.@@Pn .@Piv.@`Q!p@p`!@ 0Le0)@+,AP J)@?P b!@ 00e!@ 0*ep )@+0 APZ $.@@0@!@e$oPaP nP@pP qP @.@@ !@@.@@'!@ dL!. @J!@3 Ѝۍ@/ . @  (=&!0@! @0 G-KMp@P7`APO h P` .@.@d/ . @Q0 DP/oS0B 0 @W[ T .@ P3 B W7pEpHT T ,! @=P P ,! @x=P PP /l .@@8/.@ 0+ !@m@.PB r, @ R @ZQ@/ . @ VT[ !@ 0)@ @.@@@Kލ  @FB@@/ . @  (=* !0@ @0 HO-MMP P `-! @ =P @/ @ . @.@@ m!@PT .@ P   @x8P -@QPlu.p@ P2@P gxX .`@.P@pPPqPn BP#  dPc d .@P0` .@ h .@  P P P  @A t.@!@ c=@/ . @L!@o . @.`@ pZp/o 0"   @ (=!0@ 0[ !@A).@uQ.p@`xX .P@P L.@ PL.@ ?P7.l .@Ѝۍ/.@ 0+ !@JK-AMP2@!@YcP- ` P"@ @ +.@0Ѐ``? (} !p@ @pPJP  0`<+0?p$ . .@!@ cl .@Aލ) ! @@P/H-P .@-=!@! @!0@b^.l .@p@-P@P Po`@ P  !@P @.pUpP 2.@!@0@0!@ bpH- /=. @!0@l .@H-P `.@P.@ !@H.l .@H-%>. @!0@l .@H-P P(P I .@!@@/oQ" @@'`B@@PP y !p@P &BP4P  .@ .@ -%P .@P .@@UN.P@!@ NbPO .@@P d.@!@ Bb!@Pd .@ l .@ .@-!@-bH-`!z>. @!0@=l .@H-%>. @!0@3l .@@-dA>.@@!0@ (l/ . @QP .@H-L!>. @!0@l .@H-MP PuhaP.p@.`@ oP* I !@@/X-I@P@P I !@@ P=PD.@N-@@,᩿@@T P B@@.@D!?. @p!0@W 0 !@ a 6.@ 0!@l .@ЍH-H!?. @!0@l .@H-\!%?. @!0@l .@p@-P PeP.`@P@@P  !@P $A0pʼ .@A!@_a, o200%S. @PSP.@ "!@ @0 [!@>aQl .@pH-MP2 P0Pu/! @ :P' !@jPl .@}Q`.@P .@!@R!@TPx .@ L .@ x .@m,l .@Ѝ0H-l_ .P@P  P.@=P0@ p =.@0x .@P x( !@. @` 0H=,!@>$!@ 0HH-MP PP,! @ 9P !@PL .@,l .@ЍO- MPZ P`-! @9PQ `  .`@P @P5 -@NPP <P4 @㸵Lp!@@.@.@P! P P PL .@PP pPpP <pP4P+l .@ ЍH-MP) P ! @ 9P P ! @  9P P!!@]P)!@VP L .@P t+l .@ЍG-Mp`pJoR@!@P We c!@i㵝 P!@ @ T .@PC WR ^!@WCh  @;p`pZn!@2PPP-V P@@;|` ᖽ V <`P, t!@=P& : 0@  V%V ЍG1.@!@0, ЍGW`p*l .@Ѝl .@O-$MP P`- ! @\8P P, ! @R8Px @@h @P|Po!@@뀀  .@PP @3@ -@=MP @P@ i@㵝 Z f.@!@@ @ P@!`@p @[0P- 0 ! Sp0p [0$P.@Q L!. @`PL.@`f .@!`@P l3P @W*l .@$Ѝ;P t!@mPA-MMP @G3P P `P@MP83v!@<%*l .@ЍۍPPU 3 @lB]P"P@/PP+w.@P e.`@P @   _T 0 #.@0 @᳍ 㮍!@v<l .@M[p@-MP  P  ! @A7 @P:)l .@Ѝp!@`P  P!@ncPPP@$P!@v@nFT P!@TcPPP P!@^@V.`T @oP  @!@HA.@k8.@!@00H-lO .@@Px x\ .@.P@PPR<P 3.@x, !@. @]00H<) .@!@0% 0H0H-lO .@@PxX .P@P9P I.@x( !@. @]00H).@!@0$ 0HH-MP+ P)P^!! @ }6P !@Pl .@}Q`.@P .@m!@!@PL .@(l .@ЍH-MP+ P)P^!! @ D6P !@Pl .@}Q`.@P .@!@!@PL .@(l .@ЍH-M P P!! @  6P  !@(l .@ЍK-M@P +UˆpE` "@ +㭺V +㧺`UT !@6P L .@ۍH-M P P!! @ 5P !@:(l .@ЍH-MP P'  @ 5P P,! @ 5P P!@P (l .@Ѝ0H-P `A .@@PP !@ 'l .@0"!@P00H- @R:'l .@0`A .@@PP 0!@:!@P00H-P `A .@@PP G!@ 'l .@0L!@P0@-PQ 'l .@G.@@P  s&P YH-PQ 'l .@.@PT!@bHU7H-X@-M P  PP@ s'l .@Y!@0a@P@!@=6ЍH-8.@Q0.@P&T .@.@P&-@IK-MP P!! @4P ,P p .@b!@1#'0.@w!@)p P -@IP   @0@% .@P P.@!@%0.@!@l .@Ѝ_{.P@ @ᴲP `@ ᝴P FP@ 2/T .@P%/H-`/ 2. @!0@bl .@H-%2. @!0@Xl .@0H-P PPUdO .@.@@!@nl .@0&l .@0d l? .@@ .0@ p .@  U.@0 0H0H-MPH PhO .@.@@!@9l .@<P3"! @ 3P. P+l 0_ .@.P@h/ . @ 㮿@.@P  P  @塿@+ .@㧸 P  .@+㟸P )&l .@Ѝ0p@-P P%TY .@X1!P@.0@/oQ" @ P@/`B@@P Y !P@P U"@P %"X.@Y T.@!P@ X.@@X.@PT.@.@!@ 0dZT.@l .@pH-`!)3. @!0@ R0!. @il .@.@H-`!;3. @!0@ R0!. @Vl .@.@A-`P.@)3!!0@. @P@0@l .p@;3!.@`!0@Q`0. @/.@`H-X/ M3. @!0@$l .@H-\/ Z3. @!0@l .@O-MPPR@Pc%Ѝ`p"@P  "@P  "@P`U 9PJ`U 9PA.=.`q.p@ U.@.@`T P .@.@0.@" @ !@S i!@Y U.@.@`T P .@.@0.@" @ !@S !@zY- -H- ol .@H-P# !@Pl .@}Q `.@P .@!@!@Px .@ L .@ x .@$l .@p@-MP P@T .@ Q @_ eP.P@.`@! 4QJ R  !@Y$l .@Ѝp+ .@!@0/ Ѝp@ @0  O!@ Ѝp@X4!@Ѝp@;0H-P `A.@@P!@7P0[$l .@0G-MP< g.`@Q.@!@zP-ʳ$! @ 1P( P%L㼅.@.@P !@儠 .@ H )@@Q.@  P PU%P $G PzPpF p P  U2  UR3 PW AQ ̅ P p AQ ẅ P!@l .@ЍPE!@0H-MP ! PP, ! @%1P j5@Pp .@ H!@0!Xt#l .@Ѝ00H-MP & P$P, ! @0P 5p .@@P DE46Q0!@ WqX#l .@Ѝ0H-P P J#l .@W!@H\!@H@-: 0@@Pd.@0 !@@WH-MP: P8P,! @ 0P/ 4P+ @n!@)PPP-V P@``3 pp"@ < 8#l .@"l .@ЍO-MP = P;P, ! @S0P2 n!@)PPP-V P@`3|@ 0 P @o `.@.`@ .@Ѐ(=Pp!0@[ !@pP"l .@Ѝ0H-P/P@!@RP  "@LP !@FPPPP6p 0.@0 .@0.@0!@Vd"l .@0A-Ml .@  RP, (@0S v UE`!p@.P@!@@ QV0`SЍA8" ЍH-@`p|'P PP 20`.@0PT.@!@ HV.@!@ HVp@-lo @.`@PO'P PP  .@!@~Vpp@!.@ !@p@qV0H-P T .@P `A.@@PC!@P0!l .@0.@!@0, 0HN0H- @R:!l .@0T( . @ R `A .@@PP u!@ H.@!@0, 0H+z!@sP00H- RT( . @ R `A0.@@ PP !@\!l .@0.@!@0, 0H !@GP0O-$MMPQ `!*P$ ! @.P .@`VP p.P@@ P pPVpW.@ J!@Ul .@$Ѝٍ.@)㚳 .@P)p@ AY I @O.@@p$Q \Q Q@  00iRU.@ A)b@ P 0 0@  AQ`/. @ B)<@M&.@h&P @p .@b!@.@w!@ P .@P.@!@ol .@ Yy`.@P e.`@.@[P @   U` .@`.@ 2/ .@PP.@)в%.@.@.@ @P  P WU[ PUO- MP@.@BP .@P P  @%) @!)P .@Pp l Ѝĕp:.@.@`.@P [P `PpW h @1P|P PP `p@-MPr!@ @P z!@ P ~!@AP `!@ P U PP 0PЍp !@l&PPЍp@M !@ P F!@0:aG- M p`!@ p/ G P/P:P# 1p P MP I ЍPP lO p`.@@@cP)`PXp *p0 孱 "@ y "@ 㢱 /pP p/ P :P p`// PPpl .@@cPPa  !@hPO-M-zMMpppp|pppp\pppx.@ppyptpppwlpp0pp pp`ApAP.@@ p 'p  'p 'p 'P: 6<p  0!@  * p /l/p/P)UtxP'PQUPQUj UQ . PJ S|p |WPP 1/PP H9 l7 J H P 9P 2P +P $zߍۍЍ!@ P !@M/P..PPP4 H8 `.@`@/ `t.@pP. @d`P`` )P@/ . @PL =*.@! @ !@5P! 5.P@8 .p@ d`@_ .P@ 5  p好qZ`.@P U .P@_!@OR@ .@  j!@FR^!@X.@ PQ `pQ P  @& @&E.@.@@ P.P@R Q P lQ P Q.@:.x!.@@. @p t&f$P@P' @.@.@@ c6P=  y0peV3 "P2 W0J@ Q;Q @ qQ Q @wP,W" p@aP.`@P  4 .@R ?.@0  R )` U/? )`x.@)` R 0`.`@  S 썢 Ρ0 !5P   P 0) 0 `pWp  gp F#PP   [X` PP .@P dx.@㼅們.@.@P.@ ,P P P&@c,P x .@ R 0ES 2 I0ppT0(0.0@@0P~ `#p @P  P  p  R `@dQ#p0 P0! . @P @@ @@R@# Q.}0SG/ rP@HYk >.e5 FuSPP T) @p3P- P`@`P p.@.p@ 5P  @<P V P ` @ !@ !@ EQ.P@,Hl .@PPgQP^ P` !@[  @S !@\.pA.@@h @P |P $ @aEPU @@ .@  0 %0&   P 0 '0*8/ . @`0 P&@#P@ `P0`.@P  .@ 0 !@YD !@ . !@5"L *.@! @ QP&-P0 pP Ep.@ P` C0u\pp55505y?᷹PXS P (- !@TP!P R +`?  "@ P ?{ ]X"p@:$P  P  Q Q(P ϽZ:$ AKPL  PPXprWT䥝Z` `~^ `.@   00 0p` #P k"`@ 9 ` 4PP .@!@ 0CO p0 Po2 0p  on/m?!@.%p z !@ +-Z ޸0 !@ `)P bUXTU FP RUU 8P DP  `|a|p:l @Y#U.P@Q<A#|(!@\2\37#P<3#`㼵.@.@P !@ NPP `.@PK 0 UQ-!@! @N@  !@ s!@1!@{1!@w1u.p@Q o !`@@!h1 R:@O .@@ Q !@ !@T1 !@hN a!@F1l)@X$@.@P =-!0@! @Q,1Qm!@!`@P P  !@1.-=!@! @!0@1렀q!p@PYp`Q`U `.@P B!@ Nx!@ 0 PV `.@P W!@ NPr!@ 0U`.@P A @7 @0U1p U"| аp(@* `>PPL`P` P3 P   ? !@+6"m ᛲP P Q+Q! /) @ @p   0 P `@pA 0.@@  0  P `@l)LP@ =`9PP0 0   PgP.@P P QI)P QA) .@PS` &X.`@!P@pP `pWEPPDpH` 0 p `@4`8pPLpH`0 <P y!@u P> !@PS !@P] !@ Pl !@P c !@Pj !@ ^ !@Pr !@P  !@P| =(@ DP P ` 0` 8/ Q. @J 84P08O`U0 [.FL 8p#@@.@ `P /〭P``{ P P +~@P@ l .@P @ P .@9!@= !@-V .@`T!P@5Q  P"`!@ "P &!@ P' 4!@ PPl .@dP @ P*9!@X.@P t.p@P.@`Po g Dp  1pQ 0 p p.@ 0 T Tϊp Tp!@zP PW.@PC .@P> d 4`3 B  S P,`a.@.`@S `30PP7!@UP Z.@P.@! @. @'=.@PZ Z .@P  0`AG!@PPW.@P? Xp``PP.@e!@;P# !@@@@'!@!@@P0 @F!@'U @.@@@KލЍP>l .@P? @ P<.@!@l .@P @ P.@+!@PdX l0 (R p`PF.\0.@!@@Z P@`P\PXP .@|!@dl  00( [0.@!@ppZPl$!p4.@td,d(hPxt$ 0 P3?( SB .@!@s.@!@FS d000(.@!@Y!@QST QU QV Q .@%@X@T.@m!@.@ `0 C @Z.P@0ZpX.@P<l$!p4Ptd,dh(xt$.@0 3?( PO-LMlT.@.@Q LЍOg @pH P pA (PK(.@@m, PP<@b`A(, 6 00S( 0B 0@SCC?7 /p P #P ^!@P !@`@LЍ .@ <Pp@< pnP j#P   p P Pp =P0  _g@!@TO-LMpp`Ptxǿ@[ǿS.@0PW 0#@P~@   PppP #P  ApPJW PP  @pP #Pf @PJpGPWppP  #.@ R   0QPr" @P  P P ء ?$ R# P+;#.@W@w %0 08 (P0S4$pEP/pp r^@P@@A'UpPP(  P $!P5.0@  @P  P  #P @   :5.0@圠QPowLЍ#:5.0@O-CM.@`8 .@/@L P$ .@! @M x.@d!. @\.@P@[!@ةo`.@4Q P0PZ.@PPj.@ Q P0 .@'PP@Z U.P@P @Pl .@p Vdap.`@p  MlA.@@PJ"xA\Q.@@P.P@P 1/P fpY-P !.@!@9Z .@!@ 9 Cߍ @  @Y pZ\ .@P P h @3P|Pw .p@P  .@Q   l .@0 pPu Q Ph0 .@J'P_ 0 .@D'xAP.@@  @ .@PQ l/ . @0P0K H/op"P  P0W @W "@:/ , " @P"@-p\ .p@P  Pp?P  Pm {K!@@O .@@P ZP T!@! !0!@P "@ P!@Py Y 8P( @4]!@h @jP |P    @-Pn \.@d.@ @  @Bd.@\.@)@X_P@0pH  P4e.@.`@P Q 8Z.P@P Q P Q_ P 0.@P d!. @.@ R @@Q,*P q `.p@P! R8*. @0 pP xaP.`@p P n!@!p@xaP.`@p @P@P.@#pK PL P pK^Y$  x.@@T @P  P p"  .@ 0-S8x.@  0  P`P   8p# @ V v V   #p x!. @\.@d.@#xaY.`@pk @ T  @P  P #P @ P L0 pP000ᬢq+1 !@lxap.`@Q 0 P!JPp`P P pP p`U  0up+D !@:I!@ 7@ @@ P n!@$ p@ A @ !@w P 1/ dP E .@@!@6!@- W  R Pt \.@P @PP p0 !0 < 8 @`pN,`(p0PpA.@P8$0!@ 6#17-G-/P/pP @ "@T`p "@"@U`v.4M.@@+i.  V(4M1dp1P.@@pW! u `P9QP0PPJu0QZ.QJP K!@h@.@c!@0H-hM@8.@ P!@d # .@PQ0 .@3$H-MU @.P@PF oP  0PP !@%!@ 6W .@ $l PP.p@ uʬ!@0 .@PT P+P&P PP ۍ!@0 .@Pl .@ۍH]@-ͩ8@.@4 .@@G-@.@P @P2 .@T QPjs.`@.p@PQ cPz.`@.p@l 7.@.0@P@Q@  ,vA_JeP.@PE_ `.@EO*a EA_*EU .P@$!jd@ % . @j@P(QW .P@,$A@ .@JA00.@,ApO 4.@@4X .@(188\ .@0 <<` .@@@d .@DDR%R !O YQ.@@  h O .@l!.@@ l+ +C W.@@+W+  P G/@-8.@@p .@P .@ P^!@ $.@. @@0 .@@ .@"p@-M@PT 0S00U 0S 0100 ` P TU T@Ѝp@-P Q .@!@l .@E .@@ PJPH!@l .@@.@!@O-4MM0, f @!`@,%<.@"@8.@@@.@"@DQ.P@!@@1xP.@P@.@@!@H.@L.@hQT.@.P@X.@@\.@`.@@d.@@l.@p.@@t.@@.@.@@.@.@@.@@.@.@@.@.@@.@@.@@.@@!@ٍP @.@+ P*.@!@ȍOP@.@ !@㾍P. @!@!P  "@P !@P U"@P !@X.@X.@T.@奧2!@{P z !@tPX.@T.@7 !@rP.@ R`Q PA !@o\ "@\P !@JP@@h_)`@PX .@ .@ PP `T.@ Pd.@80㈩.@ !@`0,P 4p@DWZ @ 0(e $p f $p $p $p Dn $p $p $p $p \n $p f $p $p $p $p $p $p f $p $p $p $p $p e $p e $p e $p f $p e $p $p $p $p $p $p $p $p $p $p lg xg $p f c ,f !@ D[lH @@xulO  @@pm  @i0P}[,:幕P ,3Ps .@P  @O @K,@P៕@P `P0@Y !@0@?Q  < !@00E !@`pP+ᆎ,t.@puTZ.p@!P@ DV@.@@0V P R P  .@.@@s0qP [c0,p=.@a  @ @G !@ !@ !@ o !@ ?@G0!@ /!@[=?;0!@ R= P+/0 , @8.@P P-ݙ0!@ 1=O- M⸕EgQ.@.@@)@.@.`@.@ P@P ;P  /6 )0 p P Pg.@P .@p pP w!@W !@ b!@ P .@P!@/ P. @ 㔍.@.@ Q P@2/ .@PP  @P  @P  P  0  @ @ ЍP P @  S /Op@-W.P@P, (@P E `!@@P P!@n<F*G! @P.@@ pp@-@P ,l P(`@P fP @pp@-[.P@P, (@P 6I`!@@OP P5!@3<F& K! @P.@@ Npp@-( (.@.@$.@.@U, .@.P@o.`@@TpH-P+ % ( @PU& 0`p@S`P`V p`V V`Ap Vp `PUWO-M@p ` @eV2 PPV. V/qU@.P@0I.@+ @! @S w!@.% ( @P  `Q R Z Z`Pi ЍOЍOV0{.@!p@`P p!@ 0U 0 !@L.HX ` % `2/Ѝp@-$( .@.@ , .@0$S!S0S S (@(@!Rp0? .0@ 00 0 S S S080S S00? .0@ 00P@` P\V "V `V "V ` P`V$ ` P `!VV V VU  @pS  Sp 0/ . @ p 0H-P , @(@P PP PP !@ :0!@:@-L (@@p,.@P@o O-M-RM@O Ѕ p.@@.@.@U .P@ e J  1$qS(apPPVpxP@ .@.@ `0T.@* kPp J `0P P dAP.@@PX zP Z.` P4`0`8` ` EP. A`0`  PP.` @ @ 4`4`08` ` EP cP HO .@@0S T%! @+  8 p.@`PV9 >1 A ᠋!?0 A6.h! @  _ dUdP0+`4 .@Q-@AP @DTE. # @ =.! @P !@2?D h+ `@ PY@p:0 6@ uP[p!E:R :Wp G.#@h! @ P@~+P .@(A 1$q@DS 0? -T=IBxqPJ.p@@ 1 Aᡋ0 P @l>0 A 0 Q\ *P#p@ :0 %Pk@!% :S0: #p@` &ed a"% `T.1! @! 0e++8 P.@ R4@X)@& R #:Pv.e! @ Y@@ .@ R>`p>0 A@1kG@ p JT `i.e! @*PZ^&e! @*P.@ P RߍЍc PaI* p(e" @*FP p.! @?e*FQ%.Ba(/O@b"(r0r 27"cA.! @qd*P`ꖟ @.0! @p* .@P .@ .AH- M  ` Al ЍH-0M0P  B ,`PC0Ѝ@-m@i@O-M-JM`.@Pd.@P/ F` Q.@1Sq@E = -T=IBJ 1 Ax.@㡋0@T@`p =0 A 0 Q=`pX p$⌮L &  @.@! @ .! @ 0* P@ [..L! @F K @ P !@1!He0)딹kP IP?㓰dP:.e! @)P.O! @` pp7ecDp) V 0&U@  `U'p*S0`p:R ? #0@!?#{ 0.0! @@d0'5;A0h' @)`[ x .@ pZ@ 8 .@ Y @/ . @ P@PPP ^&f! @q) [.@PJߍЍ .AP=@P =0 A 1KEI > p * P᠟P#g.f! @?)@ U:.d! @ 05)@.O! @` pp7dcGp") q.@Q `W  0Pp Qp0S.f! @ )`@-x@.@ R.@P .@ P^!@@O-kMP.@pPi .@!@`@) P.@C Dp.ӫ⬎뺆 P!@  .@ !@ eP2 PP\ P p0SP  P @P礊 p Ћ EP p P  .@]P  .@qP !@OP PDPJ?P p P .@RP,PJ?P p P .@:.@Q w.p@Q A  V Q  Q Q q R p .p@P PQ Vp )@@ U P .@^ .@  .@  wP.p@ PP P  .@ Z{Q A  GV Q qb ġ .@.@ Q 0VpP q Q  0 .0@ 0Z 0ZS P  Q?J P!@l .@PPꛜP !@.@p Up.@!@˹Upkߍ.@!@.@!@!@Ls!@!@FA!@C.@!@A-U @.P@`  P,PQ A  UP @Q:p ("P&e @.`@Q A  U\P p"P IQ {Up< F@Ddt0E `.@@|Q A  bU[P \PQ  Q P ,P IUp D`Fdv- !@@DF@@ .@P}  E #@P.@@ @᎗P PP @k@iH-` .@PP .㏌@P pP `Gu .p@ sPoB@p@-MP4 W.P@Q l N .@!@ .@'&P+ ! @ wQha<.`@D1 .@@.0@R0P0R .@P R y !@4l .@ЍpvP P`.@P  .@!@ .@M'  `.@"@ `(  .@!@` .@ ` .@ q.@#@` .@ $ .@"@` .@  .@#@`( .@ PH .@.@ Q  Ѝp@@K-MP.p@`K뼕@.@ T!* !@ &` `0 @)@p/.@. @ R `Ѝ !@G | 1 !@!0@&>O-dMPp@Q`PP PP `W P .@P V  !@U  !@|  0ppW%P.@.@)@ `0S a  !@&p  !@& P 0epPOpP h.@P ᰔP᭔P pC @  P p!@`P> Q!@{+@P@ ႔Z !@ P@wOT!Q!@]+@P@d<P< !@_P@V.`@T-QP!@IP!| @.@.@P'.@d .@pWOP &h.P@!`@៕P7 PpWB !@@ | 5!@!0@%l .@@P  PU ܘ P  PU ΘP dЍ1.@!@)㄃.@.@xX .P@KPx .@x .@A-`Q.@.P@`P!@P\q 㼅V.p@.@ @ !@| P:.P B !@0b%@ !@ $}P  @ }P p .@t( .@. @Q V)   .@!@ tP! !@} .@t( .@p .@. @Qc  .@!@ V ' !@. @%TH .@@ 2q\ .p@ @C!@XP  1s0b Br`0H-@Q )@@Q !@TX P.P@ u!@ |P  !@P _ "@P  !@P0 0@-E .@@P Q.@p .@|@ .@.@@ t8 .0@R .@l.@ !. @P .@Q .@H-8.@.@P .@ P^!@.@wA-nPgu .`@.p@P P PjQlA.@@PJP P PKQT .@qpX,PG !@ H1H-P >Pv !@F1P !@81H-P`p @P N@ R. T 4 t !0@!p@Rpp`FPh)`@ AQ :Q PpT/ !@`T@-@[P !@ 0@-xH .@@JPO-MMP .@`H.@Q.@Q P `Z .P@P P@@P ` @.@ R `F .@@tP  _Pd @.@@d .@Q`@T``p.@+SP/P "@+p !@+cpaڳ`!P . @.@0T00 0d1.0@U.@ o R : i`p 0@!`@ 6!0@Rl .@@dP:T .@U.@ o[P .@P`.@d.@!@## Rq T!@ P@@ !@@Ѝۍ0H-0MPH.@P 0P A @ A @P !@ 0Ѝ0HP @ l0Ѝ0A-MeP.`@`TH .@P.@@pP B !@P# .@~@PA   R5 ?)0@0 @ @1@U- (.@ 0 !@㈇$Pl .@}Pp@U PU .P@.@嶳P @ "pЍO-,MuP.p@`l Th P.@.@.`@@PK s !@PQq .p@`P. PxP`{ !@ lqPe .`@ !@""2 !@ "` P A A BVPB !@5P;  !0  . @:U5 (.@ 0J !@,P}PpU" PU .P@.@"P  X" .@  .@!@ !,ЍH-" 0h ! @.@2 Ph .@  !@.H-`PI@ @; !@ !5pP U !@ 5pPo !@ 5pA-x .@`a.@ .`@Q l p.@? @PxL P.@@ .@APQpP"QQ x 0.@C"Q "R  Q S0:  x .@@H-MM@P$o1 `"@PP FP /Plp` ӐPP /@ooP !@!PЍۍO-M@T `PpGPPpWPP4 .@`U@D`  VR:PEp.@@  P? * aV Q"*P*` @P  P `V: =!Q* XP  $!000S Ѝ@-M⏔@.@ 0Sh0DBQPp4 P.@y@ЍH- P.@ R&.@ R1.0@0  Q !. @ .@ R 1.0@0R B Q !. @ QA !@o-@-M/) @@ "  w R Q R/) @ fQgQ mQ kQ Q bQO OЍ0H-M@.@PU.P@ 0rp !@ .@P U.P@ 0^p Ѝ0 !@Ѝ0HO-pW% Q" S AP\〒@` @GT ^ *p\W ^p2P`pW ^U1:O- Mx GpAP`.@.@@A%Y Y V* `PbY.IP :%Y MYg nY mYb cYP Q Px !@.@cY.Y0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^4BQ1 x G.@V.@@*.Y.0TV* 0R07 2R1|*`.gl h+.@ @QPP} V  mY.Pv Rc `Pnx G.@.@@GVU*% a| .@Ph  @PX V  RA `PLV8*% RB:2V-*/   R)*<0 Q0 R937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ/O-\MMp`@    7 4YP ["P@7$n| i|.@P P R PUP p=  p-  PpK ԥ<.@8HP   p4  qY  !@@Y t!@ @7 0Dw10 @   4P "@$|@F !@)\ !@T$P,8pP! H@b0`@@S 0B0@mb`ASCc?; / 㲀,pP #P !XAQ!P<` PT0 ?p ThVz `‘` !@7 \Ѝۍ0H-@P0Hp@-P@P@`p``@PP #P `QJp `T H-`pv@P@`PP Tp`@P`P \#P `P@@U K@p@-` P @@P X#@P P  !@A@@pH-(P !@N*@-@<p/ !@ C*MO-DM@h h l0 Qc 0Ե0.@@B ӝ4 `p@@bA04P u(80 S0 0B0@SCS?8 / pԐP А#P "P ɐ P$ pʾP #P  Q  A<@㪐@ꤐ  DЍOЍ/ @/(/H-M$Q 0 Ѝ0H-@P JP0P @P0p@-MP`0`P @$`P 0+@ЍpP @-@@/O- !@J[ G-MP@(.@ȶ.@.@!.@; @~PS.@ .@PK(.@wX#. @.@  O@ ).@J.@G.@D  @㫁u .@!@ i !@RT!@O Jep.@a PdU$C.@@ BPJ ;pR !@wwP !@n r !`@.p@.@!@ qvP 0@ Q :p   0@)@EQQ@U4 )@{ P: !@ | !@.@B.@@,tkP  @R0.@*/ @@! @ q \ P@  p P  !@ !@)@X 0 !@"g P(@.@ @FC.@@P ^ (P@PiP PN (@@P  H !@O 7 !@I0H- @)@P  !@  !@   H-.@P #H. @ƵеA-n P(`@ATP `v.p@P Nq'@ @|P( .@`` @|pP" a @|PP "@|P+  "@|P  )@㰀!@   s.@Pp H {[(@.@ jb aF`VafaFjBp@-0M$cP.`@@Bv,  .@0   R/ (@  PRR   w*/Or  c/ R F(0ЍpX#. @?(O-M^ G(P@P Mb$㺦 @.`@.@w!@)@l Y  ' p?oR 2 0Q Q Q P "!@ P % oRQp\P R R P  )@ P  (#. @'O-M@.@ @p |(#`. @ 'T!@" .@PHP)@@P9p p PUX#. @  'GD.@P  @oЍ@-@3.@@"!@㏊.@H-M (@lpp>< (0@ R `.@p@r R VQ  `RpPwP" $.@ Pw P:P .@p^ .@P @ ?  PPT!@.@ 1/ЍH-)@Q )@8p  .@Q  P:P .@^ .@P @ ?  .@/@-5.0@0S R .@0@^@@@"pP "@@  !@ Q0S S /H-PU* $? . @!0@\^^O` pW p`WU@PPPPPU `BlV U@`P.@.@O-M !@  (@P>  .@E唿 o p(@.@@^P!@!`@ WP)l P:P @P?P   W P:P @P? W* 0P   QЍ@-G.@.@@ ~.@ @蕱G-BMc.`@ ㌱ Xp@P } Q UP:N df(@@G0.`@ S P >7 X!@> P yn.@ 3Bߍ (@o /O-MMP}}K @@}}$.@.@N dp `.@(@@.@P!  !P$! .@ PBP SP WP.@ .@ o aM $.@+PP>y:`.@P   Q: ṰGP0S* P* U%P @q_Q:|P  R0B00R P 00P U: u n}P $: dn ,:H- G(@Pd.@P c6>K-M (@P @PT cP @P\1 @! @(!@G P! @  P r%` .p@ P!`@P b anP  P6uuۍG-p"@xPY 7 p!@"@ `=mP @=P4 P@xP@?mP #P @ 7 !QP $@ xP pV|G.@@P"!@㢇N (@@P  @ WP A-|g.`@pG!PXp)P@ @p`pP @P` XX@X p#PpPv@PM    T    t A @ P9 d'P/0)@0`p Q0AQ`0!X X ! N !@~A @y P p@mvTX!T!@b#Q"!@A 0H-0SS@7, @!@sP\U  ^U%0S! @0C@#0 0RP00C 0R100C P0U!@00B n@t@S @ T^0@0@00SS S@ 0p@-@`P P p"@}wPgp @pp@-n P(`@@P dwP P ]wP @pH-@P # p@P6@        `V ;wP' PϷ!P    *P V !@H^!P P P Q e !@p@-0M@PX  O(@P P !@)@Xm$cP.`@p   #W\ !@ B"X!P@b !@ 7, =R RPSu %"H!@@ @P7 g !@y1P "@.@P (@&PU !@10EP       "@ !@   !@ !@ !@ !@U !@0ЍpO-Mx$C1 XpB.@@!@D .P@` ̭G  i R (R( ܭ0tkPOokP KjkP   M IpW5 !@`ЍO- Mx@ @zw $ `.@.p@(@.@PvP,~ ᜭ x  tP  XPP yyp Ѝ0H-M$SxD.P@@B ~G \kP# rGT !@ ? !@0P3P  !@b !@_\G DϮ+ !@ 'PG2 XЍ0H-$".@!@ HH-m !@8.@.@ O-{MMPy& `@u밸㬈P.@.@ ! @uP  @uPXb q 㴘!`@(p@@.@  ^1@ Q*0@cP @dP lP nP @@@p VP )@PPa@p Up-PP5  @P$ pYP uyPsPPv  3l.z@ P p  !@   P  P  !@mP..@P* pP^JUPr ፬+ !@ QJQG  PB P PB bpMPT 8 Tp; `PP' /!@" @ 0 P.#z@#%P-9Ppe U.PPpEP%' P P  !@ s  !@cws  !@w !@s$pz !@Q ^nX` +P.@b  PPPrPP@' !@gtPZ P.@P  ԫP p:W !@_9 !@6P* !@)@1@1 0oP.@P-㲫PP«qV .@P 0 !@ w᭫@Y ᨴ`V] 0`sP啫Pe !@V ፫Pz !@0 % # P`P bp pجP  !@P⬬ !@/s !@ !@ 0 !P   ᘬ !@ O. @  .@H-)@ @# @@-)@@ @# @wF !@A-MPာp` p PpV`JP< .@P h  !@0P*9 @/%vpq#@ ժp P pW@p0Fs S !@ p !@h !@ ԳЍ @ MH-M  .@QЍH Ѝ/ MH-M  FK-MHP.@@`Pz !@E 0@n  @p  pP p !@ @ !@I@p !@00Ph0`T  RJ@T` `@0d `@Vp@p:O0  }.r@`" ! @0. P @ @)@ X!@ "@)Ѝ MH-M  %.@QЍH Ѝ/O-dM$PpWP `HQP P( (p @(p @ @8@@,PP `4``PLH,oZ  QP X ( [$(h(P弩P p5,@,X [ ( H( p( ( ( ( $) D) ) ) ) ) <* h* ' ' XXY (QH(, z(QQ,H,*(QH,!(H(, P (H,( @ P w ( H,(C( H( ,  P b(H,( @ ,  S ( H, Q(   E (  H, Q(  P 4(H,( @ )# (! @80fP  (cgp(8P5  Y .( Q(X, Y Y( Qr(H,P ZkP, , , T+ d+ d+ -  !@8p ` ` s Pi` ` X(Kp84Y[  !@n ( !@j` !@` [:(+pᓱ呱PdЍT& !@Jf !@ !@8 !@[ !@ !@ !@ !@ !@ !@L !@+`2 !@$.@ !@ !@H-rpq#@W P` p P pWPNtO-lM$(jPgU@P !@i0P 0 #0@ B (@ B,p+0 4 C 3 < /!0@`@ 8 00  +uP  !@p] ,@ <0@p@P ((P;@202@DTP T)P*)Qk .@P (/@P.@P !@/VQhdD/@@Ph(@ @nP1P !@V"`D\egP%g 0.@q  d/@Q)P 0E/@@P 1P p/@Pf1.@0 /@PA !@eUU T>T:@-p .@@@ .@@ .@B&P [T/@P( .@P (@%6T<&%Hg@-@mڬP @H-ѬPH-!@U Q Q/@-0SR PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SG-0M,.@ P 0 㰃.@Z/@" Php$d.@Q8.@ KP P+P;PP KPP P`[8  .@ol .@h .@p .@b P P 4 P4  @P>9JPP4 2P50PKP# P, 'P P&! P K P KP nP K P      P0@hy`.p@0`ly.p@ 0p9.0@   "  ./O  0Ѝ0H-Mh D〦tYP.P@ @` !@ #P @P  "@8P[ !@"P 4! P( @0@0PxYT.P@k !@"P @@f !@"P ݂P@PPЍ0:  @@P@@-@P @Ă.@P@XK@-M|I @.@@R@0< P< \< h< t< < < < < < < < < < < < < s !@(Q|  v !@y !@ | !@  !@ !@ !@ !@Ѝ !@P| .@ !@P0H-@PGP0.@Q 00HJKG-M !@O"n"o8 (@\ "@F"E.@@P#@ .@LJP !@PUu#@.@ !@.@ !@박.@6#@e.`@! "@.@ !@.@, !@B%. @P%. @%. @/@%. @%. @%. @%. @%. @.@  J"@~P.@ PR0@@qF !@@P.@ !@fP.@ !@]$.@ !@V P!@.@ !@K P!@,%/ @.@ 5u.0@R.p@ P P !@3#@.%. @Q.@ !@P .@!@ !@P.@P !@ .@ #@ .@R PP @.@y !@P.@P!@ .@  !@P.@fv.`@.p@Q  .@!@  T!@"@0@&6m +"@#@. @.0@\W &$6"P@  !@. @.0@(&,6#@. @.0@ @P0.@= @4VP.P@ !@PP="@  @PU`PQ  `M_pPX% @G\Ѝt .@.@0H-O0/@P .@P;p/@Pt E.@.@@P .@P .@P<.@~( .@t/@Pt .@.@n/@P t .@.@bH/@.@ Q tI.@@P0P %OPU0@.@0HF<.@A@.@<0H-HF.@@P00/@P .@PtY/@.P@P .@!t/@P.@p/@P.@ 0H.@.@P/8.@t .@D.@/H- .@\HH/@P/0.@Q t.@//@PNt .@.@.@@-@/@<&.@. @Q L.@@T .@&.@. @Q @5.@&.@. @Q @@-y"@LF.@@ .@ ,.@ $.@x .@p0H-P (@  .@P` @  .@ (.@ /@P .@ &<L.@@0H-MPpPP' +P@p%`*g-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 N LO pO pO pO TO pO pO pO tO pO \O /QPB@ Q*N O pO pO pO xO pO pO pO O pO O /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 bNPJQ00 (@`/0H-0Pq;P @+PP+P0H0Hx0@-M@P y"@gP$  +P PPJ !@PJ  !@ Q S!@S[QJ" !@zЍ  !@Ѝ@r@- @(@L& 0. @0 pP@# ( @  1 `! `@o/8 (@P  !@&M4.@ H-@M@8 (@P! Pf.`@PU ugP! P Pefp"@ (P ' P! @@0p@ЍT.@  /p@- MP \( .@ R 0aЁ@`V p T0!@@Ѓ\.@P/(&)/O-M\.@Z& (P R 0@0!p 00pS*0 7 /0@ % b0@pFT !0# " 3 @'@ T  ! / P/@P  D (@PJ Q qP @0    @@@ @ 0S*@  0 p 0  @ @ v ! 0   W)'   0Q` !  \.@ p@ (@q    *bYHPp \8.@p #@P`U`v !@`KF.@P 0 (@PJV ֛\.@ 0V .u`V.P@ 8Qp /@P PT!@K /@2gIP /@P#P8/@P7\.@P  00\.@  @ B @ @0 P:(. ?  !@3K /@Ѝ@-\.@Q" ( R B@ PRPP RPP0520Q @p@$p'p 㰀$PJ QD (@/0H-M\F.@@P( P 8PP R 0PPS # 0@@0@(@ @@ @%_!  Ѝ0 !@Ѝ0HJH-M 0_PЍ0H-\8.@ 0s0 0@@Q@0A-M̈@.@P&\vP.p@2@` `(`,` P   P000  0^!   &q@ЍAcH-\V.P@@T6 p "  `VP   嬣  P   @ 痚@V ᐣ.@Hr&\.@P/H-PPdp.@`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP nWPPPPO-M !@ !@%.@[ܧ.@ [.@[w.p@[XPX m  @P!`@!@ uP+P H-Q   uQ+P  HP {I :P rIbPP .P bP  wP pP cP .@.@ [ [,PP.@.@`.@`g'p.`@. @pw0.p@07.0@ @0P.@@ Q!@PP !@C h= (@@P.@!0@ P !@~l= .@!0@ PЍ !@r@PN 3FP !@e@P  !@_@P !@Y@P   @P !@P % !@P  !@P  !@OPp&)@. @0p`P 0p` Vkd.@Q pp.@/0H-@.@PP.@PP (@P $P/@P(@PPP0pp.@/H-p0S :d.@Q h .@ p.@xp.@ p .@ SpE.@C@p.@S@# p- .@! @  0@-MPE.@C@,@Pp.@P l.@T.@OC@0$- .@! @ h.@ .@ 0.@Ѝd&. @ RQ L R  000!30 00?!R 000!6+ R 000!9q 000!< x 00!?00 00!<30 00!930 00!630 00!330 00/ R R R R P/p@-P@P `PpP PU:` q U Q P@ RPH- \ *0 R  B/o"SJ0H-P@@P:o o o p Hp ,?% ?? 0? ?  ?P? ?0  ???P0H-@Pd`.@P QRpW`QU4 U1U uP Uu```0H-@.@PP.@PP (@P $P/@P (@PPP0H-^Q R RA 10S* Q1S@-@.@Q(@P #@1S10S/ R/H-P@`PD P(@Q pD_P pQ`H (@Q p4_P  pQU3 !@@NFv@P@O-MpvX .p@`P!@@QP8 P0@ Q(*  ?YP U 0@ ?XP H !@F= T:  F5P.P bP cPp.@T*@y &bЍ .@/ @/@/@ /@/@(@//@/@/@(@/O-M@"]PP0 dp.@/@/@  `@pT*CP P PPPЍp@-MH.@@@\PP ` hPPЍpK-MpP@/p@@; Q2 Pxi /P@.`@ a 0Q C QQ P `EQCQNPЍG-Mp/@/p@@/@@Q `.@ P0 EnPUP@  AP/@.@Ѝp@-M`P@S\  0  @AЍpO-MH/@p.@@ WDP `p 0P G% pPW`/@/`@ 0Qxy.p@/@AQPI/@/@@x2` /`@p ARpP@ЍP` w0 I A ZY P/ @/@/K-P3 /@`Pp PU @5]P@ǝŝ PpUp W !]P p pp0H-@/@@P(@P0 .@PP0O-MPd.@P p/p@P Q( 0/ @/0@PQp /@jPg ` `/@P ~ `/@P(/@`I p/p@PP V@/@@(@ ?oR2R@Pp  @ X p ԁ 8 l  ~ ~ ~  ~ ~ x ,P4`/P@p@@/`@/p@P/@@W[U P P  ЍP,/@U (@pw(/@. @pAp@.@ [@@Ty ` @\P@V /@!P@VP7@/@@P e[ ,/@b0`/`@P  ZP  Q  p P.@Y)  PYP0`/`@U DP/@P I A(@QmP P0`/`@re,/@,/@PW: /@ЍO4,/@oK,/@EP,/P@h/@.`@P P QP P1 P,,@/@@/@P Pf B,/@,/@/@,/@r/@*@,/@@/@P P,/P@h.`@/@PP PPP P PP PP,/P@/@ P P P ,/@ P 8E#(@( @h .`@ PU P*  ZP X PP P` V:`0`/`@QQ [,P4`/P@/`@,P/P@8/@4`/`@[ [8/@8/@"@ RQQ *PP; .@PP(@P  !@1P"@D/@ P :p@-hP.`@@ Y'Q:-p / @P:00@T0Q: (@ pO-$Mx.p@0@ P p3@` 0` @OTP p !@@jA+P.@pW 0@0 @CSP p0@ P  0 ` @*TpP  p.P  <@$Ѝ(/@/@ .@R//@P /  @ 0O-MM@.@PP(8Pv p’PqJ  Pm!@4`rVd  P\ p !@ M9PT PN ⸞ p!@Q Q Q   /9P  !@ (9P  !@ !9P mP "PX Z P@ꠃ⨠(@Ѓ⤠(@   4/ ᜩP 4/ЍۍQ  R/3G-M.@PkSc(P@(`@PP3 bP^ W W Q PQQ Z  @ @ PD @ T@+PJ  P !@P nPd /@P) dpPp Q@`@ P. @! @ E ,  @ 0 !@2 E ᫐ ቙ᇙЍp@-P !@z@P U p@qh @X`P ,"@XP p@L_`P pp@-P@Q `P P(@V` (@V. ! @. ! @ @U  !@ p@Up(@P . @! @(@V(@P . @! @(@p@FpH-M@pR"PV`OP`P T`P`ЍP (. @jP`P`p@-M`/`@Q0  lPx/P@.@@ PAPP =P @ PHQʴ=PЍpG-Mxp.@/p@/@ .@BQ  @P`Q " 0B `VQ @PP Q  @/@@Ѝp@-PH/P@.@@`V F R(@ m/@ @oopp@-.@P@/@@ /@@(@ H/@H-/@P;Hp@-MP V@PP ` @PPPЍpA-@ !@  !@   !@`ypP  !@ oP  PipW !@  ^pP !@ AUH-` R _ @!P@pP kp` RH/@iPP/ Q /H-M (@  !@2>ЍG-@M$ .@@3TP @ЍY p`P P@U>V`:pLpT/p@" PHad@DTB H-LPH`/P@/`@P p@p]TPP P P7P @WP@T @g@@-@0L/@ @-@%@L/@ R  @-P@P@-u@L/@ O-LMt P.@/@ HPX0.@/P@/@/@e`@Lpc/@@/p@/`@PCP "L .@P {PPZ ?h / @>9P P B.@$Pw` /`@P P ..@Pc/@P[P" !@;EB`IP  @;VP :G;(;0/@c/`@P@`/`@eT/@PetePjpP6PD``P/`@ /PPYPF /@PU W W=WPI /@eP P P.W 0G P:u CeP/@@l 0`dP/@/`@p/@, R{Pp 7P iPP P dP  QP `P0`/@/`@iXiP i"@UHcQ @ l ܟ D ئ  h | ا @ ` ̪  L t ܫ ,  h  @ h  8 | , 4 @ d ` X | , Ж .@P a"@(@ `@Xp`%0`/@/`@.MfPC W W P #@Q2:PC/@@P/@P P/@pP `(@}Ai :P  >@ ECP A4 (@PH-6(@?]%CP/@@Z WSGQ  紟 H , , , P , P h , , , X ̢ , , , ( )& !@{h .@P 0 .@Pl .@P P7PM aGP3/@/@0@PW6PP 6`/!W @W *Wb.@P]P / @7Q  Q  /@6ag @m/@/@.@P(@` E !@Q0`/@/`@l 8 @Dc /@P/@rˡQ.@P% !@(sh .@P0 .@Pl .@P Q.``. Q`H,P/@`(@`%d "@J0C/@/@@m/@/@a"6P XP/@&(@*qC/@@Q 9/@ @Qb @*WbW !WQaQCP/@@(3 (@n #! @08H1@Q* @p P  .@Px 7Qt P / @! Q (@C/@@ 0/@`/`@eQO C/@@P h .@P0 .@PV l .@PP_WM-W +WHQ6/@4P; P$ /@ a@P3$ .6P  $Q {Q/ @ @2`QRP$$@"/@C/@@P keWs !@Yh .@PeD 0 .@Pe= l .@Pe6  Pe2  Pe. ?X|+3FHo?pˡN?:7pi.`@ P>?*7 _4/@P l <'?(?7pˡ? 7|/@QK PGh/@Ap\Xi.`@ P>7|/@Ph/@ N>7 p Vde/`@pp>}7gN !@Zh .@Pe 0 .@Pe l .@Pe  Pe~  Pez >N7?+ep>D7tdt/`@$%/@/@/ @0p0x/@|/@/@0 !@pe JP z !@{ RJ0ddpspp@d0# /@@ R  {JP  !@c.@P  t0t/0@x/@0/@0$| /@/ @ /@  Pe P {e9>%6=T!@pˡ+>6|/@QU PLPpˡ>6R>6((@(  !@.@P  !@R8n PL`/@K PX`/@W pˡ Pe  !@p1=|6|/@Ph/@ P %/ @ P/@ / @P0p /0@ ~(@=J6"P/@ /@ r`/`@ p `/`@ p P/@rˡI(@Mr=^6p|/@P h/@-^=J6qtve!.@`fP 7P  n pˡIP  !@` pˡ'IPU `/=5 0Pe/@H 0! #e d/@ !S=5 p :| /@t/@#t/@ /@k>t !@h .@Pe 0 .@Pe l .@Pe  Pe  Pe 4)<q5/@ *<h5/@ ,/@0& /@! @1" e`/<L5|/@P h/@O  /<85 Ce[@ (!@60/@^ pˡF PeH 2P fP / ! @p !@  !@ p@/@@]<I5 pˡ' Pe / ! @p !@   !@?}e H.@@h @aOPm P O !@~6(@` "@<4.@c9&;/@Px .@t$/ @`0V0 /@F`˱0 Px .@t$ / @/@0ppTd%/ @ K !@*6e0/@A/(X !@(4 !@G-p;;_4`㠣.@ /@ W xP`W@/@@RU  f PU g48We 2QeK-`PPp/p@@  =  P0@  7=`倐/@V VJ  )  P  =`@ !@5T KKH-4A (@@P 0/@P .@P8P (. @0s  H  /@PQE`f/@@.`@PpP pPp@-//@hK`H/@ @@ @P"@U@jw@`/@PoV !@jU U "@ @`/@p@0H-:m3Pf @H/@"P.PF#Pc $Ph %P.@PT/@% !@0H4 P@ P PE P0!P P/P@P ^ .@P1 /@!@P !@@+Q Q X.P@P BQ; "9/P+ 7P7 EP.@P 7 !@0H$P P.@P+ 0X/@0HX / @0 X / @0 0HE`P/@/@/P@0 ./0P/@!0H@I0H|CA-MP/@ H7/@   !@  !@  !@ !@  !@  !@P `@x!P@1  0Px@T -"@" @  !@ i/@Ѝd.@Q/0H-P@U NP0O-$M@`S   iKP `nH@@P @ pT W QdA.@Q =P 9 0AS R 1@P P  P *VPp Q:@ P XP ɔp @P JI Z P Y:HUq P@TA$ЍH-/@ /@/@/@HO-MP6 @JP,@ P!pP PJPQ !P@@P PPV@`pP V@:XЍ@-~(@2(@E !@P @៌  ! @!@! @0JP  & 5! @!@! @0@ B L! @!@! @08P U ]! @!@! @0@-0H-Q0P@ 8P / @00c !@0H20H-Q0P@ !P / @00 !@0H2A-@`PQ >PT #pP 5/@5 !@(PQ  !@!PQ  pP !@ pWK-MP.@@Q@P<J` pp3@㺉P-  0Fp!  ł$ 'WPMP+P PQP@P M@ċ@ЍἋGP`@VEPVnPVdPpU/@/p@PpuP cP eP PU*4vP #PU* PU*@xP@p@-`P/`@ @PD D  0D04 /0@/@Up /@K-PG pA@`Q"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi /@@-M@/@ Pi4PQ  /@QЍPo/p@-Rp@P `ᜈP p !@p@V1H-MT!@ O1ЍG-Mph .@`P0 .@PЍl `.@P @`/@PQ p p<iPU:P Pe`ЍGW @R d 3  BP`d`3`dV P HV)dppU PAPEP`p@-`Pe@V p#U `U aUB@/@PC@C@/@PB@t) @. @ R!@#" /@p@-M`7e@P1JP;P-.P);P&'P"V @U AU B@/@PC@C@/@PB@mQ t.@Q@#R" /@ЍpO-MPPFp/w YXPp YP !@ 0@ @CPP Ѝ`wp 0G?@ BPp/w P wp?@ CP O-M@`GpPGPPU+G(@PWP* HP Z P@T:(@P PP @Ѝ0H-@Q PWG R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@, P0P0H 0@-MP5 p /@Q- @T TPP% ) !@"@,T!@ /PPq !@ Trp ,O !@ /Ѝ@-/@PH.@@P P@P H-.@Q HO-M̈P.@@PV cP  Z >`{ P .@U Z;  7@U4 v @ P  P``pJ !@GP  !@GP`  Y` `P h @GpPp)`h @GP  !@GP  !@GP P T!@.[p/@pp\/@PPJAP C !@@.  0"@Z` @ .@   P   .@ .@ p /@/@PPQ? s #@!p@ /@4 0. r- `@ ᓒP EZZ P >GP T :6@T /@PUH P.@@$.@PQ`h @#GP P ,0p/p@( / @.@P k,P# "0W4t/@ !@FP  !@FP }@(@ ႇ/@P z@ЍZ~p\p/@PH P P  !@@z. YP W~+@-H.@@P, 0H-MX.P@P$ 0p  o- P @ R /@/@Ѝ0P/ H-@P`Q p3) THp@-M@qH}OPP J}.@P !@@.Pb !`@`UAU DU. OUaU dU' oU -P }0Q (P@ 0A q }iY0 (@p !@@;-ЍpO-M̸@.@PP  @`@U ~DP-*P@P U'*  pW gD P*p@P W *@PV3 `e b@V P ЍOv@@P * Ѝp@-`P  P@\P U  EPpT  =P p@pH-P .@ H*HH-/@H?P h !@,.@h  @rH".@ .@ .@ A-頃@P`/@T>DpUP W PE` 0H-@P%P PP0H0@-H.@@P @@e@eH-jp g*H*O-M-MP P;  #@͊! R  P \P P:P c ͊ @A!`@ PeCTp  DP `PV D2/P aP PЍЍA-@BCD(@QPP+ #P( @0PQ!@P !@-dP`@`CpPP PW {DP@PH- !@ P@O-MP !@ۄP@BpW/@O `(@(@ PP@WWVv !@`P !@`(@(@P/@`@P9 RP @ pWY P [@B@(@# 0(@! @ PH+@`@V/@ pv P!@ @W pP !@pp 9P ᘙ@U`PV ЍK-MP@`PЍPZBpWBp+P  \%"@!" @ 0X @:{pO{ @ L@-@ !@@ @G-̘ШP@.@.@`p#Q%QWWP P #Q%QP B`Q `p `@#Q%QTTP P #Q%QP  A`Q @p@-`.@PPAP# ! @0@yP`p8 `,zP1dX@ P.@/@ `P DP  `P mP  psPP$P `V:@U@ލH-M` @@ P !@ЍHP P@`@`px" @!" @0k͂!@@ƂЍG-@ddP EHP  `἗ ᫂@PpP@ppw W 0H-h@ @APP  !@AP  !@AoR0p@-M@P  P RۍpO-M`/@pP .@Pq !@PPz @PT|PPE-PDh @APJ De  %R R   0%S sS4P-@ @`@` 0p`pV5 U @ T@xPh ` @  !@p(p/@CP p<p[ :P @ !@@pفЍA-MP.@P Ѝ`O9 !@P @ %R R   0%S sSPC !@ЍA5(P?p?`?p 0`P+ፁ዁@ᆁT ЍAH-M yp    @oЍ0H-M\U@/P@P yp(PP'  P# G?*IPc(@ yPJ  P3?5PO(@ᛖ$PЍ0@-M@yPJx| 0<ЍpC-M@.@P `ZyP  / @ ! 0/0@Ѐ "!q p RЍp@/@-@>Pp/Q@0H-$!/ @@0!P 005/0@0S 0H0Hp@-`@.@P p<p `(@P!$ /%$oB@@-@P (P@3/@Q/O-M̅/@pWP@P`<P`n%@T/@PW]/@PW/@PP\t .@PJ@P`.@T(P`%&. txy/@.p@/@ f tp/@ W  06P`t/@ $@ $@P`t .@@TЍ@-@ /@QI( @O- M0p/@@P t U.@ P D/@QJQ@P pP`" /@P 2/@ `@!.@/ @ Q!0 1 ,P` P`EZ/@@<P t .@@P !&% .(''&%(P ('P ~(@P 2P4 (@P  !@$@X[WpW`P,P` ! %P' ! A(P(P+ P`'Z .@(@ % &/@P/@P #/@/@P/@@X t .@@`(PP` @/@P (P ЍOP`.@ Z a(@ ЍO0G-M/@,@P(`Q /@Q@/@p /@P t .@@ P T t .@ P/@Pp /@P 1/@ @/@ 0V R k0Yp@+a`P!&X 'Z~%#@YT Z (ЍG/@Q/@/@p//@P/t .@@/G-M P P ZP ЍG& p 09ЍpZ t .@@u'P" `.@P W' Pc@P/`@`& 0P@&X& !0" ЍG+ A-MP`C&p@p  0@ЍV 3&ЍA p@-tY@.P@` R ` r `V V@pP/@-@(. @P(@0Q0S0\ 00  Q 0R0C0$ /@  B }}@}&P( @0SQP/P(@ R/P(@ R/$/@/O-MP v`(p@@T <P2 @w}8f@V[ 0 $ @ P0004000@  Q  $/@3; /;X* >}!9}T ЍP/P // a @/ ` A/// ////0/0/0H-P4@PP }4@04/O-$M 0`V %@aCH/ @.P@/`@/@@(+G P //@ P ?.  * P( #+p P Y  E Y + ` po 0P `pP@l/@P U U`pZ P P @`V@p@DTVC /@@b Fp ` F FooPp V Vv pe P0 P,l/@P V VU T& PPC/@@` ) @`PATP@ t/@PA Q@P -CP`/@@ Pp`P0/@P`7l/@P+ V V!  P P C P/@@P P`Mt/@PX (+ PP`C/@@W|/@P  P 0E  P (%`V@aP/ @.P@/`@/@P  0  8/@PW  p P P p $ЍO  $ЍO-M D@QV   0 (*ЍQ OH 0H-M@Pt /@ 0Q P ;Ѝ0O-,ME@p`/@@/@wP &./@ 0W R ,W2P8S/@/P@P @lk T T g P P p Yp PPP P(` mP` $ `P`p /@P X  P0,P l/@P X XY `Z(N @TJt/@V@@P]t/@PXl/@P X X +&XZ`Z`E@/@@/@P: P P P2 P  P P PZ(, ~PE@/@@/@$p ` : ''P#E@P/@@/@$p `0/@PT R  ,Ѝ/@P U 0 PwH-@p P'Pp P P @P@P  (@@\( `(@x@VP@TPp@-yP  !@p@p ti@.`@P@"! p@V" 0s B @"! pp@p@O- M`@ #"PJ@@T! 000P ] !@ ЍO$ tP! !d0|/@P~  ЍO%P!!  pq V  Pt.@@XM !0  D &`P Z@XP)+ Y`@!& PXPpt .@ 0  @ /@ H/@0t .@00@ `@/@P 1 p/@p{! 0@ Ѝ 0pH-M !{! r   0ЍH-P  !@Hp P t)P. @  BHp@-@P`P1p P`P|/@P  p@H-M@Pj`p pP uP  !@P@-Ѝ|/@P d/@ ЍHd%/ @  !@ЍHA-P@p( !@B`p!&  0PP0Pd%0`Vp/ @S AC !@AO-$MM@PPL !@P(/@`P0(@`1@ (`(@1,`<0 14q0/p@,/@/@`P`(@ h @7P !@P)@` ᛇP ,PNh !`@ P  P! Y !@ P #nGP g !@ P m !@ P p 0 S SP0g0 `<S !S <SRP=Q P=S >SHP=Q P P=QP=Q P P B H t W QPQ@ Nh Q!`@D QX4/@QPR  !@!@[Nh P!`@HPQ4 Nh Q!`@8 Q>4/@Q68 C^PNh !`@4p ( p! @Nh !`@v !@,4Nh /@!`@Q4/@Q 4Nh /@!`@Q4/@QWp Q Q q"Q#Q P Q\Q Q Q Q P PP[ =t+P `P+P60PNh T!`@0Q Pq/QTPP P=P P/Nh P!`@U P PP=PTJ/P P P TP Q Pq/QtQ Pq/QtP P P/pP U U U   !@!@cR  !@!@]MPU U UP `5P `P- !@BdNh P!`@ U UPU q=/P LQ Pq-/QP"/q/P  ὅP* ,/@$ЍۍA-MMP(/@`00/@( @! @ Q `0 ,/@:ЍۍH-Pp^P' \P1 @aT>0DPz* 0r !`0 B@0TS@0:Q r P (@8/@ 8!/ @0P00P08!/ @  S(@0QkD P00Q- `0TSCbCPP ZbT eT8/@T  8!0^!@"!@V#@="@CSDS LS RS +1S BS %US" XS   C^P#8/@0#   8 /@ !!@  8( /@! @ 8!@/@P !@``0H-B !@DC/@@P  @S !@HC/@@Pd !@ KLS/P@ @/@@/@-/@-S@/P@- @$T/@0P3//@/0H-L /@ | 0 0 0 R/@@/@@/@@ /@@$/@@(/@@,/@@0/@@4/@@8/@@</@@@/@@D/@@H/@@/@g-/@d-S/P@`- @$T/@0G-MLp/@`P? U/@/P@LC/@@7 { H-P/@  ! ( @ q W( -(@ Q Q |P %p|pp0/ @ (0|P 0p|pp(0|PP4    P 0 E2/@AQ 0|pQ`|``q (0P %|0Pp`|``1p( | | (|/@ЍL%/@/@/ @0/@ S Q/p@-LS/P@` VC/@@!R, `V`|/@ `pH-pP0U H1`d.@PPVv@F@PLPGLc@/`@P @Q GP 3@P, P 3P"%. @.@u 5.p@.0@@p@0@@ d.@P A@P@@@-%5.@. @.0@.@@/0L#L/ @/@ /@ P/@/L$L/ @P/@ /@ /@/Q/H-D/@'PH/0H-@PPD/@'PH/@x'@P@0p@-@P` hPp(P p@-@Q T5 Q \T.QJ}) ! @ R  R DoQQ PT D/@''PQ/H- H/rA-8t@/p@P`P  Tw X/@  Pn# T!/@P$/@0D/@@P `/@)h /@P PX /@`PHdv.p@P6 0/@P( QhTl$/P@/ @@ Q0l/@2P@ lD/@@n`/@ ?;`/@h$/ @P l/@@h/@ 0$h$/ @ Q P P P `/@ `P`/@O-MX(Dd/@ /@@/`@pRP P /P) P@/@PPC Pg @P} @PuPD/@w/@*hW/@PU $/@QPO L/@ 0S S CdfQ.`@CLc/`@P p n @P6{qS@/P@w@[*d/`@/@*M*VUEQ@tT$t/P@/p@Q/@*@PqNP L/@ v>P ,/@P<L#/ @@L#Q/ @ p# P/ @p  QPA/@*q@@ PQ_W df.`@ P_p_W PpP_PPdf.`@ W)/@P) $/@QP# )L3( @ D/0@/@/@|p1R0AMQK B1Q0BR @EPW^i `p CpW p!0 2kPQ? PnSj 'P/@p P\@ `  0PPAHA(@@Dhp"`@@  PpGW4@2 ,_p/@PPPwxP   0ЍOPP l >P   0)@P@pp@ЍPPCA-hP/@Pld@p/`@F2 0 PpW@@-0D/@@P`/@O-M0D/@@`P`/@8/@PZX/@ Vd㜵xy/@$DL/`@.p@/@@/@P|& R /@/@ lU/P@ @R    @R /@QHT/P@Q   0 0S  h  QP.@P Z.@PX/@Q PX  B   :@ @/@PPЍ0H-X/@P#Dm/@#P X @!P@p @TD/@P0Y @!P@p @T0A-Ls`@/p@/@ P@P ʝP` $/@/ @0QT4 /0@ @-L/@ 0RA ^01 0RL#/ @(/H-4$/ @ R x%/ @ R P @ P L#/ @|0S1(00 P  B! ~ $/@4/@/G- p`r, P(p% c@qL@P/`@/p@/@@UP@Pm@t T`pYXP`PpG-@/@pPTl@PlT`V V nPT }nL/@ $!$onmnPPPO-M Pp` APwP;@LC/@/@@P@ P# `/@v+ UpP 0@Q: QBQ* PBPE`` P `pZYЍ`pG-M`VQ &p@  }PP  @  P@@@m 06`F@ VR:B AЍH-tT@/P@` pP 07pP Ls@/@/p@ @P(P`G-x.@`t.@ RP 0!  t`@/p@K 0R`T@ 0!  Vp@-@PPJ`s+ PP  ,P (@⃂Pp/@P,#+/)( @2S/Q/(@2S P(@"R P(@"R P(@"R P/H-P(@CA-M@P`p +P P p P@"PPЍ@-X%/ @0 S $$4/ @/0@ 0@@x.@ P O-MP,D/@@<` @p/@+ U/  0  @9/@@ H/@RPQ x$P/ @0p(#*p)6 X 1@/@P Q' p pV/@UEQ@/@ P @ P1@TpW @U Ls@/p@ P  P@ 0@VP V  /``t$/@/@pQ/@ # "s/p@P@ @T/@% @ $/@/ @0QTL#/ @4 /0@ tpX/@@ @T`Q3U p/@$L/@ Q&PR 0ppp0pqq 0R A P ڠE`/@@ @PЍ0H-MP X@/@QP@p2 0QЍ0/@ cR:c/@00/@ P!-/ @(-/ @ @/O-/@pW /@@`T@`@ `P`P%`&`V pW@ᐍP/@`/@V pp`pp嘍/@`VPP ` 0 p ؠ P TP PUV RP0A `pVp0 `0 R A 0O-MPL/@P@%$Um/`@P m/`@ pRpPp` !Ѐu-`/ @/@WU0Rp0^0/P[`РV/@ 0`Gp&'B XV  0#ZUP  ' P(`ЀU/@ 01`p&' X&U  0/@ Ѝ /@p/L/@Q  /@  !@@-M/@@PJdP-/ @  0P !@O-MPPpt @/@Q ` 0pRp!# " /@pDP5 pU"p# pMp R0UPpF*PЀpU 3c/`@  0p + ! XU pЀXc/`@  0p + ! X  09 ЍO-M@`PDpo/t[Jt.@ Q@`p!&o T@P` pu P`&0 p'pЍK-@P( !@S누㠓/@/@`PpP 0 0@`p%/ @ R/%0/ @ P0S/O- M`-P`r "@JH^!@Eee!`p3`!py` @&PPP*P @@gi`b``@;Y  !@  H /@@ ЍOP P &@ & ܹ@x" " @ 0} h@TG-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P !@'@r  @fP: @$ 嵾 "@  ^!@ 5c 㬹h +p p  Y `P2p pPwP w P  ppᆸ @pw W p pPwPw P  pfpᇮ @o+PUm /@PK-НP/@p@4T 5T'#T'a3  `ppPp h@ P6TH-o0H--P$P 'P( /@jNH.P ^P D.@/@@PPPPnP  !@D/@@P.@P gP#GP @p !@@J.@PDt9/@@ .0@0PP 0 g@00H-MPP @ jp X.P@PP0P g /@ꖽЍ0a@Q /@/A@Q/@N@/'P/@j/#P /H-M !@  ЍH-P q  /@Ha@-M p M8/@@.0@k0P6 5g /@ЍH-0P7 ]@/P@jTx.p@p d/@` Pff& gfP P`pyg`P`P@ P H30H-@P (. @ Q !@n PA00H-8-.0@/ @ 4 0 S@0%@$0 :p05Qa#3Q'H-/@0N A R qG-zЭP/@@rJP $`&Pff@D6tO-$M/@P*   @ ,Mh `/@@ @!@P r 0 pW>p %P  0 p  ` V$Ѝp@-MPmPI PP``P> @ P Q `@ P.JPt.@UP UP R Q @ QJ 0 S  0 S  B0``S# f `Ѝp0H-M@.@Q 6 !@Ѝ0H P P Pٶ.@g0 (@PJl !@0 (@p  .@ !@e Ѝ0X !@ !@ζX@.P@P e@jeЍ0H虾(0. @0@- MP P PF.P-#@ (+( @Q, !@'( (@0s&* @! @ +z#P DP0@0S @ !@#@ 3Q !@d/@ !@ Ѝ( (@ d/@H-M( (@ R Jt @2.@0@009 d/@Ѝ@- MP P PF.P- @ R,+( @Q,  !@', (@0s&* @! @ 㺳 #P DP0@0S @d !@ @ Q 2 !@/@H !@ Ѝ, (@ /@H-M, (@ R Jx @2.@0@00/@Ѝ@-MP @P !@@R Ѝ@-MP @<P !@@A Ѝp@-P Ppᐵ/@p.@P !@p@* ᛵrE@P p@L6Pp `od/@ p@0H-MP P P"^(@sW@(P@P(@P id@ Ѝ0H`d (@ !@ Ѝ0@-P @/@P 0.@/@ "@@0H-M@P P P5<[/P@lP=P MP hPW@(P@" </@/@ T!@ mP wP sP@W@(P@ < /@P< /@P@W@(P@cЍ0P/T/@僿P/@Q*=P/@- !@G(@@R !@  !@ !@!PxP< !@v !@ !@ !@ !@@ !@u !@@n@-MPd cRA0BSA@ ddededeedeeeeddededdeeedd +mRnR sR uR.dR kR(       1BP O%/ @ R, !@Ѝ@ @p @!@  Ѝ !@O-MD!pP@/ @0T* P@W@!T*00@ P ? ` 0A? ?*W@0D!X/ @P0T* P@WT ,PSS )( @0@(@ЍK-MM@P P PC ߍۍK(@#@ p @P DaV @p,/`@!P@W: ఀ !pW #@ e @@@ (@  !@T !@@* ߍۍH-MP P P1P  R! Q"  !@ЍH (@(@  6 !@  (@(@ (@(@ (@Ѝ0H-MP P P/@_7 P 0@P˾@h @!P %/ @ Q>/@/@P E/@Ph  @@ !@Ѝ0@Q*X !@P.@/P//@P J@-PE/@@PȻ@-MP E/@@P i !@Ѝ@-MP E/@@P  !@kЍH-P/@P.@P<pH2H-MP P P 0 (@^R Q0 (@¿ !@ 7Ѝ0H-0MP, P P4EU/@@/P@,P,, !@JQ"  !@@/@X&0/@! @ !@@ , !@-Q  !@0Ѝ0,,P @-MP Pc P0QSSEC ^: $nHnnnnnPnnnXndSeC ^/ $nHnnnnnPnnnXnC ^& $nHnnnnnPnnnXn #RS WS ^S   S -S rS wS S SG 1 CR C. 0!@9/@ E  F   K    N    R    W   0 >0@@ 0RQ-I !@G/@Ѝ%h5/ @/0@ /@0R  S0P /t .@/@ `/@BP/@-颾D /@@ !@uO-MP ܔ@/@P Q Q 2/P t/p@@@ HQ~ sqqqsqqqqqqsq`tqqqqqqqqqqqqz` V  P@a ERPP3Q Q =QT QQ3 !@aHPPP3@`T @PDrrsrssss o% ! QQUP   Q Q~ X$ nX z/@Pn  Q @0 PT  `R 2/V _QOD/@+ý !@ 0P1 `+P.@P _|.@-Q ``` KbN+Q @@ +QR /@ 2Ѝ `P !@ !@ @\ `!@H-M0S  /@! @0*ЍH ! @*/@ЍH-M`@P<p-W0A Q:TU P!@ pT-W` T U P!@ ЍA-M`P* @pPQ& /@pP \Q`P \$Q T iP` `Q !@ i``ЍA-MP  @pP`@W@ f/@ !@ !@ЍAEW  S/@ !@ 7QQW W!  @POtxxyxyyy0yW5 W0 W?oQ5W* W W/ Q QV%WY W W  QAP4 !@  o  P PV R X2/@PX U@Q *pʄ !@P X  /@Ѝ` !@RPSo/Q  "@ /oPH-tHX !@///@P/H-M/@ /@ !@oЍ H-MPp`خ@0D QW1 5 aR0`0FR`@`3 0`C V:R` 0bkZ`0bA` `SA` jbah#fd `0+WV !@`&Ѝ, /@/@ QR/@- !@{P /@4 (@Q@P T 2/$@P4+( @0S/ S  C Q $0/O-M4[(P@0S@ ` pW) >P@AAQ:-P X T T DoP堂 p  p$PZ  RQ   Q P   ЍH-* !@P1P(@/O-M``@/@p.@P/@Pkp/@P6  /@ ppP@ /@QF  /@Q(@ /@P S a0(@PN iQ/@Q QB G  rSPP &U/ @Q8u $ P #P U/@Q'/ @P  A,S/@P /@  /@ЍH-/@H-M H-M@dP``*! @0pP循Ѝ0H-@dPP W: /P@!@ 0O-M(`,Pp 0[@ 0!W!)  %L&9#,@ʇ t'6#z'0 X ppPpj`VP3UЍK-P@p*`d0%"W$! y ($5#  W4!00 0dp W2O-M@@ 0pP` 0*"CU_ᐔ  ' $5#j 4#Z%0Yppr@W3[ЍH-MbAQA#,/O @" @ VRЍH-M/@ /@$w/p@QP P`@V ?@`PЍ0H-@, /@Q [W((P@/@#P: @( /@0@-'(( @/@@P(@ QP /@@-@(@@, /@Q/$@-P@PK-MO  Ds P`!p@? Fb@  E y-PoЍK-MO  Ds P`!p@? |Fb@  E y-PoЍK-MY pDC piB P`!@@vaPpEy-PoЍO-$Mp`P@0@ Xa@QW@A@Q7@2XJX 0`  @0 t@P PPT$ЍO-Mp`P@0@ Xa@QW@A@Q7@2XJX ?`  @ ? ;@PPPTЍO-M`Pp0@@ Ta@QW@@A@@Q7@@2TJT  0`g 0@  pPXPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `pP%{ʷP `rpP 0P `dP p@pЍ@-M@ P @IPpЍH-8 @Q 0@ @ pH.p@-P0 /@@KP, /@P붯놯ܯ.@`l@ !@P P@.@Phx .@Q /@p@L p@H-M6 U# !0@! @0ЍH-@P`pzJ㠯3P PPPP @PP @PZ, /@0H-M@PP 0 (@0t n# !@! @6 U# !0@! @0Ѝ00H-@PP @ᷮP xx .@P /@ QTx0K-M@H/@jPPVP p 㚩 0PppV%㎩`.@/@oQ"  bpP XX  !@P #|X`WpU uXЍ@-@P jXo/O-|MⰰPᤀ@᠐ ;  ` /PQ  P   0wmoP  #` 0V pB `CR JS 0@ S pwp`pppp@@P0S ?` U-H/@ [Q0 02@Q0R0s0Z0PU p0p[X 2@XRqQ 0S @PE T:  ꤀ @ 000![$ "(; 1q0WQ|Ѝ#@/p p pt .@@ t .@@t .@@4/@/N-4/@pt.@0SC P Q 堎K-p4/@ t.@Q 1PC00C1SPʁ蠋H-t .@P4 /@ 4O-Mti8.`@/@P34P/@Q Р +0* 0 P Р@+0 p*p BEW4@4 /@@P *+@ЍK-4 R/@*t.@AQt.@A 1 0# "  0AP 0$ `%0  0a1X @ p%0  $ @P@0H-4 /@ @0\0t9.0@^00N @@\@ 0^00H-t .@Q04+/ @ @0P0s0: Q00 @- R 4;A/0@01$ P r :0Q tP.@@PP@/@- #@ェS:S Q\S 0SS/.SQ?S/(@0H- <[/@/P@@ /@oPB(@ .@ 0(@H-@HsP/p@H `/@  RP  hp@-@S0P Cs/o"TJti.`@@T @A !0  /o"Rpp@oP/@/H-@/@P dST/P@`V .@P ty.p@P@ r ˩e@@T)o`O- M  (@q F ( &(@. @ R: /@P t.@P'@P`p ! &@  [  0!   R/y롩@T Ѝ ЍOp ЍO@-@P/@hT/@ P d/@o@^ !@@@-@P JS@h/@p@-P@U `:S8SVPxP/@/@ Dp/@p@-@`ᚯP  /@0P PVPpH- P BR Q9 bR4Q& ^ RN  Q P@pR @pR Q Q PPPP P0H-P@= /@0P !T @00H-P@% /@0P  0T00 @R P@P0K-$P @Yp/@P  (@0`#( ( (@P%`$ ( `U0%h0/@ZQ  %0$  ! R (QY %/ @ R d /@PRH-h/@d/@/@ QH0H-M@ Pp g 0.Ѝ0@-PC/@@ PH/@/@@0H-P(@@gP P/@ 0@JP J/@Pd/@P @0O-,MQP@@P@"PC P/@  :U/P@P /@Q dSP/P@P01P /@PJeu/`@/p@ d/@h/@eQ Pg  !@P P !@XdP/@ `p^`p!&WP/@P PP t .@P@'  P"t .@P@`pP`p&'*`p!&!PU`p~ 0m`p !tP.@Uj`p!&P & ' `$pv[[# P 000 P' /@/@@oQPZ5 /@P /@P  !@w ,Ѝ0  !   $ 0  !  d%/ @ /@P /@P H-P/@ ToPG-M`Q `P@pP WPQ:PP H/@ /@PH 0/@ PQ P /@  PJP tPpVp []wepЍO-M`x .@P8r4t .@d/@@p`"/@P  /@ P Po  0pS I084@Р`@+0(ؐ`oP LH$/@4@P p D, (HL !y  W` HTLY ` HPLY YIV 0@@

`@pp,($(,0 !  PaJx#0/ @4 P@#p"`Rp`Oo``B` R  Wp P P&P  0t 0!"P (/@ !0   (@$` T T(@$`TP  0 !0  P 0(@$`x/@/@P<Ѝ (cH-{/@ "Qp@-P/@@UPS/P@@T `LV@Ν` 0p ڜ/@` /@pp@LO-MHP`D@p0SP@ p-} P Q Q) @ @ 0  9 0|E W)  @*pWQ pP#0/ @00  00B PPЍO-Mp`0 V A@T5 P @V @Р @V @ (@ R Z ` 0(@T @Z @( @T  @TР(p V@ T< . ,,`0@ i+ A + ЍT$p% " Q  p .p, `0@cppP p p Q p@" ' @Kp pP   pp@@ i+ A +Q `X00SPU  p X@ WX  WX @@8p@Ep ЍW O%O5p@-P@U P``㋜P0㇜ Q `PP p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLppH ppp@ ppLP^    QY ?h/@ Z   Y I$ЍH-  @b&/ @/@ RHH-P  @OX .@@ PE  @A> @H9630-H)H- @#/@/@PHH-X @&/ @/@ RH}yA-/@@T P ڠbٛ  CAX @ ʛ @/@P tixy.`@.p@P7QP .@) /@/@PA.0H-W(P@@T   kJiJgJ/@/@/@00H- (@!@P @P&  !@ P  !@ P  !@ P h @ P AP J1A@@@@@0O-MM@P `pP T 묣/@Vb(@(@)@ YP  /@P P @ Qj Pp R 0)@ p @ 0pRo Rk Pp`0@p@p W P0`@P@  pW 0`0@ 00RE @`` R> @ 0)@ 0S0 0p0@0S( 0 0@ BQ QQ P 07 (0@ 0   XPg)@X ᵏP /@/@(@`!@ PKIU 묓/@/` XPw p!P  P  XPe P P"Q `Q Q Q@P  P,  ^R  R R  0 \R0Q  $ 404 RR 0p$S $Co0?)7 (0@ 0 wPN /@(@/@ApBJ !@㧽PŽP;`FpV7p #@W`pₙY  !@0`pvW H!@S~HXo(@P  /@ /@ppGP#@Ѝۍp)@X ᮎO-M`/@P]   ЍO!@Pp/@K 0  gp!*@PQP@P3 L/@P  0X/@P|`ၺ `0 Ⴚ 0H`H 0zX < !@ Ѝ@-P/@0 (@/@S @T0000@0 BR@-P/@0 (@/@S @T00C00@0 BR/@//@//@P/忾H-P p`Ꮨ@㉘\PUa y{\G-餓`/@P@dp QQ Q ? Q H-P ?>p @9>PCH-/@//H-Ms@/p@ Up P`pVUPPЍ/@-@P G/p@-P@P`Q0/ ! R:`Q  gF`@pH-M 0)PЍp@-Rp@P`@TpQA /p@-@`PVp`Vp/@-@ R Q Q! R * Q QS@SJ@0A-M$`S R@x0V@"Q^PpP` 00(0,0 00P0ЍO-M-MM/@ /@Z/@ P㼃/@/@pP )@@ P @;PP #P o   !@3P _ )@ZN 0R `PP@F  R00Q )@@-`# @P{ R  PR S RQ @!Q R0TPtH F,R @Q @e0P Q )@@ QQ @ pP8 / p) @@.W  )@@0P ``@;P }PJ\PPN $㻅 |P @`P@TZ_ /@ p僅Pp`PPG \P V P P "=V   0@ Q*\00ASp 0S*:Q5\P&P\`@@PP B`I `P@A POPPM/@@ @PB p@AA\PP  @ Pp @I P㠠` PQ )@@QK 0H4Kp @IJ 0(Kp Pl )@PE> `(@ Ab PP (08P p弃P/@/@A )@@ @k P4p``QgPe M/@@ P`[  @JP@ TQ  Jp1*@ Jp)*T`V H !0q1 A p$`((;P }PAJ A L 弃/@ p` VP R P)@ @ RPP1 A R*PhI Q@_"P t@P@hQHQIQ gQP  iQ pQ1``Q Q;Q/@P /) @@P?  @ P5;P3P/wQx )@ R 0 @ JA PR R Q J P@ i /@Q !!:p PQ @ !@ /@Q Q @ !@ Qu @ !@mp pP0p`V @ P0@@\V0S& 00@ 0PQ @L @@P pP; P 2PR3P `lPN `@ \R R  0S S  `P5 D P@P GP(\PaV PP `㲂 pP @ !Y9p9Ă p. p+W/@n``H !@@QU pPIBWP`VT/@P mX/@|/@d/@ލڍЍ !@` !@\ !@W !@Sy !@O !@J! !@FG !@BU Ş !@8! !@4 !@0{ !@, !@(d !@$ !@ M !@ᱞ !@ !@ !@ F !@k !@ !@ !@T!@ Ꮮ !@ !@T !@သO-MPE TP@/@qP{P tP rP 3aP bP/`V P p 2pR p/@X PP  fA@TЍ !@A-MM@0 A R * uOPЍۍ.Q$Q +Q%/Q \Q `>P P IQPR IAo`APB !@Sb !@Op@-@)@P  P @ 0S SR { !@SP, `pO-M[` [d \[f p[]` \0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" PP]UW0C0 U \U nU 0p0]Q pRp00Ѝ@ !@ !@O-M/@`㧀p @\P \Q Q: . AR [Y+ P[R[& \0S! Y @P ]Q [QY[[Y][Y   P R   P R @ P` IP|/@ R5Ѝ !@HH-M@P`pmPn@ P2xxx x(x0 aP dP fP       P pЍO-M@P`p$ V ?P P[P E@ Z *?P  pP P@Ѝ00@?6SC \\\\\\\\TT```````444444``````````````````````````DDDDDD?Q7@?QW@Q?0|/O- M`P) !@Gx /@ą)@X!p@/@0@ {\HPa@Q&T(X/@EP GP_ IP/@!/@*@T  '( @@ /@ P!@/@ 0FP  !@l/@ 07P  !@sl @~'( @@vp))@/@APU ~'( @@P%PU ~0(@p 00p"g@(`@p~ pP PU/@  P/@ @0H- )@ !@0O-MP/@ v@`/@/p@/@/@P P< MPu-Pz  Q Q!@P /@ 0=) ! @㭌P:" .B/@/@P:@P /@#QnP/@Vc/@ p0 W8 W @@P/@@@p70@p0pp` CRp  -P- Q#Q) T  P" TP P %/ @ p @T ЍnQ%/ @T!@RO-MM$v/p@ fE,P/`@/@@/@)@/@(/@ RPH 0&!@/ @X @  4V/P@ XP; QJp P P/ P z5c4P R4P4 /@P `PP ڹP4/@ ;4P4V f/P@/`@0/@P (/@(/@P Qk H5P! `P +v+C PP+j+ dᶜA5 X4) /@! @ 0d P*5PP t4 /@ @ vP k 48( P3  P30/@/@P/@4V f/P@)@/`@ 0&@/ @!@EP4T!@6j /@ ** F /@@/@ \PP u  E PEP   0/@Ѝۍ T!@ u 9 !@!@!0@  @c !@ c !@i4 /@Pl !@i4 /@\4ᮈ? !@ޘ@-$F/@@ Q p C/@P /@QoH-(@/@pW e!`@᠋P PP ۸p ዸpW@ Mp@- MM @ $$40 0FC /@!@0/@@ s Mp@-MM@$40 0*0/@ /@C !@KЍۍp@ Ѝ/H-M4~P/p@@P ; 0]`{ 0]ЍO-M8F/@/@@P ,)@\XT>PnX/@/@/0@/`@/@/@Y Q P# p RPU PY P >/0@P p R Q Q Q PAnP$ P( Pl >/0@mQU_ P2 >/0@3X\PnT>/@/@/`@/0@PK?AoRX\PnT>/@/@/`@/0@PPQvX\PnT>/@/@/`@/0@PkI/@P5 >/0@0  OT>Pn\XP/0@/`@/@/@ PPQYQPPSPPO/@P  >/0@0  OT>Pn\XPP/0@/`@/@/@3 PP//@P >P/0@0PP P OT>Pn\XP/0@/`@/@/@ P Q QQ*P PoRUo DA7PdP   (8 HT ,  P $ H  PL@T2 P D P+ E  F/@T>Pn\XY/@@/0@/`@/@/@,x/@P  =Q /@㍉^!@ 0`/@ wPp !0pa  0PZ^!@ 0X\PnT>/@/@/`@/0@P J{^!@ 0T+X\PnT>/@/@/`@/0@P /@ 0! ; P  IU P  P0! % Pv  Ir@Td*pj p/0@_`N/@@P  !@ 0X\Pn/@/@/`@ 0*b0p *C0 (  A1P8 G PP  E   p ex@P ! p Wx@PT>\/0@/@F/@@0`(@p PPvPsP; .p/ @0|./ @ p p p LP T>Pn\XP/0@/`@/@/@ \X`Pn@/`@/@/@T PT9Q/@0  p"p!`/@09` /@0 P" @!P R /@ 0!/@0 p[JP/@Q P |P/@   LP P{x}0/@PP `/@ 0@-AT  W: P`0P @TH`/@ 0@P8,/@ $ (/@0P8/@ @,/@0\X0PnpW/`@/@/@~ 0/p@  *b0*C0 8 A@F/@@ PN8/@@/@0 @/@ AKP/@ 0v.8/ @ 0p/@*g0, /@*C0 A8 @P 0! U P  FFp/@@ P  T>Pn\XR/0@/`@/@/@q !x-p,   I-P ^!@ p?-X\PnT>/@/@/`@/0@P @T /@0! p P'" p[fJpP/@W pP pp|/@P pp  lKT>Pn\XP/0@/`@/@/@ 8,FP/@/@/@@B k !@PQAh D.P(@[UPn\X/0@/`@/@/@T>Pn\X/0@/`@/@/@8,FT>p/@/@/@@/0@x/@ (@F/@@ Q  PP /@ 0! b P  E|2T>Pn\XP/0@/`@/@/@TЍ/@ !@fO !@a/@, /@! 0@. P ,/@ EF0/@@Q >0!@ 4 i !@ T!@,H-P@` pP$uW   G-MMP,F/@/@@P3 X㚅Pp/@!@!R R"0քP `*0#P 0*0 PᵱpW:@x/@Ѝڍ0/@@Q =0!@ ᧑/@P  R {RP` /@!@ 0mp@-PpP@`{P wP sPp +P` p +P`@Tp  T!@kO-M∞/@耾` @)@/@P 0p&W \W1p2 `/W-0G`2p#  pp'  p@ Q :t 2  0)@W `p0\W&W``\p P :t)@pp P:tЍK-P;L.Y`P @ݐ./ @/@0@S@ @` `!@PP" P@p@@: AR 0#h#$#P#D#h#P# 3!Q , p0:KP! PBQpPP Tp  X P K3 !@ np@-@/@PU- P0@`P P PU P$$$$$`$$PP PPP@pA-M @N*PJP `+@* P *p !@%RۍAK*T!@ () @0Q0p0Qp \ 0 /^H-O/@@w`PpVP`WpU0PQ S0R ^\ P`p PP0P4 a*dB(*`` DHi # @-h;00@0\ 0S ?^/0@ @T P PP Q QP RR  P \ 0S?o\@-h 0@/@  0 0L@Q0 @ TQ Q 0 G-h0@)@Q <P P @PѸ ڰ ? 㔂% @<< `/`@ PEuP@ @p@\P P  % / @TP @PѸ ڰ  X/@P  (P % @ ,P % @ 4PP Q P @PѸ ڰ  #G0H-M@P\ "@Z@PqBP#@@ /PPPP@.@?PP)@ pPP P !@ !@7A @p Ѝ0PPLsO-M@)@`2 ~ TP`P!@/p@!@T   / 0'o AP  PPQP@T Ѝ  lA}O-MP/@ p' !@ /@ E`P0@/-P  )@#@@ 9P/@`V& Q 0`-QV-QpeGQ QeW kW iW7(0@7(0@7(0@0V6k !`@ 0@@p 1NPPa@Q&t/00//00000<00h0.0x0000M !@DPEP IPK-P>@QP7 SP ?U !@p^WP p?Pp^ZP ?P^YP ?Pr\ !@m p)@EQ`T'hK 0@@$P/@/P@ (hD(QPPQ gH(5P  ZP/@/@, P // @㨛P f )@!@ P| !@ 6 !@ 1 !@ , P  @|P PB @!@fP;  !0@!@;  !0@!@\ "@~|H-x )@ !@w|p@-@/@?/0@PPUp= "0@; !0@ )@`!@ oh 0@P UP U !@U@ % !@0p@TU !@ !@ p@H !@ 0p@?O-TM_\ `p!P@0`@P  LuPPp GP gPP)@PU}@X (P pp Z |@pY P@ @[ P`@"P@C=P Q WO gp a 'p  "@&p T!@W &p !@Z <&p !@X &p!@P @}BMP"@@, @! @0fT!@ ۭ͋f !@Ἃ !@ ᴋH-t )@ !@~s{@-M@&P   p Ѝ !@ ᒋ0H-M@Pi P P ZЍ0T"Pp H-P@P Q `CP <P`P CP rQ <`V@-@Py P   0H-x)@a1S  @ P PU  @S*Q0Q aD A0sPQ  0 c A 0C0 @-`x$) @!R0@T 0RQ ` @ rP   a @0 BH-QQHH-RRHH-SSHH-C)@0  !@lz0H-(@/@@Q0vP6 \P  5AV0P@, / @0 / @v4@/@@m+8P/@ x$) @!A< *q000O-,MPP_U.J4/@P)8/@X# ! PP !rQ 0p 0R)@㰰(FP , R P 2/0 R  2/ @P!p0@pp$p ppS pQPPP P `PV ` @`Q|l  P0S 0,/@0 @sR Q1D@  @r  1 PUʰQ@ r R  @pPV`ӼtP1S.P@P?P T@PU JPP`` @PV` >pPV `Pp@0$/@ PS`/vQ  Q `@ @`R ,/@A 0PP? uP S~&(@  0Ϫ $ Q 0@?oA)`@PPPvQ+P @Q0SP RPG@Q CA`GACAP* ?Pv < 2<uP dP  P@Q:P wP uP qP!RP SPU PQ  C;xP ,/@EP,/@PAqP$@ᨫᴙ0@rvo()`@A ;o)`@ or0)`@!pS B   ; ;(o)`@ xPQ zPaPxP@a@(P(@P  :lQ%v P xNU4R``  R  2/pU P!PU   G u `P K / `*8`/@1 u P 4 P ~*Q P`P q* P`qV4 R  2/ PPP  P,ЍA0$0/@ !@  4$ !@a0 @ @',/ /@ !@1 @ pyvEO-M@Qzup' QP- | `P@Ug 0{UP` p` zP@U 0eUQ p@ 1`VpGs\ R0A0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PD !VPUrV !   P (q 0, `PqUP 0!0@  t!A ЍO輩8 / @ /Q/A4 / @ R8/@/O-M48/@Pp*@/@0 T` y'P4 `  늠`P   @<&P   4 H0,!0 S , ( Q- ! @, 80@D04<Pp岑$0( 8@Ѝ@-PJ4/@Q8/@A P P, A A @ @Q/Q//0H-@ /@ /@P@U U,U0/b\ H-- 0! @cH=@- Q@PЍH-Ml /@ 0,Ѝ/H-Mk </@ 0ЍH-M </@ C0ЍH-Mi </@ 0ЍH-Ml </@ 0Ѝ//////B "@/4 !@/= !@/ !@/ !@/ !@/H-M /@000Q  a ЍH-M !/@ 0ЍH-M /@ M0mЍ0H-MB /@@P  0PYSЍ0H-M f$/@p @Q   !@0J # 0d7Ѝ0H-MR /P@@ 0@$P !@ @ !@ ; !@7 !@7Ѝ0H-M  !@  0ЍH-h/@J * /@*J" A//H-M /@000Q  a ЍH-M /@ 0Ѝ0H-MB /@@P  0PSЍ0H-M f$/@p @Q   !@0 # 0dЍ0H-MR /P@@ 0@qP !@ ㍍ !@ ㈍ !@7 !@7Ѝ0H-Mj /@ 0KЍH-L2P /@ * /@*J" A// B/@"@/ 4 /@!@/ = /@!@////////H- @-M~ @P  ~{^ЍH-G0H-P@p @_~ ~00H-@1p PP~{0H- /@ |L{@-G /@@P ?{H-H- 0H-W @/P@ |!~ ${0p@-g P/`@)Q N,@ @ |A{ 0~pp@-g P/`@)Q Nk,@ @ |Az 0o~ 3~pp@-g P/`@)Q NN,@ @ |Az 0R~|pH- /@~0H-W @/P@ |! z)Q ~ 02~0//// !@/ !@/ !@/ !@/ !@/ !@/ !@/ !@/ !@/ !@/ !@/ !@/ @/&"@/ @/7 @/ "@/& !@/////////H-M /@ 0ЍH-Ml /@ 0uЍH-M   /@ k0cЍ/H-M 000Q  a IЍH-M   /@ r07Ѝ0H-M@P  0P$SЍ0@-M@"@? P  !@0 0 dЍ0H-MP @0 @P !@  !@  !@4 !@4Ѝ0/H-M /@ e0ЍH-M /@ q0ЍH-M   /@ r0Ѝ/K-@`!PRp  " RrǠ QQ0!0@ӏ堕8"0@̏Q P"@e!xR Uaq wRb(q !!@eY `T80S  3/PK脕A-P</@U@& P2`+@/@pPU/PWP:Dp`/p@P P`L/@H/@A-M`hP)`@P/@p @U@-  pp' P 0 0p pPPu "@P @@T/@@Ѝ0H-@uT`)@PuT)@A0T/@P:P P/@P*@H-</@hH/@L/@</@Ô</@۔@-@</@hH/@L/@T!@@ MH-M    $ЍH Ѝ/M0H-MP</@@ 0hH/@L/@^& Ѝ0HЍ/O-MDP@@/P@/@0 k<LH\`T/@/@/@/`@ @P _)P@ 0@ @ @ 0@0S 0p0@ @ P P3PX/@P P %~P ~X/@]PP  ~ ~X /@ GXQ/@@ `Q PDĕ[ p͕WɕVUEPU }\`/`@ [\`/`@p }pGW  T H_!@pP D/@)P@32PfP儕P }啍X/@ЍO蠜H-T!@HM@-M@ 0t% Ѝ@Ѝ/H-M !@ЍH-Mp</@`@PzgH/@L/@, {(L%  0`ЍO-4MXp/oo`"P5<@/@d\ U,@`pWP"@ `,@P(`$` D@`@ 0)@0P}d\ /P@@T %, "@f6Z /P@@T , "@f$`/@P)@0 "@Ѝ0H- /@PT /@P HycH-cH- !@{P P  "@F!PqHO-MM @PP `[PJ P"@/ p  õP; P +ᰰ),P))p&P!  [P  P ppɀ  ƀ / PЍۍH-A-M K /@@PP|*P P @PQ upK Pk Y] 0O&Pd GP_#Jj% @'J'G^SPUJa뛖W /P@P"py" /@P8 FP/ @`Fp $aFP"`"#P`aiT!@ X*P )P P  =P GP=" ,Ѝ pP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p`FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0.pp`W:U `pwFP pPUp}}@- MP @ /@ h)P= @   P4JG /@@$*!P RQ 1/P $1/$,R @FP J>P `"@?Pk"@:P , Ѝ)Pb Ѝ@b!FP 0@mF0@@ 垭k`c {P Z_ 0$PqFP`"@Ck"@@$k&A-(MM@(P+wv"@+C(`+m"@+9EPP (EP !@ 0 @@@@ @@@@@!P((`C(Ѝۍ0H-MK+<v"@+ P+2"@+DP  ?Cۍ0@- MP @ /@VD'(P @ 'PJ /@*Q $Q C+qP X+ Ѝ P ` 0G$Ph#%O-MQ   0P  P P +X @Padq" P: P Rr pQ %R R"/) @  @G  hR%R; dR `0"W 0 p!!+Qp(iR* sR/) @ 0 ``@`Q \Q`V Q p%Q_p  R P P Q Q)@@QcP aP<0  3/P3 BP$PPpH ` !PX Q Q  0 PP$PPP`V: @T0  Q:Ѝ0H-M Ad\ /P@@T *( "@b;!"@!@cP @ ( "@b$ /@@0T * "@! @[Ѝ0)@"@ b_0H-M @J /@@P ' "@P:&幏P4 "@ @bP D"@(& 'O "@!& h'0"@" @[Ѝ0@-(M (  @0@d 0)@  0np@.(Ѝ@)@0} "@[d /@0S }"@ Q=_p@-d, j @Q/ @/`@`P Q 0!@ p@nYMO-jMp1s? 0aW- !@QW`P7 Z PH @pz3p8 pEZ :[6U4*P@P0  pc3pp  P!@〱 bP `[ Pd /@P &0"@" @a .pW zX܎X d /@P &0"@" @ajߍOЍ/Z(MO-M(@" -PD24 (@T  @'P P  @'opPp  P Q G0p"@{P P * %R@RA* `'P`V*PLP/P pΪ/ȪpX5  P$ KG$ .P  P P U P9 $  "@0 U |믆 @"@L@r y,phD PQP@ (,F0@@P Щ嗑 F0@@\u2{뇑p(! 0p9@p 輪 /@bTPH  x)p@P  v PP d\ /P@P J p/@@P p `P P.@ʢ AА @ B T /@` P $`. `0*` @*@dh`` P pu` W `P,p 0H   P[` $@P @7 d\ `/P@ p+r* @A>& I @ oQ beW,p  P េᵐ@ [@` 0P P P& /QP"T@s@P "@=@[   "@_꿇 p"@8yЇ"@2&$P T /@mxP Py<"@ `D lP  c/QPX)P@0W@`Y V(,pW% F0@@W < 0Y @WZ ^!@ڀ&c+ F0@@xGW] `ɀ"V {! W ʈ@Z ^!@㱀뮀P@ )@㐌j[ ՏtwW ~X Zoy㭌(rPP @lPgY ߍOЍ/ [``K[t"@ l8#@@P 8^8l"@ l0., "@ u# BzQKP  "@^dL /@@P   @^巋#@_P "@XP@"= @@  j /@= <P <)P @ṍ"@<B< "@<H-MfP0`@@Zx p T!@FU!@U崇P0 ApٍP @'U띢P `S`$~ ʎЍ+)@0 "@ZO-M-nM M h/@Qf8 -" @pa㊯PD`<PF @2U@*L @@% z)@Pq}$@"p@@ |PpW<劯< iY⊯3Y iD   Y 8P  P h3@  0@aPp Y 0u  0u,@tPlؑ8/@$@p0@t[8@)A@p hP/@`PD 9@a  P @P4 .P @" @03\ ( +0㇦pP"@ 0-DpP/@ @ (0 jp ("@q!@sPnsoRdlP/p@/P@/`@ )@PAnsoRd/p@/P@/`@ "@׍P<@ns@P T `q`40iv (@ + ϊL%pc "@ P㸀] F/@@0 ;PS H/@@0 KR"@!@\PA : "@-  "@) O "@%  "@!  "@ & "@/ @ P  "@  4 "@  "@  "@ ဉ"@"@ P)  ⸀~ 0@"@ 㘫P<  @ 㑫P5 "@ ㊫P. "@ ルP'  @ |P  @ uP P P "@ 0mP /" @ 0Pq l/@k"@gP` "P xk/"@" @ 0FPF 4  G㽏/@@,ֹx 0ow 0jPplG /@/@/@@ V 0P <P my/@0 M<P z/@ m/@$/ @QP*"@@l /@ (" @qpAP/@@ ㅹ  rP (" @[G P/@@ o  \P ) /@" @Pl/@<P R P  )" @+P A  .PPl/@v`P P l/@4A> #/@" @ 0(ZPxJt?Q*"@P5"@ $/ @{0} 0l/@| 0m4t/0@/p@ @P@: Q "0@<0R S DTp/@@/P@`Wp0 pV` `S0 0 n3o"!@/ @/0@pd0/`@S0p 0o"Wp0n3 p !@/ @/0@ppYPM .RrJ R  /"@0p  p*P"@P6P\ /@H8, 8, J"@4P h/@ h`/@/`@P7 g  "@ @ZP x@"@ [|8*0"@" @o/@P o""@/ @ p/@/@P ' "@/ @"@Gm/@Pg W' l m4/@"@/ @/0@@k #@F0 `+/@@ A+ TP  0(=0P:/@P- "@+ p#@ `/@ G "@}:P H_ (p"@@Pp+PNp/@ (3"@l m4/ @/0@n/@P nC/@@N0P P M"@hp!"@/ @0Q"@onߍ ۍЍd /@0S 6 ""@ ㎾)@0Y  "@ㆾrVd /@@T ;7)@p@-M!I0@L PDP 8m/@ E0 PDP 8/@ 6 `p8 PP@ @$ A`l/@(` 8(L PUE/@ .FP D`P @/@@ Ҷ ζF@ P"@PЍp0H-BMsPP P.Q׽P @n/@ Pܶo/@n/@ ӶBߍ0H-nC/@@.orP/p@)`/@!PEPQ.Po/@P G /@@"@!|o/@!HvP !@/$@/K-!MpP"@lPPH ;`@"0@` A: 0`9@p; "0@-P P/Q/pI/P @; "0@P$@16 !0@P+`" @WW!ލG-PB@U' -`"@)@pW Y /W P EQ 06W@   P p`T:H-MQ h  /@@\60j /@ /R:* /@" @WЍ" / @p@-M@h/@P  @ Q$ 0  /@@Eh /@+6j^ 0/P@`:J"@@/P h /@V60 /P P/@PVЍp@-@)0+ / @@=p@-M /@㡈Pns@P h  /@/@ 㔵 i /@/@ ㎵& j@P ! l< "@/ @/0@P K/@h 0 "@@/@/0@ ~V i? /@/0@ wV@ލpH-BMh/@P P lQ/P@  "@Pz "@/@  /@P g "@O6v/p@P R"@G6 @ ,l0" @/0@@V  @6@P* 5 0 "@  @d/`@P <$"@/ @"@g5 0 "@P .`"@  "@ l"@/@UF"@m$4/ @/0@"@U "@!@Q6P9 P:5` "@n"`@|O"@xuob/`@P jo""@/ @jm$"@/ @dP ' @/ @Zn# @/ @TՃ"@Nz "@WP p"@/@`P "@Z l"@/@UT ḃBߍH-pP@ -p `l/@ pt K@G-BM@`"@:PP v !p@g P h l /@/@X 8"@0@PBߍ4~"p@ PP  P @/!P !P1  @/PQ !P[ "@/$@/Q QH-M  @  QЍH-MP 0p@$@ ppep( P$ ` 0p$@ ppUp "@P x"p@4/P PGpCЍp@-@"@ `^PPᾳ!@㋳UPp0H-"@$ @$@Q P P ^oP P0H-)@ O-M`V! P@p QP P PP `VЍH-)@ K-Mpp$a m1PFP @H0L! p4/P pP 1/$qp "@p@1/pЍO-lMP P< 8p@ L03/P' H$ 0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-M-UM0zpLpؐ  [ /P@@pPF`0@@㔠,o끅)@%V]~@P#Q4"ZLpN/ P@ ԇ XP /@@/@0/P@Q N/)P p nP 0 }ϊ ᄲ " /@ z p0! 0P040P8Q@Z,L1H!B Z@ZR$()!0 `(KHaLa及 /@0 S< @ /@@aXP /P@P[b4bqLL P  /@$ $ (aP,qP,q048aLQPH!0 ; P/0@0S'f !`@@#Gp P`P@nK$``P;$B@`Kd /@P H!L1L {"@T@$p$AB :0<<8<P P, 8 /@]P  _P*Pw $1/$@Q() N}Pr$}PmK? ?A$ePW @$48aHL; ZXF X h# @! /n/!  Z(:h0_@p@X BBP` pzoB@B 庠4@N_T40PL zOZ`0 0 4}p0PLp`zOq Vh@ 0  z 0000008p,W L@T!@ E,LLpH {!x  0 p LL`0Pp PXJK,I(P { nH)@@" Ѱ /@@ /@p {   /@ UݍЍ /@[J [p8Pm AkQ#0B"@/!Q//O-CMMg /`@ *Q Cߍۍ)Q; A_ 0" @Q"@ P fP A/"@ a4M"@@1A_y+0" @qQ"@ 1P =A/@"0@\ >0@p !PP A/P4`p4@00Y WPp`X:5;x@B!P PP4/P '0P  P ;x@B 4/A/;x@ 4/< Rp B<@R0PP@0A"@q"@"p@p<@RR} RP00S " @PA"@  " @"@pRr 1RPyVA"@ hq@"p@n00S " @P(0S P!" @Pf,0S P !" @PZ$+ f @P!@ PR"@ A"@0z*q"p@@"@"@p1(P,Q 7!" @pP=A"@ ^Pq"@"p@$"@P"@ANq"@"p@ pA"@C|q"@"p@P0)pR00  A: A?"@ Y  3 /@P A/A/@T pJ/A ~0PA/ A/\0`^K-MMpQ8 @P `"@  P- !P L&"@P$ VP"@0+p :W V` !@  0`p@!PpЍڍ p p * YlEPT@PPJl@Q"@ 0"@ 0H-PP 0 S,0S ,\ SH= S:8 80S:^3O-{MMG p/@@*QD"@._  @ @/`. "@d /@PU . 0"@IPVC /"@8`)QH v /P7 NHx"@ wP$ 䩝ܙZ  @ڿP tPJm@ p@U ο@`PFvo ^ T:0S "@  LDPP Tp@ `T6 (P P PS Y v0 xP   @  0 0;5/ P<z <Q!@ @"@ P"% I @"@@`DP(((((X<6 <@!0@Pv+ロ2"0@8"@ tP$ DP P  sg8"@h$Y (، @ @ P J @"@@ "@7P`@ "@-|!" @` "@@%PY  @F }# "@!@@" @$ q@0"@ j#,0a3" @ (`Zc"0@RS0"`@"P@`P@M"@a08<0% "@ DP r80"@pp[.: sv} lZํ܉w/ P`_V 8v/"@J /@@P @A8P"@x"@t"@pP * "@/ @gHH p"@0p!1! 0@q& ! @ !P "@N("@:-."@7-4"@4-P ="@.-D"@+-"@8{{ߍۍO-$MMP $Ѝۍ蜒MD P`p$@"@@!PpG`w @M|!"@" @P`@P @H @@P@\"@hk㬫`@!@`@In"@@"@ @h $@"@4`8$(@hD@MDT pP`"@@<@PP P "@  @h"@ ` s$@h4` $(8PEu|A PM"@@"@ ^}P P"@ T @hk`@"@ ` @E$@xh4` $(@8Kp K@Pv+P4 @ /@"@t.P _  @h.P _+B @*.pD@e-  0 "@@pW $ T/@!@ M  /@)Q @y+0" @LJP3 @P+P@pPT: T/@!@  -T*d0`48 xP  0;`5/P b%5"@" @"0@ᕿ0|0z0H-P"@ @FP0$/& !@! @0H,@-@ /@ p8@0H-M /@ Q! 8 P Qp 0@ xP  )0/ @;@5/P I/@@ PPPЍ00H-I/@@P0 PP0O-MP P\@JPO  PJJ@ )TG `)@JI `xOJ p@P%  P  P   P @DPPP  |p)@ JJ @T Ѝ@-M @ ]Q Q P p? 0@:Ѝ0H-*JTR0G-MMX /@P, @,T A4^ QoP0 `$P P0`AT4`0 P ,Pf'T7 8 @0@pA`@0)@  0@$8x R_ P4Qm @0R 0pW PpRaPVW:( R1/4@TQ* O@@pp@P@TBP0< `Y ᚻP K? Z9P 0P4PP 0`4``N@TV  y P4Q @0( R1/4@T:0 ߍڍ`[H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU 0Q03P  L03/P P `V:0Z o`Pq iPl (0$`P5 (`$,q P) P 0QUQPU 0Q03P@ L03/P P8@  X:0`V( X@< 0`H0  ```p 4<`8`P$`4`<8P  tP 08p<  $` 20PtЍO-MpPZPF `(Q9 p @pp  L0 3/P# + p/ @p`0t ẸP 0᳸! #"@{P P B `=pY: `Ѝ0H-@P0P 0HRp@-Po@'`Q 0!@ p@AA-@ PQ ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMP x`p@;p p6/P  @;x` p p6/P 5 0"@(oBЍۍG-M@$@p`"@P RP PN 㦧)@ )@Q Q `P# a'P| ``04P A% H` P Y%`0" @XꅽP[ PWQS HpPO fs@P I @pj `wpu'P @ @ @ ! @ 8q}$H0 LJPhUFH@. @P; .P8HM @zP2 d"@uP- i.#@xP' K?Fov !p@p # h@qZ)@ G0 PPB@n%" @ 0`GHYȝ/@\ nPL @ Q圑P P3 JJPHpT  S`L0PH`L hPd`UqP P" K?f !`@ ` # ?s%p! @vOP3 p167NPEQ, FPXQ( o!0 k .pA0d 0^K?F_f !`@` # ?% " @p= ,H`70 pP(Q0030SP'Q 0W0'0Q0p 0WP07@&P: Q@ RQK?F_v !p@p # ?|%`" @ 0"GNPPPލA-S `pW WW`V  0B pSW WW V F0\0@P\``vp W:v\WQ Q `&c``aa``a`Q p0RO-dMMpQ :S"@P P dЍۍ "@ㄷ`P $@}P v/t_r@evGVv6 +c/r+\F(P \R R 0S  X /@@PU1 $P R 2/pcQUg /`@+)/+r!P᯵`@PaUn:=7aPj+ /@$P R4 @_R"w P/p@[P K? 4P ` R 2/p1/w /p@N_[p2/p p /@P$aV /@;x@ fcp@ `@ @ @ ዶP) ᆶP$ ၶP  !@{P  "@uP  @oP FO"@ Z  V@ P FE&P  Tp!@ Ppppr /O-M aPL03/PH t R 2/+ p/ @0@ Ps 0l0% " @BEP @"@  X @"@  Pv P..@T!@\=ЍOo/G-M $@$@0$@/@Rr/S0$p@/ @`PW0C's`0Qppp0@/@@P/P@/@ /@P`/@`@pPP@pPP@p PpPP&6 P" @!0@PD/@ЍG&H-M I!oЍ@-M@ <!oЍH-M 0!oЍ@-M@/@@ 0  / @ !Ѝ0H-!@sqk+^@ P@##"@~0HM0H-M@ P$0 ! R "@0@ Ѝ0HЍ/"@ `R0H-MQ h /@@d#:Jj^ 0h "@@/P@/@ P DX#0 /@ PDЍ0O-$Ma㐑 _`| "Q @`!@/@"P@/p@庶 !@P I"@8  0 P= : "@/0@"㝰P#@`pP- h Pl /@/@ "j /@"@ 0Pp` @ 뜰P!yP! a!  @$Ѝp@-MM  @"@~uP   @ ϓQ u$f @QЍۍpH-MM  "@^uoЍۍG--M( P0TO0L0$0LP$ X/@P`  PmP h  /@/@ - i /@/@ 'PP^ /@ rP @lL hPnJPl@wqW W /@/@| cP4i /@?h#  @0@ t @T0P" l 0 PPPPPPp- `mT2Tt㐁! /@E ,PW A /@@P I"@nbQUU oRP܍/ ,'<"@" @"0@'p@-M @/@P+ I* "@/ @P# /@h@  :Zk/@"P@"`@/@@ 0Bi /@  /@0yB!oBЍp/@-A /@@PI"@@-@P W%= /@@tp@-M   @P( ! ; "@/ @/0@P /@ G [/@km h "@@"P@/`@/@ 0`%Bi /@  /@0`B@Ѝp0H-MQ Gk] /@h "@@/P@/@ 0Ai /@  /@0AЍ0/@ r/0A B0 //@ P/ @/ /@0Q00A B r  //@  /H-M(@/X )@ 0` /@ @60IP0```@oߍ0H-P/@P 0T A @P1UT @D0U@D@@DL@@ @ @/T1TS0%5 @ 0@ 0 0A-q 0R&Bo/@/@ P#@@/`@p00S 1SR  B0  pT 0T0 @pG0/p@/0@ p/p@p@P "@0Ad9 / @@p@-MP@Q PPg"`@  m"@"`@2P` 0ЍpO-kMh @/@`P j /@y PpWh l! P/@/ @  G." @0P@.hPQ 1/pPtбuP  P [ /@ p@\V[ /@D Y P%"@X M "@0v "@`V [ /@  T !@Og /@/rpPP /@P  "@/@p[   /@kߍ@-#@"@P @h  / @/@Q /@H-h l / @/@PO-,M@ᇯp$@P $(P@` (``@ ` $VQQ P*j (p@@A$@P@PE p$pP@* $`PA( (```~ $VPP Z*`H ἧ p@` S /(p@$㺥PPpP A@D@P,Ѝ/ w+;"@" @"0@X*) @0/S//@S0S 00S/0 /S/@-M  @"@0@ POЍO-MM00 "@0܉QQQ 00 "@0ɉPPP l 㠗 p0@"`@"@F%  ) PTP2/11&M^!P@^a\n "@YbWUÏi /`@iUP  $@ 0":wP YU`ᲐY /P@ 2;pu "@ WPJ P-gl "`@6 P  00RQ;Q8Q6 =PU/ P P"@ ! P Pi"@   00PPP]T"@ ЍۍO-WM@ "@` U /@0S "@ 㨤 X/@)@PP 0̏ C/U/@$@X 0S   R /R/U`Xq Xzha )p@"@/`@Qd QaP @L 0@@l0@Yp@㐡 /@P I"@@0 0a kV @XP P P* P P00S 1S /S#Q APP @$PXpG @Pp/U$ { P  QG0`"@ p /@oZ) P "@*PKP 0"@g"@"@P  VA /@@2  O"@ "@%PA P/@@"@(GP( ,0"# "@G"@'P "@7 "@"@PP I"@(( @"@0@̇Z  Qo P T"@ Wߍ@H-M Ѝ M0H-M@| "@!@P P. "@ Jk"@Ѝ0H Ѝ/p@- )@PU TE `!@@P P  6PUQppp0H-M "@uP `G/@@ 2P J"@/Ǣ "@ /@܍0H-M "@R_H/@@ !`/@ /@QXdyhY//p@/P@" @0<!@ ~ZK@U<N8, "@ @H0 ` 0 @ 0 P`0P$Jl])P@@bN+*@0*" @< "@)P gNߍA-M`BO *P @ G 6P`< d/@U/@ ( 0"@!@@ލH-<H\NO-Mt/@@T)@V@x/@P)@TP pr/p@@TP@x@T_/@ ᄆ` ZP` /@U  \ @ Vl ˓Pb @epeTU .PR  К pJ )@p/@P UjPB  x/@_P7 x/@  )@  P  P"hpr@/p@  @  "@bpr/p@P` /@"Wx/@piPZpr/p@<0@ GЍ@-M@P   P= /@P H=ЍMH-M  0 ЍHЍ/O-MM@ | "@T !@@PJJ "@T !@6P}Jb "@T !@,ps{pwڔ(!@P<Pp {p}گ P @ChPz p  PP` { @M`_ ǫP `=P T!@ ` P i iV" qP @P!㱾P  ^PP X2P3Ppo m+ )'P " P T3!@ ヾ /@clPЍڍ h hH-M jЍ M0H-M@z "@!@P P "@ h"@Ѝ0H Ѝ/| "@"@#@- "@@P "@ P "@@P@O- MM @)P2 UP2 g @P# gQ p` P@"@@+( P* + T  + T]P |P  Oo᠂ Ѝۍ v@-@^Q @!@ Po@-#@"@ŪP  i / @/@Q /@H-PPvi P#@Q0p@@U/`@ UP ut 㮀 ==ZZ%U#U|kHyk0H-M@VP@Ů)@"@ 0: "@Ѝ0@-M@oj h Ѝp@-PX )@@/Q `Q PP /Q`@T@pK- M@$UP Pp` pp pVQQP:$<P ЍMH-M 00 @ 0ЍHЍ/A-pP`eP@V ! P P8/AMH-Mt00 @ 0ЍHЍ/H-h /@Q "@ /@ "@$ /@ "@ /@ @  /@7 @ /@ @( /@H-P40 0 C 0 A AH-P40 0 C 0 A AHO-DM @`P pP L03/` PU:pP K ` PVF pK L03/P2 剁i(PQ "0P  i PPPR $04@P0R@ S8p,00, SX 4 T\0 [2Y1:PDЍO-MP  @ @4 A0p W[ Ѝ@4 0pS RP pRP P`4P!ip  U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P pP` L03/P `V:  D@<08 8<P@ D01/HЍp@-PP` F@ P p@@-@ (@A-@PA pag0 hPUpIpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:AK-M @ p@ Pq`op @@ @ 9r ]@ @ /h! @ (a}$0 L:@XT@ @v KF !@@"@ ֧PЍM @`P "@[P @/TO-M3PE 8!"@ c0Aiy "@ @pmo)`@ ` m!@I( PPy  ) P/ @xPfp@PPk & ! @PP"@0d`oRWh/@P !@'ɸPP@  /@P8 l /@PP1 `#@ `X @X@P' : 9 "@/0@ %g5! l< "@/ @/0@`PP"@ 0`"@ )PUPލ4." @H-MP' @dy/p@PbiP $PP% `` hY/@'0_/@/P@A" @`4!@ JRl )@Py@T O)fЍH-`9"/0@|0_/ @/@/@ !@-@`)/ @ _/@ b@|!/@ /@ H-MM` p@;@*p  Pp @4`0`ЍۍH-|dP@`L P DP p P P  Pe zDH-MM @`;P`=*p p 0V@D`t`@Ѝۍ eDO-AM@ PPAߍP` L03/P  P@U: АԠ,( X*$ L03/P  X: аp  [ ,[( YY /@ @ 0 ᚢ, (0㓢@ /@P`$ Q "@pP ]3 /@0`  xp  0q`P( / @@@0@P ` P<3 0iO-SMPP@(WXP@1hT㘰mJ `Vj:T 40@ YVp@$p5Ph 0p8`$@,P<@Y@P$@ a LP` $@@ RR$@pP8 NRAX; $@ 0 a<@ @H1/ @Pp`0dp0 ppp3/P5 e  I803/|P`$\ /@!$Q , @ Q$@<40 8L0 d3/Pf P @Pp J4@@- @  0 0 7p` 00  @F`b P$ ᩺@q: p<@80QU Sn4P4P@ PP03/q8r L0 3/ |`@D0@ X@<@Px``TPH, \ v\T<@!a8 RK Ba"pD,PT 1 C"; @BtS: q8d 0@ 3/P2 T `Q4P, 0 `V/  0S# @0d`4 6/P P 4V( L0p `P 800 08   `lppH` `h\4Pp@D  PH LTR<P  !ά44<B Eߍ0/O-M@Q(  P00 ppS pR*0 P0f !`@ p!#"! # ! g(P ㉈( P Z(P M PQpL@ZG`(A 0PB;H se/@@0!`@  g)C.0  ^)-%ɐ0   T)Dp ᝘묳 PPP/@P啘밃 @/@Ux`- aPxP T- VB./@@x0" @P").P`)/0/@" @P `p@)!@ЍO-MpC `/@@P(QżAf0  8 r VJQ8q L0 3/P /@P800 +*Rhl /@< @厼 0 < Z0U3"@ 2 /0@R 㔠/@`0 Ѝ`6 !0@V00H-P @"@㷘P /=P PQ0P/3P0O-Mp !@w @D`xCQ$@/@@VH[d  r * P[  P B)PR @ wPa Z  P "@ wPj P; \TAP T@P 8APAP *TAP CP ! SEP0 !- ro᠂ # o᠂@XԀPDPX @l /`@ពP wP %Q- /QD0Q R@FP@RQSSG @QDQ !@Ѝ@ԀQDQ "@O-AMMpP0 8`@ P`T0`$P' 4`H1/; /0@DP0 `P` R 0 0    P"@" @"0@֕@-@,PQ 0 a8 480qAQ 84$0@ 4 80 8 3/P,41/,H048 ,TX 4 R80Q0Q8$@1R Q//@-@|0S c$S 40,8 0P0803/P,41/,H048 ,TX pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W 31Q B21Q B21Q1 B2A@ (ܕWP0 0@P@w$ @0!P @@ⰠVp*@ ,(0  @咩PJ(PR٩@Uߍ 0 0R RH <\H @`/O-LMMH /@Q # / @0Q *1S$Qȣ /@U )P G /@LЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0MP  ;x`  6/P pW:HLp@-8M`@4 00P0PPJPJᴑPTJ J4 003PP U@PoQRQP8Ѝp0H-P @"@㐑PP y"@㉑P "@パoRP0H-G@,  / @!@P@-M0@P /PP@/P:*@C "@" @P/@@ /P  Ѝ@-@@,  / @!@P@@-@ @,  / @!@PR "@@踿K-M@v @ !p@P/@P@p]@d /@P c "@U!囇j /`@P m"@ 叇TBЍPpp> @)@ @ ,!P  @%!{ 0H-@P@,  / @!@P]0"@ 0HR@-@P@H-M@Pf @| !`@P/p@?P ~xP`3@ ~"@ 0$܍G-MP``v @L !p@P/@@` ~PPp  ~pX 0"@܍0H-@P2@,  / @!@P0H A-M`pڎP#P @ U@ & P/@! @ "@ 0þP P P P/@@Ѝ0H-C /@@P P 0@ & P/@! @ "@P㜾P0P0K- /@@T) `pP P@T `PP@ & P/@! @  "@0oPTPw H-P /@@P 4/s `/p@ } }`HA-MM@ ;7PJP`  }{H 8ЍۍG-̇ /@Ps /p@@T @ 㺦 P/@!@"P@`QP 0@TS /P@@T p@-@P`0@,  / @!@PT%0! @p@]0H-@P@,  / @!@P@P"@ o0   H- oH- oH- o /@P/H-MT `$P@p 0pp @ 0ppt"@5P"@.P /@ЍH-CHMH-Mg @/`@(P)P Ѝ$p UP4 P $1/$P  0@:P P@H!L1 0 @1/P !PRP$HQ@PRP @ RQ @F@-Q @T R Q p0S@@P@3 @@P@3s㲱〡/H-M(P@U k`gw 0C1/P㐱@]Ѝ/H-hMPJ ha -0/`@P" @"0@@pPtP"@"@P "@"@  /@P P P% 0P" @"0@PSp 0" @"0@H@ @< " @/0@dp@P  "@㉼pPhЍ0P/H-"@ "@H///p@-`Q 0@RPU @T00Q0SRpsp@N0H-0M@ /@PU ,($U  z 0Ѝ0//H-Rp`@P"p@TPQ ᎍP `Vp@$' / @PUތU X0H-PR00@Ƌ /@Q" % %!$#[ /@0H- @/@P`QP /@( pn{ HH-h/@lP 0H-@Ph /@00H-P@*@"@ 㤻PV00H-P@FP 1"@㐻V!P8! 0O-GM  Z%P B 㤡+^ a ́p/@@"@/P@/`@"@P' P a ] YP+. "@"@/ @"@LP . "@DM;O GߍK-MO"@p2# P"@OoPP @P RvP@T ;aP`ЍG-!M`P@P4"@ @:!| 9!"@ !@P2 p P { @ ͚Pߊ` GP=P*  rP I"@ ,d\ /P@P: { "@0z2| "@@pt0"@[ Ⴏ!ᩊm"@" @0M fIdL /@@P  "@M哂| T "@!@!ލH-P@=d| b/p@Q!:1"@"`@91`P0  "@%k"@"@ S0H-M @2c 00P YQ @= /P@!@ĞyR T @"@"@0:"@ 5܍0H-PH-(2o !@H-Ү1"@HO-M-Mp@PU mP g )@,P/`@Y Y Y /@$LAP L#" @wP 4P3 #" @j4P3 P:9-`m#" @0Vd /@X ,`̉0"@ ,`ÉpWg N#/`@=3L#0" @48Y+  ! /@/@/ @P`P P P 䍊`  @0@KF0@@ P"dK K  @@& F0pp0  0pPPP',@pݍЍ /@5խPJmPCJp@-@Pĭ`@ "@0p@2A-MS@"P@p` @d P/@ `W1"@`V "@L "@"@D"@ N("@ 0w"@ GMP #3" @"0@#0" @P{"@HP 0"@ @4"@ RPoЍ, /@"/0H-X @/P@Pb !T0, "D/@ Q0(0 4 /@ (0@-@ /@PH DQ$@@t0H-@P@o0@-M@ Q T ] ЍЍ@R@-H /@@P x!/K- /@`P P (NpOO QPP R 0 RR;p@DQP ` A A @1 0 F0PIW# (  Q$0X, @!$ % Q K-0M4o @/`@ PrP ЀP 0X0$ 0S!*P    PP9P QP P  R 2S  PP0ЍK-M⺛YB0P,`(BpW@T V `VPY P\apHPW :X X# [wq^ "@q^ 8"@"@="@ 0M Ѝ@-0M@    @ @00( P, 0ЍO-M /@pP  P vo!P0APP S @0SSP`RЍȰU P0p 0  ]((Q $P,QXQ  v  PP Q%5"@" @"0@eO-TM@<p4`,$  e@8  `2Pv (@D` $0 R 0@, RRH `L0@8 R P T  ^PP T04_ /P@R 080 P@N0<Ġ⺛Y" 0` Q BTPPQQS S S @ hS:@Q@@bTb 0`Y P @ ( (Q $YY. *$@`T& {"  @ 4QP   vu 1 (p Ps 80  RTЍ0 r/ @ YH XL0 H  @DL QG-4O /@@\K T$ `p0SRUSSW W W P FW:PSPP@U@ p`T`\( p'1!PE Q $彆`X {U QP vhu !  @@@0H-@P㑊P  0O- M0p4`pppQp@ pappb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(0P @ 0  T PD" P%00@@P@ pGY ЍH-@+R 2 `PpWpW V ` SPT j"@ RPT ~㴩  p"` pG pPO-DMM@XP \P `P dP hP H0 t0P #@ 8 8pWQ  80`)p@PPPQ PV`:pW`Sp$@ a @9 0:W` pQp S0pPPQD`a "@G  @Pk sD `"@ "@`0d "@\h 0"@X "@ P- Vֶ^"P@"@!@%ap$ @0  p PP  p"@ @X  X:"@7CD@'0"@" @0`P᯾oRDЍۍ%5"@" @"0@@%5"@" @"0@7%6"@" @"0@b.%,6"@" @"0@%%G6"@" @"0@O-$MMPP @$ p;p p e0 D`ᄾpTHtPP:0L$WXQ  h` @ PE Pv P P  P%q P  $ 0PP  Ys Q m 0P0P p[:᳼ &"@P㝳P$ Q:P a0rD`V `VpWs0CQጼp$ЍۍpO-M-@MpP`PK =PF pxp@ d| Pp* p P  {4$0@(0\0 XpG(l/ϊPx $@ `H `(  B䐄 @ЍЍ/h/p@-M@XP \P `P& dP, hP2 P0 Q&Ѝp6'5"@" @"0@gۆ6'5"@" @"0@h҆6'6"@" @"0@iɆ6',6"@" @"0@j6'G6"@" @"0@k᷆H-R0H #[rH-H `H-P`/y@P p@H PaP:a@P*Q P @ R R@P@@-P @@L'[7"@" @"0@j@- g@"@q@0H- @/@PŽT TT44444L\LTT T  T T@ P"T0A-Mh @/`@PP "T*a=0 , /@/p@Q (` (0S0  R4``U* [P& P4PP$ # @0@` @$ @ Fps pp@ @$0" @(``@pEЍ0H-X @/P@PqD  Q "P, /@Q 0/ (0D/ @ S Q4 p0O-$M H 0L rX`0SP\p YPT@QpS 0^0  0m Pp0 bYp [Pp   ^ T  YP `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP@S@@@`Y```` PZp^TT@ ` p 0PTp ^P pY8 P  P   p  p^T T` P @p0ȀPTp ^Pp Y\q:p $Ѝp@-4o @/`@PPe`r0Rv+Piv@ 00  S@ pO-$M < /@0 QA t$p@ P - LP@UP U [ ` 0 H6/P Ko Fo@P  0H  p1/$ЍG-@P# Q 80Q 3/P41/P D0/P@41/@K-ㄼ뤆@p Q$@` 0/P``pWV 8 /@`h< P/@  TR!HA  qKp@-8O /@@Q <_ `/P@! R 2/`V:< /@p@H- Mcp` 0@P UUT @U@00@P` VVU0V  PP@Q o@0w "`@P"@  ЍO-|M1/H1/4 /@0P1T!sP 0Y, [(0I4p8P0`0 ` ( ,3/PpoH`P ! @ A A40 eQ  DX 3/ p03/pR H L03/PJ QE pH L0p1/>H@$ $p40 ( 8,  7/P\ 8<RLHdh 803/\  p @03/p 0[ypp|ЍO-Mԧ @/@P )`Q(P ЍTP~'7"@" @"0@قPUa  /@Qq 렉 /@  Fp0 `@@RQ0/@0 P``{p &0PHpTPPP@H@Q@ LP*LPJ4P `P TPQ `" R pQ 2 !08PpW:T`V:P Q TP :@PPT@PT:P(ޢ$ۢآ3p⺖ P` !@0(C0`\`.`!0S$(0 f`!@$客$娢H`P A P0 A0S B BP @8 3/P , P@THH`L 8 /@<+@ @ !Q :\P@, uH `A 0` `````圖p Pዖ@,WޖP P`߿P ۿ ϖ׿LobP P  P* pHP` L03/P PU:X\P P`(VB`P ?P R 2/@``d /@0S~ 2"@ )txO-LM@ PpPD@|P;|@8|  PR .| ᰠ@I%|밠C2| P@*`,叠P` <0  ῔p V@@XP*@W DPpWo D<@t  Wߍ~2(E8"@" @"0@/////G-P\1/ pW ᆻP W  Z B0@@` @V0*PV`:1W r!  Y H* / @  L$ @  !q! +0 @p,  "u!06 1 p@0@ !p 0 A0qA Q~X(r8"@" @"0@yJO-Mp@ɟ@şP` p P  !@ 0P{ /p@0 {밸 N/@ <DP `R@ #X  p@@6/P( X\ 0 hhl 3/8qP  h L0 3/< h4pl0p `D @0wV@pPL[:I /@@B %,  PH3pCߍ/O-MPQ `$@@`(咷P "$@p7pU $Q  @ Q "'p@p@ЍA-@8q X R 2/P Q8q6 1S  `@ R   `0SP P $0S``0 3/< QP0`2 P$pPPVP*8G-M✚ /@PP[J /@@㫛 /@/wP㢛 /@&wP㙛 /@wP 㐛 /@wPŁ㇛ /@ wPł~ /@wPku /@vP$ R p`(cv p`P$ V:< 0 RZz 4* : / @/0@Qh0 @ b`8pdp``J 7/ /@@P(&0"@ I @/@ 0qv`* : / @/0@ @/@ 0cv* : / @`/0@+ / @ 0 P0Rv* : / @`/0@x 0/p@ p"@ p/@0 /@ Q  /@"@MލK-MP1< @Cp(0AS*d`08 6/ 0( 剝08 pp 7/Qh0 83/ލp@-(M@,0/`PV  @  R  0 @ 0  幎`p xA(ЍpK-0M8q L0 3/P  w@P |@1/ P@ p U`0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  e` 0P`PP œP p@ 2/Ps` 0`PP 娜P`@-@Q 0 A2/@P  T@㴙T !@@'@-M@8q 0 3/P7 Ѝ@/O-MM "@@ Ps "@dP ]Ph  "@WP Pp#ʡ "@@+dMP  "@ 0"@ߤ@"@ /"@@+gd(P "@ 0"@㺤 "@@+MdW"@ ᫤P)0"@" @㢤P IP"@@`+-d"@y0"p@ ᅤ"@+d"@}0 tu "@lPs"@i "@`Pg "@@+c"@U0"@ KPR  "@m@+cP"@> A#"@5 "@P+P2" "@N묰+ c#"@ ,:z㧙@`)@"p@"@ 0(P  0PE u P +KЍۍ O- Mp`O@T> YP Y8Pi\P0 -z"p@Q:  ?uP : "@ 0mpB @L\PP Y Y 1"@0屣*M ЍO-MMP/ @`"@ `啬pWP P :*0" @P8+"c PS*Ap/jPP `P FQ Q/R IP:JP ĭP+ P  Xi #GP(J/PI/0" @p+b "@+b PP J P+b P:x?x@ 8 7x@`Ѝۍ+P /PP) P`P  s` s PU "@+ob P*+ib P* p `x>x@P`H-*5p@-M P1@PJ  @˫PJ PΎ`ګ V P: !1qQ0OЍpO-M 0 ` 00 @(8p> DD DP  0T 3/P\ P) hpAg"80s ` 0S ФP L03/P hl ! PU:P(P"8PpW: { 0@/p@8 ` ` 00 ,`$r& 5! @ 0@0 @*X" @P,T0 S q #%p! @P`TPG DE & ! @ ` SP0|8P` S@*X" @,`0@4$P,0PU} /@ "@`0 0Xh`@Z  /@/@0HH,!<L`AC p` \sPJP (P7 P Pa(P!p P* p`@p@@b"VdhR"pVPp Fnp @0 8@٧Ph  p hl@ 4 h۲ lhֲ`o `tЍ///// O-lMP pP4` Gp Gp G0Pp`@W@R $0 000@ pPp0Q  pP p*.$@cD  P:R ,0ST0 S Qp \ /@lЍO  a @ /@P r $,4`X( ,$PQ ` Q 803/P ,(Q  RR(  (  ,Q  P  B p,P P*4Q4$@`G"@lP "@lP GpP,,(($`P P p X:(4,$($P Q 8p` L03/P LPTP P (` V:(8 0 P1 88`p L03/P HLP  08 < P    R pW:H1/` [*k8q p  /@Ѐ@pT 0@t0@pW  0!k , P  0 2p@P@0@ X*S 0pP iW!h0$ [ 51 0 7$P5 X*1h2(0 S&*1c20@00@WP,  QP@p`A R80s@0p @X0p0pP0@WPZu$4p W!*!P: 0` Oig [$0`p@Q@`V0 @Q@0@P [#* 0P` *iY0px /p0S P  2p@@0X0@P0` PN0 @ Dp @P@0@ ? P<0,p@(W :Q*Aa^p q P rPU  P$0 00W* ^ 0@PPhT!g0 lЍO-EMP`0Ud hlQ `80 R0P pQ0s  BYN p㜨PI ࠍpPV p ;ahP0 lpp`pPW:!8phP @T pPp ah L0 l@3/h @T:PlE oq-A&KQ匪P0MPX <H1/TPL HRP h D #X`"PPT\P{  0+ @p8q hh( L0 3/l0@TpTLT PHP0 @pg\ PP\lp0`Y:[6*l 勑kD\p< @  0Pp P L P0PHT `gPp !Re@`DPR` RP PUY\ /@YlPShpd `0r(@Y0 T`0d H1/0W `PP(PPR$Ph SDX\@& @88P @4p,`pq[m P85 P g\p 08 4 pD @ d`3/PM , tp0 Pp\\PU0U p8 0 0( pp00>/ j< J\P A0l0 , 3/p P\ L03/0 $0 P` (  0P`D @0p gUd`p@p0T:W P T0Xhq P Dp p @p\`Nd0 S`@ P8q0 lpp0Z: hQ~  0Q00TpP`Q0  d`p ````3/Pl Dp @p00TP d`p  ``3/P p\ t l`0p\,ppX pW08 0pT ``;/ g+ Ad0,0R,P}l 03/hp l L0 3/LpHpP`T P0SfUd`t l`V|*Pp L0 3/Pe l 0`06/PI  PTp0 RP`0  d`p `PP3/P  0`D P@ P  TP d`p6/P t0p p 7/PQ P Pyh@hP lpdP8X Qe`g8p_ 0\ QW PT@@ Q P L03/P  ! #"+ P U: XPT08( @@B`  @!@!`@"0@U( 004`8<@ D & @Ѝp`0x0  >/ @D Ѝp@PH-M%p  @Q0/@ 84 #@ @0@ЍA-M@Pe /@Q y @ _bP* $ /@P k @ SbP/  P/@P   @ FbP{ /@p00 @`CPU PUM pW@h /@ 00A<p8`V 4`V HWQWlo /`@N0A8&04QU 0QU }WE< G 00@  :+" @3NC0$ xP  0P05/~%" @P0N@ ``0` `PPPpW XpW,`! VBG+" @$0`P"` OPЍH-!RUV 0%S S S80S00 80S0$180S 0|1S 00000 R H,x?"@" @ 0@mdH-8Q H,x?"@" @ 0@md0H-  /@/@PX@ /@@Q QQ   Qa/PU000H-@$P xQ R1/0H$ Q:Px$P U:H-0M@$P L0 3/P* UO @ /@0S0A`0  BR@ ( /@pWpA`p'`&p  BR @! 0! 0ЍH-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H--xMw @PP` /p@ ϊ@ϊ4$@p@?  ϊ ϊ,⏊`ϼL$,P a㞭@|xЍp@-0M`@8PP Pc8,0" @P 1/$ 0 x`   06/U U  @e+" @50"@  0ЍpH-0MPUJ@$p0 x` 0  6/o"@ P x xP@!0Ѝ0H-Py@ @ C`P k @ <`P#   @ 5`P-  "@ .`P. "@ ỎP0}#"@ ᱎPP @ "@ ᥎PP 4!00B"@ ᔎP 0P  "@0ሎP0O-M-MM,pZQc /@P X 㨏 /P@/@P ?Pwr$] l /P@/@P /PX ̿ /P@/@P H!Pir ] /P@P  0 P/@Qr0 /@Po M/`@/ 0P/ @@pO Π/@@Hppp PPX        4/ / @0 0`00p0 p x` / / @P  /@PP 0PonppK/@, ϊ,⏊ ϊ `G R |@ @0@pwvp' @p   3rvP /@$P X /@P |QKPPPލڍЍO-M-MX` /`@Q| @/@T  P$P |Q1/$Q}P}QATg "@ /@Pu P0O p/@@o  !Qb  i( RU  80 0S N(:*0" @X /@PU  ^P QU}QU-P !/P@.}ϊ( )<,L "LX /@P a/b?baY [ X` /`@P }AQ  Q  Qa/@TY@T  X /@X Pp k0` )!a `R ``: 0@ 0 8儁Xs$Pl  @ P`8 U5*L0 3/P+ &P# _[%  kQ$!   8 ` @ V P `0$`1/``$PPV, @P P L03/P P _[  kQ  @ 8 ` @  PU:@|  Z /@P p | /@h0pxtlh P P/@| \XT0@T d@`@ /@P 4 | /@@0H /@4,PD@0, L@<@8@ /@P  /@| (0$ y|!0"\.  @00 } ,@  /@00QARQݍЍ !/@Q/Ѵ!/O-Maa8@P{4||}}(~~Q|Q 0" "@ߍO|PxpW  R/ 07/P- L03/xPPR 0_v  `0!p@; $pc" "@P;  %P"@IPIHP`Ip,"@@h!P RP,1U A J J0UP @P 0IP4,<" @@D$ L0/3/P0T" P  I"@ `[P pP sPIPHRHQP -I" @ 0@ˆ@pRo"@P  LJ HJP8p@T 0x 0SU #_R-" @mR/"IPI`'0" @[ 0_v @ 0;!p@ $p"@ ` @lRo$ $#@`~ "` I  ጜc~Q~`48ϕ00PS `_," @ 0$ R FU RoR!@ I I!@ I$ 0 _v @ 0;!p@ $pER/"@0%&@~T !@@@.~I  I ߍ /@/O-MMpX /@`@ /@T! P|P $P 1/P $ R  0P1/P 1/P|QAT p/@$`P _ 4C/P@~`@ P l- " @0 p @P s "@ "@ 0"@ pPQ+ XQ(0 ἰPPTq P0xp `` `7/ /@ PT0 0xp0P_ H0/P@ `7/ @ Ἦ,! Y"@㴮pPPQXQ( 0 ႰPPTq 0xP `` `5/ /@ PT0 0xP0H0 `5/ @ ᄮ /@,p! W~  0 $"@r"@n"@j"Q_ 4/P@"@ 0P  "@0 P, "@ P ? "@ P `NZ /@P_  XD`/p@"@D@uP <  0P@ PΈP P$PH`YV( 4@0xP  5/ 8 B$0xP0 05/"@0<  堈P!@Y d P/@P Q "@ /@P 0 O@p/@㐟 HP`  P[  0x BQP !#RN0`(@@`30Q  P"@Z"@ SP33"@" G" G8`@T0`4@ !(0S /" @C"G !,0S /" @C"G !Cn00S /" @"G0 3"@0P0(`Cpp  R,/0,0y0," @Pn0"VG3/y0" @\Pn0"GG5\ !0@" @(P @0y"5G:/y0" @lPn0j"&GWP }/" @0X "G0@WP 4!" @0FC"G4@CP0S A/" @6"FT0SM/" @("FX0S T/" @"F`0S [/" @ "Fd0Sb/" @"Fh0S i/" @"Fp/" @"F0吟  z"@0',00pWx`!Sp (@0`` @ p HV0`   08Sa`a0` R(@  R   Qx$ /@P l C~30/@@,QP X (@/@`VG $ Q@  L0 3/P @HXP$ Z:*  V P/P V/l /@ @ V  XP{0P ,0` V@,VTaV{_ 0l 4/@P,PY 0`x AV:* " @0)@ c1!@P !@ ᎭP "@0 b(@l /@P,00448!0> "@Hlo  /`@ "@8P (@l /@(@@TC@Q 1 1Q Io00FF"@ $PQ d L /@/@@P NPP"d P/@P  "@~)@4 "@dL /@@P ~4 "@PP 0 "@ߍۍP@-@s( /@PP"@ @΅p@-MP' @$PP# 0PP `HP L0 5/PP  !/@$QH`R UPPЍpH-8MP8PFP @ AT A4 @06 P2 $q$Q wP `P``V Q  ɭP B  D P  S < /@|8Ѝ H,x?"@" @ 0@m:YG-Mp8Q P `Y A A4 @P bP $A1/Q  01/P P1/P$QPH1/P򘀍@ @ W A A*4$@ 803/P<0S  3/ !`0````X@ 3/Pm d 0 H3/pc h L03/$- @ᥬ  p㦸ậ PA @` L03/P |Qxp `V:W$:P" @`p L03/P  |Q h l0"#v` pW:v```  [ /@|Ѝ H,x?"@" @ 0@mXX :,x?"@" @ 0@OXp@-@`QP <㠐PpP^ /@p  @D CT pp@OO-$M\+R X p@`"@/@\ 0 PU PPU 0P 0`PU UP Q` V$ЍOU`$ЍH-M"`A, / @P8@Q`V P AJ{xpP qd  /@/@`P o "@@PPqLDD\DBha x# /@ @PX2 $ d @ @0@ Pp %/@P @4P@#8@ P @0@9:P x9 /@ 0@09   @ &  @0@ $4 = /@ 0@0<   @ P+  @0@/ 0r / @00 2 p@p@ @0@PЍO-M` P@  `p2f1 8 00  Q7` RQ`V, P&$pW Q 0"  Sp @PF'@au"@8  `@Ѝ uK-MQR@簞8ԟ4Ldbw` B"@ OBˆp"@PPP XP AB0 =B,p! W@w` aB"@ -Bˆp"@PPPXP  B0 B,p! WT !@܍Pw$0 "Pw 0P w 0 Pw 0 Pw 0 Pv 0Pv 0"@܍KeK-HMD`)@@PDPpu 0 `0)@ 0k QL b@Pl̡ء P/@Pf7  /@ fP/D fDPP$U' P{"!n@ b@b@PPb @0&p& ! @P 0p [yiPWHЍO-4M@Q> `PpPP TL0 3/P X o 0P 0r000"P,`! VU $@Q:P P+E⚠+ /  @/ @PJ4ЍH-P 0  0$ ALVG-(M /@-p`W Jp$@@PvQPpGP wppVTl h(@u0 @u`QP + / @ 0 P P$1& ! @p@. P P(1& ! @p@ P P,1& ! @p@ P P01& ! @p@vu0  g"@(ЍK-MP P@ܦ`xا$LtP " 0 ```(x /P @ l@+" @0wP@/QPPePo_PP[ 0/@,!< !0PMPoGPPC o > PP: P7"Io PP0 P-#Jo PP& P#Ko PP P%n0p& ! @P 0p wqgPWPPލ@-@Q OPP p kP/  @/ @PUX @-@CU4 `I @ 48<PG-M^P`t ?VL0ت@pX`@"P@P  m? i?8p@T@/&#@it 0#(0S& ! @@1,0S& ! @@2 00S," @~@3Dt0 "@܍K-JMDP)@@pu 0 0)@ 0chQ  5b(@XDPdP+P)P  0Pv6b,@7b0@0)p& ! @)P 0p vfPWPPJߍO-4M`p8` P`f`AP $$ L0 3/P`8@ V V 4Ѝ@-@P$ 0 @\ @4( , TEQ"d b"@@A-BM@^P`s > VpЮ0\t\9@qs 0p:@js "@w;@_s`0g@Ys`4a=@Ss8P`NP^KsP"@ 0XX0S! ! @s@>8A@6s`d>?@0s \0"@/`0S, " @Z@ h0S& ! @O@Bl0S& ! @D@C p0S! ! @9@r 0 "@ E@rt`Qr0"@ cBߍK-MP Pe@IbXp Tlбܱ\xP FP 0/@,!< G0>0Po084Po42P8 P 0}u%dPodJb\pKb`pohpMblp0& ! @P 0  ZuePWލpP PptPotPP P@-@ QMQ p@-@` `Pt` F`R@p彩EQ"d b"@p@p@-@MP@ /@P JDP R ,@! pl /`@P  TX0<=P @ЍpG-Ml /@@?hX0,@gP pW pW (pArr` rePq @ ,0Ru0U 0 00   fp paQflPJP`,吁!(Q !C A ,R㐁   ލO-Pq  @ ꨠ pD pxrP `P e D ᢆpu (0 c0< C0 $ D8(4 @P` @ @4 Ap @ I0p8s4  @is @ds  @ _s  @Zs + , @Ss@  @ NshP `Y? z D Lp8e D Ep4 Pp) 0( @T!*pPT  0 iQP  @s0 *PP  6;ߍ  @ uK-M@ P;pP`p @0 P+pቄW ` 2!ݍH-(  /@/@PQ@-L /@@P @f 0H-\ @/P@Q @Z $ 2d/@Q 00H-\ @/P@P @G T T( /@0Q $ /@ R <Q0H-X0$@ R R 0S0P 0SHu0H-@PP 88AoP0@-M@ 5T APwQ ЍH-MjQ ЍH- r r00S@"rQo 0"@" @"0@N0H-00PQ%S?o2P h<$0@0P A A A@ eT00*eP*A, E00 ,000P S:A-0p`PWQpW P:PW ,L /@@PnV:@P0H-0M@ 8PP*{" P  0    0FPPP0Ѝ0H-0$^(0 !.BR*o 0 ?oRQ \Q A ?oR  0AQQ QH-M@00oQSrPW:$0S6( Ta p sB 0CoQr `CS0pFP@`$8D  P @=n _9PЍTP#%0H-0o^B Q0 A00OoSB P@P0T@$PU(P !QR@@0^0@ Q0A  @ S0@-0o\Q^ $@T ( PD` 9@Ao\ DT@0/oPQ"R/DQ@@/A/oP" 0AQO-wMM0P@pXQ  ؀ X R:RX &RZDQQa &AoZ P((P@堐@8$ `0Mq!P,$ @A 8p 8$8$Q $ D@T  88P $$   " @0 P( p;pPJy( L@?p@ ԁ( [8P@Z Z& ZpiDP_ ?E ()0@\p```@\PppP*  @(0J 0P9 ." @A~ 0P3 y+" @8;NPq|d`L $p[ PY(  P * ᫈P$I $ тp? " @ 7* 0 @pwߍۍY( @$% 0@T T@IP@BoM 7@{H ᔂ [:$(y( L㈂PH  0"@" @"0@K 0"@" @"0@K@-0M@    @ @00( P, 0ЍG-P0@pP ` Q ` `` V R:RJVH    P PP8# 0 0)"  p"0'wP  @  04pP Ѐ "XupX\ /@O-lM([ 0p  X  0pbP+ 8P+*`0 d40 P  ±"P% (p:0$0 LP   C"  R$p0 "[ p[ {k[p"@,plЍP P0H-@ PU  Po0H- 0pS8 0P@Q U `PQ V*`UU U P Rm"@040pP "c  0p@ "O-GMM@8 P;4PPP/J4 D`!p( 0P# P 0ypp PpW pW` uWPPPDP 4` V q"p@#jvPyU`04X 8008,D$( 0`8p P#"@Fv؀Xr8PK PPa 0 #",  #"T(B8P n "@vPDD$ GP "@ vP6x@pW W  E @fP& 0 "@]P "@uP 8 R 8"@808 "@uP PNDR0`V> 0"@"@P3 DP  8880p W P p$8 P"@pL8"@ pu @  `.`V 0  UPGߍۍO-_MMP /@P NP"@ ju@P _ߍۍ( /@`#Z`" @0t@PH*P ^FDh!@@(P՜pќPd `T 0,@${d<YO8 `@p4PpHL\Pe`PH P [ [) [TP+T `0\ P \&eXePP "@ V4  R4PX  ͝P d! 0  " `T`p  eP   @%P   @ %P   @ %P \P^!@4Pd^ @ $ H48@W$,L 0 HPp?eP$@ X\%YHPL9 Y0 PD` T04T0`PP0XԐ4\<8P ET0P<< <R 00p^!@՛Pd HLPp <@84,0DP<h 48@<80p@90`v?(EU_/`;D W/ ,0`0 R 4P @  PPϬPQ088P`8pZ0W P៬P0@w,0|d[/`L 0plL~P<tPpql0 [/ `;~`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R 93`xp W:ᧅ |D@)'#:3"@" @"0@zG'#E3"@" @"0@qGK-8MP* +`P! HHP @p $@\`Xp`Y80!!!1PppW@ ``8 p<0$ 8Ѝ~#X<"@" @#0@8G/ /H-0`@V PpDDP DP `pV@p@-P 0P@U  ⹴,`)VP$p@!#3"@" @"0@F@- @"@r@A-$ l /@/`@p@W P @PU# 0 4 `X `8T 0`8@D` `X`@0`4p`ZpP@p`Zp P0p8`Ѐ`P` p`ZpP[ e  PpPppWPS ЍO-EM8aV) - @@[ t $@p@"P@ P  / `/pV 0"@epoEߍA-M "" @oP-^!@ܗ $@AoP^!@ЗP 0@{T^v` P@!p@?P  0 ṗPB9@ЍK-MP`@S  "@APL "@APL "@APT "@|AP6 "@vAP6 "@pAP< "@jAP4!@P. tp`!@$@P i P @TAP@@PP ֏`P 0@( 8@ 㬘ЍD` ЍKP/(?6P )P:6P O-LM4p sP㴐`8  000<0尔,`dDEF$Tm<@$`@ P  P *Z48 /p+lPTm<@p$`@P g P p*W48 .pFGI0H - @Jp4800 p,pK`$` LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00  @ @ p` P 0 QQ1"2(pTmp$`@@z@P p*W d I(. 0rp 0O-lMP# T㙝 ,p$@ @P0  @ ` @ @` ``{  :/p*WlЍ0H-MP /@0!481"@c  0PJ  "@uqd  0H@T 0 4/ᑿЍ0O- M /@ .0LQHA04q8aR>TU @ QW X ?V p ?`\p`  0 ЍO/ ЍO-\M RZ dv @!p@0P  P0|fPU`@>PF P!@@0P  P0if=Up@P @/@P HL0Pd!0 PU@P?= 0= 0$%PX@! `5/p`\Ѝ@-0L /@@P 0H-0\ @/P@Q Q0 T/@ D 0"QP!@ RUR00H-@P *p- 02 $@H. `$x?"@" @ 0@A0H-0 P/@@P  T/@ T TEU P *$@0T T00|00H-MP0 /@@P  㹍PPT aP / / @QQ Ѝ0QЍ0H  /@Q/^ /0@& @ S :H-M (0 @ ЍH /H-M )0 @ Ѝ)0 @ 0H-0MB"0T00    000#P0Ѝ0H-M0 )  @ 0 ЍH-M00 T*  @$P ЍH-M0 *  @ 0 ЍH-M D+  @ 0 ЍO-WMMXP@& @0`p @P L+$0 @ P$`VWߍۍ刵P AP*[S y+" @xQ@[q ." @p0P QH㈠ 娰X\`@dPp}A " @0@0G @;@@PJy LPwpuw  ,$`刵P`$4"@" @"0@`@  ,&(`(P@ L03/P X( \,0"# #" 0@ T:$` " @ 0@o0 0xp 7/@`p@-M4  ?0PBT T TT bRPU 0 Q T TT @0  A PCЍpO-:SpX `_7@P PP-$p 0 Q & P`!R U R RR "q pRp a ` ^ P@UQXp: 0(Pb0P!,Q Q0 p p  F  P$p  0 0"D pPS 0  [XC"@F8PU qPU x|<P@P(P P' ?0@ . ?` $ p6RU UU ``%x?"@" @ 0@l(>:b>R R@>  pTЍO-tM8^PR  4/@0@ SD0AQ0R^"@L0` p@SY PPTTT  rp 0`:T 0W_ 0/P@,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^tЍQ @ P`P ` `P`  T.^Y:^ q110`2plppS 0 pl  40p0 PJlPU4PU8<`Y,P  Q Y  0Q0p 8 /@< @0RD AQ 0pS  0/@@ SD0AQ0R  /@@RD @P QbB`0Dp  "W T `V@`8@<`@D 40 P8PP! "A8 PQ o PQ {P- ? 0@ `pc-0p @Q Q< `V@ & @0D (  T, @% @0DP$00(PP0Q01Q U, $0Y"  PP (PP^ P $040rxP 00U* /O "U@@% P:$ (0ER@P@D"840 P"5 P`V PV |zgB0P-80Q  0U @P$ (0 `,0 V R8<V@D408 PPU PU Bze Y P W wPb U r@@"800P`V PV z5 5 0 D0pP T" PpPP PH` R V R RR Q p`@VP 0S`@`%5"@" @"0@;OPyPUy4 R\ /@A-8R4`U @y@TyRP2" @ @ @ @/A-(Mp@`P  B0 H@/ @`&PP  "0P 0`0 hdpt@lVpY`? " .0`Bi54@ h:0 ;兼PJ,dPD(p` Pp@{V$` P PP P! PPP P`p !R RR)0RH " ?0 ,0O@l@B R R R (0"r" " 0 YRX $@ PCtP T `p W  ,, Ꮙp 7qP" @ g ,| pP,| U-v `  WU PO `,V (pOPvPUv(pXJmz&  P4"P/0 L03/PDP%  /@@RD @P Q1/U P @ @ @ @vpCލЍ (p,`'':3"@" @"0@T8K-8M:2tP1 @X`$@\PVp pW p`V?0",.20 $R`p4  P 0τa@8Ѝ`n':3"@" @"0@9 8O-TM$H0$P L0aPHJ0H L`P4P000 4<($D @0JP.J(?< PP,(ŇO,t'C#u( p;)@0O!!D0C/R" @T#"p^    0.P'"X$! `VQYu  吵" ?|3@ /@p?`HL Q pWp  g3 0d3L?#"*P%"S ' H0$ 0PJPPL 4p?#"00 H ! `V Q @TЍ/p@-8MPQ2 /@ "d@A`y p ; P5  L03/P- ''+ "+p U3CUE0 0@3CC #1@ 0 0A""` #1 11@"" &<",R*" P&08ЍpO-M4@pPo? FFPP Z QPکPW   pP "@F4P JzPP PBPTW ЍG-4pq=pW /@PT \ &0 ?@`RU U UU R, @"0R Y+WӅP  GP:YW mP?6"R 22  G4+O-MMPQ {T4AnpPH 县 @P w  ;9pp 7 ! l@XpZw 2k0P 1/ BT _`%t`V tOPtPUt tЍۍ`}'3"@" @"0@k5H-MM@0P 1/ ;p `PqP p jsjzЍۍO-MO 4 p/@@/@$ $@ Q9# @04`j`0, / @pG0w@0P@PЍQ Q R8 /Q/ AR/1Q/Q//@-@0 /@P T /@Q @K-M /@$  Q@4`# @ 0sU p$0" @(@ 4 0 /@/@ p0@@p@@ЍK-M4 `㾁RAT V* T`TY pP@T U T TT V `PpUT ^ 0 08Q 4PU* pRUUO`Hp`VCp4WRU PP  4 W @@P"@O`p`VpO-M@㾁p_`EfPP V QPکP"0@XKQ RY  "(  `FpvPP P[Ѝ @- P0r0222R0+080@ R  @ Q" `:'V7"@" @"0@1p@-O@@T  @P`QP?@A@p@P`QP?@A@ @ 0$b #b QpO-KM`P[0@Gp 0@"@@0p@ ᭌpPePfP lP zP<bP eP"@ 0#0 @!@ 0 p)@pW@T  fpT!@ > ZC XAT? F"@ =!@سP"@ _g P)   P% #0 @`p@ u~PI )$ )#0 @,p"@pn@Z2 Ifp"@p"@P(f |f$e(e #"@ @0 P "@r$ gf$e(e00@#)@SX0 @cS0`@fpF/@@PhDfp0@P hP"@>pI  1mP n@-Mb1@+0 !@|)@"@ q[H- 1+f Hd@-D)@@pd0@P`@o O-M-RMdt(p0`@0p@0@T0P@e e J e 1$AS(aP@V0@ @@@U* k@ Jc0`@P\ y Y5 Pp@4@0@ 8@ ` EdP. A@0@@0 PP.p@ @@ 4@04@08@ ` @ EdP" mP s 0p@0S T%! @㶻0@`PV;1 A ᠋!c0 A 6.k ! @  _ dUdP0ᕻ`0@Q-pAP *pG WE! `$ @ =.! @P !@2?G kr @`TP@p:0 6@ uP[p!E:R :WpG.$@k! @ P @EP0@(A 1$q@DS  -T=IB PpJ 1 A0@㡋0 P @30 A 0 Q*P @ :0 %Pkp!% :S0:  @` &ed2a "%$0@T.1! @!e 0P0@ R50@pX(@% R!:Zv.e! @ Y@0@ R`0 A@1F@ p zWi.e! @㶺PY^&e! @㮺P0@ P bRߍЍc PaI*(e" @㓺vP.! @?e⊺vQP%.ra(/Ob"(r0r 27"cA.! @qesP.AH-0M0P  B ,X/PC0Ѝ@-e/@a/@H- M  ` A:c ЍG-RS PPC/7Q `I p@"@: `T 0%@`P: A-M`@P@1 P@)p@P P:PUPP#-P  U   TP V  ;`@P.@ЍH-`@%bPp  pbP3bU.7Pp@-P @ bp  `a@bpp@-M@ Wcp D@ЍK-`P* pP  @!P pA !P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM  "@BpQЍۍp/H-M`P@R   `Pb pT1Ѝ0H-@ _ aP  PU P R ojmjP  R aj_jPU0HYjO-MMRR @P T k p`P H`Vp@U,  0p "@:-P -#P,T P$ #!P U p PFP@ R@ "@ -"@-7"@"@Ѝۍlp@-@$`P-dP 0! 000` Pppp@-M>P`@+p& = 0@@p "@"@ 1p = 0@@p "@"@ЍpO-lM `KPo2p, @ 'p a ap `p XP aX" `p ap [ ! 4 t` a lЍ} - 0 z0 v0H-@P q ,R`}PpPPq B`!p000H-P,@@rap,@P@0p@-pM`0 @p P ' `p @`pЍpK-Mp@` Pp% j+  !@"@TZ)b"@" @T X  , !@W! @W T @ j)" @h0wЍG-MMQx,7QPp@& ` V/PZp` v_ЍۍH-MR @P`P pW  R: QpP ;,5UfpP.pP  QQ*fP  P  p0    H1 0@Pp@^h\hЍA-MM@P. "@"@ bP3`   ^p, P ` `PH1 0@ @[p "@"@l #^P p "@ + P +9P "@"@V _Ѝۍp@-xMP`@S . J"@"@ j  ^p3  `^p'  ^p!  ^p  ^p  P !H1 0@ p J"@"@J "@^J "@xЍpp@- % P  @ DZj$$ VPV  Qp$P%Q%pH-8q%@ PB6!@@P: %P; d' @0  0,, 0Hp "@,],Ѝp "@Ѝp@ P P P 6#! @!@H!@ "@Ѝp@H#! @&! @ "@Ѝp@p@-@#@80% p@xPU j"`@ P.PUp@0H-Q  @0   @T 0 @PT 0, 0"@ 0.=0xP Q0HvA-HM@tPP Q0@$3p "@|` 0P pU @ ? "@ 9- "@ Up  D1HHЍA-@`P7p@$   '1?  6  rH Q 0>P :&NP #P P pU e(0A-(MpP@`7LPP$p @ |=xP1 Vr P  "@"@U PP tPQ` 37tP P P g "@E PG | RF xG P? P<PP@Pz7P 6 "@lM(Q "@(ЍA-W  "@]h"@- "@xEP $P  Pp)P r "@lU(ЍH!Qe  !@d-(ЍAA (ЍA*@-M@tQ0$2p u  "@c "@<ЍH-MP@@p3P? + 0 - +;P  0h ` "@xP @P RP 0 0 R "@ PUP VJЍ  "@ЍH@-M@pP Q s pP t 0  "@Ѝ@-M@ P Ѝ| \ xHQ P Ѝ@#@-@: "@,PP PH@LP! hP! @"@@,p@-@`LPp @P$  PM: @!$@P wp "@WA ,p "@Np@G-M@q , =p` 0 pPF PPL x PJ p P   "@> > >$Q$ **]xP P P @ "@ "@@ @CP  'pQ "@Mx!pF'p9 Q    x Rx %  "@~| R xH!Q  pV  P%Q   @Pc  'ЍO-MM`0 [p 9 H"@"@\ "@ӽ@PbA+MZ` p!@Y "@Yv'7P & PP@ `Y "@E\!`1 PV PxP `@P  T`V1 @P xP 70@x` xQ@ | R xH!Q @70@ ` `VbxXPx  [x H "@Ѝۍ@-@ xpP$ L@}@-@3@TA-@Mp@PR `fP V :j&7  !@"@@ЍAP"R P  "@0r>pWU% * P P `*<0 p "@n <0  "@dX>P * @ЍO-$MP1"@@!PM B"@!PL R"@!Pp  b"@!PE T PFD `Tp P> `Vp\PK `T:0    TP. `` p   X P`;"@ 0A  $ЍOeH\`PP Pk p"@pEb\)@$p `"P@$@ p  0`{jPMP 4P 6PoP kP nPNP UPqpP xPpzp)@b   ZP x`V  PE PZ !P  T5X3 @ 0R  R  R R "@0 PU@ @  P @0 PbA0`PV_p P88x PPU!  P Z ` @ P @ @WZ (p2 PU   WP$xPU P Z ` @| P @ @WZ  (p P88P88P$Ѝ$ Z$Px@T h@@ 0< <!PPP Pf  0`P xRPB  ZG-8@P0`@ 0`R0- j`0`V$ Ȑ ̠s@"@@ p@ P   : i @`V@-@ P@ P @S=p@-M@ 0PЍpD1`H 8!@ 0P0@0@00@P 080 P  090 00  Ѝp@O- MxpW[ 0@Y P ` PP PXP X UB PZ; @` "@( @"  0?U   |_X |P  "@ |x6X.QpW ЍO-M`PP,`(` @"@)P 1"@#P? 0p)"9{  )@"@`\bVp] VpW Vp H @@M&K㪼㩜No$s("@"@$p@$ 0`y?PMPpb 4P- 6PN@Qf@ Q&tuttt8vXvttpvttv0@`ututttv v,v} "@xP\ "@O@K$$$p_0@<pd "@v "@@FpE)@Po p{ 0xEtQ \  0@cP= 0 0]P9$Qi "@y-P0p  0@DP 0 0>%P<sH "@W- 0 ~61 "@N-@ "@3 P "@=-Q 6 ,0!0@" @+00)0 ppRp% 0- @ "@$@e "@- @0Q@   J D:*Q p "@%Vp "@"@X P[ !6$@0@ pQ pW W 0L@P :\ "@ UP !P0cV 0 R/q @T# pP "@& !@! @0pP  P!@,0" @+㏬pm "@ . "@p!p!@F "@"@ @$0sp"@"@ 0,] P Q R000 ` ]0P i] ]0@]r )@P ]P@1 "@r @\p0 p])@Xy]$Bߍ$ 0p "@"@~ pR/ApP/9pB @ "@6 0@ }P "@  0@ X=0@ p |=0@ @|p "@T "@QWW x "@ 0@80@2 @ @ P "@"@ @ Q P,  P( . z"@GUp  P  ."@"@" @ '"@6Up  P '."@"@" @ 0LP p*70 "@"@r"@   @04P  "@"@ 0S p P p)!@L0 "@ -<p 0p 1"@  \STp x@P t "@c  A\!|S\090@ p) "@"@w #P "@ p"@ / ?!@" @ "0@ 0\"@20@ p^ n+A(p#"@K P:0@ @}p "@"@= !1R0, P: @P$@ P PW"@?"@' @!T$@@T  0S@ QP"@0-"@"@ /"@"@eSp p \090@ p TQ $"@"@ "@!@T p P  pp@T!0@,P  : p,p@0aPU p P  PpPU. !0 S PU0S"@9 00@ W!63 R  d70@@"@00 'PU @@@ P  0PPU|p$ @g"@^S0H-@, "@Rp PRp  "@0H)R , @"@0HpC-M@`8!QQ!Q/QA Q FPkЍpC,pQb  0>p\ ( "@"@VQ, Q< Qd9 a i! "@"@" @0 QI QV9  ! "@"@" @@Xp7 "@ЍpC9 Y P! "@"@" @ 0P9 s . "@"@" @ND!\H1B}9 I P! "@"@" @ P0 P Ѝp9 z ! "@"@" @kx@T  @ "@ЍpC@-M@ᔊq 80@d @/ЍЍ@_@-@၊p ? "@^@O0H-M@.  @ "@"@k, 1QP p@ "@P<,,>Q,Ѝ0Ri @ "@"@0JO @ "@"@DЍ0H<PЍ0HU "@@-@Q .   "@"@$.p 7P  P@iVPP  "@@O-M@PP`Р,(pZ @R ` `0RP    !   "@ "@9 P P @ P@Ѝ0H-@LP PPYLPLPYPTP PXYTPTXYXdP PhYdPdh|YhtRU xP  x,PPxtRjYt\RU0`P  `,PP`\RXY\0@-@ "@g@<@-M@Q .   "@"@Xb Pp PQ L>0@ @ppЍ   "@"@Ѝ@-  "@'Ѝ@ p@-M@Q .   "@"@$] Op" `PPJ|X5SP| @? !0@ @1pЍp  "@"@Ѝp@7`` "@Ѝp@p@-M@Q .  / "@"@_? BOPP p / "@OЍp@!Q| A0S| h)`@XPP `P@` XX  P ῨL>0@ @p Ѝp / "@"@Ѝp@p@-@>P PR 2 `L0p`> *>@pH-M@pP tqe& P" @?)P pPpVP T !@"@FuRP  "@>C & "@" @FU9 >pQ; `l!R pP 0qP0   "@.(p  "@"@lP >P p *P> g>)WptqЍ "@x`V >P`lP c "@>P p *`> <>p@< "@/O-MqP[D@pT `P `V`V P@Q`P T@ⴱ p``( P [ Q    ``㴑qЍ@-M1@T T @@@ @ @@0 S 0@Ã3  @  S  T `0NpЍ0H-Mq P@U P PЍ0"   0    P  @0@ 000P`0Mp qAA-@_0ϑ@`\```3puVp 0H| p CSRH-M\J C\U 0ЍO-M,(@`0pW P P p [Pp< 8pW P<PpP ,P4 @p @0 `P Q   Q4PPp4p PppQVPЍH-M0Ѝ@-M@bA̎.à.b@@ 0Ѝp@-0^ @PQ`V`V ^R`V`^`4``<`PPPU Uz7wV*T @`@Q T TPUA @@P> <0@  "@j> #P> *@XЍp@-@TmC@A-M`V @P P  nP Q  R0 p yC`VЍ SQ/#@-@TDC@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB 20^0R030O-aM0@p`F @iKPu P!("pr XZq  NRRp P$ PP eP ZW@T fP @X @\P @X@Tx  T@P(Y PX oP TP UT\X @` ^P \@T\X,LP P IP L[LD, o U( Q P[PPP"P  "@ PR$R$PLPI (HNP @` ,P PU$- 0 @  pp  @0 DLHpA@ 0@S0,PCP !6SR S2 @,PWP3RdP @h ɨP d@T!P(  "@P,PSʇCP%:S!S SU(P "@P U P(@ ( T"@ T@,PP ฒ*> _@RU p @ 8"H !pHP}H P! P 00L N "@ ] P3"@ @OPaߍ3"@ PA- MP`PD` Ѝ@ P P P*:P `  p8W p`8  P )@ !00:P PPA`p ``0Q` iP.P  ` ``Q40H-M P@  ~L 0GpЍ0H-@MP @P`R gp `V pT hP P `V`@Ѝ xQ/$ /H- M@0 P:`V 0 PpPP `P`V R: R #10xP Q Y Ѝ'Fp@-@ N PP ` `,PV:PN(`$PP` ` (`,PV:$PN$(pO-G- $S@p`$P@ P `mV? "@ QZ 0  G( @GLQ/K-PBxP Q @%L@QLP Q @L@QLx@P@TF LLK,(VP K,,PP,(VK40VP =4,PP40VK<8VP /<,PP<8VKD@VP !D,PPD@VK K KK` P T PT@ PH-@ D0\  %Dq@ ": 90+Q+\!Q 0\ RHrO0 O-MS pPQ`)@@  @0$N$@, @" @"@ 0 Fep 00@ P @@0Up  @ `p` ЍO-4M1CPP9   x ``\@X  ,dp8DP\h,lD|,P|P,8DP(8Ll@XX8HT`lx0<lxL@@\ t "@\ W "@&#!\ 0P " @ b0 R "@m< "@rO \\ , `P @@,P< pDP - " @0PC  =JQ \  "@ @ P  "@ P !@ P P pNHPF ptt\b  @ @n P y#@h P  "@b PO  "@\ PE "@SP\D @ 0p< "@?< 96\ ?fX\Pxr `tB  0PP0  0P P  0P= "@\ ?5X0\F `xrtR 0P 0 \ =@ `P Q P Q QHQE,0 @ PPq/P< 0@.P <, @!0 <,0 @ PPT/P4 08P 4, 8!0 4 \. XU X\  )@P @I 0@ `p PP ACP  0ApPHf@\ C  \M 8P 0P p  "@"@\? @ 0p7f "@y\ @P_ @d@AX \  "@ @PU 0P" `0Q=  "@0\ 0!   @ 0 R( ; "@\ ?X\FtR `xr 0PP 0Pp  @PPg@ \P  \H 0P " @ f`0 R W "@24 0!A -P p "@\# ,@ `Pu PpPp W   4$0 0 0g`,0PP "@\ 4R R 04S 6R 6R R{ 0 R R RsC\ 0P " @ _0 R_ "@\ UPS EPO\M ,`P@@TP" P PD PD HoP DT, !DHP)  P PP!@\ L @GᣱPL "@\t ? X&`\6pt @x@pP P $ "@3   P     \3  \( :[ XM "@+\Xlh~PP y\  P (${\ tgrxx"  \ @>P Xw\ ;lif\ ?bX\FptR `xr 0P 0P 0 0P< "@5df\ SP$ 0``VP< P P0FP !p @ ^0Px  "@iPUP P PE : @P p0p! pp pz^`0P  "@U\= @ 07p 4@\* 0P " @ H^0 R "@\ 0P " @ 2^0 R "@  "@k mQ 0 Q QQ "@PQ Q QPP@Q  Q QQx=NP p``0    @ ]0 RO  0PnPI F P  A1 "@4O24/4 40@ 4& "@ "@ /P `@P /P@ T /PPv PPn7 "@f "@`XPP^q "@J "@.P "@M P`p @!@MP`  "@ MP `P+ "@MP d  @LP $@LP^  "@LP `` "@LP 1 "@LP !@LP9  "@LP l  @LPP  "@LP Z "@LP a "@LP g "@LP o "@LP v "@LP ~ "@LP H!@LP  "@LP  "@LP "@LP  "@LQP@P@  "@}LP S "@wLP  "@qLP  "@kLP  "@eLP N @_LP  "@U P P PUz Pw P Ph1Po@ P4VP4 "@_A "@Y[ "@UP@ "@Ft "@ "@?VP.M "@A  @0/p 4@R "@ |PL ^ "@ uPV k "@ nPs  "@ gPL  "@ `PE  "@ YP> ~ "@ RP7  "@ KP  "@ PCPw  "@ <Pp  "@ 5P Bo"Y? P@PP'Y #Y P-PSVA P> P P'3E,p4PY:G7Y  PPP_ >PUPh P P@@EQ  Q QQ`` P PPVG PD P P3Pj P PbP "@ @P  "@P X"@P `C`CU@ #@P  "@PQ@lB @P.4@ 0)Ap P 40\!@` P P|P`P P P "@ P4ЍY,"@MP45,0@ 5 0@ 50@`4lPF "@fPp P PF\@@,0 p$ ( p E P ,P_ 0\ 8(Y  @P B Z E@PYPTPPF PH P PF^P P P Ic "@{RY 0D P  " Z0,Q "@UY: , Pp\ RPX 0P@08, P B D P P P y "@,S0 "@4B$ "@kP PP P@PX@@U@@U@@[ \WW\\V@ Q P "@ P @@  "@ G@ W "@P PQ  Q Q Q "@P@Q Q Q@&  @IP ɫPKBDP "@$P  PQ `0S0S  ,PQRU, ,PLP P% @ "@rhArW  I@ P:< "@N@` d `\0@P @ PPPK-P1PAp`p`UV# ];P Uq@ P*q@`FpUV < ! ; "@" @"0@AO- MP`p@"Py"PjP p U [^VQ UP X` *`VU\P @mPsPnP: rPXUZ VUPUPS 0P/ bPIUK GtP? xPA)@ p 0pp  @0  P5 U 3  mn.U!   0RP P  SnU P U U P X: PpPPU [7 ЍO-MP`WP" =@P" U``V@ BP @ PL  A Ѝ "@ЍO  "@"@ <p=y@W OP `VP P p? qp  >P     >  "@ЍO?H-MRP`@PUT' ``:/)P p   Q 1 "@pU  P W /G`T i-PT`U z-B "@`ЍG-M`PᐩP" !@XMP! !@ォP p )P @ q @MPPPY "@K Y "@GY "@B8?6?ЍK-@M P`@P  A p A A A KP t t ?@ЍG-`p V`1@PKP X FGdZ : J 0Qp00@T*H Q3/K-T`V0 TpW5 @LL Q Pbqp ||PPPP HHPQPQP3PPPPY` {" 2 "@" @"0@{` {" 2 "@" @"0@r@-$@c$@4g$@@@-@P@H-Q# @PP gP  P` TpP W`9P ` ! 1 "@" @"0@>-H-P TP gH$H?>` " ~3 "@" @"0@op@-Pp@ P`P T P`p@p@-P @c g@` ! '2 "@" @"0@Y0H- @cP0P> WPP00H-P g_ KP @#8@P 0 "@@` ! '2 "@" @"0@uH-P QT` ! 2 "@" @"0@c` ! ~3 "@" @"0@@-P @PT@` ! 2 "@" @"0@@-@P PC@H-T R H` ! 1 "@" @"0@hH-P @ c_P` pTP W`p@- MQ @T R% R+ PcoP P3" `" @ 0  Ѝp` " ~3 "@" @"0@z` " 1 "@" @"0@` " 2 "@" @"0@ O-MQS pRY P@ < 8P< aPTb t"`@P ` VP RP U!  "@"U  "@t  O !@"@U 7  "@ "@ W  "@  "@  0Ѝ` " 2 "@" @"0@` " ~3 "@" @"0@O-4MP8@ - $$@;$j$`@6p2 P B P "@"@$`au+P $ lbP ̠$`@  pT Q c P P T8pY "@qPPO9PPKPFTc|X P)|TTQ88xP5  P' P P P TT R P P "@[8 8AYP XX:PxxQ pVP g "@c_ EP> Ȱǃ `@"@ p8`PP,9PP( aPT P    Mp `P \P  "@`V P Pb @p"`@J}P >E pP$RO4ЍM0Q03Q/A-Q TPp Q @8P @Pk`PG TTQtt PPttvP88qPJ   #@"@W t  t  @p,P  "@& pP  "@  #@"@W @ pP  "@@V T$xxQ "@ @` v# }3 "@" @"0@;H-P Qw/ $ (4 "@" @"0@;H-P Qb/ 3$ (4 "@" @"0@QH-P QQoG/ >$ (4 "@" @"0@}t@-P @Q QoB+/ P$ (4 "@" @"0@X@-P @Q Q@@oB/ ^$ (4 "@" @"0@;H- MP9 @PP 00Po Pa!PU ` eP /`P@t0p@P `P  A AXP` Ѝ m$ (4 "@" @"0@ m$ y4 "@" @"0@'K-PP+@~A#`Tǁ `YiT d@d0`@QP/ $ 4 "@" @"0@nH-P Q  \L L/o"1!R01 CR #\ H $ 4 "@" @"0@ $ 4 "@" @"0@iH-@PUpEa X@WgxUȀePp@-Q( PR. `@P P pQ  0p@ 0p@U0%! @Pp $ 3"@" @"0@{2 $ 4 "@" @"0@_)H-P Q!.  $ <"@" @"0@v $ (4 "@" @"0@0H-D ZD $@P!@"@@Q0O-LMH}pP P0}pP G}$@PU B$@@`@?P:!@PU$@PU B$@@`@?P:!@PUp}| H 020Pf}U mPH LЍM0H-M  P0 3p @Hp@@Ѝ0HЍ/G-R'@PU`  R R* R3 `PPPpV' P* VP a ZpP  B% f5 "@" @"0@PYE R  @T:q B% R5 "@" @"0@6H-Rp`@PWU Lh3! "@#0@p! @0P `p``P QH RU p`0H-P@p 0He0H-@Q pPWP @Qze "`@ XPPPU:)@XA-M@`PPP]  up+  p"@ 2P( !R0  "@0 p PP ` p8aP ,   @"@ "@'ЍA   !@"@QU u "@"p@` !qPUЍ P PPQ4S  "@/Q *@0< "@.  "@O-M`Q @U GuvUP" P;@ @%  " @P "@p / "@}p Y  "@ tp  "@pP,  "@P$  !@P h"@P Q "@{P #@uP  "@oP "@iPY & "@ 3p t $@!3 "@)p x;@ 0 PP 0S y"@ p @ y"@p DP Rp @Y   Pzx& @" @  ? "@pl L 0""@!0@Q# @0QP  "@p[ H ] "@pT P i "@pM $ w "@pF H "@p= PP tQ0$p   "@p*  P  "@p ;@p$@x`V& P P   P` "@= "@:@ЍTE`!@@fp D `R_ "@ąp  nP `  fV T(!@" @㮅p TT!@ ᦅp  P`PEp "@OP>  "@IP3  "@CP-  !@=P'  @7P! #@1P h"@+P| Q "@%& P" @ PPj Pf x @x @ x/ @"@ "@pd   "@p] %P  "@pR %P x`V %P`V  "@p9 @  "@p0 PP} 0Sy "@ Sp @ "@ph "@x/ @A-R 0S w P`@"p@ qp 0SH-@P@pP'  `P.P$ !@xP !@rP G "@ _P HE .yP`V`P @H-X@'Q)P@(`A p`pP @P` XXpX `:`pP @P` XX X  R "@㫃  "@㥃 c @㟃  #@㙃"#$% &@'( )*+ ,-./ 0 12  "@.Y "@+` "@(f "@%n "@"u "@} "@ "@0 "@G!@ "@"@  "@  "@ "@ "@!@C   "@=   "@7 !@1  "@+  "@%`P@`XX X VXH L70@0S /A+ R 0S,0`Q \2 R Q,0 /H-QM`@Prp ;,>" @ D' " @ "0@ዂ` *Q pPE E *Q:ǖ`G ; ' >"@" @"0@nQލO-4M$\(P P 00!@APx A`0`,!@@p@PPc  "@ P "@ P@U P PY P.  K,P P @T,P(@$PT= P  K,P P @T,P&Y# `P$PX  0X  0A!@@P=AP C3 ?34Ѝ 730H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \0\0O-MSVP` @ Z7*@p` `V2 P@PF V :QE TCYP=@Z7@VC*^p [@ @@7.@ Z:pWA @'*^`^@NY Z:`^ ^ N BV?"`Q V`FЍ1.7+O-Mp@Q P@)@`X0y[ PkJQp a Q @YQ% \Y PJ \Y V; WW\pG6V0 WN5 !0@pG)  `) P /Y YV W6  0pG)\` V W" pG``)@@ U:@`V W  P P@7@ЍA-PpPW|)@ e`0.Wp@0.W`!,W W% W Up\ 0 -W_W  >S0p P p?Xp H"pH-M`P @P RpW"PP t-Q0# (  "@" @W 0ЍO-,MP0@ \p P(P  0 "@O "@p P P* `p P   0 p@( 0" @ "@  pG ,`Y:(PW $`    08/P(,`Y:( $0p8/P^ (P $`  R 6 Q S$ 0m(,`Y:$ ($0(pGp8/P-@ "@)&p 0p6 @( "@" @0,ЍOW "@ W"@ @( 0" @0,ЍO-M-JMMPd@` p. Bp>Qp\ T!@ pR T n!@pI =e@pD W  `   *BQ+V42 0;p( P B@p"  KP T !@`  ,  @  0ppBlP JߍۍЍy|WPV $@!P@#@ p W @p 24:= E@HK x  DR ϊN .0LP T !@xp P Ph% @jp p.   ^p p" p p Op p  2/ 2/^T !@:p~ pW:S  @i@f Pp!`@TP0P 1P! 2 }?p\ PEu1T@- @  Q T  D08@Q Qp@-@ `P` P `,PV:(Pp$P`(`,PV:p 0 O'A-M `P+p@ Pۍ@@zP `0)P q@///p@-MP$@  )`P? @"3 p6 0`)`&p  "@"@0@ `&p  "@"@ 0" &p "@ `np  "@"@Ѝp0H-QU0@p %.h0H.G-FM@>P+ pF`E    P `yqH F?&`> * F?&`Fߍ0H-@M@Q$@P @ @oQ Q@Ѝ0H-Q  RRP` I) T9 "@" @"0@$ Lo/0H-@QP   Pt 0H-(MP P@ 0 B C ) L0p`P pT !W:7 W`(ЍH-MP@ pP @$` A` `Z8(L 0&p!  P(pPP` @ A| ;L `p&`P``ЍK-MP pP@ G `䰐\ :L (%P qЍA-M P`p@B  @%ЍO-OMMQ @TPP Z @@&8`tpTC@BLpHP+p@Lp P TpLpXP3pLpT !Y|0 x HHPpt`(P 0T @x Cp 8LpDT@x@ Y PⲀ @ @ @  e`  `FV@L ` RFVL@ k Ⲁ @ @ @L  X 6@P@@ D$r z#pOߍۍ d) ~3 "@" @"0@ d) 1 "@" @"0@ d) 2 "@" @"0@wG-M"㠀@P`P P 0PPv4p Q *P p 0PPe4p ` P e,4a,0@`P'@xPԑP   "P\P  P  P @T:0,TЍF "@1A-(M P @`Q Pp(Ѝ0'x Bp pWtO s  QE j   RQ|@|  8U  Q' XL0Qx x pPTPPx"@GPT ) 9 "@" @"0@H-@M`P@  Pp B B0 B G $T !4P$!T@H H@0a@ЍA-p@l0Gh0p"PWP`R*)P lpbh `EpV "ll@-Ml@Q  #@ ` Ap l h2"U#ЍG-vMM@p$"Pp U U``U`QQZ ARr*P(Q~#`Z~ $` z xPu   Em? pk SP$  RRRppuQ  RQ  RR^P0 ` @  @ @ FY!@L p,#ph Q u AR:Q*wP$0`P$R p7 P " ( R;Q QP P) P  &P9`vߍۍxP @S@,PPP` V`P` *`RPRN % &5 P 1P  "@"@VP ,E/F?00 Gp=R^  L "p / $L -)H-M 0 2Ѝp@- @0 Q*P`E`U``@ Tppp@-MQ @P P R xЍp@&P.PBP @v/PU ` 8xO@ PUx@T^@Ѝp`>P* P @TQ/@-P@@@:V@-P@@@+VP/$$ @ `O-M(p@@5$@P.'Pb `@@`@P "@D PpՉ pp"@  0w 3 ppP =pPf D !p/ Q(P% (`  lH !p ) !p  7/P$ {!p $I#P  "@ p  )@ЍO-M`$@P    Q4:  0Qp@T WP pP P   ; 00  R:   q ЍH-Mg H !Ѝ@- M^ @*@@ @@  0J Ѝ@-@ (@(@-@p  p ~B pH-M@P `$@p `Px *`$@*@ G gUH X%$ @\a b @%$ @\a b+ G   +X!V/ ލK-pz P $@`@"@"p@wQx™\ tr `"@T 0R ,0TQ vx™`,p V:T j "`@ v,P@TO-MRpЍI Q@"@"@PU.* U 7p `p!W*P%W Q  4PPV  0`wpp V  Wwp7pppJ"G-MMRp @0G`P P Pp T !@pP*PЍۍ PVT !@wPp TpG`!@W q7p V wpGpb7@-M! @ R r@Ѝ @R S0 00}P Qp@DTD@O-,M`P h,Ѝ@ _ @  y0SP  !@ow 0BPm 9 "@PP*P`JP=`p  Z8PP6@#P4 Z( Q( F j0$p t$ ( w$t8 q P`X@: ` P"P ` @v @yht X= "@PiT`W@ !0PN pJPHP `Q( # Pk ( Q   Q  Qt$ ( $ 8  P`pW:0p!R Q 0p$t@P0 jP pP$($ ZP P(  8  mP`W:`O-M P@P"40$4P $Q``pW pWO U0   "@p P"0P` $Q:` `T0 "  "@p 0 4  "@p P"0P$P T0 F  "@p T0 ^  "@`p 0lP p$`, s 0"@ `p 0,P $`!@@ @  "@ 0p @xQ tb@#,`@xT:4wp@0@ R @`,`@T:`Q \bp,`p`W:x  QH tB`0 P1 ,@`xV:8Q pW Q, P" UP "( @p   0@}P(P:0P ("0 B@ ("  0P" @势`p0P0 P"P 2("0@0  0@k`,@V: ߍO-MQR\ @cPPSP PVpЍcPl,@P`  p YZ*0S S6 Z `  X4S V R  @  S 0W  Q "P X H00 ` Q p @ ^P  rWz0H-@T P PPPPPP@P*"0x2S0@t"PU 0S, 0 00H-PU0@L0@-@\Q\X\@-@`q``H-M`# @p0 P0p pp" 0 pp 0)p PV @   p @Ѝp@-M`@P5 0Phh\P  R 60@@" P  d * "@" @  "@ R "@68& @Ѝp@p@-@`P`@ >P:&ꔳTx RpRQ TQ   >P:a  "@p@?@-@$@ᙼ@8& @op@-`Vp@@PPL&  @0$8 0@@>0 0@@4  80 "@48@P! h`H 嵺 P dhCP ЍKNЍi`L "@ 0.pb "@ "@LP00 "@z) "@A-MR @ ` 0Q0@ 0p 0S  R-  . 0P Q :  PN  0P Q: P3 0| P 0P:q P 0P;f P  60P Q:Ѝ6  . > "@" @"0@ H- P@` "@08 @ "@'  @0@ L <  cut'  @`HV0H-@P@   "@  "@i "@hhL0HLH-MP@`p: @P PP dp` |8  0@@p Ѝ& "@ЍH  & "@"@ЍHK-P`p @@P'   P%:G  P  @  P - %= "@" @"0@M  zP  d#P  $0 4"  @Ku "@&: "@HKR "@KSp@-@`KPP c SF Q pKp4" @pQ0S/00@0 dQ Q/ "@0H-MP@UP  0Ѝ0H> 00@ H1 PЍ0 i P P<P  0Ѝ0H #@ `$P EN 0 "@g  0~30@ @O-WM`Р@R L@P@QP1PP}LP咱 _@P @[/ " @)P @[/ " @'* " @* " @!$@ R 0 S $@ R 0 S ZT0 @ "@0P  T0e "@0,Pp (P " "@ R?>, "@9'(PXIK,p`P dP KQ* [( RQ cR R SRcQh > B(P* g,p$`  P [[ RoF ((!(R$`,p[[T0 5cSF PP$ AR' DQ$[ [d0S h`$`0R 2P$$Q D  RKo<P[@P8 X#@ `O*`P @*A[   `DPj[  @P^:2 PzD[ ,p[(Q AQE:30P@P;:7` PxPO t0p $P (` `(``P` [:Q `V  p``x0, S:AP+ tP @P:,p6<PXp PlPA h&0W` PvpU Q: a (pP PPp Pp  Pp(PPPP P0, S:[ P:Q Q plp(W @P:9pp`DP (Y APwM PP,p(P APa,`=( (P[   (W `DP APB< PP : ( Z@P&:P[F  B ( 4 CP Y Y. p@ `P `P  {P ARQY `C  P PP $` (^ @P:]P$`[   D PE)JPFKKhP[ p pxP` $` D   PpE㒮w@ r\P 0pw2 "@0P$`2@P' U:#@e 0,EdP $` h PPU P$` "@S0P$`.<$`P:"#DFH!$#D@! r T/ @4 0P LHD@<8R44L<8ap* 0PyT APJ "@!$0PX  0@Wߍ ` f$`P$ "@/A-`@pPP P H "@ PP @PPxhPdP    5 $ AAK-M`pP@P PJ i "@"@0ЍKpG tW:@Q Q ЍqW:<Q:Pp R:pP P p pVP J u "@~P  0 `  a007ov 2P0 /r B @H-`P@R : PjJ0c "@ HCpPd@ 0Hp@- P`4P @T PGJ0 "@ p@ "@p@ Q \Qp0 p@0 p@O-M@p xPU& `;U PQPUT P> R* ỹP "@ 0Ѝp@-@PU `` (`@xPpP QQ|q t||p p0H-M@@J PP@ P  Ry  @>P: ' P 0+' P P0    }HPZ "@@  0+S90@ @Ѝ0Ѝ0HzDO-M M@  @(P8|p= pL PUP P` i`"@ȀHp 0@Ppl@@ ((q2 `DQ*  P(  R5 p| 49  0@@p  "@"@3 p "@Ѝ ۍO  O>@tP(\ @((*(>  (P >Q * 2 + "@ 2  "@IpF @L@ @@ _) ` iP) V "@ - 4L*taP( (((1pt! "@Z "@Ѝ ۍOS? "@)@$P Pp Ul # "@" @K!PP  !@ 1;@  50`TP    "@P PP   cQ0S0SS 0 PcQP $P0 3@Pk cQQSQcQ0p i P P{ cQQvSQcPq n@TP PL P , `EP PR cQQSQcP~$G  "@n < 0<U@Qk q>0@h !`( P `PP  h hdP y0cSacSPcPfc T  2 "@Sa@ F r 0 `0 P0R  "@ 6$@ @@4 B80A0 C48X  "@$YG  "@ uЍ ۍ9 0@ $)  @a0H-@) @0PUhP00H7O-MP@pWQЍP PdP  0"@ d"@  P@Q P<8 <h $Qhhd@ P   eQ $) "@HHP P PF  "@=``@ `{P P  0 Q 00S A AR:   `K-M@`p@ P P$PQ9gF  "@Bi@P/  1PP  0UP  "@H< 8 H `40@ @Ѝ hhB'  @=0H-M@0P Q  RU 1Ѝ0t'  @ p@-M`P@\P Ѝp@ @AP\ 8 0@ Pp > "@"@KP )@1 "@@@ > !@"@@ 3H-AMMp@Q\P .  K "@"@ `$rp 0 pW\PU  P K !@"@a_Aލڍ0H-hM M@ TXP PP0 A R CP0 X C . X "@"@EU ` p TX "@$hЍ ۍ0RQ:0AQQp,R| p/O-M@P P x@0P ЍT1P> R *ƴP   0ЍOLQP Pf0 Q U 0S: @D "@oDQ Hf0 Q U_ 0S:  50P Q  Q P "@ P P ; "@ "@CK "@$ P`L p0  0PPL`VP6@H   60PP=i "@7 @D "@ЍOC` 00   0PP6V`VP l 0@PN P PG P ] "@8t "@ 0   =P Py "@ P P :p "@iP `40@@埾PP < <Q 1P  "@ 0fPP! 0`! " @#JPK?0ac 0 HPP   "@ 09  P `y "@ Q  "@i 0\`4 0@YP PP+  P`&PQ QD Q]PR`@`Q$DV   60PM QJ:P<H "@4 "@ 0 P hh 0`40@ @߽?P.   P0bP + "@Qb Q "@ "@+P<`:   P0AP  ?; "@ 0 y: "@ 0 q Q* P D  L:B8& @0᜽PR  @ R 8 0@@o$)  @ QP * P    0@h "@P p "@`H ``p\PPPO-IM t p"@P HPLa p` X" B}PH "@IߍO_ P @<a Pp ,0@ 60$@@z$ o0R03p 40@l'P $ R ", R QP $`!@@ @0 P@BfZ!@ a "@ `W O"@@fM!@@ ` P(BZ Q "@@ Q "@A t @"@0  IߍH "@ܿIߍOH-M0080 @P PU`PЍ P  p(@0H-0M@: 0rP P ,,P    ,A  "@g 0P 0K*0Ѝ00H-@P  "@d iL 0H$)  @ H-p@`@PQ ]P P P( PHu "@ "@HHC0H-@P  "@vhLh0H00Po ap/A-`@ P:P P@qP fP 0p !R P/H-0S ^Q0 SR 0 S QQ/) 03?#R/Q/@-x^0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-TMxPUt @ P @Th$ @PU]@$@㈼ QP P. ?P* 8 :P% <` @oV V   P P 0<  # P  P@T  P@$p<` 5#Sh0O P pttWP`PQ8PL?dxQ XCSh07 Y ؽP `&@ V@ ƽP `@@ 㸽`P5  <  p "@J5  <  H "@>dP  $@Ȼd P zP `d|@p  |@d @ 9 qP$  jP" `8]P Pe  pu+ | b N`P pK $  'P@ @p`@d8dX 6xp  P ` n|xp |h|dXkᔻP `#  `PTЍ+ ,% <5 "@" @"0@*up@-PH P z "@H@p*1P &P "P P m$ " @  !@v`V  R 0S `Vp0QP   RU dPdh+ m$ <"@" @"0@ @-Q @r P  "@7K-Mp@PP# @PP`V4L P ` P  `QmV "@@OT  R P` >000Po @ aI# " @s]$p >66 0@ @0 "@ ᅻp  ``@^P   "@"@㸻@ ЍK-M`pVq @P $dPP4( ,0 dP  h d@ L!PHPPU "@ㆻ>hP dPHs1 R PQ PU( R, R  "@XQhdPwPHCpЍPP  Q  /G-MPPU @ `xqz 00   0 TPЍO- MR0x!@<R  {P PP p`PP"Y Y V' P PC 2yv ЍV P PP3T? 0S= Q4P7 0` P0` ` <000PoI# a " @-\[P: `Y ЍOz `` "@ ЍOy@-P@TQ   d P@^ p@-PA `EL0@H0@\@ P)@0@ Q(  P:Q0Q` 0@PP@\Q @ @CQ:Q`VQ`C`QpHD0@@P  L0@p pp@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0   0ЍO-P( p[ PP  P J Q  P Q   P@ጅ PpPZx0@Ѝ|x00p@ p+P ,P S 00P P P S0RS00H-PS :@P0 a D@0p@-@8P  PG@t0@P `dx0`@0@PP لdT0@pp0H-`Dx0@@0@PPP0ńP0p@-@ P  P@t0@P `dx0`@0@PP dT0@ppH-Pt0@@-@Pt0@@O- M`p[ pPPt0@[@ @P! X P P P[ X Q UP`Dx0@@0@``P J`P Ѝ//////@-M 0@PP K 0@0@@ 0PЍ@-K0@@0@ P  "@!@WPO-M-M`0@ QT@Pp0@ P[ V``P Pgo `@ 㤻P;  pϊϊZ |P(P  2PJQ @oP P  PJQ  P@߃ PpbP,g  @P g @P g @P P P P$ :&PP0@ЍЍH-MP 0@@`pP$P  0p`1PPoPЍH-M+0@0 @;PЍK-M`p@PP  0pp(`Poo0@P 0@0@pP U@@Ѝ0H-K0@@0@PPP0P0H-M+0@0 @;PЍK-M`p@PP  0pp(`Poo0@P 0@0@pP U@@ЍH-P0@@-@P0@@H-@P`p    H0H-M@7PT PP 0@P Ѝ0 @ P@@0@P @0@P @ P)@@&  ! @"@04/O-,MM@0@P ,Ѝۍ"O,(0@@(0 a p/0@0 @@0P oHhX!@(p0@)@@)`@)P@P P P "@+p 0@X  "@㥮P lP (H@2Q7 <H\h$0<H\h 0@aAP] P` )@po 2 "@!0@7/Q0@MPI0@EAP?AP80@40@10@*0@'P@%P@ 0@0@0@0@0@ 0@ P@ 0@0@0@^(pP6( 0@ Q p `0p@R0`@ 20pPp`p0`@p `P0`@PP300P@000`00@`?00@P0 00@ ? 00@$p0 0p@ ,p&0p@ 000@o ( 400 @1 00@0`@ 0q8000@7   A0@< 0 @Q4 F@$@@0@ᬯP P0@T0@X0@\0@ᜯPl0@P_@0P@P P@0@t@Qv$  @@-@<0@P*@l0@P @iO-M@`PDP"V(:U3UE3CF @ @ P*T@0@Pcf@pW*0@PL ` P 0@P= `P0@W<P0@:W0@P `V `P0@P Ѝ/0 @ 000 0[:S[ 1pBW(0@`Xb,l0@0@[ pp1Y 0@Y 0@ P `,0@;H< H0@` FZ0r ! Z 8G088S B! 00P "QQV  0@00#0QJ 1q R ? t F0p@Z00&  aJT` d(`+ +!+ +8!+ +!+ +9!`Q0  @0#0Q 1q R 0@0#0@Pm 0@P( ?tx0@0@@P@P@Y pGP `H H <` W G-@ 0@ `Y0@P/ 0@P2 @ ` @k)@@ "@)@@ "@& ! @04/b@P`o  H-MP`pP4FPTA Q:Pp)<0@P*P P0@PP0@U:X0@U :0@P. PP  p0@P  P@0@P Ѝ0@PV@U  @ P@)@@^& M ! @"@04/O-MP@Q T `<0@P *,P0@p**!%`$0@P;PeF    P E1o 3   P "2//o 3R= HP P0@PRX0@PMPv pU  1P :0@Q *Q$*0@P PQ: 0@)@ 0 2!0R 0@P 0@P pH0@Pc P5 Up`1 ᣷5) @0@@嶬@0@ ͭ0 0@ 0 p# p @ 0@0@PR 0@PT W0@P-  p0@P Ѝ@ 0@άnP0@P T 8PSPP p @ )@@V& z ! @"@04/Uw*FZ wUuE~qU*KZ sUEqA-M`,0@P  F0@ 2!1 pWQUr  BA0@ PpP{ $GFW&<'$ @)@P0P@`@ 0@Pe l0@@=~WH&$ @   W<$@'Q0 0R!p  RP Q Q Q Q T*P  @Ѝ   0 @ AR  ЍAQЍAZ ~ Z Z @-M@0@P TKЍ  @@@-M,0@Q /0 @ @2> RNT C @0@ZЍ///O-M0@P ЍĈF )@!@@p "@ 07/p ^&"@ @! @07/000@0@0&`S! @!@0`@y: *P`"0@# @ { ?p!@#0@V0+ "@7/?00@C-0D 0@oPS" @"@0`@&pU` @!@0p@{6$ Vp"0@ @Gg   3 P"`@!0@W05/0@gv\ j fvF\L!`@R Q5B1/! A  @!^㺦 J !@!@"@ 0 Mp`@ 0)@@函 ^6"@!0@ 4/0@P4 (@0@@Pl0@Q tPx0P@0@ @P@P @Q P\ 0@P孥DЍePT0@ R@ϼ)@/)@/Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^0`SQ0CP1S 0Q  /1S 0Q  /l )@/@pA 0pS C  S \ 00 / OIp)@/p)@/p)@ /p)@/p)@/p)@/p)@/p)@ /p)@ /p)@@/p)@/p)@ /p)@@/p@-gP@$`@P @ T@pQ Q'$ @//Q R !R/ R/ RQ/r)@ P/P/p)@ /P/@ RRR/@-@R !Юp)@/p)@/p@-MV @!P@P@`>)@"0@V0#@ GЍp R/QQ )@/<,  ! @!@3P/H-0A Lr RA C 2r R 02 |s R|s Q QO-MP `R,V@Qw r& rl[n $ Rj`Q@gЄ@$@ pU `W:` P`pG`PP`@~T~ Pu 0ЍO/[ @PE:`QC `Фp `$@Pズ[ P   X( Q   1ᑵ@U @  [P`~Y `XP,@[([@Q (@Ѝ4$0@pR `~Q-@ 0Q Q@0@U Z 1ЭV U X \ $@Q[ "@/)@/ $@Qp "@/)@////MH-M  0 ЍHЍ/0H-P)@@G @P ú !@F  0HMH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M UUE3333C@@!??@!11@0! S Q:P @J@GЍp@-l@P$`@P P UppQ/,$ @/O-MpP `@ `PP:P@L pP TUAU$* #P$  P$p`ㄐ( @,Wp -D @@@ <@ 0pP0 0 PD00 0p4p ` G E$[@   P * @ p P:P|0@  $ A  b`P Vpp@ P0pP"=SM` ```````````((< [Q< Jp0p @ =Q P90 p @4< ["Q<"Jp0p @" `~  >#Q>#"R RRW<0 [Q<Jp0p[ Q P0p @  p0 @>3S<P[; P,4 [8p ` >3S P:/V| `0@` < Q:8@TY H` V` < Pp` <`0qp`[kP  P A,K Aq P ` P8 @[  AP, 0 B P *PK0pW q1Wp! Sq:0CR A1S0!A1 R PL*Q Q: Q:D 0aqPWP1pQ Ap60 >#R R0S0CRS 0`00HE2 er0@0 p0 |R`0@` V 6cppЍ`8`;P`p2`1A-M@``>Q$A QI !&&&!"!!&&$ 0 (  (e]Q?Q" [Q \Q(V:|`0`@P`>Q* <Q-&'^Q {Q |QP<9P7 4V:P|0@ @`@` V $P*)P )  V LP*`)P P|0@`Q(**0@SpP p@{P0S * ?)0@000,R Q |0@VQ |0@>P *PW +P0@ E_?P` {P^`0P*0,Q)@< H0VP |0@ cQ* }R X b. `? $   $ uPh0  @+0  @&0@  @P!A>#" P   ?Q^`!p^ ]@#  x)@'Q`QP ] P  }RP P |0@P* *0BS p` p@ P |0@ {R P*)@ЍK-M @\Y P:P|0@```JY0JIPBL))h*h*h*h*h*h*h*(((((((((h*h*$*h*0*/y`qPLP  O$ ( F*YV .Yz [Y]&}P|0@ Dq{YKP2 / @`@` V $P *Q*\P)P \) ( V LP2Q1* \R)Q P|0@3&. +P |`0`@P` `QHV x)@'Q`Q||0@ {  P#*0*SPh 0n @0 c @Q*\S{Q $YЍo`0Q* 0,R<Q*)@ V0VP |0@ q RQ1*0\S0}S+ R *Q * Q\R }R P P^ ]@&`P{P |0@p @-@P*^Q  $   $ @-@P @ (  (p@-`P pP@P:Pp   !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QP|0@tPo u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AM  R0@0 @1>3 " :]P P|0@PP  1 B>3 ! A ЍO-@@@@@@@?F 0u @ P!A># " P   pPp  iPpG0H S@@X@P >F 08  0 @ oP!A># " aP   PF 0  @ GE|0@H-l}`)p@@PPQ  , (,YP+ ,( , P<P! )@0Q1 Sr1`/Q) @ Pr0P |0@@-@ P*Q* [R .R. Q 2R1:Q|0@P|0@0.S ]RA-@X 2R1 :P|0@q`0pSWp]W `00S: x $@P"p@ PᬩP pPWVPA-@l )@PPQ 801 ,P /)@) @ (0# RR: -'R:08GDG\GDGDG\G\GDGDG\G\G\G\G\G\G\G\G\GF\G\GFF\G\G\G\GG\GDGDGGp >Q>"P P P Q`qQ` O-lMPe"@Q` 0E P  lЍl)@,0Q : P  ᙨ,0  X8P= ቨ,0 ; @Z:,p$QX 4Q8P Rp.*$pJ @P< [:$^,0P pKZ+pP(P0 P,0 .@ Z:, p$P  4Q8P \ p*$ p J @P< X:$%,0P pHZ @P$j:,P Q 4Q8P$PR* P@pp@P< [: ,0P $PKP<@ pB$ W B*d@ W'*P p W:(P0P``@CPE@T`VV[0V 0A`1T@1@(P,0p W: p <@ pB$ W Bt*d @ Wj*P p0(P`@P@0C@T`VVXVN A `T@10p(P,0 W:pD#RR>p&A Q `bb``bbH`b`baaaR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Specc@eeeefgcccccccccggg(h8hccccci2 Q@  0p@ @P>  X@:; "0@Pd\jii\j\jhjj0k>S 0pm `Rd\hA^c p @ Y0PW@[ >># R0^B*)@ _Q7^ ^/^*_Q',0^! 0^ ^*/0) @  pp_S0^0 0^0^ _S^   0^* Q)@_Q 0^^)@_P ^s )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >l-) @ `SRP 8010 Cp <@T6 P)@P"  @-)@_P# Q@P`Xx:?^  y_Qv)@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0tmm0mnn n4nDnTnooooooooohnxnnnn0m0m0mnHm0m0m0mHm    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJl->) @  s(RP 8 7  000>0HpW2qQ@, B<.Y PPB()@ PP()@PPBPP  @T" ,ЍH-@l )@PPQ 801 ,P /)@) @ (0<pQ ` u`R* w u`R# 0P4P 0 QR RP$P `p P$p`W:88oO-DM0@h` 3 (pP* 0lP p Pp  P Yl P   /$@Y p<<p@h` Sl @Q~@Q40p,@8 Q$@ $@$$@<(qQ@ @ Q  (pP8P@PX y  X0yp Q@Q# )@8P 8=)@4p 8_P @P <@ p_R 8Y 4 )@r  8 _Y ppr \ @ R < r @_QpqQw  0pY@P"Y <)@q@_P4@P 4)@q_Yo#wP'< )@^rP4pr o w@ $@  w /opP"Q~  R0(, o0` PPP SY @V#RR>p&A Q wzzwwzz$xzxzxyyyR p>#p!>3 S @ 0@I`8  0A FPP @   0 @p2PZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp|{{}}}}}~{{{{{{{{{p{{{{{2 Q@  0p@ @P>  X@:; "0@P\|888D >S 0pm `Rd\hA^c p @ b|0PW@[ >># R0^B*)@ _Q7^ ^/^*_Q',0^! 0^ ^*/0) @  pp_S0^0 0^0^ _S^   0^* Q)@_Q 0^^)@_P ^s )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >l-) @ `SRP 8010 Cp <@T6 P)@P"  @-)@_P# Q@P`Xx:?^  y_Qv)@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`pT@ QV,ЍXP 0 0"$  ~(p-+Rq08ąXXXXXXXXX$4HlĆ  L> AGE !0 > Q  > 1> Q@4>  >@ PA*^# $p!P$P P(Q qP p  zQ ^J @`∀Vc^Jl->) @  (RP 8 1 >083@8Q` <@Y PP()@ 2PP()@ 'PPPP @ O-DMP, 04(`  y   0Dh  lP   8P PU8l@ Q ! U <<$l@PP  \yP@8(@p0S S@  @$@@<qPU U  (@hpp S4P0 @U,0@T {B  0@T?{p Q40P,\$ )@,0P^ hp(4,4)@8p _^ \ <_\p ^hp(8 )@r hp ( _^ @qQ?@0p s0RtB  0(@@ p0P 4(p^\!^ < )@r _\2\ 8 )@r _ ^ o"pP&/<0) @^ s8@s0 0otp0P0 hp0 0t0 ?o4 2 Rq B 0kPo@p pP4 @ RxP@Q( $@[$P ͏ ȏ<@0h tB @@8@@ @@P\a < r [_\fXlP h@P DЍO-M8@S*P`  >#RR>p&A Q 砎ppppԎpp(HhR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp稓XX̓HPpXXXXXXXXX @xĖXXXXX82 Q@  0p@ @P>  X@:; "0@P ThT>S 0pm `Rd\hA^c p @ v0PW@[ >># R0^B*)@ _Q7^ ^/^*_Q',0^! 0^ ^*/0) @  pp_S0^0 0^0^ _S^   0^* Q)@_Q 0^^)@_P ^s )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >l-) @ `SRP 8010 Cp <@5T6 P)@*P"  @-)@_P# Q@P`Xx:?^  y_Qv)@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0PМ(4ԛԛ    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJl->) @  s(RP 8 7  000>0HpW2qQ@, B<Y PPB()@}PP()@qPPBPP  @T" ,Ѝ///H-! // //0H-P@0P@P0@{ Q0P00H-P@0P@P0@{PTP00H-P@PP0Გ@P/=@P@   // /////@-P A'+ 0@@0" @P+#K "@@P P/$Q/ 0  /ᤈK-M@Q% Q 壟4`0_8p%pG_Ə%_YoP/rP  A/"?'3-YЍ@K-M@Q$ Q4P0<8o ş&``FWoo/b o Ao/"?&B-WЍO-$M@0LpH` 0 R*PV*V 0S{P # !PpW !@"P*`FP 0V:P A TP 0Z ?'/Q3Q3 ^2w3QP ^*p@ 0 0p@ pW@@2P W*VJ3oPP& Z V0`FV|:ZPP P `FPV 0V*eUY TP  Y w: Q:VK U! E\ *@P:0 A R9Q0S EQ1 L P| 01P`F1`FPTP 0P  Q* 0 <  ! 0V$Ѝ N 0H-M(P @PPP PЍ0蔂@-M@(2<FPZdЍ@= 2  *4>HQT D  ,              |  d T  <Ѝ+  l <} W   |aO-MQ`P@T FP p 8P P nPoPoPa@PThhhhhhhhhhhhhhLh  yP  sPZ U ePZ T WPZ Uhp IPZj UZ< ;PE ( 5P?  /P  )P  #PhZV U4 P'  P!   P | P h PBZ6 UZ UZ UT13TTTT TTU  Ѝ Z% uG   ^X 6&p@-`MP0 ` B@ @F?Q @@@@@:ϔ0"1P p$ 0H ᧔p ᘔp  @p@@@㪔HP 㐔뤔P墔 P 뜔P`ЍpO-DMMp yX@@? p FDP =`v P `e $($ ;r$ P@ p @ @q⨱8`pp tpW1 @ 0?X A  =zp P= PPP bp PX*@ @ pTP  @n h\Y @ ; @U gH DЍۍpq be  r 0H-MP @ 00Fp !wPp U .i PP $Ѝ00H-p @@PT 0P.Lp xL PꮓP\@@PHUD  @ @P0$wovdoPCލnmr0H-MMQ@PPp\ T /P@!1@@ 0  P:?AXp LƎP :4p%@@i/;p- +| 0@]Kp 0@(p   ]PpВ@͒@PЍۍ0ƒP#P/p @ἒP\q@tlts\l @ Ѐw  PB v:  ;K!S-5:0`X/ Tptp`VzQ p@P@%g'E# Q "q` 2pG`Vp, @NPJ" 2"pq 2apRp T廏@P4/@!  S P! !BK P * *BSRCq?Dr0AB1/@2 `L"HS p 0! , @P@pO-M`2ᜐ嘐@P p P ` @P8p,00@8L@DHXPPXH`<Cp(d$4T@Ud aV$uʘ ~_P `PP PN QJQEaV 4Vi F3Phx$L$DLXp @   8 ( D 0ll@"0 "eK p  02p;0s0 0p3@P@ 0 L   00 R&@ptp*#pRp`p $ L @$' r0'$0S(ʁW@@CR@dB¯ " p!" Z"@"B \0 @p 0@}o 0 p/"?'P:@p`!< !0 @3$0SʁW@@CR@dB¯ "@O!" Z"@"B \0 @ 0 Go  0/"?#P:@ p`!< !0@2a ppTx QpQp tp pT\$P ?/?#/"pSp"B"r"BB"r@@Tp:dP  7dP 7P P  `.P` `Qv``HPD@V  ㄄P# QuPp@ჄP Qdt@P  cP  cDP@  cP  cP  cP D c4TPP \ cP D cP dy@ P  cP  cP mIn@@P  cP sc@P ᝂ`@sPBD cP $ cSPP  ~cP  wcP  P  mcP  fcP P  [cP~ sc@P{ sdP`@ǃPZ Q P `@᱃PD Q Q}#! 0 0 .R R  @P`p 0 PQPA_L @`pP Q@ P;P P 0P @PPP`PpPPP P%lUX f }  L|  i  Пy ^ $ , @ . x | l Z ߶ 2y 0H-P@aB @ p 〻}zU:᪺00T0P0 P <  Q/0P  Q/ /ES |E@-t0 p0@ R @P  T@@Q 0P @T hE H-T  P  ! P  0S XDp@-t0O0Q O O@ PQ0 P`VP  pJH-PP p@ PP `QP`H-d`@`P p P` PQPPCH-d`@`P p P` PQPP CO-M`,P6 PKP5 @p`P  P QP{ @ `)pPY W ᒀ ~k`P Y```Ѝ HX H-P@Q p`_P `Q0Q  < F=hK-MP@Q p`=P `QQ4 Ѝ FQU&  2pPpp`Y``!"P`V Qp 06/Ѝ8Q( <0g;t h< @-@ @ O- M`pPP PPQ1PX @,PP 㲿P G P `]PD `nPoPo@o`=MvP PPQ P Q0HQ  P S l#`PDP @ Ѝ ] 9e8 O-MMpP@.` hP:uPr  hP /P P Op dN☻Pl 380p ppGpf 养P| p0 6pU `P{ `嬒  `Pn  ~P 0p z Dzpu  sPY nE 0p#  Mn1ꕄ `tn ꌄl `knꄄP/ur ]nvr` Qnp@ e`Ѝۍ 0p K`P    0 :`AX  00 `ᐷ% _ bW  ϳ $d O c Ҋ  |d  H-M  0 fpЍH-M>  0 PpЍH-M?  0 : p ЍH-M8  0(Y pЍF P   /0? ?H- 0H-@mPP :? $  0 0H-@]mPP :? $  0 @-*@P   2/ (>@-)@P   2/= =0H-@PT U0 03/0 =p@-@P|T`UpV  0 fTQ@S04`@@017qUpSTz <`V*,4`z*Y~ZP T[4`Y? p@I=?Qu Rq pa2! Q'3!Q @4Q <P*, 43(@P< R4 4080CS/:04 R*>(4 8 `0B4 S  @4P*# 4 4 R*`4 @ 0P@0<08 4 l0@@jV*<4`@ FY4F@   4  4P 0Q:Q*=  4 4 P 0@ P` P` P@44(P< R 4080CSP*P P*< 4@ 4  44 R 0P: (Q<0S} 8 @Py:40S*>(408 40@S 0@4P*# 44P*pp404 R*>(4 8 p0B4 S  @4P*# 4 4 R*p4 @ 0p `P@0<08 4 )0@@' p@ Z P`4`P-J(P< R@PQP@ 8 @P P4P4P80FS: R4 *>(4 8 `0B4 S  @4P*# 4 4 R*`4 @ 0p `P@0<08 4 00@@.p  `Q@p(04p8`4@Q @4P*# 44P*4 Q@<84pA 4  4  P0R:Y @4 Pj R*>0 *04 R*#004  4 (P4 80pBW  @4P* #004 4 R*004  0R@0<08 4 *04  4 R$P: #  @P:  R*004  4 R P: #  @P   @4 QBLЍH-M006ЍH-MPЍȒO-MR @ `pPJP/y l-  Q/\DR/S M Jp@-@ HP`Op Up p@20H-@PNp  R00H0H-@ 0PNp  0H000H-@PNp  0H0O-MP `R@QphYPD@Pp P@ T @ 0@ T TZ, tP 7 0pU E 0hEP' yN"AT T? D Pj 0Q fNPP @ 0C XN TAT 04 0 @.PPH ?NPHPJ Z@  0 @ @AP  0 @ @N@ 0 @ @ N@ P t  0P@@ 0   0rЍЍ|{O- MP @P H@p, pWbDP0 Q@`p p P    ?Q Q$ v , A L@ P| 0  (0  Cp/  0p P:pv , pL C@@ppW,0 Ѝ Ѝy0H-D@ PU CP 08@@80\y0H-@P P CP 08@@80H-M0     0"ЍH-M0     0Ѝp@-M 0,(@0P4`@ 0 P`ЍpwH-VMP`@s@ ." B")#2 `K *` K0*@0!K C0," `K *` KB *@K Bpa "! `!*` K *@K BtQ "X! `!*` K *@K Bxa e" `*` K *@K B|Q hJ"  ` *` Kh *@hK Bha @." )"+! `(!*` K@ *@@K B@  ` *` K *@K B@h 000 B/ pp Vߍ@wv|v vu0utPtO-kMP @`pQ P  *a gK*B Ap" `K *`K @ *AVK P  *aV fK*B A" `K *`VK @ *AaTK 堺P  *aB dK*B! `!*`BK*@ AV AK P  *a fK*B(! `!*`K*@ aT AK ^P  *a dK*B  `*` K*@ AV AK >P  *a fK*Bl  ` *`K*@ aT AK P  *a dK*B! `(!*`K*@ AVK P  *ah fK*B  ` *`hK*@ @`0 A3@KHPh `p x  h0    @    4   0 D఍   @ H@0A   X \    T X! p `pq@PdBXP `L\1V∡ ℑ$C  <I,08( a,@PCX>` f`V4 Q Pp @T`,@  V Y封: *><^vO\p 'P  R*11P0 c0 P C/dA-M @`pP+Ѱ`(P Up)iP 3(-dP`Q >㳰<㰰^㭰v㪰8#㧰:㤰0'㡰#㞰 #㚰H#㖰p-㒰-㎰`_㊰|ㆰoグp~rzyvzr{nM|jh}f{` *`.J`j`/` ` `pH  %  % C % % %80@01/0 !Af%,ϪA 8<% `# # (% P$% x4% ,% %   # # d" j*AnJArjAvNϊAh`M ez @  R 0S  pW) sPU1PPQ1W8SpU0U0 SQ  00E' 0'~C g&~C*gp(KS0 GKp*C0 Pp0Ѝ fghijklmnopqrstuvwxyz{|}+,-. fM ; xtJH-D' 0   b*`(K @ Q*BK$ $0000000/\IO-0@Q QJ q" R R `!0Qu  0㎭Q`Q| 0 ိpyAT `Ta  0n`pe @Qb ᘴ/. A<Z P  E P EP: p8 Pi`vW @UTQ 2 p(   ` 0on`0C10 p;@`!0Q J`C! @Pp$ @)!Ab ?>0 B0R!!`p P@P`Ѝ/. @@ <0![F8DCAAT@ p 8@@?O-M@$f P `R`P Y0 R LZ 0 R LPk Ex!(0$0R  Dlh<p$(lOP  KT`OP  PC XR$T0pd` x$ @ld00PQ\pP PP QoPHP QLQd_TqP@〱V,@P `p PS @Wm LATj vcPd P``p$V <P>YPVVc⠟P P`@`p$V <P>Y@PV @ H FT [  dPEQ dP E W dPO L `C@pP `P@ \[ P UP&  ZЍ\[  `dPP@YXdP@PPV MdP@Q BdPP @Y  :dP@ P PV .dP@ ῤE s/ n hn <===<0H-H@dPI 4dPC bQ08QP@Q7 P  cP*mQ+P P PmQ 0 A R;A"o!!!0Q 1 A R:;A@o;Q 0A@ P3@00H \i 1i p@-"TX@lP`@`000  xpPp ,0\``0PD00 p@W776h7d6X70$(Q  X//76p@-P@`` V PJpQ PPPUp@O-MM@h``"P _ }D2ʽ@<"0 Gy Gu@ Gq Gm Gi Ge Ga G] GY GU GQ GM GI GE GA Gp Gp Gp Gp Gp Gp Gp Gp Gtp Gdp GTp GDp G4p G$p Gp Gp`b` G``  0"`@T( QU ja V#QaapP`pGWP 0PU"`Ѝۍ$4d 3O-M@PP LsPp8$Q  BQ   BQQ8& P u#P  0 P 0`0Q 0`02`N  cQ @8LЍ Q A  AP +ԡ oQ8<Q q j Q* q.)p  P@ x"@@; TfP7SP2 L&p  <PJ.p cP  XYz X PO@`I{|31`11$2|0T0H1l00@- $@:p@ h/@-@:p@H-M08 R   Ѝ/O-M(@`pPP U PJpQ Q 0Q[ЍK-Q1Q+ PY# _@Pp@DT P` 0`V"p 0".K-`Pp Pp W PJpAP P QO-M` PE@蓟 ` QPLU V V Pp ppp@ eP\P D<0|  @Z p\ w q!  P( PU pB Fp P~ wb U }p6 0,q/". @@" 8" Q3! !@10q! PQ  RJr0"1pW XpA0S 10S0p1\\! Tq0poq&.  C 4R p@ udP`S`P tl|`Ѝ |0 RU>-)(D) ++D,++,Z p)(p@-P@p p@@ #dPHPcPP 0(LpX(''H-PPQ @ S pᄞcP 00A BI @'H-PPQ @ S pScP 00A BH @8'H-M< R 0 Ѝl&(Q  T//$&@%A-pqP` q@@P| P      @a@VA`N VQݙPT _ } Ay Au Aq Am Ai Ae Aa A] AY AU AQ AM AI AE AA A A A A A A A A At Ad AT AD A4 A$ A A APtt0T <<0 SS #S QT T #"G-PM @,  !q!1saqQ P `V PEPjW *  0 c00 GW:W`D0H |-p apW 0@O @- $@[7p@@!@-@Q7p@0H-(M$ P@1 b(Ѝ0 0H-(M P@$ U(Ѝ0p@-(MP D@'7p ` @(Ѝp(Ѝpp p@-(MP@7p ` ,(Ѝp(ЍpH-M   ЍH-MT P ,00  ЍЍH-M P ,0 1 00 0  ЍЍ0H-MP d@6p TЍ0 ,0  PЍ00H-MP@6p TЍ0 ,0  PЍ0$Q/`h|@-@@@p$l m LK-@4P`P WpP PWP `#  e0Ja*e CJA*ClPPR aP*c20Jb CJA*EF c4<mJe?OJ@*a @,*A   PP H@-@@P d 0 T  "4 ` 01SPPL@-@@ P b `2P01S`` PP0@-@@P <l   R0 @T P` P\A-As@P   # R6 ``: P P 0 02;8 PQQ0"``@ r8PT ` 8P9Px@-t@@P  R  8 PPDp@-@@PP"``P   P 0 `V P` P p(P8<@8p0H-PPQ n@Q%  "+ 8 PP Q R@Q  ,-  0@-X@@Q 6Q ,-  0H-PPQ @Q% @BK@8 PkP Q @Q  ,-  0@-D@@Q Q0 .pC-`P`Q @Q+ @-P,@P@P@8 PP Q @Q  ,-  p`H-0P hH-0P $hH-@@P n R0LPH @ m   t PPK-@@P = R DP@ 0lP@0L0Ll (00P{P4@-P@@Q Q,@0A,@1A@0L (00P@J<x0H-P2 P@PP  R0 T, 0P,0P,800L PP00@-P@@Q Q,@0A,@1A@0L (00P@ H-M@ PJPmQ DQZ QP1DQPP@DQ 0p  pPP050  5:  < 005PqЍ | p P/H-堺H-@ R/P@SPxH-D QPZP($ Rs/ $ Ru/ 4 0S s/x (# Ru#/4 #/ p@- M@@ P` `` `Y `` `Om G ЍpH- MRPQ  R Ѝ ЍoPRA@P\P \t! Qh \TLA@P p)% 0  Bp(qp|P  6P: 8  5@@ 5 X5N 0@w @4# PrP ЍP   ԮĮ 0   t A-Mb`Pe A@P\PP! 0 C00N\hD Pp QP3D<@4PQQ  2 QQ  '4PQ P0CЍl  0S 0S@@H R 3PP  P |th@@-4@@P$[ܪ@-(@@Ps[萪|0H-MP@ PPhD㆐pP QT  LDPP  Ѝ01/Ѝ0<H-M\P ЍHPD 0 C00|[Ѝ贩pdH-M\P h[8  Q, ][Ѝ8H-@ R/PQPxH-0 PP$H-,/4PPP@-P tQ |@Px@P <  U40#@aM@ P/0H-PQP @ Q Q0t l0L0Q00,  4+M0$@-@@P P P tPl P H  3@L$ P< tH-P" p8 I8P, (@0`P0`` 0C`V@`V0PpW0H-P0^, 0 (P@PP 0PUPAU^P/0 S,Х/p@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V  P B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0`` 0C`V@@T0 Q0pQ  R/, B0BR P/0H-^, 0 (P@PP 0PUPAU^000H-^, 0 (P@PP 0PUPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-0QS, (@`P `` `V`@PF`VP0SpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^0, 0 (P@PP 0PUPAU^0P/  꼓P/0H-PX@tQT X0 P#P/  P3P/" P#P/  P3P/ P#P/P $P3P/ 0@-tP MpP @pQ 17@z1tP *#t@$P#P/ `< R/Q3 0S 0/, PP/PP/H-4PPp H*H-@T& mpP @tQ 6H1tP |Q pPpPp|Uw tHT0 O- MPE ZCp P=S;pR0@P @Qp @R`p 0]PJ"P  `FPGP  J0  Ѝ  PP/4O-MPpW! @`  0|* P  0`pp   0}PP ẓЍp@-]P D|P @`禓|`0@V埓xp& @P@0|UP Q @XPPpD X|$pp@pApp@-@P P P`[`0PVp@SA-P @pPP  X `0@ PS S'0,01N0oC0000\L0|X, 0cl00`S00C`VXP PUPP`np`P VO-M  p BT P PP`p 0PBJP [`Fp P bP P P(@ PJ J P QP@U  jUJ@W  I J@Z   XU @ЍO-TM$p R TЍ]p!R @0 0t 4TЍO"/tATV |! BR8   `,PLP 0TЍ 1€ ,``VS@4p  ,pʀY`t 0@  Qp pங t1 Q 0 0+p 眙 YpG-` PPp ᓙ@PAA@Y ZXT  8PP မQK-P `P:@6P3pP:PP,JLP P$p @ @ WP`W ` @$ A` !pPX@ H`PW PW P@-p0@ SP 1 @  !0 b D *c *A  PK 0H-@ P  R!4WP PUXP R 0P R 0 0R00705,3`Q Q QP 0H/@8  R/P@0?30Q@ ( /DP/Q@0?30R@/Q/ R/Q/ &|R/!R/p@-@,P?`Hp<S/p@-@?`PHp\  0S QX-@ @ 8 R #@@ /P RX=@ 0(@ 080S03@@ /M K0H-@xPU XTP@? @48P@@$00H-@PP XTP@? @}08P@@0p@-Pw @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP , @pX0m@ 0(@ 080S@pp0H-PO @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@    @0(8Q@@008P@/0H-TP  0R  QS\ UA ^ T (!R !R 8!R !R  R0LQ0p@-TP&  0R@ S 1T S1 AS0 T4! S`RQV U@@^\(!R !R 8!R !R  RpLQp(0H-@ PL 0Hi0H-@PR J 0 P  S L 0HO0H-P@L 0HE0H-@PQP J P  Q L 0H-0H-@ 8P"'p L 0H0\0H-@P'p P J Q  P0dL 0H0H-@P&p WL 0H0p@-@ l`P&p V J P  V p4L p@\O-M-MPxpWX @P( p0T$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2`"$p Š ϊ ϊ ϊϊϊϊϊ 0 @D PT ( 07pP ЍЍO-M-MP$0\ p`P(Pp U ϊ ϊ0ϊ@ϊPϊ` ϊ Šϊ4@% p ϊϊϊϊϊ ϊ Šϊ$ 0 SPE`U ڨ 0ГpP ЍЍO-M-MPZ pP@P( p0T$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2`"$p Š ϊ ϊ ϊϊϊϊϊ 0 @D PT ( 0mpP ЍЍH-M 0 0ЍO-M-M@p%pT WR P( ap0V$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ4P"$p Š ϊ ϊ ϊϊϊϊϊ 0} `F @V( 0pP ЍЍO-M-MP$0Z p`PP( p0U ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2@" p Š ϊϊ ϊϊϊϊ ϊ$ 0PE`U ( 0ᕒpP ЍЍO-4MP @, !X0Q\`Qq @Q@ \$XHꔓPI @X0P{vPX @ X` TPT`F8  V P p `VTT8   `bP @X0 T P8  GX0pqX@T PP}  @T  (0 p0Q Q 0^\ Ua,0D |@ 縀p+  HLPE`F @U`(0`  X0 Q[CA[TQ8 XQ  (0  `0S0 RP|D&p HLPpP 0A( p Q0@ zTXP,p (0 P P #X `@ c@H@PPU080ᰱ`P:X`@@ PPu `V@@ [X@P`F `F0?V P P X@ Q0@Q_  pWP,ap|DPpK pHL W!`0G( Q  1@T R 8 + P 0@(  pP0@ TP,0( 0A  6 4ЍQ`V1, , q O-M-MP ( PpP IP4$$x Q A X@T`XPEP8  P4 0P8  `,p,ϊ (ϊ0$ϊ@ ϊPϊ`ϊp ŠϊB@!,p Šϊ(ϊϊ$ϊ ϊϊϊ0 40 c pG @W ڸ 0PߏpPxt  Qh  T P 8 O H, Y@ $@`ِp0s@ (@po0`@p`S0 p`S0 YD0`@  S1 HpQ! 080! p0pp CQ ЍЍQeLP/88!R!RQ@@/pP/48!R!RQ@@/ <Q/(!R@ ,@ /TP/$!R@ ,@ /LP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/(P@/A-P@P8 `@Q Pp fj 4P r P@@X| 40S \/A R QPT/\ Q/A0SRPT /$  RP00T/PP00T/$QQ/$QQ/O-M@T Q lP\PH@X P\T \ AAR `hPVTV[Z IQpI W @ Z+ Y  0@(IYʔ ` 0!!>G`F Wp,0P!PPPPPP,!PJ ZQ`p,D |    {pM p`WQI P pIV 0!!=`V,0 S!PPPPPP!,Z!p WPP`,D |  㰡 3p `PVЍP U 0@PYP ЍH-^a^ 0S,P@ Q( ,APq`0SPQPQ RA/Q R  A/P/P/P/P /P/P/O-MPF @P H@, DP 0 p@Y* !Xaq | Pp pW:0@  }ЍЍؿ@-T0 0SQR,@(r @@@ÃAc`c`c@-(^^*,@ Q 0+0N,2*PA 0r%r@P c`0Sfffaj(bb 0+ 0NR@0S QR@@O- MP6,`p@蠟 @T*Q QPPaBHQ0 0A  P !(R p(X! 2/p < 0 Ѝ ЍXb4bxahaA-@(P $Pp(pWa,Q Q 0aBa,pPq0 p,Pp@-@(Pp0P`1(`Vpp@-00S S* $pPPCP @P `ACfHd$b`kk@k@k@@ PU`0K0CP`V P0SpL`,` `G-P pP% 0P 0 R@ C 0 `0 V `` CV` V`QB   P BPPPC: ` P>`PTPHP@ U PU`P V `V`%P P0 S0 `0V `` BV` V`Q R @ R RP p h $P P@ @p $萹<l||ȹO- M@ZX'PQW Z A(O 00!,PP`,PaE`a0ZpPppa Pqp5, ͂PPm 0 ,jĂPe Q,4ḂPY !0H!0p4,PPpZ P4P0PJTPP*`pPY, PPDp`妊| `7p ⰱPZPPQ P ЍPU 0p S0G0$ p  `0GVQ 0QPC 0p0WC R R .PU  RQ/$0$\/ P/4p@-`@P#0P`T0p$ R Q P8Up0PpG-P@Q訡 $ Q P P0  @`$ VQI0S R H@p 4  0p$` WQI RPUPH p P I p$ 0 `S R0 HSPU P@p x@hT @T :q@p@DԳгP0H-P0S 0@@T@PU @^8PtVx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P _PU   TPUP(0 P CP8 @ #8 /0H-MP @0@0Ѝ0K-MP P@Q E0Y  `I  `V PЍp`^p `V`4pP `0pD QH0 P$D H0` 0 R Q B(P,0 qB,0 0 !0PU(pꐰ0H-MP @0@0Ѝ0p@-MP @lP`0 ``F oob` P `PЍpPHO-MSP8U[SZЍ@<@`PP p @p8 V0$ @  AY  bP GPDQH `$H(PPPX`@p .pW ,[D 0`0S@P"  P갭@H-M  @ 0ЍP Q/H-M$000lЍ蠬O- MQ@pR Ѝ`P{P @{P, 'P0v 4`P# 4<0EL0P00 `8|Q@`  P$pH* P@lp\8 @~P4C `c{P< 0@0(Q?  Q8^U80@@8 SR$0p@8pSV0 @8  R  R| !R$Rv RdQ8p @f8(^00 4 U ``  y 4` 0, @, `4U" 0 `H-MPЍA-@  Q@(0`p,0 Pa B,0 !0P P 0pW(`p@-X ]80 @^_O` P8`Q p$0 T8R0Q08Qp Q !R$R RdQ8pP:/p@-M `0 B 0C@ P  L 00N```ЍpO-DMPP@QDЍt¿pPlW`GSA@?Q`0C@C00h0QpRL@\ K@P op0K P0@ P0 0VPOxp` V` , YPPYZ |@ R $P   0 0P  Q:ꈥꬤP/H-Mp@pQo : 0 tx P`a%P>9 D 0` FA/   ЍH-M0   ЍO-TMP$  X0 R80 Q F 0 |  SSpJ0Jp`S0$@x0Q Q$00KJ0pQ@  80@0808@880<808p080:0~0 r R pz Wڀ$@tPp t@PB R :X,@PPu@Xp p`p,0`G1```0pp 0`0,p0C1@@@000~0Q@z @pWN ,p@,t4400 0,p`(0@ p8R ppW68` 4@(pP@P@U4@8 PPU& p B$@R P `p@P G0 V4 (0  B0s`t upPGP8U00A0 `x8`  `0$@sQ,0P P <`0 `@,P t Quv H!L@<`pD@   `p 0QpQPu@T@`D@A `@NNA^p:P p(p4pP尠Ppw@AQ ᰡP(ppp u R !@ PD@DQTp D8L@QHPL  @ D| pz : 4P`pv`qaD |L0p!1p p|ex 0(P  AR  8(Pp ` `4`FW`p:` ` (P@` ``FT0@`(P000p 0000CW000  : 8P  (0 @R (0`pV0` V(RVʟTЍTЍK-MP 4\008@?SЍ `@ P@DpAT BpGRp  0ЍO- H@_@ P ,0@   RQW@ ' =  @BT<[S8P%  0PCAlP '  xP l `PCAP < 900@@ TAWgP ` lP PG@T*lP  PZP  PCApPJPP  [-FVf@P`  [PJKxPP PCAEU@P|Q A i PPZ@P> 4up0@P9 e`  L @pPUqG/@TPP 7PCAx \4tpD@,Y```T P \@T`pppJ WF, $ 0S!`q 30S0@?3S P  P PCA W5 @<# F@ P    Ѝ@PTP D" 4P ( PCA  @T(QpaP` s qpWNGxPP jPCApp2bp\H(a$x 0(`d  ``_    t  X@ 4              X     4 l \ (   d T  H   d[h d T [H 4     @4Hh\YT 4    L,\H-LP @8P4 C B xpTPp8 RDQ/lPh%R/!R!Rt%RQ/ V P/UG-錤 80SD`VlUUhUUQUQU 8ğ4Pa# S < pPD@` \000Pv``0 # m P # d 0p@p@lPh0P0P l 0h00p0Tp qTp@PHJ\`rvpVPPǡPP?VPQǡ_ PP8VPQǡWPP1VPRRR@$PP(V_SǡP0PP!V_Tǡ0H-@Pp 0H0 X>  4>O-TMP" `Qo pmPC[ 4`P @P G PPR0@[eTЍPP$0 A Rp? 0 J @ P TU8  P PP P P P#XppH$p;mPCK  /mph WIpC 吇(+$PmPC P  Q$`$@P@$Y@IXHlPCKP5 @Q# p l@P$pPiTE@C Pt!)+ $$lP C A PQ`F $0,(p!P@PPQAQP U!A@'r 1pWpp P/ @gQpQ [p|D pl HK [ U: `PP K*Y$ p(@P $P ,@ 0P,00 (   0@Yp  0@ 5 P$P @T @PP 0P P`P( A Q PQ pd TЍ <;0H-@ 0Pp  0Hn0 80H-@Pp  0H`0p@-P 4@`p  p@Mp70H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS H`Pp NpOOpq0Pp0.Qp  pP0000pEp` 00`B/Q *Q@`hq Un HD 2/`P$U<P.X@>AP [.Q  >?O  D.Q `0000F 00BH/QDp *Q@`` `Q PQ` Q'qr PP@7/@DTPH`PDp PPЍ P qpP@7/@DT64 5Q H-M0 R!R Q L ЍH/ $ R p\p2H-M<<000  0ЍH-M0@@ (Ѝ10H-MP@PQ PQ   PЍ0dQ\QD  << x0 0Ѝ042L0T1H-M@Qqp@P> P 0 @6!N+A2"!K``!a  % a!`pa!P `V $Pp`Vp fP!P@ @Ѝ,1 H-M  @R  qp P= P= 0 p6k,'@2" C`` a   ? @pa!P `V $Pp`Vp nP!POЍ/ K-MPQ| PPV `0 6-( ?,DC2" @ pA$` $a ! "*#E"!`q;!P* aV$ @T $P pp@T WsP #!P`V X PU v`PЍ.f P 0 O-DM4l[Pj P @ @ A4@:3@P2 `4:P) P Q5 21=Q< #Qr Q+1 T80 58q<N{A''!K0`!a$ % a!`pq  PPz =P p"@kPi180 N58-x ?|D<S'' @ 0A$` $a# "*#E"!`ql P5  Px-1 80  58k|<w@'' C0` a# ?@pq ; PP \ P ) P1  # P- x  P) d  P% P  P! <  P (  P  P  P   phY c P P ^P6V, lu`Y  fu `U R``堀,=@D t PpᲐQ7Nu*P`Fu"`DЍU )`DЍD  H *  S Z J NZ :Z (Z Vs O- M` HZP @0p     00.R A*R 0Sf Pp%p+c p  00SB   RX%S ,S  RQ p00\00000+0AGS`1ppppp  pppppppppp$ppppDppppppppppppppppppppppppppppppp ppppppppppppp  R P       0  dQ00  00p  d V  QP` `0cp        p)0iQpp0pppp6 QP 0p0000Pe Pt%0Bp %/C0  `%%G +%|%+%+Ccp  p PB  p `*`  A0 *@ P,pD Oa0@@W:P\Q P^P  P \[$ `J Py^" @ $< pr/> Ѝ\& 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q0E   C ~0 % ,  PP ,S 'S\S/{ dS :) aPP0P! S :@bPP%aB0  b0PP%! N0 00}0:S ' 0000 0DO-Mp@`PDQp$ %QpPp1@ Q:Y!PsPplP T TX L! @0@@T`ЍMH-M00  0ЍHЍ/O-sM`Q pPP  Z W|Z 00`4`P@WP, 0@@PP @ P A`K QP$ %QpPP1@ Q: sPPlP [ [  0@[ `8 P00V @ @ @D Ax @`Vp Q Sc ,Pf  4 @`@%T TRp%W`40 P:P, [PK 4,0P%P 0 T-p@ p0Pp @@Q* 0G@XSe Pa0d.Y08 0 AR Pl00Pp0Y \ !G]P@xxTxxxxxxxxxXxX4`xXxXxx P @ aP @  w` Pp&GVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888`4 P @ A P @ ~W !Wo@ Y4 `0 P*,P Vp,qYP 4,0p 0Ω`p 4P4) PP*    P 'PP'PH P @  P @ A ;R ?R%Q Q P* @a@Q OQII/P88P@@ P @@ APP  PT*1@P OQ$80p!! !P  P @ PpW  P4 10 P*,P P @ P 0 0p0@   PQ*    P +@`>`@<V9 `6P``2@ob.P``*PV``$``!` V [``P}P}PB~W OQ  ` OPa  P &A@Q# OQa ARI/A AR @40 P*,P b`,1XP\ 4,0`T @4 @ APT&:%Q Q  ;R ?R eRP$ P" @PT*Y `,WP 4,0`  0Kp44, 4 ,`E`sߍ MH-M  0  0ЍH Ѝ/ MH-M  0  0ЍH Ѝ//ᄤK-Mp`PQt`P# P WpPpWP  @TpC Q& X.pX,X# T tXd P XG X: X7 Ѝh DiQpP Q  (P dP  Նp(XP  ɆpXЍ@8ᘵ, ᒵ@ < < < ; ; s= ; x S @-M0S C@P  ЍA-P`P p N@XT  DpWP P P P P |P 0A:  : : : v: O- MM pP /P  0 ЍۍOP= Q/Q9 OP6 @`#XV.C`P& @XT  Pp  0`XA V Wg@3 aP$ `@Pt@:PUppGTP:PW g U gD  0PF[P P9 7P 0 XP 0DP% @`P@t@:PppGTP:PW g U g   0PF P P Ѝۍе9 9 8 8 8 f 7 7 O-MR `@P pP P!  A @%*UP P  !UP  P (UP  GP pUP    rPp R  pPpP ?@p  `p[ `Q'pQQpQpQ [ P `A0Uup  !P 岐$ Q$P  $P` PPR V$POV$ TP$E `YC [ PP0 0Ss0  r0P, psP nP fP0p pSpp1[pp2Xpp[ .`Ѝ/ p`P[Aqr 0Xp`G-MtPp!` 0 P4(@PpP+ Q(@P + 0)pp RK*Ѝ P 0)P  0pP Pp p\2 ȭH-@`iP! V PPP` |m P p@U oQWU oO-M- M@P  PP,POP  `* ,`3@UPH p|$ P  倣P  Pl @@P,P {`OP  P`   #PPcp@SPe  gU[ paU P  p及WL ` P(, (, `pW> 岀PPUZPUJ  $Z @TP cSP &P!]OP ( $@Z㰀( ( PPƂ@H U@ขT @ @及T3 Pp`sV nV fV   P 0&  rP @T pT ЍЍR- / f &- A-@P P|``P,PPNP  pP  :+ A-@p` PUP RPPNP !Vpఀ  O-M`8P. LpW @@fP@pW PPr @sP nP P@@ PZ  0{pW: 0Pn4sY nY fY  P H DPUP @*RP'@P#%NP H @DP pH@HO HsY@ H  nY fY+H @(0H0$P& ,Q@?H P00@H 0ఀH @ H  ! H@H HHLPLЍ ) ) 0H-@ PU0P QMP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW P`P sP nP fP` P``M0H-M@P 0 !cЍ0HЍ/K-Pp@P @P ` `(8 H0CMP* `p Q`   n p@Q  f p岐Q  ^  pP p@ O @,@P ,@(`  : `<@P <@8`0 ' `L@P L@@HP  PA@-0@@@@ @@0 @DS @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@pP `VP PP!PLP A pP  H-@`PpWP RPPPMLP `  P  O-DMp @ P  ,P ^P00\P`00V I<I|P@|HP@P: DЍZ P: 0 T P:d 0bPP`OP `< P`P,PKPI  PT<`P$Z5 @ PA ` ,P> ^P00\Pp00W `F2``P,PKP  P<`P hP =Q<@:Q8Q6Q@4Q2Q 0Q0.Q,Qn `FYP Q nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- @P+ PP.P, 2PP(P! K P P"P PP P  @PPPP P P P PPP PPPR0Ѝ0H-PqUp@@P1 Q|,``P | p` `Q  W|`pQ  P|37`2`F``|4@-P@CLAL?L =L$;L,9L7L Q舉t/\Q/H @-Q R$ R R 0S4?0LS 0 S00004p@@4?PT <@$0@-Q R$ R R 0S4?0LS 0 S00004p@@4?PT,04 <@$0A-P@P P$ RpW P`4@Pv0V&`v`fVP8Q(P(` (2/(`8 P $PP Q4/AQ 9@Rp 0 4%04? ,@0@4@ @p <@@@$@@pP T @@@H-`R @1P8S T* 0PS(00 0$+P$(3/P `p8`@4nP P$ (2/`LH-PQ @1P8R T) 0S(00 0$+P$(3/P P`8P@41P p$ (2/PXH-^ 0S$0S\ 0S4?0NSQ q Q@0 S@0<0<<@O-lM`Yph P $PPUhPlЍP P`4@Q \ Q + 4 / 4% ` ??<P B, \ / t ( X  p  D @@P  D 0 T$@L`\P4 @RX !|8HX|$p @H ( <`$ | P P XT*[ T 0KT*S T0@K 0T0T*X[ T KT*R T @K T XTXT  X T*X0pS T` CT*R  CTR  CTR `0CT`X0@T:X[6 T KT*R T T K Ry T T K @TT*X[ T KT$*R_ T @K T `lXQ.:`Q08< XA p w:l(X PpA`G P 0QL`<88l`H@LTXP@PR H0S*` V p`F0S:8L TX!^ PNHa Q TX0S T 0CT*S T0T  X00CS T0T  X00C{S T0 @ 0T0X@Xr XXT @+X z!P2B@PX`P  CP`V XV`V`Vk T  H@@ p LPTNHH@@L`p?L`XUP  @ p"D@0?,PQ:P N@:XT[ TKT@  AG pPp0`Ph  `T 4 p:X``pp@CL`Jp\T8 1`T*XT0[ K0 `S:<<0TX@ 4@@X@ 2&q@pW-pT P  @X@T p 2&A@^DQ@D⪡QL`<8XH@p40G:岀L`0C:@  Dpd 㴦 @$xQL`   L` 0=?zQ/L` <8 R+0XyXT0TAXL`8nXTH@A'XT TAX08L`[XV0VH@TAX @X e 0CX0 @T0L`B ATX0L`<88TAX0n T  T@P/ T%T 0H@ TX <@@ T@XX rpT T@X0TX <@@,qPp@`  F kP R~V PPNP:`PX$0`F@C   V  AR  8 D0Q?@ B?@ P PG? P `XQ, 8X@0TX@0`X@D⪡0@ a & {  , a A-@P8P ( ` 0( 3/P83 , R R40HpBWp PU 8H ,04P( 000!40, RH,`04`4 `, 00R0P04005@-@T Q$0SQ R4/ LR8 R (3/$0(3/p@-PQ@ Rp$ R`V R4/AQp0PU 480 @04 8@T0pH-PU` Q$QpW Q@4/ AR R >/Q>Q    Q 8P R R 0S/$0S\ 0S/ 4? BR $0/A-M|P R $ R\ PЍn R 4?0BS0S@@T:SRl.@ <030<  P0b 0P!@ l@PE`0,@p0WfV03ST*@Q`: l,0 @S Q@`PpV@PaQp3WPT*U:PlPU  0A  PKri @,P Q0P04P4 PPP``0?pPPPTPP<@$`P l긨Q R/$ R R 0S/4?0ASA?Q@o/K-Qp 0`S@$PPU P4@PT (+3/pP 8P ( 0( 3/P$ (2/0 a *b ga Jb+*AJA AgA14P@Q :o-QT04%A 0C PT pYA4p ( 8 8Q R/$ R R 0S4?AQ/ / R 0S/$0S\ 0S 4? BR/ Q P /Q OR/$ R R 0S4?0AS/ 0ȠLQ C0QD0D0A /Q R/$ R R 0S4?AQ/p4@@@/O-MP`80R 0` C C<4 @P0PU0pppP[ 8PQ0 Q, Q( Q$ Q  QQQQQ QQQ f U PV U@PV6p@Q/@Q+@Q'@Q#@Q@Q@Q @Q @Q @Q  @Q @QQ @UP1vqQnPQS2JhQ6QcPQS+J0,`QQ`PQS"J($`QQ`PQSJ `QQ`PQSJ`QQ`PQSJ `QkPQSZ Ѝ(Q0 4o,0$0 0R0000 0d <0@0R pW p`4P P Uqpppp 8 $p 0,(`40P :W``0C`00 Dp, ; 0`@ D000 04P$p`(`F`0@ 0  TL <@T` V \ D T*0 J pAQ 0 P:0  0@p  P0%S00 018C!! `Pp[ @ 8 PPopD U@P [80P 궰 l , ح O-TM{ a04P Hp0C,@0G0GX\083LAP,` Tp P@@<4 8D0(`$T 0P @Lp a @D1V @\&qa@D1V  PU\* ^:Y< Ⲑ T040@22@D 1T 0 @00D ` Q @D1 @/%aQ@D1 `T *PPU*0@P@P@6p@D N1W10`GV, R 8 RI Ri*0F$  B`40YVPp`: ^ 50G0 0 0[1:0 pP` k R N 4R80 NPPg` 0p`FS PPYm pI0WPbc( Y40 B<VPp]: ^@ 50G0 0 0[1U: P p0`P k R N SKy40 BYVPpg: ^@ 50G0 0 0[1_: P p0`P k R N SUX pY : I Y    Y  Y   <P< p0P ` PU ) p P804 `V  IY#S#: U 0[1:  k R E S P p0P ` PU  ILPY: P0 R0 L8 IY*?/  <PpH Q/ H`0Iq0E 0P0C @ <TЍ< H @ H-M  00ЍO- MP8@P 1P<8P  Ѝ@U p 040S(\20 0$PL$xwWpGwpgJQRWWXJ XYJYo(&3/W@ pP `* 0qk  (40p2tP  P`,L0TXp @ 0  w ,QP @0B 0  pWpW  Z 0 LQP$ IpY  9, QP @0 0 IPH  P- , R P0 @0  0pWpW   0 LQQ0 p 0 00Q ,P P  [$PF  P- , R P0 @0  0BpWpW   0 LQQ0 p $0 00Q ,P Pg,P7   R!pWpW  u 0 LQP?00 0 0 "$00  ' 0q pWpW  @ 0 LQP PtPg P^ Qe Q>P tPtP9 8l 0` 00 00t0l C 0tQl\ 0R8UP @C l\_ pWpW   0 LQ)VP_ P t P*)tPV P P`l2`lX- 80 pSW) W W$ WgWfWeWdWc Wb Wa  W^ Xy8 00 00 00t0l C 0tQl\ 0R8UP @C8 l\ pWpW  3 0 LQk      B! R R` :0000B p0uppp 0uppp`  tppGl0tp p`Ql-D 2/4V= V\0l P8U BP l\@ pWpW   0 LQQQ P<V V6  0p V L D ptP\l pWpW  l 0  QLP7 VQ60Q7 000 "$00 #00 3 00  00  "$00  00  (ЍЍu 00 < 0 000 00"4000 `~ pWpW   0 LQP`oЍ  @0 0A @0 0P. \PJ8l 0 B l\4 pWpW   0 LQPQ(ЍghDS@-\ @T$@T^ @ T9@L8T;AB\*\|0 p@-1"!4P#4 P%0U $PU^S p@T9@@8T;A*PBPP% P Pl@ T@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- MP 6, 0AS00Y @ *R:1\lp B`pGoQo`1V` V *0EV ?o 2 RiUg Ve&%o ᠒ 0z `@&@@! @P @T@T  2 0 LQW W8p\  `F\ P \, C0 PV   0  B0t@ `R' , V&*<l@P 80Al0 lPP8 0 Cl, l@V` l 8A,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l lP ,R@ T@T 8  0l, l@T@ p *pP,0qB\5/WA 1R0Q*pEQ0o0`r0S?U= 00S9Q7Q@@`U0Qpp0o`8 0 op\P\@T@T  7 0 LQV` ЍA-Q`P P$P@T P9 @8R;!"P*PU 0 b *`J` gb&*@J@( A0 0gA3/`P p&p 0 (,P3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 {, @@ vL DD q !l| 00 `$   B`p@-P@P@T `@ IP P 0 0 0pO-MP tP tQQ P P:8 lH` X@4 TP0"Dp @H p0Q , @ BPp`Pr: @l0`pp`0C0p pd```#d` C;P<;p0 S0CR @ B C`V @B@^ X+0=r<t@`T !`FRPQ p^ N p尀PX%P@Dp^ @ @`pPRP`b` PRP`b`1P`Rpc # `Qsq1#!@TcJ$ Q 1 R `pPP`P `F pVPʰ DЍO-M6v`0{Vp | @$@p^*@\" Pd$pAඐb@ᰂ`dW3`p p!`` $`pf@@D9ᰂ q@$PbpEB`gU`PP@P!`@@`$@Pdp@G' H-P`p% P @*`P%NT `h%a_@X$$ȈT `T  p@-P @Q pp Pi P `pP5'\\v% X P @@` Pppx LH-@P PQ  p4 P `pP'\\A% # P @@`@ xQ/ 0 S /Q/8 0 S / /R/ H-^ L0 SQ 00S P &0 Q/ 0 S/p@-@P PTQ p  P ` P&@p Q $ 0 S/Q/ K-M@P, P`Q%V# Q  | P pX XP0 S0_@ Pp +Ѝ/ K-M@P' P`Q V!   pF P x pl0 P`00_@ Pp Ѝ(;$ $0 0[  C ! P , 0 SQ 0S /WH- R 00 S R,o* H- R 00 S Rod P P 0 SQ 0S f O/ P Qj P 0 0 S f O/ R A-M(@P PP $ P:`P6 0 P- p P( P0 P  RQ"QD 7P /ЍHc H-$"ૻT`$H-P Q Hx@f< <0 0(g$ $0 0    q  H-P HYt 0 0;   @-@l"P X"H<z"P <$(0H-@ P ` P  P P 00H900Hu@\H-P 0 S ,  PQo"V H-M  Ѝp@-P$$""P `$"p"( P @ e A"P `!Jppp$P\!pLMH H0 0|<̗8LT ) 8 H-M  ЍH-M   ЍH-M  Ѝ@-@T  R /Q 0 S / !@  ! Q/ q3/@S"# Qr3/lP , 0S0! 0/P , 0S0! 0/pP , 0S0! 0/0P , 0S0! 0/0H- R |0P0U 0A  t 30t0 00 T  0@0 t :0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('R 0H- R 0P0U 0A ! R 30t000!T  0@0! R :`0H- R 0P0U 0A ! R 30t000!T  0@0! R :0H- R 40P0U 0A  U0H@0 0H- R 0P0U 0A ! R 30t000!T  0@0! R :0H- R |0P0U 0A  t 30t0 00 T  0@0 t :,0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('R0H- R 0P0U 0A ! R 30t000!T  0@0! R :0H- R 40P0U 0A  U0H@0D0H- R p0P0U 0A  t  30t000UJ 0@0 t :0H- R |0P0U 0A $0t00%(0R UJ 0@0$((%(R`0H- R `0P0U 0A   t  UPJ 0@0U0H- R `0P0U 0A   t  UPJ 0@0UD0H- R 40P0U 0A U0H@00H- R `0P0U 0A   t  UPJ 0@0Up0H- R p0P0U 0A  t  30t000UJ 0@0 t :0H- R |0P0U 0A $0t00%(0R UJ 0@0$((%(R`0H- R `0P0U 0A   t  UPJ 0@0U0H- R 40P0U 0A U0H@0DP , 0 SQ 0S /E0H-Q DP@PT0A  USSZ0$%o00H-Q DP@PT0A  USSZ0$%o0L0H-Q DP@PT0A USSZ0$%o00H-Q DP@PT0A USSZ0$%o0p@-MPP `P@  `R A(Q Ѝp +R 0R -R  p9:"P 4xQ P     p:"P  "p"P P $ P lDjH-$j|`0H- 0 @  Q@ PRP0 TQ @ R*0T300H-0 @Q@ 0PTP0 R Q @$0T*0R30@-@5 00H-(M@P%*P0 P  (     Y| PP P LP(Ѝ00, ,0 0/ֳ   db   PH-P 0 0@TP0T`Q URSU!P&PQoQQPPH-{Hgx\ @/0 0CS/\/H- oH/K-`@Q p@0 PCU pP<S p0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP`p,`>PX` P\ GP/Q PY (>Q (>QP AQx PQq  Q&  Q@=R(  P R0!,PP"Q qR  PR "R $PP>Q  0 0 ! 7 O-MpQo*8`QP@ QT "QM  \Q _ " @SRH 0!Php| ePWeh _ \ Y V @P !? 6 P 7 P P ?+7 R!$,O RRRR R *T# !,! "T  0,#  "P0""900#0  ,   PW [*  P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X@\PЍX\@ 0 0 D [ O-M-JMp` V'pP80?PP3 <V<Vp V! VP  P P`~G`@  ŠP AQ  @ PZQ+[0A S2@1X@60?"Q2 6+Q09 6-Q05 60A P00:PaQlQsQeQ ( PrQuQeQ (60@50 @P5"Q0(50I $3/Py $ F/ 0PO 1A $4/Pe $〠@@ @Q p<Pl` P"  P  P^PR PM -R-P >Rpp<pP> >P p PP4  0 0CS! IF/G?PP`P! `IFGP1A P4/ 0PLP Q PP JߍЍ< pPP (PP Q P[ PP P~FGo@P{`t"u%FQ8 d!t!FQ7 dcGPdP01  fP'   ]PO RPDH GP9< $0I $3/P $  0P 1A $4/P $ aPV\   'P PSPIF/G?``P PIFG`1A `4/ 0`rP t dT@ܿԿ0( B pXRHSh8 f O-MP˨`,@p> P;p F0f pW*/    0P呭z  G[   0zp j@  / Ѝ G-p0\WF@0uSBA0IS*V0 a0IS:00I S3'P `A0ES:a0E⩏S:00E S%'pA0GS:a0G⩯S:00G S'@A0DS:a0DS*o00D S '` 0000H-@|@P 0P/P,

!1 05 0 0, 0 0# 0 0D@ @0 04ď,؎,dv l W ԏ / H V 2 ! z ` x K-P? P`VA@V U1U144P pP 5 , !$ ,,P  Q,Q 0S pK Qp D!@ @0 0᜿,7( (0 0ᓿ @-@@H-HE5,P?lPH-$.TP`Pp@-@P ``QPtP Q `< R4 Q ,  a^phd d0 01P)L L0 0(84 40 0<" u Q 0H-@P1P L R< 0H"  0 0: @-L@ṩP*  0 0ݾlN H- Q 8H  0 0Ǿz  x@o/K-S, `Pp@V  ]P  P,Q 0K_} { 1 0 0ᆾv y H-Pp@P `J W  P  ``K 0H-P@`P oop," W@PP @萅H-P@`P oop, W@PP @$H-P@PpQzPP T@ p`jP  @ᝲp輄A-@P PQ P`@V pPW DP  PwP4P (`@P HQ/ 0 S /dQ/ 0 S/8H-0S L RQ R0SR0H-@P  R  `PV U P  p@U D@ @0 0t,( (0 0kꠂq M Q/ 0 S/āP , 0 SQ 0S /ꠁH-^ 40 S 0S QAoTH-MPm (PPi@P* !0 2P$P\   ` `p ׾"PL $ PF"P 0,!,1 0 0 BP1 `pHP+ `0 2P Q P P` p(PP \` pЍV Pβ ' : %tO-Mp쒟(`  P@pW=Q@1$ A Qe AU P V T,* U UP V P* 30! P V P* 20! V T6*P |-* pGZ@X$ pЍ R U:0p0@ `BV  =R p0`0@ p AR<Q Ѝ @-@P G-MP*P P(PE 0 Pv Z%:`p@P &P5 $ P- % P% ? P JZZD pZpp:0 S 0P1:p  `Q CZ  ЍG~ P@`- J0Q0@ p@P`'P % P Z=& P =P L ЍG Ѝ,t( (0 0M{ ܾ y G H-0S RR @oP P@< <0 0%($ $0 05  ;  0H-@44 (T$PPP0#>>@-@T  RdxQ  0 S/P/,xQ  0 S/P/wP , 0 SQ 0S /gw0H-P 0(PP @0  P |PP 0h  P XPPTT vP040 00 0ᓺ = d=,"\# \ o p@-@@@P@PU,``Np<v</0 0 Q \Xvdv R ,0 S/Q 0 SBo/v0H-@@P 8PPPP\ P,

\\XЍp`ЍpLkH H0 0(4|0 00 0ꂻ  ? * ǻ  n H-4QA4 0 0ꦺ ֻ O-MY*@P`4P  pOP p3P P P ЍDЍOP ` PV < Y*! Q8< Q%4P;,qW P  2/P 4Y@! Z!P p @ pP 3pQ 0 0xV 0 0ow 0 0fxt t0 0]84 40 0ThXhg fڷ 7 c Hh" [ 0 j ߹  F ) K-P! PpW2@W U1MU1H4`4P`P>< , $! ,LH H0 0 0 0f l ` @-@@ p@-@P ``QPP Q `< R4 Q,  aphid d0 0ήPQL L0 0ᴵ8V4 40 0᫵Hd~  Z ϶ 6  p@-@P ``QPP Q< p@D@ @0 0~,w( (0 0u$c Ӷ  ^ ʶ K-S1 p@W' `V" QP |` vV 8PO,Q K'%  0 00@bJ  7  //H-VPp 0 0 6 E O-GM  ^EF  0PV QUU Q 1/`@UP pP T 4/  2/pT 4/W UW WqqW@ PQ 1/`@UPPB  2/P T 4/UPPpp& T 4/U3 1/Gߍ 0 0ᣴ 0 0ᚴ 0 0ᑴ 0 0ሴpl l0 0XT T0 0v׳   w - S c j  F ` k " oC P/ O-KMP( @p$T QQFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( vP qQ$q(Q Q T JI/0P @J_Io($  2/ 0PKߍ# 0 0C ӱ //@-@@0H- R PP @Q!$P  ,  @00d9` `0 0ṳL:H H0 0ᰳ4;0 00 0᧳\ 8 s  O 0H- R @PrP  R00G-MPP*@PlԂp/W5`x (08<<bp\W W  0?P `pXPX Ptpnpfprp\HPH CPC @QC ;P; @;Q <Q >Q&.`P. g&Q&#`P# aP mP p &`P l P tP ;P`Ѝ`  0 0Ͳꕱ Y G 0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H~I 0 0R [ p@-@P1*`PPQP& `p^PP P<TPP /NP P `pDP P>p@;pE 0 0괪 O H-@PP*`P%PQG P ppP> P QP,PQP0 `pPP) P%<PP P `pP P/P >HppP PY 0 0᭱, 7 ǝ A-`PY P @TT pQQPM  lPC W` p 4/P5  P0 P" P( `)@<pP P  P  P @LP  tPo`lt RЩ TRK-MPP @JpUPP. p>  Q:?` `PAPۍ Ob@@}~p  `P p ` _p p5`P`ppP W H뭲PP @Q/Q /Q @P*U @U P/Q Ac pP`1 N! on/A-`@PpP P P @*QrP@ TBP P0 0ᅰA 0 0z: t f ˦ @-AT\ T%@QARS ^ yDQ B@R S ^  Z 0 0:: ֥ G-(MRP@U tP0  ` p  8P ǼPT(Ѝ ѓ     /     / 2/ / /     / 2/ / /     /K-(MP@`PP(ЍK5Tᥫ$P-P (Ѝ 0   0 B  ppZ P QPT T (Ѝ‘PQ @/@-@Tp00x@-@P @-@PH-P ްZH-P ӰxZH-P ȰLZH-P 㽰 ZH-P 㲰YH-P 㧰YH-P 㜰YH-P 㑰pYH-P ㆰDYH-P {Y@-?^ ʎ 0! @T 0 @S^# 0@T 0 ^# 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ǭ P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pቨ8UUE@33C @ @ /  টl0H-@PQf   @  Q d8@HHPHXHtH|Hpc? b Aa-lsww!- r- Q-QxsSw- r- Q-QxsSw-r- Q-QxtT  09 0 0ꠗ ԗ G-PA ͓P( pcP5  p+P-*쀟@ѓ`qP˓`@pW   8P =P qP|Up@qPT8> 0 0ūꘖ ͖ TM0H-M, (2P$R0H PD@P<80( P @-@pn  &p t|d xtUp PPP A P\JoBK  ?@QP-P(.d*.0.범8 0 Pᾔ-U P L@ ztpP L Ĭ d L@Ѝ0r z J 00JO-MP@P T D "P XptЍ`"P+V  -V  `  0V xP p0VpTp0@ Qa@"Q#P*p`? P0*@I" 0o 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q? 0 0j > I ^008HO-MP@P T D "P XptЍ`}P+V  -V  `  0V xP p0VpTp0@ Qa@"Q#P*p`? P0兏@I" 0ʫ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q? 0 0j_ Ə ^p@-M0`(04@0`,@ 08PpЍpEO- M80`<@4P P\:@p[b WpVpT D#P:PBI`GD0  ᒀ@>P :7`P Q 8 Y<0*P" R*P"PPPV W8 <0 Y: R3P@ P  Ѝ@K< <0 0_(M$ $0 0V꿍  u }A-Mldp`P@|@@@P p@ R |0RЍP CB@ p@-M,`0@(4PpЍpO-MP@P HU P[ LXh#  T`E@ pPᒪ"P "勪" oPi b ARE0!X    t            $w t!/w' %w' u*w' z wTp!w' qPQ( xQ*Q@  0D L j0 Q)! P! ,!` L05Ѝ P   @`DpL0 V    Ѝd` `0 0O6LH H0 0F040 00 0=*  &  ԉ 4B8 k Њ $ mD9  //O-MP0`Q S U Y S + @T@@ ĻċP PV` 0̻ + 0@@@PD Z4 TT QH P-PZ( `$p %P+P -Pp 0j `@v/ ت z PJ @ FQ  FQ`@lX\ P p0 R ``e0S AA@ i`縩 z Y> J @@ jFQ dFQ@lX\ P 0Q R``k0S qQPq( PkH@( ؈ظB ``Xq q@-ZPPPE =ベPPu `@vd:Z Pp+@om0 P WZ;Q :Q$( Q PP:P=?v` Ѝħ z~ GY@ J pE EQ EQEkX]\X P 0Q R``k0S AQPA x`PU~ @ppPU  ΣP]PD t  0S 0S Q@Z1 @P :PQ $ K50% BqP!@@TPPb@00t RP$S" X @P:PKQ 0-P+P]X0P :P?1 @R`SL 0T:PPPa#P :PaW@@T  C#P :Pt-P+P::Q :P?P!30t PhP  P@P@4 `P:PXQ  30# A-P+PHW0X@T!_P1 0l0SW4@0!,1 0`0UM@ !a1 0T0YC@ 0 0H0S9@ 0 0<0.\ 0t 0 0'0,!,1 0W6 n w  > Z ~  % ~  ~ v~ ~ ~ =>< <9 "~ ~ c~ :P : o;L=48k 494f3 1g <5\:84,2 -f 4D:3 |>8 L<} v~ ?~ 7\X@06j 55h 066d4<5,5`3e 33L5h K-@PQ T 4P+ ,0(0 P!-Q ``ppW% -W -pR)"2 00xpW `" p`::W 1\b-p``-P pޖP! :Q1Q `:P $$ P>a"2 00`P?PP:P lP 謥< 801  $:P :P ?PP  0DR@ @0 0T?(S$ $0 06y @z y y z z H`. |.. - <(,(z /xh- T., Xz .@-@P  @/ 0 0෣y y @-@P @)/ 0 0ࣣxy y y H-MP`Q4P3@LP P p0P 0PPP PP7P `PP `aP`[YP`ЍhA-@` Q0 pS P1Q*rP pE Pp pAWp ᙗ Q  1 H-Q Q Q-s& 0 0sAQT  0 0ӢϠq  0 R1 R010 腤w w w ,w fw zw H- XE1)0 X?)p@-@P`P o0 p@)N4 0 0ൢgv v 2 @-@P  0@NA 0 0v Nv =2 0H-@PP o; 0HM6 0 0u +v 1 @-M@P  0oPЍ0 0 0ju u u 0 OH-P@P p0UUa V`q]/ 0 0Dzu u 0 A-@`pQ PTPPT pP  ?D 0PpB,@轣O-M@`pDPU( ĠT (VWp` @ @V@@V 5P \/ @D P $(,Ѝ聣Ѝ4r!#/H-R @P`pw0 !#3/p pW@T@ /0H-@PU 0H/0p@-MP@P U% 0`P ,P  $P   noЍpD;@ @0 0U(<$ $0 0ur r - yr r r 0H-@P$ P 0P @ P R0 P  QQ$[0 0< 0 0=q r , p@-@PP T# 0`P ,P  ㏕$P  ㈕(MopD8@ @0 0T(9$ $0 0mq q , Eq xq p 0H-@P ㍗P@P[P07 0 0ޠp q 9+ MH-M  0 !LЍHЍ/MH-M 0 00KЍHЍ/@- MP @Q 坜  @TPJpQhLH儜@  D !L Ѝ p p ܹP,E@/A$Q//>p h>p <A-8Mh`Vp@PW4 T U ViD`Pu ,ຝPq ഝPp ஝Pl ਝPh ࢝Pd P` P\ PX PT |PP h~PL TxPH @rPX ,lPT fPP `PL a`P< QQ `EQ `2 n=0503! 20.0,0*0(0&0$ 0" 0 0 0 0 0 0ǟTWX 0 0༟O0000x  `2@,ᏛpT  &4P8ЍSGXim m m =m qm m H kp up  p p p p p p p p p p p p p q q bn H-MMЍ@-M@P@ЍO-MM`pPV  W ДZ ؄Y %u@p0 + P 0  @<($ʖP @外 x@]Q TE,@ᰊ@@@D PA P>PW Z Y t@ ;UP9tP6 0 sp6T x0 jp-xփp+PPq T | h@ 0@"@FPЍۍF C@o @LiH#H3 0พWT0j,#,3 0ஞKk#3 0फ़El"2 0?z"2 0Zu{"2 0Ym_"2 0dq:PJ5pڄeT,p|&p\X xN|L7p(P$tP" ࢛P# ᝛Pt$A@Q/@!P @ 03t tt /P/PPT P LkHX X0! ,! 10  0 Q8  U$4l l ^l l rl Dl k Nl 0l k *l X"  +z,n k An k xk n k Pk m ! 1p 7o !o 4o n 7o m im }m l ql R ql ) $ W+l k O-tMMPF`pZ@pP WX V` TXf Un P @0 @HDLZp A, ph`,$ @1 @T  %pPJ b dpTc 0P ,@,#P<=PQ0 p 4  h子P $Ĉޞp@ 4h  啐P $ଈ$ p*@X Tl@@꜔,Y@,8 , @T(rJ ,0`P# ) `ۘVVX@崅Pp匞 PP\Pz dApKD ,` @P᳘ ᭘ Tᦘ x` P`P `@ P  d` PP,P THpHB0 @RpPtЍۍ=Dh( |vxiPP( h0PԏP`b P |p , 0 0TW 0 0JV 0 0@ 0 07U|x x0 0-@Ɲp0$ )Lb ;d ?d |b d b Tb c b 0b c xb b c  sh *i 3h %h g g B  e f e 7e de @-M@P@ЍG-PMЁ`PpVLF UN pZT x@YZ !w,pp0 k( P 0  @(@QP @+ L8@t@Q $q,p6p 0@@LPPЍXC 0 0Utp p0 0\X X0 0D@ @0 0@ _ %` _ _ _ _ t_ _ _ P_ _  (@-@P  @ ~ 0 0]^ 6_ <_ K-M@P`T m Pp B`V AP A@ A0 A  A B A V&UpppUp  a @ `QP:JVPV p ڲp)ꪜ/$꥜@로@ `p pʓ0P @ P눜#PЍB  0 0֚ \ 3] ] A-(M@P`pP+ U3 T;  P(0 @ @@PpW  0@5P pW (Ѝlh h0 0UP]L L0 0T4^0 00 0[ A\ E\ [ \ +\ X[ [ \ x O-MMR@`XP Y [ T(P  0@pTWS PJ < ;pPc<P`  @+ᶅ,+P0< < <'P @@\pH  PX@fp\P<PH |pp Lp@ 8  0dppTi jPPPЍۍAlh h0 0ʙ_TP P0 0[Z84 40 0ෙQ<|X GY OY XX #Y Y 0X X X [ N t[ b /Z ؾ0Z =Z &Z Z @- MT@ P@0 0 A ! Q Ѝ;AO-M d (~Z5 BX; TC - 0 P PP@  R PK - 0P P  0` RSp Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P,!P- @P-P P  0 C !PP @PPP Pp  0 -`   /-P +P&TP- @P,T" 0` *TP! @P3T" 0`` ޕo `ϕoXP p x XP! - 0P 嵕P `K@Z Pߍ? lh h0 08T1P P0 0/T84 40 0%|4R S S R S R Q aS R (@- MP@P@   0 0 B !  Q Ѝ?G-!M⼡`PV <_ !@ 4@;D@@JPI@; 4p@>P=D P< 0 C0@4@ pp@NP)P:@;`pPU  4:``P  P@ ; 0P00\@<P!ݍI?  0 0hO R WP Ġ ص S K-8MM⠁`@pV4M TU P3 43TP ̊P6 P0Pp C0P G 0 PݎP# `V 2@3pP`V  42pppP墊P ᖔP P P㜎4P8Ѝۍ>HD D0 0 T,:( (0 0pM P N M P P O-M@P`P B⾗0p P  0 WN* 0 A Ra ARWAA AR7A Q P A BR:P P @ 0aX4@dL\LLLX 2 0 0G Z :`!@0 0ਖ 0GA Q :} 0 0 PGG!U@: U *PЍHCD D0 0}uD@ @0 0sN N L pO O O O NO |O N N "O K-(a@`p?PU ?U` ?`# @0 d`P >U.:W$ .P p?0P V*pW:V'B71@4P1*p@@V *p`ppQ:,?V35ѴM ͳp@-<`P@`(00 @p`0H-M@P 0PX@X @P P|"Ѝ03 0 0ߕL 'M Qgp@-(M`P  000  @PP@AQ d` PN$@ 0`P@(ЍpB 0 0କ+L gL Ԇ L O-dMRXP` Y 0p`@"F  `@";#Zy @  0@Ph ,P`p  _  0@`PO ฒP% X>   0 @P,@p@PXXY Z  \@@]PP[0 prP1(2P$PF (40`P,X K,$$P 0 0 O멖PP `RdЍ< OPPHXD D0 0YU,Y( (0 0LCI I I I wI ! /L !L  @J xI J &J & A-0M@pP% T- X5  000  P``P@P p 0`p0ЍI0Ѝlh h0 0ࠔTPL L0 0X40 00 0G H y; G H ى G pH H $ O-UMR`PPZV` Y !"X{ P 0PPj 4p`@( $ E 0P`PQ P' Y@ O $ 0( @?P40HP@Dp pp@ 0PwP10P,p04 0DP4O /4,,P 0 0N덕PP PRUߍ;NPPHD D0 0֓Yb,( (0 0̓YxD {E :E D SE G ػZF OE F U 3" </ጪA-MЀPpU" W!pP `\ @"2 0 P  PЍ@;p(4$ $0 0WHTD D D G-GMdPU lI ;!FP7J\+`9pP P\@ B+,pP@CW@JY!uP \@ p"2 0 P  lPGލ: N 0 0TB C C A-pM耟`pPVl) @ך W!0pP \Pᵝ @"2 0 P  lPpЍ:p h 0 0ڒA B B <<@-M8@ 4@I~ 0ЍA 0 Q/p$/A-MЀPpU" W)pP ` V@"2 0d@ p (PЍ?:p(F$ $0 0WD@ A @ O-EMM R@PE@PjJ<`8u pZ xp|X  06qG W+  RUP⠰ W+  RL@P  WpW ɓPœPTP@P(JY)NP @ T p"2 0g@ p  @( PP@P4PP@PEߍۍ99H||H-M 0  jЍA-xM耟`pPVt) @M hW)pP `P U@"2 0d@ p (tPxЍc9p  0 0ऑ_= = ;= 0O-M@Q T 噹`傺E,10 H0 0b'8  PTp pb>f b L@ @\ c9f hdf PgX`c!`c! 6ot`ea@ba ga&4_`ga&c10`a@ ba&`lP4_=ba&gqpaa 0@`a&pP4_}` p`a&b! @-P `c!a!"4_ `a!"$@g!c!"P4_ c!"a f!(@ g!" xP4_g!"c1 `1 ,@f1#P4_-0 f1#gq00@=P pa1`1#4_0fa`1#4@0baaa&P4_`aa&`=ga 0ba&P` b&8` 6oPa

Fn1a1#@#0p$l'_'pP?P`)lq0 0o&Pbq᡻nq'=o&`p'پF_`,t@a`q 0bq'o&P&|Pp'Ona@p@ `%  xo&}O&@唀 Ob!@@cqh@o,`q' p'o&@ aq-cq' &p'O` @ @ dnqaq'o%p'o&_&`` |POc1<@o&@0bq=nq' 0o&@p'o&``Oa4@8@ `o$l@b! !o&O&@o@nq0`,` pco&p@`! !o&@o&`_b!( $P/"@ `l/"c!/" !_`(P@tP g/"xPl  /"/"_c!0 ,P/"0 P n/"g /" t ?`l!80 0  hPan ?#P ?#?#0_@g1dPP b1bqi10p%''`p_aqhPDP0iqa'%|P!'_'Ponq`l poHlP0`b`a`o&Po&pPo&`Oial@ga`agA@O$P O$P$cAob!D`caga @@`-O$ xPO$O$@o` @` aa ac o Po&o&`gqx bq bap< t''pc1< pibi104? ?#?#0a4 @nin1|P00?#P?#\ #_Hg1ob!0` `` gn$0?#`?#?#0oi1`` a1`ag0(? ?#O#@n1( b1ba,0?#?##g1, f1 pfbP80?#P?#P#l1_a8P P lfd0?#?#?#p0_b!dP @ glg1tP0?#P?##|_f1$P a1 agPh0?#P?#P?#t0ol1h` ba 0ba l`o&Po&t&D`嘐Ogqjq @bqjA pO&` PO$@`$OacqD@jqcApO&` xPO$o$`Ob! `q@@cq`A-p@ O%PO$P$ O@jApaA} aq`qp<@O$PO$O$x@_c1PP04@bq=aq'_$p@ 0 p'_%O%@_``A 4PbJL P0@lqO$|Pbq'p'O$$`@_a0PP pcl!O$!O$O$@_b!R/0H-MP @P(JDU ?P : ?P:h P 1 @ P 1  㶂Ѝ0|P/ Mp@-M@襂`0T` P P  P J 0`0 PL  @@`Q Ѝp@ Ѝ/Dd0d89c~k0H-@PP] I\ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0b 0 0 . 3 O-TMP (@8D@ <86p۵`ٵ -L Lp-'@@P(L0@ P@@``aIQ* T\8' @&X]T( P8 0` F+IP =YplP0P p0  0 L0X@ PI                        S @\*p P+@ 1I? FP;#FP<#l#0I0 PP 0PPq&DBPLP@ 0PL   p L=Y@+Y@[ \.*0P\C XV L\m:0 P\g:P P0p@1&PLP@L RP `P`P&ppPLP0@` L\p$`4 0] @40 `SP`=YU =YP\*@P 0@P% 局 宀PLP@ 0@L    L[p \ *@@@@@`%P P%က~PLP@L `@\@@ XV LY] ,YsZp* `T P PP@JT `"PP : U*L@T*p#p``p0@ᇼ,@TЍ'$  $`@K%``P `L$p@@L@TO P+-`XD X+- 0p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T ATApp`D]@ @0 0~Do@ @0 0~ꈟM E ) s H-P`p@PX WW/XGQP 88888888888888x8888888x88888xVp & +W-WVp=U -U +U =W -V+p@] 0 0}Q 0H-M@PP   0P@upЍ0: 0 0|}9 n  P/P   @ @ B/P//// / ` A/ ` A//// / a @/ a @/A-M@PPU T] `pP- ؁@P lfp PP PfrP 6 `~PpfP d ~PЍ6 p P Q @ }Ѝ 0 0|Tpl l0 0| ]T `PpL H0 09  0 "~ +b  X+h[\[*H-pP@eo`+ oP V 0PPZrmopPl   V` p 㥴P~Pec ~PPdLp@-`P@`V R`VrPJP C+Ppp@:P p@2pPYG-M@pP 0R TZ P `P* @ P p PN `rP5 P}PP 4}PЍ5 p ` Q @ Ѝlh h0 0{TPL L0 0{ b  ᴰ+ ! D 6z 'l'|WpW&H-MPPD  0 0{9 m u O-DMl@`P ppthPp0l?h&d`  4UPTiJ0 oT áaV_ [@4`|<0ڭG$ QG@ d` +(8 S HOYc` 8 A$ +( d (`8 y8d (`$,Pp 0@uv0@ QDЍZ lP< 00IS6p8@lp mE%  ЍۍOpl"l2 0x[TP"P2 0x<8"82 0xV`pR p zR{R }RP @[R 0]SSSppp  cVQSP@`` ZHzP ,P [P ]QQQ  {P }PV `FV Q * P: 00X 0Q1: @0 @M a@TM C@\  R: R  $ Ѝۍ ` w S O-TMM@[ P Y [' Y/ p~P\ `Y  P0S/S 0QpJ pQF P ;HN qP1HP. tF_P  0S  0 R! R  b P 0@0 BS`Pp `p;HN ∯P `p `W PPTЍڍXp*`V*Q WL @ @T   RS QUQ pP0E EQP ?Q [Q@ᰀ!XQ 0 ]\ \!X[`Fp  p qp1P!X @P  P0]R r ` -Rp- ]W `P`w  3p`p pYR P 0N+{pPoP P  p Pd  p^p [ @`1 0[gQ 0 0vY 0 0v[ 0 0vYhd d0 0vT%P P0 0v}o 0 G  [ 1  A p@-@P PpPU aPU` P 围p 0 0v / 5 H-\50? CR,0!|Q 0SS *SO-MP`P] Ue   0 ZHP g hP@ PP  v@@PpOP V? T  `W Ѝ     P wЍ[Ѝpl l0 0uUTP P0 0u<G8 80 0uT/ )   A E 0H-P@P U 0HKD@ @0 0uU(E$ $0 0ug  ? {cO-MMp`@[  T ؔW Y ܄Q$ /p@Q 0U.*qq0 QP/Q SL/Q@pT*/Q Q[ Y [    P20 @⎫$ 2/Q!   Q  :v/T/P     0 $QЍۍ   P P[e  00   P @6( 2/P   PT*/LH!H1 0tTM0m,!,1 0tDn!1 0tY?o 0 0t6C 0 0tY[E 0 0t[SG 0 0tJpS 0p 0t| x0G 0ts' s O ' ) - g  ?   ] O-MM,0``[ V ,tP DW TT @(`@uU$@ **`PP! PU:$` P< DT  00   PL @0y괐Y ,QGP  (,0 pP,$ 02/Q#8 QDTb P    Q 00+u_ @J 1/pP @h :/P H` P, :/DP   d R00*  .RK   .R R .R R (@ Y RY$P P3 (, P I@ P0/3!1 @ P(@d, P I 0 P , .RP 0    0 S @0⡩P$ 02/P8 P{ E#3 0GsPU#  "  PI` @HV 1/VtP6  1 ,t5/Q$  (P0G0 ]PI(ob$t`/($QЍۍ`D`D 0 0rVe 0 0r\ 0 0rW 0 0rQ 0 0rKE| |0 0r_h/d d0 0rXo e M ^ d  : < [  7 q  M 8n M 8iq O- MP X Z P X:U Ѝ]* p`@ 00 T3PA uPR PF V :U \?pT [pT! %  $ P  `Ȣp- Q  罢p! РL̰   RQ Īpp`P  ២p``Ѝ< 0 0l5 i q th\\@-h@`@@PP7PJ4@T@@)qUp@-@P``PppTOh"`P<i`m` p`H-ա   PG-MP SP`LP<pU !p Z@Ѝ PJ00P Q l`q@pP PPfP00XXD0 0 0ia ƾ HK's &H- P($0@0O-$M`p@Pe Zm Vu F` P   p `pP X pZQ*Q) ?QHp/Pm PI .PkPh ZA Vc Z/P`;[Q+ \Q Q X qP @#X p*Q"p *RX p/Q0 Q0Q @ X A.Q  R pZ V  Z/R p/PV /E[P @~V @xVX `0^ @!@o/o\"`p\]\4R0`pX  @@  r@OoB=r\P /P ; P pX  r @R, -PX ```\\ PUP\`X pppP PR0@S@@pt `T[ @`[PVpRP pPK /ZpPpDp@X  q`V, 0  P/VP  p/P PpX{T T0 0gZ<|8 80 0gVp$Ѝ~ H V 0DC>978O-MBp` @0 !PP u h`-Pc``ᓞPP `  0pQ  ㅞPM PPG p p  ` < u4   0@p) X\PP1   0pۛp @  0P  `Z:p@@ `L@@` P ߍ x755p@-X`@P`R JP` RAP pi p@-X`@P`R P` R'P pli p@-X`@P`R 2P` R P pi   哚4MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00SX" QKHЍ/, 4MH-MPP@  00@  @@@ @0T 00@MР0    R  R! QKHЍ/ L3MH-M 0 00H.MH-M  0  MH-M  0 Q R / O-,MZ@TP(=  P8JJf@e R :R|R  P : D   ( PJ P?bP 9bP pbX XŢ: jPPX X1 |p 02 (0' p 0H p ,, p 4NPJ PU xPp hP` P P P P P P| Px Pt |Pp hPl TPh @Pm ,Pi Pn Pj ~Pf xPb rP^ lPZ fPV `PR L vI j PD:8 6420. ,$*((,&0$h%5 0c48%5 0c+< @ DHLPTX@@|%  ᤡl ,0p0p`H  8` 40p8p`  <`p 0> 4p 00 4p0P  P0  lP0 P HP0 T $p 00 0ppbfotᔐ&$P"a``堣 pTi*@ @@@!@%@p  p PP   wp _  kP`  P`J [ ` 8P `Q` uF   `p!1 0b_qvP$@p d&0% `P \1% P `2% P d3% P h4%W VHPllPP(P,Ѝ" 1' Z ާ Ď _t K UT X 9 xT4.$ZR 6 P }?Lۈ @ t N)@\'q^6#%41aMGd!=gKp@-@`T' PU$ ^D`p Q/R DP@Q Q/RP @@`P PF/R SVP@X/UT@@@P4``T ( ;0p) )  K-MP]P@ @`t,@gc` p`P* pPP$@QUc"P$T *Ѝb@ Pd88880888h8p2cЍ !Ѝ`%l% op@-P`@PV@ Y]P @Q/Q /VpP1 R0r/S@CPU@(P ;P/p6'  DH-@M04 $ (8 –p Q@Ѝ@Ѝp@-P`F@p T&p V@U pph @p P@ϖ̖ɖUph -M ЍpFF|~pqW1hpqpq1`pp@-  /oQ 0?o? #'S @c\ \ ) p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#  pp@-  /oQ 0?o? #'S @c\ \ +  p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#   p  0%D1B0D q1 A 0/0 0%D1B0D q1 A p0 Q/ 0H-   ?!/Po? So?`'P @`Q Q ? , (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +  H-   ?!/Po? So?`'P @`Q Q ? .  (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +     0D ` p1 A 0/ A0  0D ` p1 A p0 Q/A0@ ZH-@ p A@ ZH-@ p@ ZH-@ bp^ @ ZH-@ WpSPPH- a`K0H-@PP  0H;1 0 0V_{ { i ?0/R//R/?0S/R/P/R/H-A`@-MP @T   SЍt@p : @E@@P@@T4$ ༓ipd0,N Q +H-(`PH趔M00O-M0pᔯW q   Pϟ Wb PU] @l%Uq@ P%EUPL0aXXXXXXXXXXXXXXXXXXXXXXXXXXXX P XXX4XdXXP$h$XXXXXX X X$ H X\ X  Xx @@pG@@TUy  `8h@ZP CP @ZP CP @YP {CP @YP qCP @YP gCP @YP ]CP @YP SCP @YP ICP @YP ?CP $@YP 5CP (@YP +CP ,@YP !CP Z p B`@YP CPI @YP BPC @wYP BP= @mYP BP7 @cYP BP1 @YYP BP, @OYP BP& Y `p#  0@ Q`/^0 `6R  3:^ 03  ϟ0Bp5Q p UUptzU3pG @)0 @ R0`/SP` UPP3`:SP0ϟP3`0 Cp0B S pApG@7T 0@ P[pl  0 @ R;0`/SP`<UPP3:S0ϟ`PP3` p0 C;R% "[ P0 @ R0`/SP`>UPP3:S0ϟ`PP3` p0 C=R Dp2 PW0@ Q. a0/RP06UPP30:RPP30 p0BA4QP8llW 0`@ V_ 0PUR0SP::SPN* 0PA`0SE0VC:9VA 0PA0`V80S6:9S 0PA1P0@ Q a0/RP0dUPP30:RPP30 p0BcQ^ 00@ S Q`nA R0V::V * 0 B0nAaPU0S:9S0 A 0 @ R0`/SP`UPP3:S0Ο`PP3`p0 C R  pt 0@ Pa0 /QP0 UPP3:Q0 3 0Ap@ Qp0 0@ Q `0/RP` UPP3:R`030 ϟ0B Ap R p 0CBp`@mWP @PW @cWP @(ϟP MJ P50`@ Vp` 00Fs Q1 FR0 r0%pc#tBwpp#4#11C r  0 @ RR py P? 0Uϟp g 0@ Pa0 /QP0dUPP3:Q0 3 0ApcPp P 51ESr?dp0C+0A/S@`!0 ||`0@ V:T@`  V@0A`@ T T.a0 /QP0dUPP3:Q0 3 0ApcPpdl'@ R  51ESb?!a  `$@00C P \ \L @PUp9 0C\0@0S0/ $0`0pC W@B <̟P@p u P k˟  0  Sʁ pXEQdpOP MR`0 TR R XK@@@@@CR 0 R (k`` @ ˟R w 0``@rQ 00@ @R @ R @ R @  *?P7 p  #?P2  @?P, l  ?P& T  ?P*   ?P%  @>P   >P @mU` >P @aU` >P   @ɟ A0A S *@0A  p$(ȟ L`AVJ*MQM0a a$p( +'# pȟ  s   ̧p <ȟ  [ǟ V@RA 0``@( JQ> %P Ul lWEXǟ p< 0B0S  B  p.5r *r %!ER2?d a;QP.a! @QH \a $p( Ɵ Q JQ@ ak  `v @ Q` ` 00@P*Q  P P@ P=$(Ppş p şzU :0@@@A.ap$(@@@LA >a $ 0p%a ! Qe  Q*%!ER3/>bK/)<b!qp'qqpWQq ""q R3$40 #0 A6 Pu4 `l0pEPQ0"/dqaQ "p Bqpv AqA%)b8/0!bB$I"IqRBq/!B !b B AQ>%!ER3/>g 0K5)lB6#sP%Q7sP0UQ>sp'r6sp0W03b4p`gpA W B R:4 b0 G B 1 \  %!ER3/>bK/)<b!qp'qqpWQq ""q R3!40 # 0C +pE0Q0"/dqaQ$ "p Bqpv AqA%)c Rx?1CqJ 0Q0 R00 "QߍP8 )l5@bL6# g `@cr0W03 P8 )l5@bL6# g `@cr0W03 3 t0U e lHe LP`\1 X0 e xe `e ,e e |O-M@DPTHPP% 0 P R `1 0Q1GV耟l S  P  1 P `O*` @*@ L  qq`F`SP:@TPXXPЍ9X . . IpZ Z LZ @-0M@ P0Ѝ@-0M@P0ЍH-PH~UH-0MPR  =p1 mQD  Y X =P  n=P pp P D=  I= I>p>hCd d0 0QUTLDH H0 0GU=VpЍ{U U m SU U U (@-MQRЍ@VTP @PЍV@V ЍO-uMM|pP`w  W V@F8D4!41 0T @p7 @P:V/@~⠥$E EwO㠥WdE`E \EA 0 K x pE匥pEE@PJWHP@PuߍۍjtT T 8 0 MH-M  0 ЍHЍ/MH-M 0 00ЍHЍ/O- M@Pm Z `ZZ[XJKH0P @ P m0P` aa`` `\PZC. J[P ` X ~P$ `P [[Zpp{p- {/k:K Ѝ` [ R`P l?h h0 0TZLH H0 0 T40 00 0TQ OQ P #Q 'Q P P Q 4@-M@J(P H " (0 1/`p) p 0`VQ <`VJfU`p eP @`JЍЀ`Jp@-M@=J(P G  (0 1/`p, p 0`VQ <`VJUeP @`J UT`ЍЀtJ0H-PP: eBP? @TG E P0P D P Q P0: (6  2PU* *,P &4P "8P 0HLKH H0 0S4M0 00 0SP 0M M ; mM M M 0H-(P@Pᤣa0H蝣ꬃh@- @@ᖣ`@萣t40H-,@@ባ `PႣ0@O-M@Pt  `P0V ` xP,`p0V+p0 V% P 8 B/o"*k"0PB`pV   ("` @P` @p0V`W Y$*U".VP@ЍV @ P  BQR Q Q QЍЍF 0 0\RJ K 'K d4  R  *4 8/L 0X\S 040:8 R РS /9SxBH-P`@SH DpV  \}p@-@P`S 0A-p@`PP T   pQ @(L|,Tp \V[ [ %VYpQ:pP P ] FnP,8HP\ht0F9-V ^V?V0P"0Q v v cdv   4W@v P P v ~  v Q Qs =Q v#P-v;Q|Y /!BPR0@0 ̠ ^ Q+W@%0vp;pWpcSb`a0 `XV^"w Q" `s dR0dS 0@ hf $ &V" ` Cq0 0K0A  =V  9 20`$ ` D@ @0 0PT($ $0 0PB 1B A A B B ,t\ l  \O- MpPR O XW @T2 `  0PU+ PEP'((U PE@T P &. U PE`U FCQ  0 0O8Q` ЍD@ @0 0OX($ $0 0O@ F@ ? @ &@ >@ @  0  00~  $$E A-qPpW1 /C!=QdaV P $QPXDP* V(t`,1/P- V;  $P:@`@`P=pWpQ 1/xpV@V T  0 $PX@0l,̳$tt-A-qPpW1  HQdaV P $QPXDP* V(`,1/P- V;  $PA:@`@`PnpWpQ 1/xpV@V T  0 $P!X@`\Tr(rUG-@P_ `ZJPZ qPpW  U` /C"=!i QU ZKPB @P U& P0=pWpQ 1/U(]PP   91/P $@Z $41/P tpxloTpG-@P_ `IPZ qPpW  U`  H i QU Z6KPB @P U& P0ㅉpWpQ 1/U(ޅPP   (91/P $@Z $41/P |ĭnxn\nG-R`SPP 0/` {O`V @@ P W``@@T p P Bl``` \0Xp T@0p`@`PmL̫llllK-R@SPP 0/``V ppGw P ``ppW `Fv P l`\ \0Xp T0P`p `P@@lȪxXh`kdkXk`kO-MMP `Q P P/P P TNPN~ ㍂pu HP PPi ``p/P PY @@/QQ.P`T T.P  PU P/ @ ἂp@  P /Q P G Z P z/P P P? #e -P"J @P5H  P0 p @p'p/P  P Z/ .( ЍۍM? Z/ MhM>eM?bp@-P Q @p@p <@TC ppM9M"P/"PP- ρppȈM"P `P 㾁ppwM"P@P 㭁pẉ@pp@-PE `G\H\E 88 Q,  Q' P:Q0Q` 0@@CQ PP@\Q@:Q`VQ`C`Qp@P i0,  pM p蜤|A-PpP. U6 @R" Q `p:Q 0S R p 0SRpGS@R :XR :R@PD@ @0 0"KU($ $0 0K4 H4  3 4 %4 p@-M`@PP T V  0`'Ѝplh h0 0JTPL L0 0JV40 00 0J`3 3  83 }3 3 3 U3 D O-LMMp`WH) Z1 pY7 tDP>  TT!I@T pQC  R 0S Q:Q |Q P @Q:Q |Qp ǂPn 0PS @ p,VJ 0kC)H`  0P M`VJ(H` p$0P4``Jp [ :H+P.@PfH P7W4 @0pP@pP 0#P pQ 0 R 0S Q:QX |QV P@Q:Q |Qp'7 0JpW4``9P P P :P \PpVp ``p,Z:0P,@K PC ,J0$pW ~(t4@0PP ``0SL·4($4`@, p P p@(ǜ ,P ( @UtPP `@:PtPp p0SRS@@Rp =R R@ @Rh @:R  RD( @40 @H$0H@[ {{:$d 0[  F B 0S:S0 Ap,`S:V:p` A`V Ap ppP , Dp@ A I` I @0  0@"@F$J ,@\ 4~  T K >P J  X4HP LЍۍJ@0܂J@`pP @D@8P pD 07/p P 8p@T <@p@1/DPP  /1/pDoᠲ 1/ᣆ$ @P }AJ@ᘆ=J@,(!(1 0HZB ! 1 0H  0 0Hp  0 0zH$P 4i} hl 0 0iHp 4Z$P T}@Llh h0 0UHph) 3* !* ) * * ) ) ) x) ) z: 4) ) 6: W2 ( ) 9 \/ S0 @ Н^B /X0H-@PP T(  R 0S  R:R |R Q A R:R |R0D@ @0 0HT($ $0 0G' '  l' ' n8 0H-@PP T P 0  0000H8D@ @0 0GT($ $0 0G& "' , & & & lT8<<H-LP [<00,,  000蔕|`ddO-MMℴX  Y  plDP@ \$ XXtR pH, P 0P $400SN 0$ &P   AQ 30000@:R#R)P\@o" S`PU CPl#  P TP DP 8Q R  R\R   2 0 ` Q pAQ\Q  PRPU :Q P XPH V`N:  PBa 0`P  R :R|R  0@P P [h`O `PЍۍ;HD D0 0~FY,( (0 0tFл! ! " `! ! ! ԔĔȔqL|<((p xpht̒||$lK-pPP W Y U W @`P 0P:P R Q 0 RQPCR@Q =Q@@T ddpL~P `]T\T P:P| 0Q-0@ 00Sd00@ 0R_P0@p@ ^T P:Pb @PT:T\ P@pW@FdPe `dp@]TB@P2QE @:@Pp@@ @ @ @ @@WF )G ᱁P u 0 0uEW+ 0 0kEY# 0 0aEUhd d0 0WEWLH H0 0ME d  <  q   }I   `   K-`pP[ Vc Xk Ws V{ @PPH 0p:P R Q 0 RQpCR@Q1 =Q`@V, dd@:}P pP `@T @E d)P Pd@`V:VT Ep F  P W6 ӂ" 0 0DV# 0 0DX$ 0 0DW 0 0DVtp p0 0Dz\FX X0 0D  P \   4 F d  < l q    A-PpPJ UR XZ Wb Uj @Q< `p:Q 0S R p 0SRpGS@R% #R @R 0R xP 0/p0`C V:a`CVpV:A`C6pV0S0" q 0 05DUr 0 0+DXs 0 0!DWhd d0 0DULH H0 0 Dd  <  q      `   O-MM`@PV$  P ?/Z6P,D 0d  ̒4 p TC+밒KP$`N p4 tEp"p2 0C@YQ:Q(d PD@`@ ` I P gx cx ^x(d:K$N ;K/$N 07,D(dWpl sxEP @P9LL:P 4P+DPD  P ⤀ pAР B`7 2xh$PK4 :Pm D X  ' Z,@&a F /H-  #MH-MPP@  00@  @@@ @0T 00@MР0    R0 w QKHЍ/PO-$Mlr`p TT )DP"  0 `币jTPP U: @ P  E p p7APX qp Xp VQ!&H@ 0 4P"" 3q Q$ЍE8 P9$ P2 @ P QX" 0# " !  P ?PHP  -P* H "[ 6,pp P $Ѝ `CpLhl p H-8R, , ( Er@-M$@;0@07P@Ѝ|@ /  +` @a p  / = @ /  +` @a p  /=@ /  `A ` p  /=0 A@ /  +` @a p  / =@-0M@Q 0 !   0 T 9CPT,0 0#0ЍH- M _vP ЍH- M OvP ЍH-M  ?vЍ jw qw0iwG-MpPW$ U, `@a$A AO  O | 0xdA`A\Aqpqp@!QލHFD D0 0?AU,G( (0 05AH  8 0 ̢MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/lG-M<pPW* U2 `@a$A A劑O㳑dA`A\Aqpq<pp#  0qtq@Y!QލlGh h0 0@UPHL L0 0@8N4 40 0@ꔡf )7 > q *  M  /0 Ġp@-P@`47( 0@7p萠H-`@Pp 7 0@7O-MؿP@pU z W 0 @Q@($8p`Vv  p;@P Q AQcP Z;P%Vp@` p@WzPK!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$ $$$$$$,$$$$$$p,$$|8$D$$$Pp0`@y@pv@ps lKpkKphJpeJpbpPPVA%LQ AQP :P%`@ @x@u,``-^[ @ `@[ p*0<0-< 4 p-Q*-0][ 4 oO`@WPJpp W  pJp pBP-<Q ]Q0  $$    I @I 8PP  9 9P P@PZi \PV`]Ps  0 P iV`Tr -΍D Q %  0A D`V P @PeQ  0D @B D `VD Q (,V`T @ D@ y9P0D A````SD PgP DHD((FϠP Ml#D`V +@MQ llLLLLLLL8888888888888 Q[M*M8 8"@O @@8  BRC:M  @ DT(0 Q:L88QL 8M MD D P@kPj  @@Fځϰ T@l# 04, , T<@Y*<@`+Vd -Vb Z $4< <+VPIF%P:$$4  8P 7P0VK0V_ xP<, 4<@, @8Q V VQ @Q,@, }P?04P aQMdVEV PV" M J7P @ _< < @ UpV eV74 @PV 5, <4 @8 < <, 9,)V @   6P@_V ~ nQ @  w(V, @r4 @  7P < 4 h 6PX < `P@`PG,`T<@:B pFp @0 @ ,`pP<d @ d4,`  4  < @V`F@UP T.->QJ @`  R  T0A  Q5P )7@Pu@` 7@`PjZ0A  QP @@VA ᨀ[ P0 0H0`@ F `  F0` F@`p FP` B F`` B Fp P ` p< ` <P<P @`FPP [< ((P b@<,PK U[ APH0@  B B0 B@ BP B` B Fp B< B p P pj << <`p -P 4P,`<`@,PnP [CZf 4P (< ww@< R6P4 4P<((儵 t ,`@K,`V*TZV:@V < 1 { dD  cD ᘃ[ [ ϠPH0A@  B B0 B@ BP p B` A< B A ,p P p <@< P4@P<@F<PP 5P~`Tz@q@D ; lPDP((  S(QT> @k`V@T5Z| (( <8Dyq XRD,D 8 048 0Q     0 0 0 0(0 0(D H$$ @T @kZo@T [  尀 D Q  !1 0:@\'@̰ $P( QADQ4tp p0 09W|XT T0 09sx ( Rߍ:r <oGY$ 4@B ) leO-M@Qp yx P&I00PPT  -PN0PpyW `P6 QR@0B#+@W PuP& p -0pPpQ qP #JJ`0 0`, ,0 0F9yЍDٌ0H-@P/ ㊗@>00H-MPp$lVP d8` `0 09@@T 0 4/P @:@ЍH-MPp$lVP h8d d0 08@@T 0 4/P @~:@Ѝ$4DA-M`P$|WP lph h0 08$@$@T  04/P @R:@ЍSA-M`P$|WP ppl l0 08$@$@T  04/P @%:@ЍȀ 3A-M`P$|WP lyh h0 0n8(@(@T  04/P @9@ЍA-M`P$|WP pyl l0 0A8(@(@T  04/P @9@Ѝd; A-M`P$|WP lh h0 084@4@T  04/P @9@ЍA-M`P$|WP pl l0 074@4@T  04/P @s9@Ѝ~G-M) Pv d Qo*0 Q:  Pc*!p ` QX* pJ 4P0*00 QG* (P *   Q:* (]\$!'`";)|{}0 S* ` R*@ T@*Ze  Q*5D 84@Hr Fr<DrBrHPSߍ@\#,젟PxP 8`,r*r<(r5圠 8 P 0 03 0 03 xc;htts ( qnp4ntnBD r+[H- Mlp 3,P6 ,@``uhPg \P`X  X$ R 0@@ L@@@@P$@{PYZ@`` 16Y V:  `,@`P3hP#  % P U e \0$X  dp,, V"m Z @mT mm m `\ \0 0/ U:\1 Ѝ(K$ $0 0/ ԨC`pO-M`@PPm Tu ,XP P eP# -1`eP&1 ` `U =0  eP 1`$`00 `Ѝp P.  P.  P.РP\`8@,.V HP]P`U .U^PU P`L\ZPLp؃ #"@+*P` ```D:@ @0 0-/T($ $0 0#/ hA-P@`P2 T: $P*( p0p0P $T @@T(0 RU@ U Q00D@ @0 0.T(?$ $0 0.H p@-@P? P  (cLQJPUPlLpPlP PlUP ll,dPp`20`clV *0P`p~lp  0 0~. QA-@PK `PV? , < %P P P R P, P%R+PAP&@ @ 0Dp"0'5P  0 P /PU$ RPU4 lLPH P`U #3 0- (bP pkWP DP, PkLp\ ,  LP[ b2 0T,cP_0\` ,/ P P]Q p) 0 P ,PkUPPG-` ibp(& xk/PP@,BmcP=P%,6(ccP2 /`(^b/`, ,.$ 3bp(" dP0 , @/Q/\0  P(-b$PP.$?U 0 0"-dvWVBHB"H-M,`0@prPaPp$ ]c`p 8  "! @  "!b`.tʄ.@a.@`ЍO-0H-@PP T 0HO'DB@ @0 0)T(C$ $0 0)ĶfжI0H-@PP T 0H+'DB@ @0 0)T(C$ $0 0)4h֦ @00DO-MP@P T D "P >+XptЍ`$P+V  -V  `  0V xP p0VpTp0@ Qa@"Q#P*p`? P0@I" 0* 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q? 0 0)ju^p@-@M@ P ` 0P @ЍpP 0`n@Ѝp0H-@P `@]Pu  -P0~*@]z*@0F 0 0(깲޻p@-P`@`]@t  PpZ*P]V*PpG-MMd`p 0`@P# 8  P `P() .yP ^P J  jP  p*Ppns@ P p$p=P P*P *PP ( y(^f \fZf)@PPЍۍH@?*0H-M P^@p   P  2]p  @)Ѝ0O-M`$pJ @PK Y  PP@P`P T pPP pp`P`&Y P 1dP8 `E 0   ]p `FP)PP e 0 ePPoP \\p d)P]  pH@ Z p`*` pp W * IQ  Tq`T_@P&0 0`V `V P $P  QQleu` PG pP$pP+ Ѝ  0 0]';G0H-@ Je P PEeU 00H-@PP T  0H$D:@ @0 04'T(;$ $0 0*'갬ͬO-TM`PP  V U(x/? 0 ' Vy/? 0& UX 4 _PL @VT pP`WLP@W XhV LX`,< L` pZ4 L ,Y p, W@px P03/PL R* 0P  eV*c C*EL V 0 RPP00PL`&|/|? 0&O'/?@ 0&/?r 0~& pX:HVDu$ `eU0@,`1L 0pHP,`0PpY$ @x  :/PL R*  0`  cU*f F*CL UH 0 R``0LP0U0L@pH,` @0PY#x  :/PL R*  0`  cW*f F*CL WH 0 R``0HL0Y/L @p,` @0PP[#x  :/PL R*  0`  cW*f F*CL W 0 R``0LD HPL@0T p L`x $:/[ P@DP0ㆰ @P k8< F0P%X* \*0@`p(HP@ x P0 3/HPPQ p` Y:V2 pP@< ,@ p X* A Lp`W*  0 R c*c *H CD ^ 0 Rpp0(`8@D V*D@ :/@P8 X5* :/@P. X+* :/@P$ X!* :/@P X* :/@P X * :/ @pH@0P8H@ 1H@,L`xpW DP0 @3/@H@Pp[8D@Km x v$P03/ Pp[0 xPH@ P0DP 4<P6 X ARO:XU@00T1H:p0 d0S EW@C4<Pn X AR:XU @00Y1:p0 i0S EH@Wx{ X P0:X00  U02T1%: !p0 d0S ER  P:V!: Q 0Y1:(0P i0S A($0Q  Q: 0 R0@P`0 P0S4f X P1:X00  U02Y1&: !p0 i0S EH@R   P:V: Q 0T1:(0P d0S A($0Q   P: 0 R0PT0 P0S@JtBP@R" 4P@  @Z  ARZ:Z U @00Y1S:p0 i0S EWKPэ}JLQ 4PL H@` VS*PPD:/ PL` VI*L  2/ PB` V?*L 2/ P9` V6*L 2/ P0` V-*L 2/ P' Y*P L P2/ P `HP[DKNE&P9/ P@[D `D@@PP 4LHP07 V ARP:VW@00T1I:P0 d0S GUAD4LHP0T V AR:VW@00X1x:P0 h0S GUps V P$:V00  W02T1: Q 0 d0S GU  P:\3* 0 p8Pt  Q: 0 R0@p8P V P6:V00  W02X1+: Q 0 h0S GU!$ 8PQ 0X1<:(0p h0S A($0 Q4  P:\* 0 p8P.  P: 0 R0p8P 8PQ 0T1:(0p d0S A($0 QꔖƖ: 0 p0Se 0 p0S@] ` 8pR 4P7 Y  ART:Y W@00X1M:`0 h0S G @V EQ 4 @P J 80 `S ARM*yx;-6 Y P&:Y0 0  W02X1: !`0 h0S G @R  @  Q: @  Q:8` V P* 6SW@00V1$:  0 f0S G80\V00  W02\1: a 0 l0S GV8` 80  Q:} 8`  Q:u [  ZTЍH`@ PT7 @L 2/P0H R* 0p  cV*g G*CH V 0 Rpp0p@-@8P! (&m `V PPU 0# "  0S/TP* !P` P 0" `V PPU 0# "  0SpTP !P` P 0pP(lpp4H- P@U !P `'p&pWTTP !P  0p@-MP@P$ ``VVV  P 0#" PP RPP QЍpi 0 0/`]~O- M@Py pRR$$1  0  Qp! P J `0`F`V @ 0 T 0S $085 Ѝ0H-@DP (*lP($l00HD H-p@PP (l`P  (l }P ` `VPP p@-MP@P  P` 0P PP'apP PP`Ѝp< 0 0%r}}&p@-(M $ @T) 0S- P P` EPA FP@@@P`APV@A00S A000SA $ Q(Ѝp@ RRA$ Q(Ѝp B H-p0PP< J  R x (|H-p0\P L@ <-4,@(  4(  {pp@-@P`P U" Tp 0QR @T`psqApD?@ @0 0pU(@$ $0 0fzG{ziz{]iK-LjD@!P F 0 Y_t0INH@aOUEHOa!QA0SY  10"@PPT1S! A`VS0!V A`p@Pp1@@S10!Q0(Kjꄡ`PLԠؠ@O-Mbp@Q` jQ " BB!!hPW:PF W*LH"H2Dr @b0p`h@WP*P`p PW*`p W?`pP3`3p3_!1 0`p PPT1``FNH@!_Op0 \L`(XH`V  `pSP!    Q!p !! ` @pP@1ppQ1 ! R @0 P0 @@iЍ Y 0 0PY؟v!w(wğdTXX<ȞK-@@PC <Pi ,! L R!qE  100CC11  0@PP0ܐP ` 1Q` @P0 c  ! iH  0 0М4uuuܜd: : <@<(0H-oiP   00 0@R@PP1P@1R@!P@@8m.!D902!A@0Di0\8,070H-@P PP PP @00A 0 0xstrzA-@`P# ,P PpP _P  "PpP*PpPV 0 0BsNsyp@-@P P@`P U =Q@p=Q @p%@-@P `P@H@ V 0 0 rrr40H-@1PP P$ @00褘0H-@PP \pP Q#00 0 0qrqdO-Mⴑ@ ZpWpX_ ZP dpZ`! Q*PK VI`P@  P=P= q@W P UZ U    S`&`$P!   B``P E-@@  P pЍ < tK-8p4  p R Q A@PpQ P @P@VP  z`P UdQ UX T 4   ܕhK-p@TpWP`  ?P=P q`FWVX K-pP PP`=PtP@T p P=P ApTWJpp  @-$g@P D@o|@-$g@P 7@oH@-$g@P *@oQ3/ BR3/  /A-`V p@ PF4/P aVPK-@T `p PD9/P pP@W PGK-@T `p PD9/P pAP@W PGO-MT  `D ;/P QU  `E;/P@}  0P0Zp  @0p T00   0 TZ 0 PpWpGooqbW@NqY pPp⅐pppp pp@p$P1p%p@qP$PWPP  0Q0   !Q0p#QqppP0ppp@ p$p1P'P1P!0%00R0 V Ѝ \0S  P `VqW@pFob A- 0 DR! V!  Q@P$0 Q;  Q BEpP^P a@TV UppAV /opR`!@W G ppW Q p PPU pT  U   A@ Q"PPQU``@ooQb QAAPp pp^ p% Q`` @@ AAPP PPPpP`pPPP@``Pp@pWppXpp|H-Q 0"!R !R @Q@^  S AA-1S0#" 1@T@@T@ @ ``R   B S+ - <`@R0Pa%P P@ a$0S `\`00 P P P@'\`@&QA@P@`PPPpP'P ap%ppap' 1pppP p0R0p000 @ppRp aqpp`pppP0p%p`'``0&000P \ H-00 ?O 0DO-M-P!B(Z_O@p`qqF@dOhdZOXPTqXq\q! d눱P ` T P@Q2 @X@P[KP? P @7~@P@P`ϊ0ϊ ϊϊʊ`a0pac0Od0@DZXPTTaXa\a0 /O D@6dЍ@@$l xDA-@(Z _O@p`qqFcOcZOXPTqXq\q(((  x<x G--P`PEU6Pe!KP+ @X@'PPPT@@Pϊ0ϊ ϊϊʊ0pgc0Oc0PEZX@UTX\4O-}Mb(Pp`lNPo @fNPo hbCc\XP LŸLL" H2D 0  (,c    H@PP `0.0D`0Htq0DW@ @0 0U(X$ $0 0OO!OOOfC0H-@PP T  0HpDg@ @0 0T(h$ $0 0,OoONOGOROH-P@P. U6 T> UF p`P  >qP ppP P `P  H/TnP HNnw 0 0Uxxt t0 0vT\WX X0 0lU@X< <0 0bMWNYMM/NmMM MMMNA0H-P@P U" 1pP P PnP 0Hm00HpD@ @0 0-U($ $0 0#LM LLLMp@-MP@P U$ mP `oP P 0 0HqЍpЍpD@ @0 0 U($ $0 0 KNLKK&L0L H-P@P$ U, p`P mP oP mP mP HymD@ @0 0 U($ $0 0 JYK JJ1K:Kp@-@PPE TM P P`V T] FP p `T; VC V ppp`p  p p p pI 0 0I T% 0 0?   0 06 Vp40 00 0% IIIHIIHoI]IHII @-/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q) W1 T@T!  0S  Q@Q  0PU 0UR  @D:@ @0 0 W(;$ $0 0 GG2}GGGO-MM4J`pQ00Pߍڍ<HPP*\*X t`X`X\^Q:[pZUY iYi# @[Z|q0(  Ϙ@TJ T*0S? (I ࿘PWJ X3: Q:[ZPQQ Qs QQ}:@ 0S <( pXo'p BPf [`2Q Z, p500P ǟ B  B4  @ ``   |P p P0!00p& Up P*0 8n&w00p ? PppAQ :`&  x60!PnJ Pl*T&@pIH6 0P^JW\(&@pG6 0PNJWL%@pG5 0P>JW<%@pG5 0P.JW,%@pGt5 0їPJWH%@pG<5 0PJW % 5 @G0᱗PJpTppZ @ `X`4 \ 0pP0ᑗPPJYI`pZa0pS\ ?I#s0p tP}J| PI:y 0 U 8o  L0`2(P P$0"R0p0P01P PP P p PP0 Q0P0UpY 00 0  P @ZP( @ap P  pB@X10  0PppU YpW W WApX5  0`pPp!0 0 8>y]C"CtArqCSt1CtBsBsqBSs9BsG-1M쑟pP@`W U V] Te C/:O-M-+M^@p`SP @P ⸰ @ @ @ @4 A  Ap A X4` 0 PP @0@T 8p_P1FV@ `P )FPP0O0P @ 0 `*` B QP*BP3 Bp) aPV' p㤏O @  P `SP7Q `V P @P: f 0 HP @ x@ lP`*l@0 A *A<Ps d*d F*F x `*`O @@*@,Pq a ` *` @*@5 Q9Q Q P   P0 S p SR`pV P,P,PVWPSR VWp4Q3 <@0  P.Q QP~ PD 4P%Pg `eP pF< @ 0Pv ,PPf ,EZ ]=p!<PM<@0  PPE-P PQ;   4@< 0 @ ) ^ P <@0 P)PP,PDVP `P D `< @ 0P ,PZxX&[ ( ($`P `[ P$Q% (P9 P P P  P C B(R`;$PP P  x+; 0$P @pԀ8p[PP +ލ Ѝ+4P '@$kxp`P pP a*a  A*A `5 P9Q QQ   QP0 SQPSR <@  0 P^P xp,P[ [P,P,PSR @4!B)9 0u@xpP"@ ||||Q< 0 xpP'PU PPP@@QUCWP pP C@yZPr 0Q0,PP[ `bAP @B? KPJP =P B? rKp(@@`PpC0H ppW@8 HP U5P=pPP- Q @@NCQ@CC`\&\6 0B RRv QPQ&P#'CBP$ :4 0[. @4( 偒 @<0@P P? B a*a @*@ B/0 Ê及B܀X' SX `0I L U:P,81 (@`0D$ P`V AP Q @@AQAR@AQ U. A+P)괯 *=+l x "0~33 < yN.4 vx @-@ U?Pt  @ H-P P%0S PP$ PP+ SQ R  R RRQ/R RQQ RQp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^ 0S D0DPU S K-M`p@PN WH PPD PP9*P S  NLP P PYJY'yP 0 P P P X QQ P PTPЍ$ 0 0pW!!ݾ4O-\MMXPTP300X00p B 0 BX@p P W T@P| *0OPv  *0OPh #P 9P 1P pPPW `` P P P <UPP pp RP8 40 `*` @*@8vP4`V3 p`V,  P4PU hrd!d1 0?VP `P ?p@Z  Zi4p 0 0W_ 0 0T_VT G,QhX Q\Ѝڍ?jR] >vj\lRQ2gbУ O-M`XV  P@P @@@ MpP P PWJ@P> P  @ A A4 @@  AP A6 DH 09X@P* 0 P JP  0 A B!0 0[P t@P@`V`X@ >P& pH 0P 0L y PJP  0 A B!0 0%P >d1St`)x@d1#^*t R q PZ?[oXp @P R P P pt` @kVjR`Pd P 0XPp E EP E E0S S SK0d00 Xp`0\@00`@X0` 0xP` V @ N`( dP6:0,d` X**V  Z[O`0  `V pWp Pp R ` fV `Ѝ`,`` Vf@Q507Ѝ[L K-XM,P0iP @8PP AP A,p<004   P 0 pphpp Pߍ  0 0=MP ~ T ~ @ @-@P 8 ` D,( (0 0#EgܺvT2 K-@`PP' V/ >! Б@piWp  De  _$)P*@pP:D@ @0 0V($ $0 0oO-MP0 $pp @R P x$ j'MT0H00 X` 0 V7 8N p\@b* `0`0p0p tB0D7`p<p`pn aLpdgehp p|uO0P8p0 p *v wD lb*,P0P0V0XJ0Ppǂ( `P` Pe FmOPteL `  ` h iFx`4 ` gDkH @b ` `  Od  B|@◊ pူ p  w \yH bu `  `"akFl PPQ]O aZ 003y6J7@p@p@!x yD@Hp`dE`p`buvO`PpmPp0P@s @pLPpD[0p@0Qz^vB0p8c9@p`@w yN@p \> GO-dMMDVPD`0``P V "P pL4`@DPHp$<@X(,Ppp P@XHw$L 0pD pBq 7#)"  0v)hd"0  v@岰[[! [ [ <[ [ p)"  0uh)a! 0` uPK@'H`P o!pP 0QP,PQVP 4P0a `P 0dЍۍO/ vpPPW &`PdЍۍ/ lH $ <  = AH A @B DIh< A:?VdA>L]x)b)AP | `B XH-AMp@P` 0p zNPJ` P .\ $QAލ\@ H-AMp@P  0p  SNPJ` P n.5 $QAލ5@ A-MP0@  00N`PJpPP Q.Q Q.`ЍK-AM⬐@  0  N`PJ Pp)P Q.Q  P.T ` PAލ> p@-`P@Q xrP  @QUpp@-P@P R P RTpp (, c 0tT(p;p@-P@Q Q  Q'@ c 0ntT'pTp\;0H-P0@ PU Q0'`  0Ht'$P 800P, 0P 9t0d 2 :70H-@PT% T& T0T" T0'  0t'$P p0PPL 0P t000(00VX679&0H-@ PLT`D?Qr  $0T  TC  TD  T`0"T? T@ T@0T<  T0 T8  T0 T4 T0T0&!1S( 0ks&000000000p0P0H0H0KL>R!UWvG:0H-@&YS( &pʝ& (0 s&0耯Mp@-8M`HP`@4@I0SH@ .0@P0\ . r@U PE 804P8Ѝp@Ѝ/7 O-MP`PP2@p RQP QP 0-P0+P 0\@.P *@q0Q00@C000A.Ppp  p!p >?O p  !.Bd0 p#"0f 0`@@@ Q *PP00@@UP:Al) Q 3T Q*``V 0  3@ V`:A@PR 0@ 0@1`00@`d.T``  ``i O   @ Q  P*C P B `V  30@PV:IU< VP * Y 0  3@ Y:@R,  0@@.T P,@1`00A`d.TP`` P ``  O PRJ!.@P!.A` Q  P* P †P@T  30@`T:EV T@ *PU 0  3@ UP:@R  0p.W p)@R P90p1`00A`d.Wp`` p `` O p!.A `P@ Q  P*pr P @PP)) ) + + + ... P @Ѝ6 m O- 40`00pppPqp@0pG``rg``p@@@ @PA@p0@D```R PP@ BpEF2X<`Q `bfqoq' 2X c `bfqloOq' G2XY`pQXXXXXXXX\XXXX\XXXXXXXXXXXXXXXXXXXXXXXX\XXXX\XXXp!pPRq `0pF```.UPu``) `dPP@]_OY PPBpp@  @ P iaࠔ` KP0EP E`PP@ 4 `PP@.<0 O-LMC Q@W@R # pͰ` !s cp51 B cr !51Aq%!E"d reH D@W#P偣4# 0 oUQE a@p& b%!Aqdrf8# F<4#` " 0 o dp a@p) b%!Aqbe# %#P 4" 0 o # `V<& [8 Z 40@ @gObA00R0PQs DR(7c,01D000!pQ Pe$0EPW @#?^`H0Q"aCQA'R2/"bAY DRB:/ N0H 2/r!" bS0 0SQCS?.eP0Urrg1CW0GWpP" ` GA ?oZ  [ { V w LЍF'e td c >'Mp@-M`QP; P:P( Q@0@P0SP?83j8V3jaF``P+0;  0@P.U QR0*A0oPPB P.PPu ,( (0 01PЍpDRK- MP0"P] lG00@@04 P_ `nP% ЍH-M@PTlPK NlxaP`F tFlPB `@lP> L:lP: 84lP6 $.lP2  9`pP,$ bpp -`ZPV3opP $0<H`pTvpЍ  n< H% ǣ;tH-M`@PkP( Q PpP pp -PP U3opPpTupЍ `# p@-P@Pu`Pu` V P[o`Bp 0R0p0Rp \ 0 /Bo0H-M@tP 0Q PЍ0P,0H- Q  Q  P@@PPHP0@@P 0 ( @-@<p ,X0@ l!  0H-P8@p0,00H ` p@-`<@Ppp 0p@8  H-M`p@Pp 0@<8 40 0  p0_Ѝ GЍ p  H-M`lp@PUp p 00ЍFЍ4   / /  H-M`Tp@P#p p$ 0bЍЍl <  H-M`lp@Pp p 00$ЍFЍ   H-M`tp@Pp , (0p0tЍoFЍ`   H-M0  0cЍ H-<p HSLF   4 5P G- M@ἠD`Vt@@P,0 @ p   H ЍBO-M Mp P ${⨫K Pd  P WR  PPG R `P `T  PeP `\P P .PP `FP V& V$*  P PpG{T[P! P.P! W  P PW.pG{`[WG P P @ @E.PPV5*W':f a 嬫Z  @>04/`FJV  P*a {[WG [ {[  PJ`WK * |?007/  @    P 3ᬫ6 Z):h` @apP  @ P pP  05/ `F@V  p- P*嬫 Z  P  pp=07/ @  $o圻`[ pEPa822!2t4XhX4X&2T 2h1d%22d02'X22*2T  222l2222222222222222222222222222222222222222222h22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222h-   /;*P Z+ `V`FP[ : |C0d /  + Wi@ P+ # P * p?07/ @   / ?nPJ(o`N +R  @  P  p?07/ @U   PU / ?p3PTJ, H [ : BP @ pB`  k.0+ d `h` P'+  P *h dPT>05/ @   P p : B/0+ d h@ P+ X P *p lp\?07/ @   B.0+ d Wh@ P+ # P * p?07/ @   HB0d /  + #h@ P+  P *H Dp4?07/ @    /;PWJP : JP7 PG:   P d `pP>07/ @p   m[ : A0  +/+  dg@ P+ p P*P p?07/p @P :   GP JP'  P:   P  p>07/ ~@p    ]$J  t !nʞ )d 0+ T. 5g@ P+  P*` p?07/p @   0+ P/d g@ Pc+  P*` p?07/p @    @0d 8/  + f@ P*+ $p  P * p>07/ @   @T +l 诟 R@@T    0d |fp P H P*P  05/  P*o ⨟O `_  @   P*  0 pPJ  P* PG   P 0p7/ p UF[B: 0@0d /  + f@ Pl+  P*`P\ pH?07/p @  $p p @? J [   + .d0 e@ P$+  P *P L`<>06/ @W   +L 蝟譟 @pW    g 0d ~eP P J P*P  0`8 6/ [2ꞙb$ V5U5E G!R/0 SP ZPsJP  P:   P  pp<07/ T|@p  y ꂘD Ԗ }P[? d 0+ / e@ Po+  P *\ X`H?06/ @   `V vP JAP*PPP d @+;\2P2 [ P* P?05/[ @V  A V6 Ub$   /;APJ P   P  p>07/ @    {> t>  n><.0+ d Nd@ Q ΔT d [b: P>0d -  + +d@ P+  P *h  dpT=07/ @   @돎 _ /pk 0P]J PV   P   <007/p[ @. 0  + dic@ P+ 5 P*P p?07/p @$p    P *t+\p R֐ 5F[V;+0P  [o@ P* p?07/[ @  c  if&  =@  =0 +/( (b@ PE(  P*P p>07/p @V5U5E   G!R/0 S^Q:.A b+ 'B  @ gh    /;?PJ$pQ*+\p    QH  %  Y; P  + /0d [b` P ' P * @||?04/ @  Z    $Q:ڌn. H qc * 9 P럎 ꯎ /@k0PkJ Pd   P p?07/p @0  /P;J P4 @   P  p?07/ @   DQ ;0 P y y@@.p p  + pda@ P+ U P * p?07/ @T  程k *V):0d PA  P P p  07/ @D@T    P*: k⨋>    /;P~J GQq!0R1@C + `* 0 d `p P[   P *h PTT>05/ @  T5 ` P@  > : t ރ =[: :@  :0d/ P2`@ PP o P*P p?07/p @   / ?P J +R :  @P  P  p?07/ @p   / ?P Ja +R :   P H p?07/ @p   ꏎ o 0JPk J) +R ] :   P , (p?07/ @  `ꌂf( ł7[:d 0+ . _@ P& +  P*\PX pD>07/p @   0+ /d _@ P + ^ P * `x?06/ @    P *+\  ꦁh @    P *0d D_` P   P*@  04/ ꢀd VT    /; P} J Pv    P   p ?07/ @   9+/0+ d ^@ PB +  P * p?07/ @   8`/0+ d ^@ P + x P * p?07/ @   8@  8P  80/ P+ d8 ^}}[: y8@  r8P  k80 / P2PD^@ P P  P * p>07/ @    /; Pp Zw | q|P@ T@ Pd P   P *  p=07/ @  = J{ {[h*o`/[? $p00+ H0Gd]cP( P P# +  P * p?07/ @ $@+   P *xP  *z zd @      P *`DpV V#0b l]Z@ @P JpcW  T dg 0Z]P JpcW z^yU wQx@ P   P * @?007/ @  ffZ8~p4 P :e eId0@0PEZ  Q` P ' P *  0@4/ @0U  `0` PP  P*p 0@X4/ d adQ=* Pv:  @  P  p>07/ @    /Z# PE:   P D @p0>07/ @  -+ d0 mp`m$p`✻:McX pJ  }p࠽P  bX 0@0PE X  ` P [ P *p 0@X4/ @0U  `0` PP  5 P* 0@4/ aax ` `V  P x tpd>07/ @   Q A 0+ B 0/1+ Q+o ) )@;  A+x PbJ@ P *\  XpH=07/ P@T[⨛*U):d ap   P p@  04/ `F@V  p P* [⨛x ^_$T*+\†   RJ  G^"^] E^Z]  Y: P @+ /0d uV` P A P *p p\\?07/ @  T @  @$KT:"] ]\;+#P [@ P*8 4p$?07/[ @  ,^\ \;+#Po [S@ P* px>07/[ @   [D [Z =[   /;P5J P)*FV5U5E!R/0 S P PpJPP P:   P P  Lp<=07/  }@p  ->Z ZX P:   P p  lp\<07/ @  ZD|p@ P 5Y0@0PEZ  B` P  P *  0@ 4/ @0U  `0` PP  P*$  0@ 4/ Zj Pk:  Q t  pp`:07/A GVL VrV4 UG  P L  Hp8907/ @   Q%( A;  h* C ;.+ Q+  ) )@;  A+PJ@ P *, (p807/ P@T[⨛:*U: d ap    P p@  04/ `F@V  p2 P*^U TZT TS\ SR`SPS>QSU  P  p607/ @  Q~t2y:@A+ 0;0r5F0+#.+ Q+c ) )@;  A+lPVJ@ P * p507/ P@T[⨛8*U:d ap x   P p@ H 04/ `F@V  p0 P* .Rl Q:Q Q<P mP` U  P P Lp<407/ @   Q A 0+ B 0-+ Q+ ) )@;  A+PJ@ P *4 0p 307/  @R+  P  p207/ @T  娻⬋6*X):|d PA` d  P P `p 4 07/ @D@T  `. P* 㬋⨻= PZOX5  P ` \pL107/ @   P: @+ m B +  @ dPߍ ۍm  M=NGl H}zF< FEм mEC =DzB< BxNA A@ 5Ab?$ ?u̽ yFE0 C*C @ @ :J J2H HL IM2L LJ IKI*=J "I` HO-M(`,@ P0i+P:J@ pQ pU `P` Q p\Q Q .QQ pG0`,@Q W UQQ.Q  R.p Q* p&@p .QQ R * P005/ Bw ЍQ pWpG($ $0 0.; A<Z;;;O-M`P@V:"pP D @020@ @0 0XZ(?$ $0 0NV))~.)b)n) A-P`IpU, VX 0V@P`. Q p`0V7@0@3&b`7@`` V0@3```@V@ õg 0 0(a(N(/ȝo/a객///LO-\M.L%)$B%H # X "  I JE  @X:M @F(#W &!92TLpf @ Pc*&p `  ppJ@ p p ` %k  A%`Y "D2 & 0+LpPW;` @& @pG @@ DZ @"H2 & 0 LpPW `&x pG ` `@A[ @!M2 & 0KpPWa`X Q\Ѝg `&Q pG ` ` @1HS   @XYZ[ `` P` S2 &Kp @P* P&' P ``@RP t  l00P ppWJppppAE ͉%5` i h H-p@`ӺPP(U  E PE Aq 0 .S R:0pS\WR: S\R   . A-MMx`P$`@P J$PJHoBPЍۍTft p@-RPP4p@`PP  p@p@-RPPp@q`PP j p@0H-@PtP  0Hp@-Q P@J`P ޿pP > p@P0H-P @PP :Q QP h0賿0H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0<00H-P @PP  D`P @0!0  $ O-M-M`@pt@PRP P P P0 0 00 0 |@x@D`@P DQ:*T T T 3+T -T/@T 0T+ xQdP 0 ` Cp t0`p3o` P t R h5qtrp xh0jw@0T @0H Q40, 8<00 Q ! 0B ``0 H R *Q! 00B0 pX R `PPU `R ` d@0X X' @ Q ` (p` I0X  ` PP0X  1`H Vp`(3*0H P+0X  ^P a P p0 aPp PPU   `P0P Ѐℰ (p(ppEWO@VR $```P+X -XP``0pH W 0X ``0^ `F0T㄰1pNWppDP0NP 0pE W q0PH0N UP:L$`DpLO^^pWDpDW$`i <V :VP p@ PQ U S/ !R a@ p0K\ IRk80TW (PV IH%PS@DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD UpP$ @LpPG0K\@pI8V/W WW&`Z` @@DX ` Z` ЍЍ@8w `Z`@ o% fW_ F$``4 R Z , R,[V<'P / ! a0+\ PUG MU4 P  V:_&B`PP `T@  a0+\ v, )pfP $/ ! 0K\ P 'U,   vWn'Rj `|/, ` ^P   a0K\  , 0 $ >oP# `iy<@ P(PT$pP4` 0, @P ˟۟P4 | Pw q pDp p0 pUp0P D0!  + PhsPt p}qP P,lh p@@0(6 boO0PPS o`FO B S060000L@`C`$0@@0C X ``V`Q qP JqP PNptPPHQ1r@PD Pt@D Qzq P JQr8 P{8DQ @r4` 0Pp4`D rPP  r<0Qp^P nI C X /GJ `O`A A5?55?pg nK  KNN @ `   Q @,P |G@PR<B0k2@DB@ @0 0%Y(C$ $0 0Y-pp@-@Pᒳ@ <`?U  s@ p@f p@-P@㋨Pu`Pu` V P@`p@-@P j `@٨6 0 0±0bnH-M ? ЍG-MP`0YP @V   0 #P p\ 0 PRЍpЍ 0 0eO-MM⤃p`0WXQ0 `Z Z \AP /r. 0ģPP 0 <Ppఀ Y  .YQ  .Q P.PE :Y  :㐣P:YY   :Y.Y Y Ⰰ  P.P$`Q,P(@$ `ݬ!1q 0 p 똁Q0!QMߍXLT` t:Q0p Xk ` @CTXac:  K P# `X `@D Xa噬0PTM:  ` X  D V(@$ B 0 00Xc  c ` [ R%1[ (a K-M@`p4'P P0 0@@/ЍЍK- Mp`PPQ HWV W /@W 0P 0S+ R)PP( p@P 0 0D@@ @9Q  Ѝ辱@ Ѝp P`pP P  0 0u8X Z"X O-$MM`[   PM Pip0" pm<P^ pေPX ` 0p@?pY--  0`hXT P p@GP9p  PU R QB]"|q`@Pp 0 D<P `V *PEu($ҚP n  $Q$Ѝۍ"Wa* @$ QQ    0 0@M\] eiZA-HM@@PTD@ `P(P9P$  .0A P p``0 U  AQ   PU D QHЍV  0 0PZ i ``_fkO-,MP@Pp P(p `Pu  0p# `Pa p  0 pPQ  P  +@P  $PEP ` @ Q 0 ?O@0 B`PP PP-BM2@0 m2N 0g` RP` pI G,ЍP P PP4QP% ` ` P P P Z: QP8 J `/`P  R @*P@`  B `JR:BT a  @Hҩ@T*P@` F@I@ V Y @@ aᵩPX:  3H@Z` P k!czhK-MP@PH Q `Q6 P( pAP" P  0p`㺻p   0P)s<X  `P`P`e `Ѝ\%` 0 0Z0=O-KMM`Lp`Y@( TUV W8\WP(kP H` XXe`zDp@PpP\P p0  LPJ@P @1/P L RDP4 D0HpP pLPT0 p0`*Pp@TT$P R*<@@D ppP0@J`D4@8PooLPPHP<@4 P$ L@1/LP `8 <@ P,HPOpL@IP RLT+GoTe<@( P%,P8'0  JPzJ@ 0p@'1/Pj (LPXP `V*L#0pHP<@D PWA DWlWW6P 0%  P @P FL`@ `-P2@'@pG$P.`P+' P巗TL0pHP<@( ,P8'0  `P J@ 0p'P (P'P@ GT'⅗PL( @LGHPP0Q@D`0`% @ ( L0p P/W ,P,P,p 4@0pP@姧@$ Q*RX*,@$   LHP@wL0pHP( J WfHP50P0p % SL( 88G, I@PEJ` ZP= ,(LPW4P7  Q : `  P+ A`L ",L HP<@ZDTB8R?*0` @G p@@D`PZ3, L T``P@L( 44L0pHP( WSPL C@L4 PLL04P `$dPV:4QSDQP4 Pp b00pS QhAlQPT  V Q S PRQ& 4Q#P@4Q Q0 p `Pڲ@0pG`0CPW@ P P0 `TUP `ሦPO@ JTJ `   @} F @JQ* HA@   `m$ 00APBJ@ Q*^`(P KߍۍRP0從.\X X0 0ID@ @0 0@ER e|R 4I I G ̉@G O-MPp@PA Wp W (D`P  ` `P ` P P P ` P P`dP @ @oᠢ@P 0P Q : P  A  ` `ZNTY ` P%H`Q* P  @`~P ` `!P#XN#`P  R:0 BpC0R*8 ڪ/ ߍB@Xp` `pP R?ጝ APJ@XPp`Z*PP EqU@ X@JPqߤ`Z: ]JAP@[ PP4^0 00 0ب `~ sNSH-MP@P5 `PppWP' pp ᗤ0 U   Q  oP U ЍЍ  0 0f|FlFXFp@-M@P`,0)(0 ЍpPE\E@-M@ 9  ЍEEH-M@PpP P0`L0 @ЍЍDD0H-M@@Ttfl@@T `PPP @D  9@Ѝ0Ѝ0dTHD DO-MP`PZ Ud ^n P P Ѝ   Q `!1 0p N@gQ3I[ Y @OO@ QM 0 @pȧ$1 !0 YN @pṧ00 Ѝ6 @|0 0धU`a\ @X0 0^<b8 @40 0OfNY!O-$M$T@QP  Y T# T P $ЍO/pI#3 0QYJ#3 0GTX Y `Pp V @ :V:PHCPD@ p  P  P  W*@p `V:VKW Pq pPTp p P FW @pT?@RpP: @ P+ T: DQ(Q:  0 pSpDS=  pBA 0W0@ GQ .V@TQpP pTp ` @`QP P$Ѝ]N8QpPQpP FPpPpP 0p`C0`V p5W1:PPpD`0*g0S G*BQ`\ \0 0vY2D@ @0 0l)L; @L2Hxƛ?uHu89 8 7 x8 8 H8 A-MPPY Xa @ `Ѝ  00T @ xP `9T pP 0D P p@qp` 0D P:.T Q*p@p`ЍT @ A Q  ` V3VX  0ЍDm@ @0 0X(n$ $0 0vFXH7 O-|MV`@QPx$ V, T4 TYm Vu 0p`&: N2P P*: 5QN/K`IH%5 0ࣥVI%5 0TYM V`R P 0 @ @@Pp`0SwpQ 0 0P o0RQ P Q s `pooPpbp0Ps0$ R q `pooPpæbpPq  (0S 0r `pooPpæbp Pr00 ,Q s `pooPpæbp0Ps00 R q `pooPpæbpPq  40 S r p0oP0çr0 Ppro0Pr00Pr S  UrpJP.` Y:ZC y Z ZZ @TX*Z:YW W P,P4P P 1@F" 51P9P7P 0 p!: $1P% FP"*: kPy [P*:Q* JAP `J 4QP`QPxP|ЍLh 0 0RVi 0 0Hxt t0 0?`\ \0 064 JEzi@A6[s?Oc/ 8/ O-MpP@PL P㡚(Y$ `V$ V, VT1 + 09/p ! 0XQ <X5w1P`PpPPpPTP^PpwP`pPP 4Y  HP P   PL U PP  Z   09/ pt 0 0P@%0,RP <X8 0< BS0 @X0 pP  U 0 U  EPA0u0qPP @P  TLa? 9/p 0 P @ P U 6 ^PP'*-P PЍ 0`9/p 0P @ P 0 P $Z@ڙPtGp p0 0d` `0 0ย@< <0 0ଢꊸ2. <- f6hO-MP@pP U ` p@Z xX]pZ@[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ EPZ  {@pppZ@> @V[; pP6 p @ W)  0WPpp_oWWRUPU U@@ U@U @ U UQpPPp W ᪝@@P@ ЍɘЍh 0 0ୡꫴߴu.bp@-`@PP T$ 0 0GFp 0ap``@ )TP%pD6@ @0 0}T(7$ $0 0s-`-8>H-M  2/Ѝ/p@-M@PP T( `P P P 2/`  2/P `ЍpD@ @0 02T($ $0 0(O!'jop@-M@PP T( `P P P 2/`  2/P `ЍpD@ @0 0T($ $0 0O!'~0H-@PP T P P P0 0 0H/D@ @0 0࿠T($ $0 0ൠꃱU[ȱ<0H-@PP T P P P0 0 0H/D@ @0 0T($ $0 0귰.p@-M@PP T( `P P P 2/`  2/P `ЍpD@ @0 0LT($ $0 0B귯F8p@-M@PP T( `P P P 2/`  2/P `ЍpD%@ @0 0 T(&$ $0 0귮S+6p@-M@PP T( `P P P 2/`  2/P `ЍpDE@ @0 0̟T(F$ $0 0Ÿ귭tLap@-M@PP T( `P P P 2/`  2/P `ЍpDY@ @0 0T(e$ $0 0귬W`p@-M@PP T( `P P P 2/`  2/P `ЍpDa@ @0 0LT($ $0 0B귫pp@-M@PP T( `P P P 2/`  2/P `ЍpD@ @0 0 T(i$ $0 0귪}p@-M@PP# T+ `U1 P P P 2/P `` 2/P `ЍpЍphd d0 0ɞTLqH H0 0࿞40 00 0ඞꫩ}|_1p@-M@PP# T+ `U1 P P P 2/P `` 2/P `ЍpЍphd d0 0zTLH H0 0p40 00 0goAG`w{#zp@-M@PP$ T, `P P PQ 2/`  2/P P`ЍpD@ @0 0*T($ $0 0 /T,p@-M@PP T( `P P P 2/`  2/P `ЍpD@ @0 0T( $ $0 0/^6dA-`p@P1 V, W5 PPeP P# P  03/P U 0  03/P U  0 A/@*< <0 0(#$ $0 0$ǤwtZTOK-M`@PPb Tj Vr Ux V P P PN 2/PG  2/P; p` WP5"P P P.W$ X`P  dV QP`*```X " ```Ѝ^ 0 0T_ 0 0 V&| |0 0hd d0 0V~LH H0 0uע̣ߣc5;6H0H-@PP T  ;0HFD@ @0 0ƜT($ $0 0༜꟡ qwdH-M`@pPP= WE TM VU U] We P P P) 2/P"  2/P  R Q  R 0S R 2/ЍЍ 0 0gW 0 0]T 0 0SV 0 0IUtp p0 0?WX T T0 05#qxӟI^!BU[G-MPPb Zj @T `TYL `pT T T<` 2/oP 8 2/P* `P-V+@T T! T$! pY@@P p  pTPW  ppp pЍxxgpD/@ @0 0ఛZ($ $0 0ছGʞk0H-@PP T (#0HnD?@ @0 0T( $ $0 0ꫜb}:ϝH-MP@P3 U; `P* P P P p07/P  2/`` p 2/`P  2/P`ЍDW@ @0 06U($ $0 0,_&17H-MP@P3 U; `P* P P P p07/P  2/`` p 2/`P  2/P`ЍD{@ @0 0U($ $0 0ٚ~ʛ0H-@PP T 0HND@ @0 0࿚T($ $0 0൚ꃙsU~[K;0H-@PP T 0H}D@ @0 0T($ $0 0}˘ƚ0H-@PP T 0HD@ @0 0wT($ $0 0mck5};C0H-@PP T 0H5D@ @0 0ST($ $0 0Iӗ|Ù@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /P  /( /0//0/O- MPU \\ U*P0@ P*.000@p@P PAS0P1!0 P*@P3AUL  ` P%XPJ P*X:p0 h# I %PJ Z*GWppKPP` !0# I S`P"0E:SGp10 Sj*P`FVR!0E^S#:0 S]*)0@c jdp㌑ #FWh#6u00q pE\x@dwpP00uPp P:*PPt` 0 I $P*J Z'* I0 $PJ P*p\PUPR .  P*  @ Ѝ̙( ЍƙꙕȺDI:0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  P sQp P ߌPQ ` ׌P Ed @ F!p W`` X*p@];P LQxQp   (@QP2 U1*@0/R# ]R* PbS````  P0R| z ^x@T " @` Vh* Uf* 0pS P[  `N]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Qɘ(Ѝ RЍQ X* H Q@(@㯘@꬘ 68d8A-R8P0U9  0 PU. U'*PP`@V VAU`PVQ!P`V*UPPE`Upw`VJ@@@@@`h(C H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PPQ!P0[0Z1*`   Q*?0 0P `T@@X`V(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pTq!pp P SP@ P@(TYTpQX @QUAPT Pq!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$AK^AL 2P 2 \p R$ PR@PJ@p P-*@ "(`W(p@LpPP Q* H P(P}  ( up2 XY)(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P pPP Pލ =L H-BMhp`@P 0p(p  0!QBߍ< Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H-Q 0S AQ:Q B胖ꀖ(G-@pTWo᠂P` P0 P1*T`P &zP@pTWSP(H-@QSP`p R zPpGP`W@A-PA@T  )QQ* (Ap`PJPQ`@ ?@-Q 0SAQ:Q @(@@ MH-M  wЍH Ѝ/@-M@ ip TЍЍH-R0Sb 000S 0s 00 O-M`PP U @ E @"PXЍpP+W -W p0W xP `0W`U`0@ Qa@"Q#K*@`pQZQYVeZUP@@D"ep00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRA@pX QЍA@Q? 0 0sx~A6gO-MS \ Z@Y@@`ЍpP0Q  ƇUAp/W mNP%p@ BP@UT@p`*VJV:@V@3D    @ZP @`@V P@ 0 0,}`}H-`p@P᠉ 0P0H-x@x@P dd>X,PP P P0P E@0/ X h|/L/ /< 0H-@Pj 0HH-`p@Fh dPZ W  '!8 0LP HF  TG-CMr@PTp, U @ PO  `0P!0D 20|" 00M@P5`P A:@P+ P4P1 (", 0 P',P! P  03/$P QFP  @,PCލ9p! l UP H! !<1P f!0` B` !1 0 o@P ( R $2/P ēQ 0 0UH~D D0 0UU,( (0 0L xyyxxV-- {`{Ԋ H ,|,\,@,ԉ , O-M@PV q1 p0tR0PD XQTaTqPP`LpH X0*P ~   o h a Z ЍO 0 0hvwvz^xIǝygxRx>xwH-@PQ pP P`dqpP( D` PV:4 ` bP  pdP q0G0 PP Q `ApP V pdE 0 0 uuGu)(()(((`(O-TM`R  xY X pPY P Fp|,pspQ @T PQ$$@$ <( \TQ "$0 $( 0G 0" lPM ZR P@p@ [J VAQ@@0XT" PNPQ 0 400>P  P QII0S | 3/@x Q@Z@X3PtpP <$Q(( AWpTЍl&h h0 0+TaP P0 0 X&8b4 40 0pnq&r.rJqrr"qqrx  '&t &Ą &&4 <&0&%% x d$`$O-Md{\ p D@ D 420S$wPq QPP! ``V*AT pW W P P U \pXppHDQPP `4p`W*V nP  R  2/P -U Z @@ 4JQ 0 0t@lЍX ]# #Ā x """"!!!x !`%)<#"mqr0Q#1'p0#2r pPnq3Rnq P V: PD P@!gQ VQH@, 0 V V4* P `@\oIHP% V&: P+x V,:E)@P"d cspgG'v2br r#18?Oc0Q ?H@ 0 V*P `@\/ H@, 0  V*P `@\ B/H@Q 0@ P ,0  Vs*Po `@\H@, 0  V[*PW `@\H@, 0  V@*P< `@\PH@AIIP(@!, 0  V*P `@\H@ `P IIP@!, 0 \ V*P `@\w$RE)PP"d cspgW'v2brpwY1(/Oc QTdp=H@ 0-V$*P  `@Q` PJ @p Po P V*Q `R`p=P8 V8:$ H@, 0  V*P `@\ H@D,  0 Vn*Pj `@\H@,  (0 VT*PP `@\H@,  0 V;*P7 `@\ B+H@Q 0@ P , 0{ V*P `@\H@, 0 b V*P `@\} V* 7 V* P$Q `\h$C  apH @0 D pX \0)2@  V*P `@\D V*  V> H@D9 P 0 V*P `@\# 0 {`H@8  0 V*P~ `@\$ HH0 U`HPPa)pEQ"d aq0cw#6aq r1OcPd PBJH  `@p *` Jd @JG*@ sp/ JdP `*` @JG*@ !   p P$ /1 $8 V*Q `\P d0p"sgb {tgYP#c  sqRdP d0p"sgb {tgY#brpwP@dp 5H@ 0+V:*P6 `@Q`0 $ V*Q `\3$h V*Q `\%1x0OQR0d Br V*- Q 0` V 18 ?OQW dpGw V*- Q 0` V $ Va*Q] `\18R?OdAP3QH@ aB0  VD*P@ `@\Qd@RQ PH@H3`B 0 V'*P# `@\EhW  PCdpG; w9ʠ V|*-Qv 0`Vq o hugUg |2Q 0 Q!00C -Bo R `V*02R,0 R `W`H@HR2/3 !Q1IP2aB%d   , <0 V*P `@\0%4"4# `81H@ W0 pgBp V*P `@\`0H@ W0 pgBp V*P} `@\ `w `xP|Ѝ0?ib  '  [ 8 o2W 3_ #;{ 4VH O-M`Ppw@P@@'o 0᠂@P勊 @0` p p P P@Ew @s"SЍp O-MP`p9@P\@@&o 0᠂@u`M   80 p@pP `@F: @6"Ѝx P/D P/y( d P/rc @-0Sm& h@T@R @0S\  H-\ m60 R0\pP/@-@@;@8$c O-M@PQ(oP `sP:  eP p/PpP ZP:PPnP U SPP ЍT SPTdoLSPP @SsP:$ dP`/P `4PJp@P:P 3s@pP$P U  P h` VP-h0@Z(R P| 2"0r pWW( `V&-PmF0lh0@  X h l b R(Q `V(Q# `V d-h0@1P AU @ @A0 0c 00S5Q `V Z 3N  Ѝr`}WWW m  X ( R t1Q0!Md  b GZP`O 0 h )' 0 Z0v @0pZpppW 0 P 0 !P RԆ P0UP .0@"0pZp S  Ѝ  1hOW MA-(qP@pP PP ```3`P P @PP@ ox 0PT PP `@P < dL|U hU PV 2L4`U p@-P@P `PG@``\Po_@ 0@V ppܯ JlT XT T p@-`@P<0@0@ _ Ph(pdT 0J0H-8P@P O P0Th.(0\Jp@-P@PP P`P ,P`0`  Ph(pcP `4bP Ip S /pddS /IH-pT@P``@P0P P Th.(R /H0H-`P@`P =P'pP X`-p0p P tTh.(P p4P dH R `.\Q T.Hdp@-PP @PG@P` @obx  R l0 ``TP 0 dP`T0~pܫ P P P -lF,P @-@P < 00$$  0@<dP ,LF@-Q @ R 800$$  0@O ,dEP 0H-PP@ ,,  0 0H,O +`EO-M0pW0S PP ( 0/ @/P `(p< 0 @/`P (p- Y,JZ% Q⪃P-@.$Plh^0@@@0S0`Va```V0` 0p@`cp0Pߍs*YV$`/mFh  PQ 0 V 0 0PX V P/P1o$PP   0H @/P/ 0; @/P  /mFo 0h$Pb `Tp(`(pTp@` H-0M@$ P b`0 Fp 00 0p$ TP 0 RJ 0 eJc0*e DJC*D0ЍpK ' A0H-X \ @LA@RP pR_# # r0ȥT0pC-@PP `P`@P$`Po|P X0" Q ЀA B0T 0p@T_V p (?I I DI H- R`00B `Pp^p C0@S0@/_!`!PuTJ?T &p%S00S^G-H`pP 0@ypP p@0P3P! Q` A ؀@`R ` A@Qp ?o$P$`vWJT`@ `XA`(P)``Q`Q``R@( H P=G 8G O-MFM<  P`P 0 .: a Lp:Pp/P q~PS  ^~P ?P%/P B/P A/ .P P `.P`.P0.PP./UV0S/SP ߍFۍ(/R 3l` ?P Pn oB ` E`*up@@㘵`UVJP& ㊵,P @ᣵ Lo n,phmP-,$wyP@zu wHTWv`p{@7x$wp q@d r(sp$F umPa ns($o0 te@4 fP1(H$g i@Tp~TQ p($j@ k@$!W2SV(pJ V H^^\J}^ZQXJ QVRTJ RRUPJ UNp8  @'"4p@p +"  ,@W@KOoB $P@ 0@ 0:0@@ /(P [z:|8PPvUU"L^D@` 0Pm0 ` P$ Lp0 P q ^@? P[@uP `updH@DAğ`pudH@h d `VHh ta pDD'DHpRp BLpaP`pV p T  ppB 0 P$  0PpW L@np0L0 R`0Vʬ$L V"0@ Pp`sX$ $!R   RL0R  p0 W`0@`T0PL pW W*0p0PL05hn30000Q1 : P0` a`V E0PW0 WLh> 0S^p`H0 P IP4 `SpJ Q  [p 0Qp@QP4( Ϡ0Qp@QP4( 84 0 S(8 4 P$D%̂  P@P0P Pt($ ^ K0PVH0 Y P 0씟A L 0P ,0pq P 80S 0S,pS01 00P U 0SS0PJᗳ@:ᐳZ Z䓟 <@ QP PAP QLQP  L P L P?Lh` PHpY.Hl[pAhP p{P p[ pgD@iX@Lh  rD@` NX KTZ yLH PL0.@ 0p0pWL00@P L0 ^ BLpX Lp0p P0@U0P@!0P`0^0@pW& P 1L @0`P2VР`F0C T 20@/%o0% RJPL !! R }PLH`嬐V PLph `V@00!@PLP$  0 {s?sT@,  ؗ T H Ԙ 8 O-tM@PQ <Q ` R >R `0 A R+A"Q#:Q`@PFpQpP hT pQ0Wph 0 bQ CX 00p఑@Q <Q)  R >R, pplt` @h@ qPpPY @  q P 0 A R+A"Q#:Q @IQq<Q400 ,Q;QdpAl\ R;P,P\XPW ,QTDPO PLp p 8倾 l0@bGOl0 p0dpET.Ao@$  /.p. pWJ80<0S00@@vS00(0 lPptЍ(@ q?Op@;P7&0^0QQQQpO-MR`Xp0" Q A B@pT pQ0 T  P< 0 0@<倁@ 0u`.LHn౪lW@RG8?hgBh/ B  -) ,* -CR BབkCBx/ (( BSw?*f 0|up)` O0Pza`ou."b@(97dd 0^%.0`Q^[/!@ `@ *),8"L\?H\_UO!Q8 5@!.+N 0#q"!? 0U(<2@0:.+NQ( %@!".  pCP  @  3(@PMSK@P@ᠯmP2 ʏpYPyd 0^'.0@Q^@Pyc p0 y Ot@.0t@P[p{}P{c p0 { ot`.0tvl[ & &J/0 !!0@ [!iIIQ p@A!AP{d 0;^(.0@A3^zTЍp{d 0'O"^@D.0^ pI>@HII%Q 咓cAs AB@  @C0p 0R00p Z *) 8L\?H#" # N Q @ ao"!/\O P( @  : NQ @  "2p C>! Q  @ 3l0 0W ` ` @ 1pG@W$`  @Ѝ, H-Wm<~ xmH-4 0P HPYO-M4 0  $  ` ,0Q H1R/@"b1Cs@T<0$0< 0s `0QDO s* *BS D/PB l?H?U^^^^l^O-MPtll\qpW9 PL@  `U P P#Q P  1/1/Y Pp `PW:#W*`@@pW@xxp A `PT PU@Ѝ^^^^]]]]\]\\\\0H-@P!  B0S0S A#q"P lPh  P4PL0 0 0sH\\\\\[O-sM8`pQ  W% [- v5@PA$Q QKOtVO | 0p`FdQ`Q\Qqpqaxa$pPtPp p0 0s[XQT T0 0sv$uT!Qsߍ4l :CNH-M0 0 Ѝk MH- M 0 0   ЍHЍ/k H-MЍH-|pPpX@i`P`u`pPu` V XXP\`Cjk P  `0Q`0pp0Qp \ X0X /X?Hk MH-M   X~ЍH Ѝ/j MH-M00 0 XЍHЍ/|j O-M@`S; p!!WVP Yj Z7 riP pU6@Q mtT @S -P[p IxopCi9=!1 0rQ 0 0rW  gpG-PP  fZ0@  ipiI5opЍ84 40 0lrnperJpzoMH-M  0 ЍHЍ/MH-M 0 00qЍHЍ/H-M@PP6 ,pP- `{^P) @!PJP$spp  00`|pp@ p$0(,   0jpЍ> 0 0rv0g f f /? 0Rgx`/? 0Ggx`P/? 0:gx`/? 0/gx&/? 0$gu/? 0gx`P8 @RIR?P00 =:X@VI QS YP^x`K D T@X/ P:V Q Yx`P .> 0fx`X@X@lh.h> 0fx`| .> 0fx`Q8T D@@Q@PQ  KmQ0x`D@T@D@0D@T0CX@@0@SDP XP@R X :V Q 8YP D @-@= 0XfQ XP0 `CV`VR`:xP Q x YP G` ;O| x,x< 0#fQ XTP@Px`P#4< R00 ?:V\? QH X P w0 `?OE UP  R :V Q XP   ( $+$; 0e04 +; 0eQ 0 \"?aNPXZ\\h0lpPt@Xt@ 0( Q %F/0 :V P TXPlx`lL )9 0oePlwo M3LD (8 0Xex`Q  0sZcsڬ8R00::V< PF  XPx`>D T@0 R :V Q Wx`P  0 '7 0ex`( G'7 0dx`Pl<\ P@@T@TQ:V P WP:x`J@0,',7 0dx`P ER?RhP6P00 4:V Q D T@& P:V Q \Wx`P $ & 6 0ydx`hPLI WGWpP%P ?:tVZ dpQF &WP> pD Tp%@ P:V Q  WP O%5 0'dtpPQ tQ V VPmLp#$4 0dP\X$X4 0c8 $4 0cx`E x` p x` dpWF cFP V VP夓 dppPU ᶡ@pPP Pߍۍd pPPGe p쑟 x`Lp 꼒 dpx`ꬒP dp꼑 dppPx`ꠑ` pdpPꈒ @ ` @< dp葟 dpx`/QE3 0 0gc[ 0 0]ck E 0 0Qc ?D!1 0EcPov DHd[}D -D]51gf- $, p+  0- + + B!=$ C; - ;( GB SuB!A+M@( K> >+ [}=`+ #: 94 Wy7, + ;]8 7+ 77, 74, H-`@PpjY 0T@YO-,MPPp(( @00 @pWP  %Pp R *` A 0`B0 @ R :$Pnp `BZVU AL L L L L L L L lL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L hL L `0L 8 L L L @*P2 0 @ p R0 @ R:}`0A P2@!`0A P:$Q?V*:vi @@@ca [ YWU`0A P:!p`0A P:$QJV1:O$Q@V :  p00p (Vp^7*^ :  `00p (^ $QV :(  00po (Vp(^*^ :( `00pV (^ p(^*^ : @`00p8 ( ^*^ : @`00p$ ( !^     c^*^ : @`i00p (^*^ : @`V00p ( L : K \  ^*^ : @`700p (   , = ^b*^ : @`00p ( ^O*^ : @`00p ( ^<*^ : @`00p ( ^)*^ : @`00py ( ^*^ : @`00pd (^*^ : @`00pQ (  e ~  @ ^*^:^*^ : @`00p( ( ^*^ : @`y00p ( o^*^ : @`f00p ( \P^*^ : @`O00p ( E^*^*$^~*^ : @`400p ( *^k* ^: @` 00p (^A^R*^ : @`00p ( !^(^9*^*^1*^ : @`00p ( [^* ^*^*^: @`^*^*[*(@PTTX :ȗPI ``X:  00P0( !R0!hhhh0 P0pp00 0 P (@P(@?,Ѝ@H-R R RT 0p Sppa r A`PqQPBVS0U0 P0a0p , ,L"!1@00a$gF fFF PU:PR0^Ba/a`E0p`pf pSW Ua0`V0_K-MP`pV`U @o`@m`Q Ѝ p@``@^`P Z`@ᱜV`@Ѝ g*g @*@Fj_`ЍG--@ VP P(0,&/O0dL &  */O ( Q!UPUpppP `UG%_ P Gr`GWP  !G@Q@W"Ppu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P:  ^`%O-M-HM<Px `@0pP P> P@ P0p0Qq   JG R    @ P qWp0    HЍЍO0p00W0H @D40nP *ʠ* Q0  L D @0OSA$  8AC@ 0+QA 0p1+A; q+ `+b p r a @  0C  AR00 `0BBD (q`a`pS$@Jp`Fc U@PU  BU@PR80, ` p 4X8\<`P<Q<`P<`CP/ 4, [o Q Ѡ 8V \   !,H "\ = l0 "Q h( "2-  pQ0   `t   Q T-0  pS  +a Q:a  ZVQ@L ` @ Q +`q1 R %B1 B +PP$ ;P+  ;r p0a :Z0&(p$`yPD?aCoc?`(?+ pa @ (p@$` ; p@  b0  Q + ` ; p@ *0 P+;qc $.+QA;KraK#JP$ `@ Ka0 pa Za@a Z (p$`H ora ZPUPE0P 8@(p$`@P%J\#ʜ (p$` <pQ* A + ++`b+x@+;pc+NAB000@@+\ RJ " BQ D3$6PaQPwP @ P@QJ ``1P8@ P 0TRT B@DPES Q" P 0MP p0Q0p, R[ [ r``P0zpP  P  Ql P 0p,Q!4QX QI o  pQ ` `  `P:@0P @ <P8T; ZZ 3P0P @QP PPN [  PF  P**0P/(p$`Pp9Q^018E808U0PWPpR0P PP' T`q P[ HЍЍ,P,P0P@PJ ` (pP$`8pPP`@0p0EP0PV 0  0P `FP  0P 8@8P    PYP p! NP 0@Px` x@P~ p4PQ @P<@ 0@PY`0,[ @o <4PJ,P P PP,PeQ `[XE4   P3 @  0@Z Y'   P0 Y  0@` @ HPpP 48 Q0@ (pQ$`A 0fP 0 P18 04(p$` PUPE0P z(p$`@3꽫|Q? [=DP 0 P2/ 9Y 1*9Y(p9$`E'% 8 0@u9QS1 8 @P ?<P1EQ 9Y 1E p@E,@ `   , L  H-MP`@ZpVU!PPP Q:RJP PZpЍZPTPRR:S S/*/*/0H-@PP:P PQvPP@0H-P`@Rp:ppP_P p@Q   R@U0 12 O- MP QepB`  @ cU T@-P 0@` `0V00R@P @ `PA ` P @PQ@JP@PP J0 `P` 0`PU0P0W Q @ PQ@J P ЍH-ɖA-RM(P@XD@, ` ( L 0 P ` B` YYH-H-p@-`@P PV P PVP*`P  \Lp? 0 0Wꢕ֕p@-@P SP `P  lPC@@`V pBW>l PlG D IpD h 08@@m {k Y. DP ``,($@˰ ۶7l R0 @YU"[l xTR Tl ЍЍ`W Lt r hp n $@ P  ! Gl P lP Pl |倀@|H  P s P qQ ' Pa tlT  l  P`l W. pg P`l  Q `A@`TOW, `pPpF0 W* I4PI R `A@`pT*8@Pp@@ l|p|@@Il 1l Pl@ |p@|@@@<0 <PM4 | `P/0P, J+h  hb#J`#` y`ZT1D wPlg`@ @plHp|@P @@@PlT`d@P\@@@ T`\@dW U!WdU!4PW8@ R - P h P=U W2 0l rqR#*`v PB PUAU9E P49aQ `pY "@@U!@ 0"@PP!@  eP X!@@@ Q @Q rM"P@  P /K-`p@ R 9C P0Q @P*  YppA PI`V0 A P PUpGpHY pY @D` 0 @P @Tp`0H--M@PF  B ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A0PP@Q@@ P :Q```F `F`PU PPR*  T:  @ Q`Ap bpW CU P(PࠁNK0S " R10\  R/ R /@9+-A357A4013Aa 00A /ᐺA-`V 0K@R!0 R1*@Q c@`@6`V: `0S00CC X* 0# 0Q0!p1S`0F`C&11T&11210Q1:(`Q1!ppW a DX 0R: SA@-MQ @ R @P:@ {@ЍH- a@`P TQU  t㌂PU P xtPtPEQLUPP $Ӛ \dk k , 0H-P @!P:0HdPPQ T線L0!S A0,0H誚 ! A0| <  ط@-  #"!rQo"(r^2"$^@\""0"!0S    O-M?Y a_ pA pp\0[ `QY `H8P `! >!P : ᘇ6!P: ᒇ`3Q% 20!S  &PPQ `0!S  `h! Ѝ$`!   8h (  lP31P"0"11P 31P 31PA/A /0H-@PPP@0O-M` @R@` [P4 P[ PA@IZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` L P@P &Pq r&apW!RPP dqpW EP` pqpP K똡 猁PP$ fPG pT !P:ᅆQ )1 0RA   A@[ p`WP pW3P pPP HPQP LPЍ|4 H t h ̱ K-` rW WPl  V:RUPH0`! fP@VPPS5Q:UP)p`V AA Q*pV` `F`FP`pPp0p2V1 :0!q1P fPU @^pS:YL! !P: хlPPQ \qT0!S  4e$! d $   0P/00 R @A P/3/G-P pR 0!p`VpA BQPJ   pp3WAPAP0 /0A P`p`pPpVpp PpW: p P*`@``PVP@0@P T0:@ @R p@- P`03P@P3H1T"D1"1T 3B1T 3A1TJ  R @b@P SP b 0A5 S>0 R N+b S 1@2@@pK-- |P kQ Q*Q&V  KL&a@R% 0_G"!0Zv@T0Oo&8RspWB#4WB\@#2p@#1#pW. @`T+r0S`?o"hBvpW2&dWP2U0&bp0&apW" 0 `T @` `@  0 @ 0d302$`R` `Q 3$A5d# 0 @`` Q20DpQ031Q""11Q2 31Q 31QJ ```C R/  R/H-M@Pp U G@A$E ! 1 06FP3 ` @{P,JpQ Q( v|p   P U2P @`  hdP\  X00@ 0$( ,@ЍGGOOOĶ Ե |0H-@P x<P@PP<0= 0 0E*N@-@P P@@I 0 0EMMup@-`PPE aP rP wP9,/ < 0e@CT0APx5 S +S4 ; pFp> 0 0VELLLp@-@P; P3 ; P0 QQ p9P Q 1/pPӼ (0P @ P 00`aa-<`O` pF p8 0 0 EKK@-@P 0QQA ; 0 0DpKKa0H-@Pa P1P HkF @H0P @ P 0<PPP80  8P%P9 PPᖕIᑕ!$P  5/PP0 @ P0J 0 0vDIJ @-@P P@8; 0 0[DxII-H-M1?A EЍ0\ \ \6@@ GЍ6@@ IgЍ6@@ Ѝ  //O-OMPEYPwpPP @[Q    7zP EPEPE[ 0  p x|Z : `,DpP (8 4 ED[  yP P `X P  Q P4P PQ Q$Q4@X@P3 P!0! P$:qP 0 @, !P2#(0<  R5PX Q [0$4${P P"Ÿr b 2p `0P @XA/QX x123P7` 5 602 p37 $1$(1(,1,010414818<1<@1@ D03?D0 @Q>==0H-Q B0@P P4P  P 00ZP@0A0O-M@(0P!(P5R%p5Xaꇑ yP.  pؑ ` ' A ~pa|P (! !  PD  , U , 0 ЍOJiЍ@- 1@3/, (P0G-M4P Ha5 !0@ 02/%'()*+#,"-!. /'0&1%2$3+4*5)6(7/8.9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=@ J<` KC0P ``  LB 0P` 0 `P  MA` `0 0PP   N@`0`0 PP$ E O!0"`#&P`Fppp DPE@G``G`@Pp0`@Q0`A/ ep APP`P@U 8Q 0,`lP ލeAObA,ލ:O-MP@ ! `2/,V( o0Q 03 Py  @ᰀX]:@ `YTZ :FW eP*Z 0 pHoPy@oP1   0P @ `㲀VoY ) Q] QA0 |oP ;@ @P i R  Ѝ egP  zi P  UgP (@Y TP ( B  ($ @$@O-Mp`@S [2`p PW , P ` F P,  [?O@T {p r{@Ѝ 2$p( q"n(/@?=?P9?  P.P ` I.P pPx ` B<> / ~l*h h0 0n=aL L  , T H ؖ &2Z...H x 0H-@Q Pk/P 0>0A-M@`pQ PT/PW >PЍ P ` P r 0k"P!@ P )/P #/O-M ЍQh 012A3 4 HT*  R RP qY P?0@2? #P0ppp0P0@`@`  @ @p`Pp`P p 0P` 0pP`0  0@ 0@ @  0 0   00  00  @ 0ЍP] qQW P?0@2? #@@@`0pP`0Pp 0 P 0 p ` @0 p ` P @0b 0 0$<>)))O-M  QR @@T*  Rz RP qPY@ 0P p`<0P@0@P`  @ @`0Pp0P`p p 0P` 0pP`0  0@ 0@ @  0 0   00  00  @ 0ЍP. q PQ/ @% 0P 000`Pp@P`@p 0 P 0 p ` @0 p ` P @0012a3q Ѝb 0 0I;3#&W&]&p@-P@Q `[-`'`p" Y-p P "y P yP yay y p`P`pp@-MP@Q `$-`T <Ѝp & $   ,P b@!@ @ b b20 + @'@, -P Ѝp  Ѝp@-Rq0 @z;rspq pp @R*R/0Q:/H-Q  0 th\PD8,"0"0"0"0"0"0"0"^ O-MPR pW1 Pp.!8A@T p0oW#@a@T( vpP `uP TD}po@W ! q  px 000]  pWpW 0pp @)gPm0S  @!4q@Wj 0 Q  ![+ @p0@ | P"PP 0p @f@P4@ @  0S Z`a `o 2 &fPppZp Ѝ@< <0 09/($ $0 09kH-  0 A1à\1#!K-M`qWWЍ@P QwppW R T T  0efP U P 90wЍЍ 00 !     /p@-`m@p PV nop p:`n:`pA-CMHaP@`,4oQ b !P1 P00, P::?- $ m, Pp ,op  mp T %op  m `:@ mmX:@P,PCލh똁 !s?O-DMp` @@Q P*P XXwP 0S@PP%&:X(P :@ QDЍ- p ,0 0P(p4( 0S p $80 P8 ` 0<  PX  )P 1 0Bp7 0cPE )P0  0  0㰱A Qᴰ&:QQ @P*p P PJ   *~䱄 P[   *8  J Pi X0P  )]P        A Q *0  0  뀲P @TL0Qo*S* r  B 00  @ 0q P nj( PQP"!娱P P PR  P@U8*pQ!  ) X     P\ 㰰o ` 0 0bA7 0b| |0 067 b(( (0 0*7, z L} | ?A{  O-M`PQ @-)@ U U _P P @p0  P  P@@T *U*  P 4b0'07 06P@X(*@EPoR  P 0  p P@P@@T*   (U`b\&\6 06Db@&@6 06  Pf P PS8(8Ѝ  (P `P@U@*O@@P @ {( @P `QB k( 'O`P@@ 1  ApP@U*  P  F(X  P@U*   5(o".(, P$(Ue ZO 2! 'P| `pZ@@T*pP (뼡Zlbh#h3 05!Y0Z崀pIx !1  ' V'P= `W pG ' D'P+ `QNu P `@QZ>  'qWE  2! 'P `WP  'qW@ Y01崀 $b!1 0]5x ps' &P `P@U*奀Y崀p \'  &`Pb| |0 0,5  ~Ppbl l0 05db` `0 05   WwOo   _K   sO-M(p Q R Qn @P  zp   pp  E pP@  AR 0 1@`@V* $ / Aq R* q`{[@0 0SOJbcRa@HVMJD\ /0@S000A(@ Q R QAˁЍ ( EWT Z J   .P[ @@T*p P   Pi ZK @@T*p PQ P%P2 @ QPP  U&W㰡  갡    0yP((3   0ᰡ fP Ѝ(()Q %P @ @P@U<*  P  &(( ( ( % b 0 03db` `0 03aXbT T0 03l(b$ $0 03OU +1?syO- MPp,AT  2! 5%P T` @ !pA @Z*@ PP- P~P x b"2 0f3  p0@[   AR 0 1  6 `%I@ZG*% Aq R*  q{@ K@00SOJacRa@HVMJI\ /0@S000A@ )%P "%p pP$pPp Ѝ(b$ $0 02p@-@PQ x$P    $Q `i$P    $ppp@-M@P  0PЍ5 0 02GzO-MM`p@PV TUP WJGO PJ P4? F @Y:@/$P 4dP Ѝۍ @(XP>GIY*;F  @zYFG    U -gp JT$ khpD3P P p尀? 0'P P0PpPLhP* P3 /P HX*h/P   P 3{y8X4 40 01Gu3@oᠲjg g(g @-R@QPTP%&A-MĀ`|.P(p@h A  a@ *` @*@PT P T |PЍB$ %\d 8  H-(MQ@PDÂfPQ 寂`P" x @0PP   Jw Q p T(Ѝ fP& &`##-` 0p  `pgpeg`ZVeP ᾁ `P` @ A ` K-M⨑$P@ Q "PHp` A  a *` @*@W%@ V9  V. *]PHp` A0 a@ *` @*@ ` *a @*@ V V `  PЍd$$ $$ Ba x d  h O-TMP`PP @ApG[ B? *C"TCYK? PO[W*[   j` `$@Z*`@Z:P@d`   VUP``@P@p:Y `  G $@ @ @ Z PPTЍ 0 090Yxt t0 0/0`f\ \0 0&0[:D@ @0 00_ wOy+]Z^ O-M-M@|dd-{Ph(`P   ϊ  `@ *a A*Ap W:U l U >-T| PЍ Ѝ$ h] `  \ p@-(M|` P`$8 @T L T $P(Ѝp^ $ A\  d O-M @p P 0 QH  @ gu@` ᨰ P Aa0 a@ *a  @ aJaJ@ @*@n  " 0 =up.  P+ P@ p Y @  @`d h J  ` *`*@ D@ Pz (PЍ)0X[ Z A-(MⰀ@Pq$ p `kV | V $P(ЍD@ @0 0. $  Y @R O-M-MxP P@   @ @ J< T0PRpA?qRxy0 `zP p*`  *G Gϊ ` fP@ *e*G K   ϊ . a@ K f @O a @ e G   ϊ  e@ *d G*K  [ P2 `D *` @*@ZP F E P  C@P@eWPfdPЍ ЍQ/ X \@ @-@@~ $ @= ~x ~h H-@P`p$ % #*HGdO-dM(2e0bGpF,te kF @H Pp0 $@X@ @0,THL n$ #CP\PP`` 0 pPp "`X %Ha `h!TDfP"4e< 8`zXe' P %a8 #i @aX `\e<P@,i#d(nʌ dH,k a("i `a ``i *d,Tn "|fl'f8#afx.g@<AeP. p 0Q  A  @P    44  0 !@ogTP@` @g Ѝb 0 0)K-`pP@@UJ*QuQ P@UI* p 0 R0UC*@!pPpB W:* p 0 R0W4*    K 0 0)b 0 0)pbl l0 0{)pbl l0 0r)@b< <0 0i)-%CIA-P` @0@p00 P& P@p  A q   P!   @ 1  Cpp    ' *O-$MH`@@ T *P@U* t |p`w|Px*Lz^@'^{ 0 Rk* Rh ^  @p  pPUG*{QTPN    BR0!@d ` ! 0 @ ` ! 0P @ 0@ !` `@ !  "2 0e( @pJ@zP* H`0 ( QwP"!p R*@z^PP@w`|p VE*p@ w00@p`@ppv P- uV pP@PW@PTTTTTTTTTTTTp      W'ڰu Q$Ѝ 0 0' b 0 0' tp p0 0' dTP P0 0'(E*#W]rP$O-M@PQ `` UJ EP*(EpP:$DDPPN )p  0"p pP !0! 0v pP `UU U UV U, P P@`@V%*  p@W`&*  VP&*p  5  PPb&6 0' b&6 0&`@pbl&l6 0&, pP P@`@V*! s! 0`a 㴰0  bPPapbl%l5 0& pQpbI(pUK UP(P@[*zQCU,`Q U E  $P8 `ᴰUP@U*{Q t,b($(4 0p& pPP@U*pPq (PW @ⴡ`(`pW$Q`P 8d (rQ=`( p!@ DЍ 0 p{ 0 洰10P01  * `P  `U-,`Q U= E  P `UP @, ` PU  o`Py PU  `Pt `P@UC*㥠cpjE$p !q0P00   ;PO `P@U*  b 0 %b 0 0%@b< <0 0x%@b< <0 0o%#WGM!7=p@-@`PP Ac (aP(pO- Mp @PPv `PF  \p@Q  A@崀X  QH R  - PJ p@W *@  P) ,b(!(1 0$崀@@T4*X @T  PtP! P Q  ᴀ@ ЍQ (b$ $0 0$O-MPp, @2Ps ` h{ 0 @㴰1001    `PU `@@T* @tᠰ ἰ( P P@D@T b$4 0S$ z[J   ' @@T*zQQ @P  @ Q(  E뼠 @ЍQ P @@T*  Q8    弁 Xq  2! P `pX@@T*pP8 p뼁0X7b"2 0# @ q Wt  2! SPo `WP5 q@W4[ X0p1p Kw! @ᴰ@ &P` `X H1p  @Z@T 01崠 ( z p P `@Z *@Tpq洠b 0 H# c @"XbT T0 09#(b$ $0 00# KO+_eR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/00/ P LP(  *aJa BH JA $8 BX *@ B @/hO-0M p0$` P (,pp `PD@$,  @$0@  $iA`F$iK$Pq (e+@!@ 0S (p  @,@0(Pp@pAq@$ ' sdy'A'pp@eC!E$L$   (`0Q @ $@ @) @ p$cAF$ cK$ @ ` pP@0 ` 0Ѝg@gO-MRV `@Q @Pa(UA (F`@D @T,:(P@0p *g `0J` j` j@ @ *@J@+@@D` ?Tp@T :@p@@D ?TpT ( EЍH- M- `@PE РP  Q (p7Q7a(v"P\X(I @9 @) @?Q ?!(b"P 4 @ @0 GD(@(P ( P2/ PPd @@ @0 @ @` D FP LP(  *aJa BH JA $8 BX *@ B @/dH-'H- P# PP  Bp  B 0 B  B  B0 *c  B  B ϊa0JcJA jb@ AjA`*@ B @/cO-MhX P< `T 8 H4L0@D(< P40(\  $ `L,0|0 00@@\P@TXp@Pl ` 8$pxp,PP t `p Pph @ @堐` 吰l 9)7+g i @ @ ')) #;4 "+9 70&kd0#`0 ` p`0t` d@` @ ` `0b  t%n0! 0#?'10&l@(c0#`@'.`$O%A" "LC "t@ ` 0|0|x 0xZ@t@@@tdd `hl @ ppp堐0xP!p0||@地P#t_b@p%"T\#'P$,0 %P@@1@pPA琰A&pN) "Ay#3%#"Nv=P@P@'p0$Q0t@P+7 P I)GP w)y 9p$KDp'+I G0#KDt0# @ d  0@p @ p0@ @0 0 0xPB| (NhpP%Pp %_&Q p"P$LCp% @&^p'OR(A@%\S@$P@ p@pሠ@@@P0x@P^PP|PP[ @PL@BggRA-8MP`  $(,bmtlVppUpXpW HP<Q. Q- Q, Q+ $Q* ,Q) 4Q( <Q' DQ& LQ% TQ$ \Q# dQ" lQ! tQ |Q!       R:Q^ @ 0@ @aP ! 10!W* AV T5 `U P. PX Q( V P U  @A ,P 5/@PX !P @ ЍDG@ @0 0* Y(H$ $0 0 mmimmmp@-P$ @* `PU5 P`AV ,0 3/PP`VDQ 1/`|@@\pP\p`P { ``@`p pp@-@P& PUpP`@V ,0 3/PP`VDQ p@/@ppZ 0 0 kl-@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0R/q Q/ R0/@-@P5 P 0 P @0P H0 $0 P   a< 0 0 hhp O-Mpc@T` P @PJ p @Woᡒ  PLp(P{TPQxPM"p0@ PzJPPq FA/QV PPPPP<PPPPPPPPHPPPPPPPPPPPPPPPPPPPPP<PPPPPPPPHP^BP9 ux! GڀpYP PNPp* !  6  [PP P U C   PЍD|@ @0 0 1D@ @0 0 @ Uee5 1hhT  1edeO(p@-M`P@P+ U3 V; P @p*AP/o"  L Q (  QЍp  Ѝp lh h0 0 UPL L0 0 V40 00 0w dKdc#d*dccd p@-M@P1 0PY0TaZV `Z0TP O0ZZZ0UTXa 0UXX \\\PZ0YЍp 0H-@P 0Y0TQZ0U TPP Z0 TX!0XXPY0 @-@LP0Y0XQXTOY0@Y 0H-@xP00PYU 0\Q\`[Z0XQXTOY00HnY @-0M4@@,  P, Q0Ѝq 0H-@PQ ,D 0H ?9 0 0a8ap@-M0`(04@0`,@ 08PpЍp O- M80`<@4P P\@p[b WpVpT D#P:PB ` D0  @ P `P Q 8 Y<0P" RP"PPPV W8 <0 Y RP@ P  Ѝ@K< <0 0"(M$ $0 0+_ _}p@-P`@P PV%  P<PJ% 0%p/phAd d0 0PBL L0 0V4C0 00 0b^^^>^o^^^G^dH-M@P`P* P0U8    0Pp L P /P ЍHX<ЍhTd d0 0PUL L0 0U4V0 00 0]d];]\@]&]\]H-MP`@P  pP 0PpJ 0s * Ѝ?  Ѝ@i< <0 0N(j$ $0 0E[U\#\[1\\@-@P PP@&<@{< <0 0)(|$ $0 0 Z[[[6[[z[v=00| O-M`pPP W G"P X Ѝ@P+T -T @ 0T xP `0T`W`0@ Qa@"Q#l*`@P?U  p 0y됶kU[ @pI" L!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" Sʐ @T "/P  P" S! @T "Q/@X QPPPЍA@Q? 0 0ZMCXAH- P,Б qYT 0H-MlP0@P\   :%P PЍ0ۭ0ꀶ /ZH-  PБXH- P,Б sXD H-  PБ3XH- P,Б W H-  PБ WH- P,Б yW, H-  PБg?WH- P,Б VW H-  PБDVH- P,Б 3V H-  PБ!KVH- P,Б V H-  PБUH- P,Б U H-  PБ WUH- P,Б Up H-  PБ TH- P,Б@ T H-  PБ@cTH- P,Б )TX H-  PБrSH- P,Б aS̰ H-  PБ OpSH- P(Б ?;S̯ H-  PБ.RH- P(Б RX H-  PБ R @/ /H-M 0ЍH-@P`p%4# W5#P0 0H-MP @/"%P?#/R?5//" !PЍ0  0S RP/O0?c0 3??oP/0H-TP @@P@ KoP P00| ZO-M(@Q [ Z" oo A R;:TZ+ T Z4 X? JJT :o9zwK!T[n ;o 9 8dT   ^ 0b*RooA! ^ p0)T   ?8ooAP*`!18.9~^ 0n#9~8.3@n pN!879'p@p /`P P ` _ Ro p?^@ა(Q Ѝ)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO@- 0@QO / RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO0///Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0CS 0Q@-Q0@S Q^ Q0C@S@R SU/Q\/ R#%U#/!0Q0 /0H-Q@0S PUQ P0CPU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-Q@@S T 0C`PUQ P@DPUU PS T`PUPPpPQPp  ///H-pQ@P`T W Q 0 0M8MOMs R US  R/ /p@-P`@R Q U T  Qp 0 0wLL2 S#%U#/!R  Q 0///-R/p@-M`@P P`h @X @H @8 @( @ @ @|x6666PЍpߧȞ A-MMpRl@`hdP@`R P@SP Pp 4b{K>KvKH-0 O-MM│`xpKlBPh@PRPAPP AB+Q8 PPPPPRD@V: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   3dQT  Q 1/T  3K55h @-0M@P @,D?P:XD" 1, 3PC0Ѝ謔@-0M@P D?Q B , :3"0  PC0Ѝ@-@4@4/ဘ H-M00 004Ѝ MH-M 0 00ЍHЍ/P /ꌖ Ė H-@-D@@4@@ip d@,//////l> //O-4M@PqPpR@ejPe bjġޗ ! 1a 0`Q*@T At @ T@!0 @PQ  0S0 0@ 0R:63P A A     (4/4Ѝ$ 0 0xtAB#BH8\CCCBBt/Z/[/O-MzP`@Qp T U v(p PUPf %P T40 `$ppxZPl (08@xX`4h*X= 0H Q 0H Q: P Q 0A0@ Q: `{0y  yti0q`o;m@0k0ilQP 0a 0_<]<[  /VX (0 pu  j sID70U c ( p(u  h  0 pn  c ` 6 p0 x` `0XQR9JpdP p@Wp0 pO  D  `b50 pO  C `M &@p#pQ-`C  `o @ppHVD%D5 0* @zp `# @zp` @zp` r0 p $RB P P$ PK *"&"@&bR / 1ᆮ!@aR 04 0Q0 $ Z:p  0! J0  Gc z `: 0a$ppG`R 0 0 p p0s ` `0 $Y  R`Z 0` T`F04V\ 0` T`4 T4 R  0\ T0`4 RZ T B`4R  BR T B`4RW T 4 4pW$p Z T@04Pʵ @   ppppp TpK 0 0Uud` \0 0vkʍTPЍȓ 777s77\G<<\d[K: A-@P PX P`ppGX`WڼP 4/P: 0 0677L K-@Q" QK QH 0 Q0B pW pBqW s`V`PUpW`W+ qW' `V$P VP pP`V QPP R R R RQ O-MM  pP' @t P@IY  0_QJ`PU`` XP  ^;P $QЍۍơ뼆 O-MMPa@ PU`p Q RЍۍ ' 2 ' 2, qpqpQ&`0HX& 0_PJ`PU}`z`   0 `qP`` ``ꨅ x h O-MMԏ@`Pxt  PP9 P2d`a @ Xp0 0  Uh\d尰[m PbpPX` R 0RSR R!RKQ F!RA )P; p* J./P0JP P  Q#Q Q QQ  QX P  P Zd܏Ph%dᴏh P!?` QP0QaRpW p g @ d`p  PDQ `U  AdVXT `J @uf【 D  a @ DJ XKQ U  A`FU  Jd `T @ XἏh\QP\P,dJ(<$ l_P H L Qp @ Q Q 0lS!S 0"vD!<8p4qpl@x`W )Pt  07/PU qPE_PPd` l  40PX4 0̅\ @DPS@ pP p8PsxP<`\tPPPPq `\ 0A P P``p >0 / f\ 0pP, PHPa8P &`J(V0`J ЀTt$4J  00`XT\P头PPdPpЀX 0TP pd 0d. |#DQ@ (A)/"|f,P P$u&Jh0 J,P Ph`P\p% aL  _PX01 JP 0 !\h ,09P`aL  P_PHX0 aL x ^PX0 X0hY * Le! H-p `  ,4PJ`  X0 P0j對+@P  Pp` =0 ``- xupf\`'LFiPg``8 f=0  - .`  XP \L($!  X0L ;9P7`` 6=0 XX, +(`\ \ hYJ d\PP  P0HC \$Pp` =0 \\+ p\h l " XP\ 0 0Y F  \LhPU PhZP4  `  XP 00Z Y  P  `P \`L  L r\L  X0  L\\P  @ 4PV@P8Pこx XHtP$` P PD T<4 i2Rp  $6`pX6PPaP6J/ | |J,PJPP PPP ꠄ P( <[P K PJ@  +Pu7D  P* WpPJTpz\J^ 5 X-d  )PP@` p`hPq *PfPAh[ Y`` ȁ  `X0hPq R :q )PPAV hI q  RJ,#)PڴAXh1 `a  0 XP 0k0hY a$^P\p` [;0 $ P(UP $`\`p`!! QX0 6`a  p X0 R ` "\ R  Q qW )P6t xl0p00 07/PU qPEP P7 $`SP $Pp` :0 # p RP缂hf-$Pp` :0 ``" +@Ph d Pp` :0 ! ుp$`$ 0D ,Vm`QP X ($@`Y$`刁hQP< H  H R\ \$@PLP q<+P&p( <@U d@a=P ZYPW`` V:X0T  KH`< @y &QߍۍSkP0l s bo n 8u r !pn K!q > 4m (n Ly (({&&y z `) w y 'S''(dy F( | +@{ F*w &Hv ,v w v ?&v x{ *%Hq |x p 'K-8MMp`P4@* X  3 4ppP 3+E `*`*@ A39P30p <À@4P8Ѝۍњj  (k / /@-@ J 0KCR  FeDL 0  p@-@ R P 0@R^`C `@^`F@BpP  QC/Rq/0H- M P@(P P(p  ? Ѝ0 e D Ѝ0PPP Ѝ0 /0H- M P@(P P(p  ? Ѝ0 e D Ѝ0PPP Ѝ0bA \L/O-$MM@H Pp  x D 0J  0  P`PK D L ;`P8   ; `P(L  0y`p% D  !P$  X P$ЍۍP  !(?/  pP 0 h/#xs0?r wps0p~PP`P`2g e we be e O-4MMp0_`` dX R 0.RS  Q`Q@.AobP/ 4P@ X 0\ Pd(ppP# R(  0X\$  $PPp$ T @ @ p@V pY (`U DPO $ @H P .PP@X 0\ `P^=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(PX  \0 PU q [ WP0P4ЍۍpPPP W W<P0$ R d a ` ` a O- MMAp`@ &P P Ѝۍb4P $Z~P `d+0>PQ1 P@Q$ `E1P  @Q ER @ R` `PK B` ` ` 6~`` ` K-AM @0Pp`  W 0  '}W p p 0| P PVP 0@.Ph p` |p8 40 $QAލ×^ {2_O-TM`刀xp A YP %x 0|@X YPPPPp W OQP/ WA WkYi ` I0PP PUP^JPxpeVz`aVWP|PJ A QG A0iUP@J@ IVFVpEV?V P@!` I Q&x p pp-Vz*V*Vv$VPOV | PpL   @ETЍ\ A-P`@p p@ Q`)`UXpU`PiUPU qE  A-p P@` ` A0Rp RQ$UU` ]P`EV:0=, ,0 0GvUE    O-M-bM(P  wU [UH &  w@ `@lVA lF5 @ p@@@&P P[8 / *` *Eit@@@,i6B( .Ud d  PQ `` A\ H@0_D`S0`@`P)*p WPq0 @0 pCWS `4@ @4hh {P v`+0;P , \8H` @P0($$+0e;P #P;P  P&  PO | Px t P t P P P, @)  P PX,p P%  P PX,p P (( P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@<P( 0 @  PhP  Y;Y yQJ@@ P @ t 08Px 1Pq, l0 P0lP P  50おv ㏊@H |$ 2y@ <0 "PI X PA ?_P& 4 PA  ? _P `D Q 0 Q Q0S0 Q 8PP:4_ Q Q QB4P< ,R I1S (< R(P2(P<P(P0(0P x|9ddf  p!|¦@P|i"p @  b @ @A"xc"x#%|3v5 0uuup P`P v;Pv.QP >4P1p `HpPP a .PpRW :P@.5PPV*GWp IDQ PH@PxQ; P   &Qbލ ЍCX  v @ L1O N &R P |Q P qruwcVkK-䁙PJ_  `Q vP@PU*p J AX xp C!Tx< |p 8 7)P 1)0H-MA X!4PTPP!Ѝ0Hp@-pM|``lQ >!`@U@@P  l QpЍpI DHG-@PJpQ voPPU*p Y2 b  B QP #0S1S  b3 C O- M`@ܡ P wP  $tP p  P P  Pr   Ps  P  P  P  P}  P p P X P @ P} ( Py  Pu  Pq  P~  P P P  yP}.PdQj vfdd` v[ Q Q vMId vH|:    Z& P ?P? ! O<Z P ?P? ! ;<(PP P P  Ѝa\r_U{jJA-MDaP@`l#0h "$10!:p Q6xq, sW q{x0x#|T0%0P00HHL00\X` 4xp 0 x)PT f DЍWT f DЍAA8H-@PJPQvO`p`V*p q Q/ Q/H- \R p@P P Up@U1`S``VÁS 3 c L g L@-0@@P @6v@ " @-@P @6qv @-@@P^8@ @-@PT/@ O-QMP@P pW EvP P` P ,  P$(`#X:zP(`U#Xt*P  P9Px rP PP `rP PX $$ P8 ' P U:$`  E Z #P P ` V:  F ZPHQx* Rus, (`PE P$$#X:᧢ @២ @_ᙢX` 0 WG:1pGWB:`GPpR;8 Qp`FPX V(: $PP FP `Y:  IPP %Qߍ(D %- @Qߍ @z%@|< <0 0{($ $0 0r Z. p@-M`@P.  P   uP ` t8P (PЍp Ѝp Ѝp 0 0,V O-Mplxl hp @T \[ {ZO@@@0*t@hT TafHDP\h@@@@DD0l5T pU zU <`V(QJ 4Q Q' !R4 P PPk pA\[ @F{ZO5 #$%@2  Ao/o" VP`F`@DA4y V*P U*&0(PUpE  XPE%0 -85,%!y|%Q ` P@48@Q DR\[ {ZOԄpʬt@Pp$\[ o3{ZO !34010SxtpaVhq\q X(:HP P'Q〰1Ȱ@ a!P PH@A !P A \[ 㸳{ZO @@s吃pQ 'Q 7Rば1 |P. P'Qwp1&Ȱ !Pz PDAa`!Pq A \[ 0,r{ZO( p@@`^p !PR @ E@ Q0!PH Ap  TTqT pHA@P\[ {ZO P@,ЍP PgQ`1`QpSP @@F!P `A DpDpЍЍ88880T0X0|7\Ą2L1D1H1t011L66621111687 6 5q55t5\5,544474l4@444 40|\l32222H-MPPL \TaT`@ P@DQ 0oP% nP P pnP pW:PQpЍ  !  0;+Ѝdd d  0 0lO,1 (// X  ..2) `O-M ̭Q = R  MP @ P XtQ h- P T HD- 04}p0,}p0- } p \P   :R 0B6S<0<0 0PR ` ;R`ۧr@v0vPTD@̟ 8 4 Q`,< L0 , ` + k` QQ + 0 S;000Q PLK@[P,P ;0 00, pk`VPV@[P(P , @P:FRF00@2U1:@0P `PU B PPFP 0@  :,P `0  EPPP; @R SP1 F`8 ` P  UZ#P$ `@ $p P ) @U@pH P   @@) `  p90o@\ T@P+H pPy mPi   80o@T@ ]pP@8T0( @V @, xt80l( dH@ `V@P  P  D 0  짟 \`PP# PP @`Pb@ \HT`lx(\ \0 70 UPW* P  RP ^ P0A06P PQ `;Q`ۧq@v0vPT85 R0(0/   R& 0`AS006V ``P``Q `;Q`ۧ0q0vPv0@@PPL A6PLD0Q p 0 P :RSFß  |P l40d^ ( P 040``B6P  @R P ;RPۧr0u`u@S P$NPHT2 0LH@5ЍЍAЍЍЍЍCP) @P P p堁 p`V *PXЍЍ4@BЍh'Ѝt0(p ---|-`-P-/ D-0-d/ ,- -,,,,,,"Rȃ|,`,u8,(,+++++X+ TD+0+\ !" $# ! h!!!u******t*@$$$H#$##D{<#,#,z!""`*)%x)Q((((P(D(H|4''D{M( (''{'t'|'p'D'd'y'&&z&&&0&H&\z8&&@%4%D%% %""\v,""y$$<|$-Z0H-P @@ D R08PyP P @P @0nDP044 0 00(Pd<A-0`NPD @ `HP= P`Pp`P,PQ!0`0P` PP 0`0` P( dPwp,l`h\0/O-MP稱qP㤡 ࠑp  AT M`Px@hdA?`T ,PQ!000 @P(P P$ |x  `1PPP00Ѝpt\l4P<H<H-  li @-@P !RR  00 !0!000T \hh0A 0 X HH0@0@8,(P/@-@\P PQ@  P @Q0$ 0H-P)    , xQp  !R0`!XX0  HP00P88@@ 0|h\dX,P/0H-@?  R1 S 001l000dd0A0TPPD 0 00H/lp,H-PPU+ ``AT& pqP KIVq Fl  QX X0 p0H`pp`8 80 0<Tp@-@Q:`APP pPP0JP8 @(,!P ``  R  1S S 0``01`1x````l0lPA0P\L ` p,\\<(,4H-`@PP pU  *PlhH-@pPP `U  lPIE"[/ /d/X/t/`/ᐻ ////H-@@T ppQU `aP Dpp@@>a;@ xt0tp p`0lPp@``P X@@@@@@@d X@<$4H CH-M,, ,0 0 #ЍuE @-@P `@5 0 0/}K-Mp@P 0`㼣pW# `Pl*LP00 -PPPPP`͝P5 `P  Q N  -0㷝P P` Y C < 0~p 0P(  &@cP P  PRx|\ x&PG \ @P!  !@V89& @  P   R @  UW ! !2/p @ޠY `@Ѝ     (,    x ` 0H-@Q P$P!00K-M@PQ ` `EPp$444hH4\pWs`K($p (?! !`2/p9 rP W! # `P- W+G jP P( ( 0$p `!@` !2/`P$pP`ЍA-M@`pQ PPW `ЍpW W !` !2/`PG P p 0`!@` aO- M@!R*aP4 r  W W( Qb8p `V 1pV "PP 0 PpU W 53 3 5 ЍO- M@ZF*ȁQpowb W U Ql P' H\appowb PE WVH P   0 PV Z Ѝ Ѝ   ЍO- M!R*P/ b R ["*V&*P !@0p@@p@W*Q0`P "7  0k P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0< P ` VЍ  ЍЍH-@P`Q pKpV VP PP2@ P. ` 7oP"-U'(P $ @P ` oP" U $@$ P K-P`p gpU  @VpI*P `FQ01P`@VB*@@`VB*F" q R* q`K{@0 0SOJbcRa@HVMJE\ /0@S000A@Ad` `0 0lLbH H0 0c40 00 0Z0iqpŞ!)p@-`@Q PfPPp   uP UP  @$pדPPpPpO-,M@P`Q p6p U,ЍO P Q !P2/p  0P ,Ѝ !$#p(  $07/P0    Pp  07/P p  07/P  s Pp 07/P p$  0 p 0ᲒP P H-MP@S  `QpP: q `V P! @ #r_s 0ቾQ Ѝ1QP #ЍЍO-M`, PH p I pP5 =@@T%*  @q00r@qP0U0 P @TQ[@ ! q [ [ b 0 0[P@qW Pp FЍ`[` 2! oP W!000 qWꔴG-pPP G R`  QE@AYt  @tntQڰ 0@T*8 00B8E  00B00B Qʲ`0V0B0 0 0d굲O-dMP 0` 0Z@Pi p 0֜P` @  ( R p <:,`P `Y 4 A8(<4 9ⴠ X&*P;Yzp G,@ <p0P 0F Gpw߽Y `@Pp`P ` BpPvU@F`  dЍ P  {0`@,`  000($ AQ.x RH 0/P Bఀp@p@uTE 0P=P @Q@ Qy@0($ 0D@PH0 S DpW LP (0$pP!Q#*xQ:m 0R @qTrPAt p@ `P\Xp帕0PQ:  Q$(PB P\T W(P Q:  Q$mP* P\T ?$P\T :(P\T 5$Px0S* Q*|Ux x0 0Q@@@Q @,( (0 0afmUA-p@ `PRPEu浼 pPuRPEu橼p`P@uTEPlmh h0 0 PsL L0 0 4{0 00 0%ˬիʬO-MpPP% Q *QPO  R Q  0ꀠQ @ `Q< 0P PP/ pQ: Q pPf PQ: 0  RA  0pPQ< U7pH | R>@p qRAAp @ 0 @0T9sF㴠 Q8 8 (4@DpP ЍOЍq|| t0 0 XuT T0 0 8}4 40 00٨'/y˩O-M4PP34 p `Q `$0@ D`32`A6r6S $^ `` @`F V^P僁 @@PY 8P P ` @ P 0, P@P Y  0!Y `$0?=2Qa0s `Qڿ` p`R pR  @?= 2q"! $p@h# P$ TDp aP T R @C Pe(7R 1 `D  B P\ W; 1 P.p/-"1@P t 0qP p  尠`  PᲐYI@᱀PIЍ@ P(  Eq !8DVT` !DAP @P`$ 0 0A-G-MP @Ppx(Q `P`{P @  c`S <V ⧘@< Z ᚘ@e ? a0"! 0Q#QSS #`p0 P P O(,P `P ` V P1P $`Q   PQ/ @Ѝ ``PL6H H0 0  0 0 y>E^eO-MM`pP  @TOz࿙pg PY6 88[ t Q    P2/ Y <WP @#  PQ/ @ܰ Y< QU ʗ@u ? a0"! 0Q#QSS  "qQ O QЍ؍ zDG-P x P pJbA  A  ഌ8qK-MP$ Q @p@P$p7`A8PP$ : P 0,PP p/-"1ЍK趘W 0 0꥜UaO-M`@v yڰ@p@W*Vs w V p@w拸qpPpwA@@TE*p@  P `V)@ಠZ  Q R@p P p@wVpD PP B  App@W * Vy"2 0\"2 0RPp@W*Y] w@Y ` @ Y@ t Pp@wqpPpwA@X!* Zpᲀ  KPP& Pp@W *tPYHD!D1 0,(!(1 0ЍЍp b0 0`|ex x0 0`k\ \0 0VuXT T0 0sXa0TϙT1, ܙ_uK-@P`pVP& W Q" Qp  RpQ R  0P `U Ip Q: 0P0  A P0?CAX*PVrᲀ "UU 8@8$ 0 08 ꋗO-Mp (P @p` V P P@P P" 0㙕P p PEP @p` VU ԬP ЍЍЍp@- @P0`Pj P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0P=`PbQ 0P.PV 张`Ა# 0S 0[p0G ) R-$p q(9 ᱐0㲀R ἠP/  Hp 0,pp% P  :pQ 0pP  (P$p q$pЍO-Mp` @PP @R'PP@P %  P> [+ (P  0PᦔP . P$ $ 0PᒔP   0PP@P P  µ Ѝp@-M`@ PpPЍpO- Mp` PP @0P0P  v @P. 0 0P% 0P0@P 0 0P P  ` @&@ ЍO-M@P 0 `p  @<ōp 0PpP  RQ 0S R Q Q  0ՓPSpPNY  @000@@TG0 8`s0 0`0`AsY@0 >*@岐P:฀@ ᴐR2*pഐᲠ2P` pḀ<`QpЍf 0 0| |0 0`}\ \0 0D@ @0 0GЎ؎#Ŏ ύXA-MP`pQ @ο@!P VY,\\,\\\/H!R* PD X0"A8(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBnP " @@W 0"P !  G 0P Ѝ V Vp$p  0 uЍO-$MdBPp@ wQ Up  p U U   P 3 `PY @pU Up `N P  pL  wP `A Q*  0PP~$A`P@/`*p@W3*U* r  B t 0!B p@d "   㧾`h@@ P$Ѝ2t  㙾$b 0 0p`jjH-4QP w \pH-<Q $P w  v H-tQ\P PP  R 4005mHꤌv P/O-MM10 RUP @ 0 B B0 B@ BP C  C0  `p- `Z*:Ԑ嫊 `p ઊJ@0ppT@``![*pP!P TH P 800PЍۍdsDx--hA-0S  pp2l  P@`p@@`p R *PU U脤tx0@-M @0"Ѝ@-MlP ЍX T@ 0 @ p P OЍD@/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/}*/z*/cw*/2t*/q*/n*/9k*/h*/e*/8b*/_*/\*/Y*/V*/ S*/P*/M*/0J*/QG*/D*/)A*/{>*/|;*/#8*/)5*/=2*//*/,*/")*/&*/#*/ */*/////^*/*/*/< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/h` */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/^*/ [*/X*/U*/R*/O*/L*/p/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@ @*/*/xG ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20260410205459Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s address%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest truncated%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist