08ci<  ci]p?Nct ctci@@<@T 08ci<  ci]p?Nct ctci@@<@TU cict`Acicici$h ciciciAciciciA.ciciciAciciciAciciciAciciciAciciciAciciciAcicicimDK$cicici (08@HPX`hpx0$TciciciPX`hpxN$ ciciciK$/cicici (0M$,cicici8@HPX`hpxFAciciciCciciciAciciciAcicici!cicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici4!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici B!cicici B!cicici!cicici"!cicici"!cicici"aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici!cicici !cicici!cicici!cicici!cicici?\!cicici>\!cicici=\!cicici<\!cicici;\!cicici:\!cicici9\!cicici8\!cicici?\!cicici>\!cicici=\!cicici<\!cicici;\!cicici:\!cicici9\!cicici8\!cicici:\!cicici7\!cicici6\!cicici5\!cicici4\!cicici3\!cicici2\!cicici1\!cicici0\!cicici7\!cicici6\!cicici5\!cicici4\!cicici3\!cicici2\!cicici1\!cicici0\!cicici2\!cicici/\!cicici.\!cicici-\!cicici,\!cicici+\!cicici*\!cicici)\!cicici(\!cicici/\!cicici.\!cicici-\!cicici,\!cicici+\!cicici*\!cicici)\!cicici(\!cicici*\!cicici'\!cicici&\!cicici%\!cicici$\!cicici#\!cicici"\!cicici!\!cicici \!cicici'\!cicici&\!cicici%\!cicici$\!cicici#\!cicici"\!cicici!\!cicici \!cicici"\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici \!cicici \!cicici \!cicici \!cicici \!cicici\!cicici\!cicici\!cicici \!cicici \!cicici \!cicici \!cicici \!cicici\!cicici \!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici\!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici !cicici!cicici !cicici!cicici!cicici$!cicici4!cicici!cicici!cicici !cicici !cicici !cicici !cicici !cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!cicici!ciciciaciciciacicici!cicici!cicici!ciciciacicici aciciciacicici aciciciaciciciaciciciacicici?\acicici>\acicici=\acicici<\acicici;\acicici:\acicici9\acicici8\acicici?\acicici>\acicici=\acicici<\acicici;\acicici:\acicici9\acicici8\acicici:\acicici7\acicici6\acicici5\acicici4\acicici3\acicici2\acicici1\acicici0\acicici7\acicici6\acicici5\acicici4\acicici3\acicici2\acicici1\acicici0\acicici2\acicici/\acicici.\acicici-\acicici,\acicici+\acicici*\acicici)\acicici(\acicici/\acicici.\acicici-\acicici,\acicici+\acicici*\acicici)\acicici(\acicici*\acicici'\acicici&\acicici%\acicici$\acicici#\acicici"\acicici!\acicici \acicici'\acicici&\acicici%\acicici$\acicici#\acicici"\acicici!\acicici \acicici"\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici \acicici \acicici \acicici \acicici \acicici\acicici\acicici\acicici \acicici \acicici \acicici \acicici \acicici\acicici \acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\acicici\ !cicicii!cicici!cicici!cicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciaciciciaciciciacicici acicici acicici acicici acicici aciciciacicici aciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!ciciciaciciciacicici!cicici!cicici!cicici B!cicici B!cicici!ciciciaciciciaciciciaciciciaciciciaciciciaciciciaciciciacicici!cicici!ciciciacicici aciciciacicici aciciciaciciciacicicicicicibpf!cicici $ cicici$cicici~$>cicici$cicici$scicici$ciciciAcicicim cicici$cicici $ciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciAciciciz F 9oqA5] _r/ܠ <FG-Xe3 M &+F =x1~blp}! iKv85xHnwJ+)MV&GM#JZMlkXm\% (JGfF<,%W#Ulxo*j?J)_)@tqpyP*@q\5uPb 7qo6W%oUZLvP~Ab!R"w!&~[ d).Gc?ZyH8Rw#yL!1HB gEJUi[v~zkgK4mxxj\9qxE97jc{Mg *XZu"=keCi>eW%8hmm:eGCDrSLm;yigd-]>+v`ro tLv"uKnZbct . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4H$4 (hv#hv#T~#T'T'\ LLT~#T'T'Ptdhv$QtdNetBSDKwGPaX NetBSDearmv6hfA-MQ t10 ]uP@@ Q  Q/R RPp`p`W*0/W:%UꢓU *`'XPX`P`U*0/U: .'''''',&'&'\Zp@-<@@8PPU*P`0/U:pW`'|'0H-$@$P@PT*0/T:04&T'A-@TpP#`/Td \P@P\P PQ804 0t 0 A/\"[([A-|tx @alll`P[pPPU: ḯP OP ᭯.\(["\)!P@H-O-M`Pロy܉I帹X b@Q            D , BP,  y po`P    œp taP \PDPP$PS << pPU ([P 0P(PP" p p`P` `PPp Y P  X V @`@@@P P X% DP v@ X X% P3X;*z P{`pP @P` :XX^9h Pi(&L@8 P]`pP @P` XX$P`N$`pH`pP @P` !XXM ^pt `pP @P` X `XIgI `p`]MpX `pP @P` XX--wpF ``@P`pPy P XX0 Zp+(`pP @P` XX^^Gp `@Y? AQ` p Qp Q X` X /@  ` `@ W [ p`d\`pPUHP,^D tЍPp@LPزWpU ZP P 1pPqJ ⧓pj (  PsPPw}PpU] pPpUvWpf Q`V }PS ` V(P Q  ` P@ ốp8@Y Б@Py7@LPU ؑpԑ$`PUqSǑx娬`V V`hc<!]((((((((($/(( ()!@^], ((u](dr aqY]T]("]O-M`P3<,t,D  0建QPd@Q) 4t444444444KPP  HP 6LP PP7 RP    XP"0Aq@-T@P V PX P pRpP0p` R p[pZp8 Q,RX`HP ;p  @P @ `0PZP$3P+]PQp`@ P0P3pPb ᔫ'P  G6$ ` ძ`T XoZ XQ 9/P [ <`0,!](($/]\VV]s , Ǐ""]H-\ 0w\(]O-OM@P㺩4$dؤt؄ ePH@ Q'8dHpHH<oPfP* iP- lP8(pP$ rP' vP/aP#xdph@DT[8 R Q # QR QQQ qQQ,52pDbQ +G Px PkV PR/U P BB RR/Q  z[Pѐڐp[P!T|P TP PH ⵐp  P! Tvp/UD 0 ⫐p    Pp `V @ PVP:@ /R @ R@: A0`@/S `V  !(( ($(m^@(<(,(8(0(4((((z^^D(H((H, _^ /L(O-M` Pp/Pq @E1PY 䵟ԅ Pp@P,<<<<<b  P幩 ZU 0` @@ P \ 0᫩ 1pPLPPZ, P/QN@PVP ,0/QV/Q/P@ E0A P:`S   P Pp/Q  PPP ŏⵏpP0 X 0`P!0#0`(%0#P <Xp  P  3:  S) Z U  P"X : ZC00P%V0 UQ`     PA b?2`2P5` PSH S_p2|b Rnp[ P  P' xPS ި  3EP   P P LP  PPpPU PP#  PPP CP0!AQ'(PP X  哨p/PpYP/Ѝ 06|| |0? X| 4|1Y X  _s ( Z_8_(_{_(<(_,(P(!`f`m`P(K`S`, _@(Ǐ"A- M0 0@P  Ѝx`O-M-MpP @၎ jP, } P pt @XP hPX`P P`V`U(@c +pn  P Q4~ @ p`0 {| (  0@pp  p ,`1 A`⛟xu @`P$KT4# ឌ P `PP  A,0 $0 `    @TP  P $D @PighPP $@ڍ+(@zp|pt`{F 0(@(b Zp3 A,`Scs$尀4 .Zlpj P  A$D0 ,0    W(*PPzJDPG^ @POp P(@ YPL8V qp @ Q \p  P+[#Y@UP  EPZ KPā4@P (P d<( `pU PЍЍP TPPPP PW  NjP PP QPPQ8P ``PX Q|ދPY@8((, $( (((4(`(+!0(L(aT(,(`D(H(H-@P 0 <z0U0 ᳋P`0♋P W`P `U ᛋ`⃋P ` W PpWU ႋd⌋p W-PP 4@|`UP`(``((aA-M@ `P,p U PFP l l P P @ Gۍ,P Xi(``,(`0H-@Q pPP \PPP <0,P 0HA0(``,(0H-@Q tPP `T"POP <0,P 0H0(``,(H-V 0}(aO-M`!V( 弱Q@PO =pGPN `QK   0pPF E 2/`V A $Q B B ( ' Q'  Q ! Ѝp XT  < ,@@x))-L")baba#=JbX11db0bX)(RH-M0 00  0 0ЍԊ x))H-M( 00  0 Ѝbh)H-tbH-M(!00 0ֱ Ѝ c`)H-M8 00 0űPЍBc#(H-M8 , 00  0㬱 Ѝ)!c)$/)H-/2cH-M(!00 0㑱 ЍHc)H-TcH-M8 , 00  0w Ѝ)kcx)$/x)H-}cH-M(!00 0\ Ѝcx)H-M(!00 0K ЍcX)H-ld@P! AP R0PPP0PaQ8)p)x)  /)x)H-  \", H-  \", H- , \"H- , \"O- MP@eB ဵp@PE$P 8$(dnd 8㯈p(H$ I4,u0P: HU$P8$('d@ 08L ,p(80` ,$ 0 ,3/ p( L$ LsD< @P C` PR`3VP P#  h Q 0`@J!S#(`1#6/,$@@bT T"@ @"@P Y b@P*[ Z lSnS80 ($03/Pt p@!0$:`_@?``@ 0 P;$ P_ (g  8!(` `1/ $T\  @@@0``@ 0 `8 0 @`P 0@@0@ 0    B 1/wl@ 0x n[Hj!c()t", )!#(x))dh)rd)BB`)?`)X)FdH-  P P> P\<!@  !pP0*BR P` R `Vp  `!(P 81/puSP 8(1/p0X)0X11x)))dY!O-MLP DCDpP P g  80( @0004/ @p  PpP/ *S P`8@< \P!8# 0@#    *"; pP̑A '%$  Q` $ y  O pWPWQP p Rp0pRp r* @" " A9p  p``8 Ѝh ЍOH,D$ $ x)))c, )p)d'dX)""cH-MP\ p@` 8( (03/@hRP ߅bRPЍ`)p@-(PUp@8 03/p`81/(`pd@-M@(8 2/P#8  P 0( 3/P (  01/pRP Ѝ$ l, m8@@-M@7PЍ@̑ ᯓPЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-M|B p & T 0㌆<08(4,D"@@$d@HDL }!,`P}$PQ@#A3(0 0S/2`r"@/@  ` |1`p!tq@`pdK ׄ  ` ,1`,!$q@`pdK Ä  ` 0` p@`pdK ᯄ /0vK؃` 0!xp6 D@@ d `K ᏄЍX)6 )dMb-dF%"kzddeO@-@L)G-MDa 6 0pWB @0Q$$8 ($0 3/PP 5 Z$'8 ($0 3/ R!:80 B($0  @T@pGW0p@!S#( p1#7/p Ѝ$$  )), #(IeB-M`A 0P`*!s#( p1#7/p"A P`80 ($03/PP`U: 800 (0  pp3/pЍp8 x(0p 0007/p U* !P`#"P $ x)m, O-yMM`HNH0, (($0 8@HJZ  uG@-QGGOOOOG@GOGOOOOOOGOOOOOOOOOGGGOO(G GG4GOLGTG`GpGOO|GOOGL  8 (   `<P4@T nQ QoPo@o@,@pPP ,@PP㹒PUP @@W ,q~@p@PWpP TPlP@D$D' RP4P $PEP ATp F`krP  ԖܦpF7p @  P @P@@P !P P< &8P JP P(ᣝ$ PQ !hP ᐝ @P  P\ 0}@TUpQ Q P PCEcp=ȰF@Gp P%lP RP 0P  A뗛&  Z m,P  ApT  P@D೟pPP H@M P +b:PQ PM` (pȀk{DP@DP Q HH PUT `D@4 PI(4@<0,,P< !0 8 P P$0$ 4 @ 0# @$ @P (P  ,   0$ 8@P@@P8<@ P@D HL`P `k @p[pU R$lAQ! P :pP P`U: QU R ట  U H yߍۍX1<<\!ce)xe$/)ff)))))|)x))))))))t)ee(), gffz fJf*!feH-rM A&(}iH-M@P Pp{kNIP `PU FЍf0H-@`P Q P 'IP Q$ 0))O-MM pP  0P ) R +R98Lp P0P%0 R @X`hp   @2L x@ 0  |0  @ 0; W p Q HP P  P.(8h@ PP PPP @ P88( 040 @8 B 1    +' `0` C !`Q 'G7PP    P'PPX7P  B D'ڨqPUꌑ匡  U0,`00P4 `QD@@ 0gP JP!@*3J (J @J ``lPP@))))(\i)H))\)b"iK-p㷉P @`` Pv OIΗ GXP L P,p>(?P  0:PJPpP LR /0` ``0`@@I凗 ddP`=PIx ((A .Վ)))(\ijx))jb"0H-@P@4 0  @@0x))@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,W)H)#())\)H-X P 00S S P R)8"H- ? }@0PPPWCP P/P UpP p tPYl`P z|TʵLƵ@k`|),)W 'j)9j-j`j), cjFjp@-@P /p|P``P }`dd p8@H0$$ G4p))("yj))0H-@8P (PP f}ƍ))H-DD 㪪np 00 P(<)) )@-<<Q@ @0 0AQ00 ) )////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0FoP5PJ`PU)j)))p@-x@xxPx`t t0````0`Pp<p L ))H)$)())\)K-Pp@Q؀ؐl  AP `QAG刕 ``QX>P0))H) )\)(\b"O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPpCt" @ `P Pd CH"PP IPf H`P,P(RB  P0,00@៊PV !PPP@`Z 9x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @PBP PPPpPJhЍ PEpF塔 kXpP`  0)6 () ))x)p)(jjj))H)\)\b"H-HL0S0 P0^() ))A-P x xPl 0N^`pAT V@@pW`@V@@P@P) )$)A-@!PPP <`P/Jp!P0F0 `p dPXX L`@ F0$,  r T)(kx)"jjO-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xPeTd 0pQ0W00 pT`R`Ѝ,))@))x)H)0)\) kk(O-MBbܲP P@P6Pu U0`/pZ Z0 <3  PC $2 Q `x`F P R R0,P0p0呈P ``PQPKY  !D֒ P00* T@Z%   00 0Q R P0@ D塒 @@j8WЍ@)4)H)0)\)(\0k,))b"A-@P!P`]`P  9P-Jp!P 6 {De0 -p hP\\ HUP _DI0(,  PQ T)(k"_kGkO-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ@),)))H-|p@P`T Q @DPpCّ $$@)(\xkO- MS`p@p PW%@jP Wژ吣 W0 <` FPo @L@P`} `@p Ѝ@ 6 @@PJ肟GYPG`UG P PA p[ᘂ [ ,pPm `T P`p  `0  F6U4 @P, KY K@vPPZEC/ @PdN MHG ` Ep[@ 8a [ P 夆 P 0QP @! C B xxpPED@ 9^)<)8)H)\)p)(\b"jO-MQ䱟葟࡟@pP p @7Tp`@`` R R0,p007P5 pQ(A <`@ V Bs =*@`TЍpBZh $\@P0   (@)p)H)\))l)\b"kk)O-M`@P CT prhlZ ` AQ` Ap Q; P<8[X a` A\P`  @^RQ'p QpQXX\X\L`V  |5P 1p @`0AQ`0QX48X X 3`0p &Q0AQ`0X X X`0p Q00AQ`0X X X `p Q00AQ`0X X X@TPyH` AQ` X X X Ѝk#((!kkO- M<PPr@o䄟T씟tട`@ ̡oPp EP# SP`xP sP# pPAP -P$P` ``  0i2`@ 6P @P@@@`P"QP P !PP H`P,6P}`bqP "Q XW3PPJ P P-P J2 P*JP l|pPTrPB P>R`,jPu6P) P`]`Pu u+ u 4`Z6P dPP(`@L6PP PP01 Cj@4 :P# 06P0 +p6P !P^ h ?,Xdd L)kX)P)(kT)$/d)(xh)kk`)d)kkD)\D), p)jt)x)l) lh)k"H-MX @0H >uP JP(%@"% P%@"%Ѝ\)ht@#(#(H-$Q@0 E H)\)H-$Q@0 z H)\)0H-PT@P !P 8;P /0P  @0L)  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` x)t))p)H)h)\)(H-\ R PP < <0PP( Q|))))8"O-MP`  P! ̰PEp @P  @RpP@ЍSH))t)x)h)\)A-M$R R$r QDbL  zP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J C@ 0 S0 0pp pp 0p WP@@Ѝ PtF6兄 ppNh;@P@ )(k*m)))H)\)(\b"K-(a@p W\yP" PQ/+ ,BW G 0\S0S0@ Q  B6, \\TP,e8)4)H)\)(\b"O- M@`Pµ@ P1 Ă弒PP p@Q Q @ yPe T"Q@H  (` P`@QQq Q @ ]yPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*5| E2P5m 6|#P T @ Ѝ)))H)\)(\b"x)h)H-P D, aA1S000()0)TmO-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ J)H)))\)t)x)h)H-Q:p@0 0S)  p#ʤoP `/PP gtP @ᫌP/P //0 w'0  `)\))kmQ 5!H-4Q @0   x`)\)h)O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍK))x)H)h)\)O-M  pJ LEpPB <`P,U P ` kwP $Q`''尔P! !Q Q %QQ Z= Z, `BwP 8$Q`+,% XY pU U ,`$wP #Q` PP \R  PLQ p-`Q> Q ` vPl "Q`,& rQQ  R& R< `vPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00vP `Q' DA,2Ҁ Pp2 wP @ %P!@orЍP<"X)L)))H))\)(\b"d)yl))j) pqQ UU @JPf8qT0 a   T0,P00/qP PQ**"-y{ B/P -k{ pp4h!P@@Ѝx)|))H))\)(\b"G-ؐPp`Pd 'P 6{ #r\@q   0!)))(\b"A-PAQ  1S@pT `Wr@VAQ4 40$$ 0pp 0))$(#(x))O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍ$()x)#()h)H))t)\)mO-M`@P/{P`(P#rprEQm_pnbr㔒ㄲ YePrPf@PTLd,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  NG@Q `P  P+  1 `P  PPP `P %PP< x"m))))))))()"", !H-H+ 0(^nO-uMM0P`P U&  ++ Q EP $P0 P*6+? ?$P  2/P, 3 `P   P \P `P   P PP8P4 /P _P+ '   P*  puߍڍ@+>P t#@0凸_P H җ_P`P $PVr PVD P( {^/ &P /P @@/Ppp~&P D [G X Ta  @} \$c 0Pc _^PC0pP   0 zqX尀 *@P`4` @P%p P YPXP   P^2_P L   0pTG.NN"_PeW  ._PT 8-<="#L H-L="#D4  x))ZZ, )")nmn))(8nEn)))Sn\\%\ \%H-XX0Dd T  V H H0S \\H%H-XX0Dd T  V H H0S \ \H%H-XX0Cc T  V 8 80S \\Hy%H-XX0Cc T  V 8 80S \ \H^%H-XX0Ee T  V X X0S \\HD%H-XX0Ee T  V X X0S \ \H)%p@-X X`p@tPp`t0 T  V  p\\p@%p@-X X`p@tPp`t0 T  V  p\ \p@$O- MP@k4%v`P  p%^PPp`]Pf E1@GQ(0@d|, 8dx4<Dhpş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP P i;\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ6!)ht@$()))o))0)),)()$) )))))))) )))))))))))(C.!\0 4)(8) $()H-& ɵ㮲(  8x `B?m 0`V$@ oP |@Q @Ѝ`P  Q R)o())! o) )o)))) )O-$P,  PJ`pP @P` XX`X "XpWX` AQ` X X ЍX ЍO )()) ))$((O-M@P$``P P,`PP`UI xqxh, = [2`pP @P` XXX,ή`0 0@`0 0QPpP XX P XX X 㯮X 㫮$P,  PUP` AQ` X X ЍX ЍO茮)()))($(p@-@`P R^P  V Pc@8*ydp s  o)^, pO-CMP@1.@T3∠pD  0jp `p V MkP?P ?`  P<W:PU:? Cߍ(p@- M@ ` ijPp TR BQ P ,X0 T rkP Ѝp(O-M@pkRP P ~mP 刢P `PcpPpATe ѽx hSp UH:kRpC0e=p p` * ` *[ BSp [ U:CRp <p+SP J p  P[ /p*p@(p@T復!!$/](", H- ɬ㮩(pO-MMP@R  kbp D~hPfP hP vP iP4  pp)PEU$A!gdPERP  P  `+  P ! UDURP Z/P / `pp/QP pp/PPP  Q:hl` #P`X@!?pL)X)T)P)(\)DDpH-S 0!(dq /`)O-M-MP@PQP QP\ GP 8@RP 8`:RPG  5a\PQP_ @T@  PJkQIP QP 8RPQP@)`uT2p^Xd W`㐄吴 0嬫,@  P Pp@ xPp$@8tXA ,GQP ҉`` ~c@Pppw W  AQ v Pp `YPP 0ᜉ 글Y\Qy  PP9p⪋ `$ OPWP c A pЀ \ A)d 0 L  (r   OPx,$ pG O80 @ $"PP 4TX $PP +P x'@@P< QP H@@ O$O;@$OP $OP -P $OP PP `P ЍЍY@P)T)\)fppp(!!`fp, d)h)`)a`pppppX)A-MP@GPP3  p  ((Cj (守 p R 7jЍ*PP)  p   p R x`0 P  p0C`xP8P p88 80@4$qp/qXqqI\`qNY", X)ppO- ߍڍ`(((`*8)H)zRy@*<$( *0* zyy!hy*s 0yA-~MHP 4PP,` @~,KP~܍4$()$(0H-Mxx @P`P 0@gQJ 0p q5@Ѝ0())$(rH-PPT4 4Q$$0 4)p)*(*rrH-@P`p MKPp@DPTWH-@P`p KPp@DPTWp@-P@T0 0`&K@VT0 0T @  T`t@HH@ 4q( 0 4p4$()$(t)<$(=ss(*p)O-M−@T|`pP  J@PpPE`UW@T80 @  @Q *tB3 P@O4@lP4T  0Q*J P0PZ#P P P tP P@@EP@@T JT @PT4T tڌQ YQ llp@ 3 L@ 04 D4Ѝ4$($()^s()t)`*ts<$(s=ssO- Ml@PSTPO LP\F0P(!00 !pW* 0〰PP QJ[PWpo ` 0 [0 QZP Pxd `   pKPJ8@u3 Ѝ4$(,)`((t)x)))$(mtwtHtO-MPpPPP<PU8찟P@P2:@ 0`P QJP 0go V 0PP 0 S P  P( 3PPЍ4$()$()tO-MMP`VJP@P PrUD3pV C `p~,eIPp̲bᎎH/@@JpgH/@Jpt ~,CIPr@ `~,;IPp\H /``JpB`aW WH/Jpcڼp`@UI  0?$4! UC lUPa 0 q! P 0sH 0P8x`p!W!`` pqL H D @ < 2p`pߍۍH @Jp'08 "0 24$()$(muEz(*uyyzy u<$(ugu:uO-MMD Hp($28 tHp#x2@PPP ЍۍcP02PP P pWWNP 1\2422 2P0JhShchxp{@.P% P   lP   P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P \Y6X dP @U1?@@1*vv4)(),)4**:v)$$($()<$(jvvvv`((w6 %wKwswww xww4$(*+xJxhxx y0)xxxx@-@(p )pd((H-@mP ,"( 21@)@)zH-RHp H "1z@-@Hp 01@zp@-MPH@p@PP NPP  P P s` bHp   P h`@ЍpO-M@PpJaH0/PjJ 0/PeJ@] PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP~  X 0@  0PP P (0/D jF)Ѝ k0`*H)({*O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I Ѝ$(H$( *`((p}`*}O- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ rPp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/`* *`((|||H)B}} *O-M`P7JH0/P1J 0/P,J&P)J~@lPP \EP D&C/4P $PJ@SP (0/, `#E'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P cFP  XFP9 dPJrPJ " 00 @/P P@  88 ,FP P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<  0 @P"F  R.G  R# @᎟0S 0@( PP $ t8`**d((|*H)******h**Ԑ*t((*G-AMp/@bP P`P P 圀p  /P x 0p-PP /P PW( 0n-AލH)@)@)H|4|O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  j|NP. (0/P`!P J$(AP C@P   C@ 0@,ЍP帰 EP   0pUP P P !PJX "PZ`*"{****h*O{*H)sr*O-M⨔p Za P.J `P+J,0/P&J0>|DP "PJ(d P W 40/ `BRP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   uBp (Pp@/P dP 7   TʜP  p  @PP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P   㑝 q  ㈝W J P PJ  P P J pP ,@ L  F `**H)*|А**h** ***H-LP  P JPJ(H0/PJH蔐*`*O-MMUp{`   P `+Ѝۍ@ /PY/P /@Bp#   P'`PJp PJ"PJP PJdv P  `(A #G 0$`(+04T@dpGP ᰬaP(  /P gP *xBP:  PJPJ ( P  p44 QBP` P  "Q + QP0P7F 7+.*PU @Q:P PF @p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7 X!0`*nprPf Pb  @P   OF R] G R4  $ؐ*{*H)*****h** **|{*{}{0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0$* * *`*}@$()(*8*<*0*}@-0@ PR ~ Rڬ~<  tpK 0H!&X4q4A4a @RP+J R <PXx 4>pH L0"#  6&px /& 0T & 0 &Oߍ謐*r<*8*@$(nM<O-M@I `Dp @Q J=P !0Z&ꘀXPZPP崀.hP`` @RP( 0 R /P R  0` BRPZz``W J R PX `` H`P 8P $ %Ѝ<*8*А*O-]MPp 4 p5pE 0 @,8:勀 H2E`P 8Y=pC0"%`4`D`J=P 4L"0%P[Ӊ( $B ` Pl;P%`P0( R,$   [?44 OP  ;` PP p+@)(<px |0" P#`  P 0$` 0K%` P  P0P?%`@0(Q,$ p!R P4p`]ߍ謐*r *@$(J8G-` @P   /R dApPRT $KQ  G;p9GP' Q; P0}pp.РȀ_pP$( .PJ 0eppHl 0$ P0D $PPLPpX*\*Đ*h*O-M@//Q/P? p` P`<P/pP*zp4 P   y;p ;PG 0 /pP  ;Q  PЍ/̐*H-Q#J@ pPo:ph`UP 0<$P ;pʮ0$ 0$K+N\*K-MQcJ` {@PT@A:pʏ\!0$PP $( UP$ R P  R  R::N EF ` `CSP :pEP 0P#-;K0Ѝ+̐*Ȑ*h*d*l((h((_\*H-`p@E;PP 9P ( 0#Ph*ς@-@ 9P $k 0@#h*H-M@` P0 `.aQPP' :P  0`# Q  800`Rp`B3Q  H0@!R!B3/ :P NPP 9p 0,#Ѝh((l((Mb/H-M@( * R I.* PRP ` V  [ :p   P, " 0ЍvA-MpP@c:P ;9P* \ `.P X  0@"Q "#!"# V"Ѝ  P XP o9p:pX 0ꄐ*""Ńփ Q/*B0 0H-M@P 9QJpQ B `' & C `0 &' !Ѝ脐*O-MM@( @0 <,P `DA($D {AD ,( 8P0$p@P,tttvuvuP P C9P8  P  [& K  ,8p:  C9P8 p P p,j,j 8(38A8P# hX XlP Z[pP +plN$,"0!P  P! 0!2؁Q P l0,P+Q $lPBhP< 8p0PXP+DP, &< $!@7C8pl?8$ Q?0P8  $0k!0 @ l  @o` $@@Ѝۍ*ʅ*ԁĐ*̐*Ȑ*zrl((h((U/p@-M` @8PPJP PЍp  P yP 7pPV TP8p0(P 0 !Pꄐ*h*N""mO- MPR^ 0PpP4W@@@P `T V RQP 4, | | $P F  P (\J?  PqB`P  `PpWPEP4 <   80 Ѝ @*<*H*D*(p@-MPR ` 0@_QJH \6p 4P$P 0e PЍp@`*(0H-M@PJP~6TP EF. * @0 Ѝ0萐*O-M MIq` V k#  86PPp@@ PP  '6P`8`5@P p*$ 7pF HL  #  0``q 8PTj0L < `0 `Ѝ ۍWlr@- 0 SR  R@|P AdP @P JHP P@C,I@訐**l**p*t**O-MLAP <08A04q4 P[Q P Q4`Pp PV `P qP V  `|P `Ѝ茏**p**t*($(l*p@-P @P PwAP `@P/Q\ e@0 S < ``p0p ``pp*|*:|Q  lQd  \QPQ  P/0Q $ /ဏ****|***H-tP dpW `T@TP`Q Pm pW萐*p*a\(O-LM@Q PPJPP (B4CE FI$0 `XclS, P @ P$88؃`88$  -PSZT  M4p X    @ Q@0 ,+\4pJ  0T"$ 4"0F%P! Xp P8@0 Pp@8 <0 DP"P $!PX  P8Ąpp@pHpppd& , #0 P 4  `Р   $00 0 P[ 4 (@ *XTPPDLЍ脏****Ȅ*zr*K-hMPp@P2 ( kFzITX Tnp!W0pP   `軎<PH  6 $p0  ᧎hЍKP x៎t0 ᚎ<@Q*XPD +ፎ N4hЍ蘐*!/$|,"6\K-8M@0 400 g|0p4`l<800PpP$  @ 0wP8Ѝ茅p@-XM@F P 08`X\D ;A XЍp>p@-MP@P7P Q `P0 iQЍpЍp@H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @蜐*GH-P(@$q``Q a` S H5[`U4`-V$``````V #P:VHw^|p``:PXQ! 4``,, 0Ȍ?`萏*$/(*(/p@-`Pptt P XX@P0 ᣌP,,P뜏*`*d(*ʅO-dM/Po|GP `o @P   0U0@JQ_tTdT,8TܒĒl̒ ؓԒ@HP8l[@@PP /0 !PL Ȕ dqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0Y /PS0BJPl̙4lDĚ`0\ؚt4,,@Hp ܘh BP 稗ėЗ R   i `{ `v  `ot lRmR oR pRaR eR8h,|CL\$(**4)jo*P*D-)!!**p((*x*$( Gn 0.ؐ*G-`@P^pp t`/W sPGp p 0"GP  /ᜏ*H-㖃(@-XX @0D 04 0$ 0{(Nҋ̌A-M `P@ Pp0A W L: RI 0lS bS kS(kxP;mS wS(oxP.`kxP# (f xP  0S xS P*S(6 0RP!0 PЍG-PQ蘠P' Ȑ@PP! ,P`P=JP p 7P 0 S 00PV0$Z<꜏*@*܈G-P唀 @݅U xx`Eo p` ЅWU@Pڰ  GF*0([!Tp@-MPP P@P PPP6P PE ` , ``ЍpH*K-MP @P `p\Q Q\ QppV6Pf  qEP ` ;;[ 0 ;;`\P P+ P``P" PP廟P3 P fQOQPQ SQ ,gQ sQ pQ&  GQ Pɧ ; ۍQt R ` ᱧ ;D᫧ ;$ 3L*P*QA-P P @P5P `ppT 0 HPR ``0>p``T*X*ЎH-`pW \P@PP` P  ᳄pWT*\(H-d!PQ! 0 {@T @1`0V (10S Q Q Q ;PP0S P0SP `P/` @/Q @4PP/T**|*Y<H-@ `p  W P 0/ /PBP pWxoddoP`8pP ePCSUST*x**K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PP|*O- MM PP `@.T.Pq >PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K @P  P  PZP/P wP Ѝۍ .P P P  @P 1 `+VZP P 2.   +c`apW7 @/P PP ~ X@p.WP pW @ /P P  P P X 2 @ P.PWXPt((>sL***ɏ $Fued*GO-MM@` &pP+X  @'@P(P`'` [h 0MPa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  JQ \R\&R Z:Jp '@` VBp+ P ZX  T D Ѝۍ V*' Q pP P   '0  V ` P' P   +'' P <<'0 ᑁ  ⋁L*(4p@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0ǐH-@MP@u`X0~'P8<040&0r'P8<040&0f'P8<040&0Z'P8<040&3s|ßp tpt, "pP  PjJ pP  P[J pP  PLJ pP  P=J pP  P.J P&J p P"JqP o%pNPP p P @PA !C@ЍdA#PP PE/Q o1`,V`  U    /00B B ^*@P  P qbxPdPÐh*(ܐ**P`((""d((t((CW 'jp*8)t*0#)l*i@-hh h0@`TiHP 1&|0P &e|**ؑ\**H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V R*/>3**A-@PI `PVE qP= 3P7 #V \V `#P` =P`/P P!=/pEaV Q PA0P `P@ 4  */>3lLA-@PI `PVE qP= t3P7 #V \V `#P` =P`-P P!=-pEaV Q P/P `P@ 4 ? 9 */>3’H-P `@V /QpW PP`VXpP0 F R :,VU .V+P 'PA`V/P W`Pe bRCR MR mR cR/pP KR#\p Q LpUP R  `` ``0  (p RP 0 44 4  &s̓**JH-0@PS# p .SnWpk0Sk`W Qp!@k`p@ QI LLLLXL|PP!@k@d  P!@P!P!@ P!@!@l p0 (T*0H-@P@P  1P @0*&O-MY; CJP5 \2:BZРL JaV p !  !  p`P @\.P- `P% @  `Ѝ   +` A P Q 333 *qvQH-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T{3Hx3*qvK-`P p |`AT Pf3d3@U`V *0H-P@P G 1P ll `P Xp " D 0$ i @0*t*"p*x((oO-MMAQj pG P ,wAT `P ( ! 7  P5  yP5 @T g-P A` 0QJ P* 0F.*p 0aP  @z vx   F @ 0T <@b 2Ѝۍ*x((֔-H-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: Ѝ0H-@P@P  40P1 @0*OA- A`P%  ,@PqW P p ,P) pP! `P qPP `PP !2P ,22 P*˕H-lp`P @P ,[qW P p *0H-@P@P = /P @0*H-B  PM-`@pW# P!=FP Р+0* R !,P  `P@q */>3EO- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ +PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   r+P 0p p ``  */>3 *"]0H-@P@P = .P@0(*G-MlP =Pp aV  0 $@ Pp(` Z Ѝ(*O-M`V9 @L@8<@P!=KP ! # " # " (0@ *P p `P P @(q $Ѝn0ЍO:(*/>3ɖG-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  8060(*/>3/G-MpPP/P` ɢ`P$ (*P pP @0 @ `P Ip0H 8 / ۍ蘏*,*O-MP@T) 嬐嬠`pP$P u  p p~P //@TЍ,*Ȑ*l((h((p((  Q /0*H-l0S ^Q 000SQ0*4*@- Q@P d  P L<q 0D @ȅ((d0H-@P <P0 Q* P0PR PT 06O-MP+ P`弐@p@PP P@PL 0<, ,00 0Ѝ蛗ӗ`((8*O- M@Ps`PJMzI( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝ<*@*D*H*p@-@ Q P`H.peRe #p@O-EMP j@Q <DxLTxxeQ +@Q@P@dT   p d @Q:P P /@12 d w0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 id0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 LGIpD: @Q :!P.1q0PPA@W@Q: AA0 -(\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0    h,'@PJPJP P@걘uP'8** Ϙ//0H- Q @P x\ WP 0X OP HP8Q0  0HVȅ/L*4*7O-MP@PJMInjt( p |Y!R  ++p/  KAQ:`|#|3kF@5`#`3  + d  |  "p EFzGj  H )n Hѝpt ,kp   (=pl  mJP1 @R0 Pdl  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  'PQ  !&"&p ( @ /R     <04KP4   Ѝ<*@*D*H*4*;x"DO-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }0T Y  `/ P%   } d 0@ Sc`2 375p |xD``@1 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 !&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 PK d @h``@|Q :!.q1`0``A@`W@`Q: A{A0 ], $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0 6 l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0  x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0  #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0  |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0  "0@ߍǙP0 <aU P  ;X)`  ;\PP}PP@@Q :!`.1q0``AP@WP@Q: AA0 N  }B@PJ PJPP p`3 P J @ yPJP P@4*lKP*{usta!7"ۚ*!T*ߚA-MMMPM `@  P+ U UX K<0 wMލڍ "T*P*[0H-@*P P 0HH-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @0(q@P$J P0qPJx @0qP JL @0q|O@Ѝڍ(ƛK-M-PP  rPP 8"10 TP匀`pîP @ Q 0Aj`P @@U ᔞЍ(r 0H-PJ|@ᇝtPP hဝ\Q0u<P 0  00ћQ X*r \**ڛM0H-MP@ 0tPP h 1TL0P Ptq Er 1Ѝ0HЍ/l****(* M@-M@@  0P  (rЍ@ Ѝ/X*p@-@QPH R `A$1P  @@qP@@p\*Mp@-MP@P0`P X }1tl0p `q qT:0@ q e1Ѝp@Ѝ/l****(* H-M@Ped>/\ap yBLP PPp9 P5* P& @/P"+P+Pp p 0#" 0"# 㣚@PA @@XI@~m$3!! (>""(dH- pim(O-MP@eXp.Lg\L BeP qPrP vP xP0 VPPP RP fP iP! pWP dPp p |`VdPЍTQpPW9 P@Q  /Q@ pPP/Q /Pp.PP .PP P Z/QpWPTlDYn,PU  e0再p@P Q PA P  PD ?P@ P< M7Q . /. Q4$ R$ $ R Q  P   P  P PP P V/PU`3Hs P0p YWP@ VP4@ᗶ SPP=cb貟p@ Q   T   Ph X Pb ùZ8Q X PP P P^ P 2$QPB pC. $ 8 PQ+ GP- (P$P% P?P" Y Т . DQ.PP PQP M pP}qPP  )P ?P PhIB-D0 9! x*t*p*l*h*d*`*(*|*s *, Ǐ"H- nlk( /ᄑ*G- M@P qnA@P$P"D`P2 P P- P( P$ `8P.`XP @PIp P Y@ob ЍpŔT PP WP4`43 0nh*|*l*j!(!3%O-OMM`@Q  p  P p PLP Ѐ # "!Ѐ # "  P>pP 0w p+ЀX` XPzp X oPXbP 0\ ЀX` XPzp X DPX7lP 01ЀX` XPzp X PyX BPq 0iW WXj`  PR  FpWPIWPA 09РZ{`xV`: ZP `j PZzpp`6P TTpp1K -,,pp'KOߍٍ*, O-MP@eaL+p@a@ Y>vPppPpP?P4 䠟P?p!P$p/3`P PQ P &p P/ J J` P bi!p*(, H- olTi(K-P3rP  pR吐G';`; ;DG!0 aS P K Ad**h*H-@Q  0Sdd`P@' @qW 8P `pPA* R 0 S$A'  A/A*p@-P@U  QX`t"r"p"PP Ppd*h*H-lP@hp`Q `'VPP Hd**h*H-@PQ  0S``@' D @qW P pT `A*@-@P@K- aK@:P 1S ppW1 0'PR,PP 30 }Tp `_9c AQ  ^`@T K:7d**h*@*(p@-d`P@Q  R @RP'Up萑*O-M@}BQQ? `V; @P ="P x !_@0P p3_b AQ ʣ] `V( ^EЍT*@*(D*(20H-`@*BP aP@00P@P g @ T*A-Mc@0A P* >#pt3   Gp ppD0$$#p007qQ Q, QR&]QC 0ASP 4@Lht00A S*@G0 G@ @9R Np@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     8*"0*H*@*GH-M@Pf9`PLP  IRNP  pP  pEPP@@@8PPR9Ѝ0*8*4*<*0H-@YP )RR0<*H-  `4*oA-P$@. `p P Q @ AQ 9T@Q@ AT  Q9P`@ Q9@8@@v@0 0Po]o!)()(L*ܟ*# K-0M@pЀ,(j`TV F P :(( 0$@P0ЍS@PWV  F008@P( `0g E^@*S1 G-@P넠 %Rpo`(U&P `DW@ 0W J<*؝@*@-@Qs@   4 L X |        Y # qV PL 0^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0>-!p@-MP`V_@`P T, TP@R @PIPP AP R P    RЍpH*ܟ* )(0""KdQ"K-@pPh`P<LY@5 0<*@*K-MP@#` 0BS0P RpToo"WpP 0Ѝ<*@*K-(MP`@p!PW$WD W_ WX 0p~'GP:$W= "WA#PukW9 WoUC ЀEVeUFaP'WP'pWAp&P 4fFT 0o᠂; 0/Ѐ 0(ЍK'FP{U Ѐt`'V'VT Pe n\ (Ѝ<*S1 @*O-M8ȰȀP`pG@ A  0?@ DR0 0SR* @Z 0pD`PP PЍ@*<*"O-MC">peP P̂@T& `V pW !P P9p65` E E/'0@0]@P~ .P.PP/P]P P[ P`p @5z p  P [WQ pp*XpxjP dX5  PP8% Ѝ-PP`P@P@@,  , )(T*L*P*5!Ξ"՞p@-X`@PpHP < ־PLP 35pp@L*X*H-p`@z p0PPP $ V t6QP \\Y @P(P sg@d*h* )(L*\O-MP|sUQ$CP lSPHP FP  Z Z@4Ȳ.b@/Q PQ P@P5@UP U/P@DpWF 8R8 PQ /Q @6P P+  .P& @Pʥ5@/P @Pʙ5@Y\T1T   t/R@pWT p@^5p@Po5@/Ph5@P`P Pt 4x  'Zd #Z@PDP ЍL*T*)()(L* ""d*P*h*@P/ 0RS /S  00B /T*0H-M@P P/Pl p  p 0#" 0"#oBލ0""0H-ALP;pPP2LUi7PP0P$ @PW! !V AQ W ;W0`J#(%#!! T*L*/@*(Pp@-@ \3`P 3C"P Pq3`_30p@3Tp0#놟L*H-$Q  HRY HL*[G-rP`V lP XPo`Vl P @T7 \T0@a DR03,44344<43333333D4333L43T43\4@3\T1 0T `@ P0 BR6!Ar@q#\@` P,  AQ DV `V@ @ @ @ @ @ @` AQ &V @`@X  AQ V PV! !l@*(, H-P JU\*`*H-MP |l   DP 86PЍd*h*L* )( MH-M,  0 Q 봒*@-000@Q#Vh*d*MH-M  0 H- p봒*M0H-MP@ 0 p@-`@P PQ:Pp R V P  VV  VT JVTJ! p|Vx@ AQ JU <00 p@UQ P~U*(x***( |*!, D*(p@-@P` M@-M@  0 }@-@w M@-M@  y Ѝ@ Ѝ/0H-@Pm 0Ht MH-M   iЍH Ѝ/ a@-0P r R P  R @ kV@,"l*Ԓ"  0/ᐒ****A-P$@0 `p P Q @ AQ p2T@Q@ AT  Qa2PPQX2@+1@(蘒*)()(L**O-MP @j1 +"`Z:pP P` @U ^PZ !P d`Pp18:PP&" Q1V(ZЍ=ܟ*)( )(**O-MⴣP@`^Ug P p1댳儓Q=<>P>p>>>(=\==>>>>??0???????????`??^`P ^`PPP" ^`PPP}lP Q^`PPoP PU[P0U`aPa``]P QO /P QP Qb9hP Q0`!*(P Q P Q9USP zQ ``3o` 0 n0P 7RPTP 6 ЍQ`PR )(****(,*G-MPPP !H!SSpW A ` NpWpSdUS p`aRP D@KP R R ?SP6P3 -@p I`PP  KPtP P RPR,SލR\* )(ܟ*О*#D*([`*b*d*h*lK-@pfPP) !GRR`V Q M`VRWRQ AQ ʄR RdQW5(`Go"(P W( PP'PWPP ^H)PP KWPP 00 G*R8(RKkR )(ܟ*О*#D*(7Fd**h*JO-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ茒* )(**O-M@葟 ^P.UQ`p`pW  ZP `!00[P p paxP& XFQHQ Q AQ ʑQ =Q AQ ʂQ Q T;^PP P P [PP, @ \.Ѝ )(***ܟ*О* D*(K- MP5.a   p@W6 P2@PU   IP PUpW P @PxP^P@ P  @T P^pP $@@. Ѝܟ** )(*O- M@P ꀑ&pPW7 ``P p? R $'PPP VIPJIyVJ`pWP E&'` RDP ЍVJd*th**O-iMxL$/? cb-@_ aT  aopP `;P  @T p_W _O`C;P  pW p!P ppp,tQ t 0t1 t帾>6 (R PpPt(ptAtQv dDO|QU2 D~=` @  AQ O @@DP @7P AQ O ``(PP @UQU dM`  AQ ʷO ` PP `U @T \`v JP@ `TL AQ ʔO OpVP[ |PK tL`Pp P$PU<<`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt $pP@Ft V$0/P t$` `Q @QC*`PP?P PPXlMPxRj$Tlx lYp&PP Tl!G%P l8JP8 lPhdT P LxxP x d P P dhGxx@Q *hi`P T%Px @ LPD ER:UU ~$ @0 븒**s H-`@PpW pV .Uj% L,_\**O-MX) pR%pPPP :PW @"`Q&P`U@  ዺZ/P/Ѝ p WQ:Q:Q @ЍO%)()(*O-MtSp`@-b@Q'ii,iii,i,i,i,i,i,i,i,i,i,iiii,iiip`@PW2 ` RU pW P  ,RBP PjjjjX [ Z V pWdpo 0P PPQ PT P PI !pW=oT pPU PkkkkX[ Z V poPQPd|Y:T@xHP 8*HP PPЍT*((**@*(K-鬀嬐@p PP `Q QQ `PP|U:P P Kd**((h*K-M Rlmnmnp @P w`$PEUY tQI!Y%&Y$ (G$EIAT PPP GGGY {GyG"I P @ AQ ʐG *l@ AQ ʂG Ѝ0u, d*h*cl*K@*(H-`@Q  0SCpa!(@r !!ApQU P" pPV `#P P,P 4Pp輒*d*h*8*@-LL@ 0 0 PP @8*d*h*O-M/@`P0[P P`  P `xP* pP P P 5p;P 7P 3   p P pp @P|@Yp P >PK h  po#Q 0'P P P'P /P  W YA P p   PPe P ~P P p@ pY( 0`@U0 @G7 p$p@崐`W pp@o p@RPP W    Ѝ@崀`pPp@op`Pᵾ@Du"+"bP pP#, 먞*((*d*h*)(D*("H-`P@P `pQ%V P pP@"H-XP@P `pQӿP pP@"0H-8P @PP@P0"H-XX 0P R RQ U 0|S:((*K-@܀`'pPQ Q:P P:QPPPP %Pv&P`:PPp@<@qVQ`UV Cq `訞*((A-销P`@T pPJR@p@T`|V:PP Ad**h*p@-`@sPP PR  PpP p@pd*h*0H-MpP@l0>00  P P Ѝ0P Ѝ0Hd* )(h*H-0P QQwO-M@p  p` W p'ppQcl  Q  L*H*@*D*P* )(`*ܟ*)()(d*@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp@  %  ||P`~P pF @  `P<UځE P#P,, X|t p U :U U |=UP|{P pP ᭱pP  AApPPp PPQP PPipP p@Pp=P ,pPy PPA @Q:pQ7P~ PutP65P 9P ( AAwpP; p~P7=U PpP -[p (p P" PMLt p Pp PfPPZp UPQ@Q*QQ  p;p0p(p [ P`pЍX*H*()(H*ܟ*L*D*`*@*O- M`t@P ddR f` p@Pg@DP:T @T P{P=  [:T@ ppW T6  [2*W @W ` `pUP% W D ӲP ` [*p P Q 㽲@[T  `  p [:P pU P UY`R p pP J p Ѝ`*X*P*H*(j"G-PJ 0Q$a$(@ >RR4 *R[R?R p P Y P k 5PP zP P  RP Pp@q@Td*l*d*h*0H-P ,P@@^@@Q0d*H-t@P hPh`ppP P .PP*d*h*`*O-M P bAB2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ ʮ1EQ ЍQQ KP Y'DP8 EP టpZ y P p P*p P PhP]Py/PU/P M)(H* )(L*5!"O-,M P( 4o = Ʈ@    P&  >P. p `( ( * `Dp6PR0C$ V7 YC0 k( P C( P `p Q( @P60AS p*P@P p R Ap$P^ R"Q P PQPTV?LP( `F0V0`,PQb䔟U  `p P P( P( PPU`F R 8<ğ0PC `倐 !o@!Q `!@PP ` `@BQ7*$Ph  0 F pXU k `Hu P ,P-( P ( PPUGBQ0笔d\  ,,,,    $pP XP@2$p!Wl( pP 8( V%-( 10p0 0PApP q|!a 00 A p@@ A ( R @ 0S S@`VW   S S00SP,Ѝ  띻 0DSʌ R #R  d \  C @ @D  0"*@*)(H*L*" )(`*ܟ*!DD*O-M <#@@P0 s\( \Ÿ@`nE} [" ` 2倒p吢`<E @@PʼPoJP@P V  CpʯP TPR p@X X@`VPPV A E@QPE` `@PP@D`T`PPP  P p P *p P@@PJP P |PT E v4PP,P ЍD*d*`*H*)(P*h*L*"*O-$MXXD PHPl@e`@A4`p崠  BQW > @@ 0@S "R   @ $ЍH*)(L*ܟ*S1 H-pp`@R@PP Q Q (`P @P`*P*K-$QPD  P aP p@@P P #P P`P  Qd`dp@@QP P P`*P*d*h*G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F )P`@V P"G-Rp`P@P D  VPp  >| pAV P  TpLH0 0 ,  <D*L*H*)(*(\ˣ"O-MpBW*(CQPxbP   WP P @,  Yp `P^V`ZpW:!pEW}: `~PGZ`@P wQ  0S Q:ppW*]pEWY: ]P:GZP wQ  0S Q:pp`ET<* @PZ Q@EP`0 D` CW P@pPh`@DpR@@ЍTD*L*H*)(O-PJp!0REPBP@LaQ* PPP:PU aPP ` P~p~ ` P%` AQ ʑ%`P@ ZЍV**l*"**)()(L*"D*(O-PP TP Q TPTn RT`TPK50!(vX*T* )(rt*0H-lP6eN\@P vP](0( P$ 0Hy0 )(8*e[!nܧA-P``QP PpPp$P@@ @``*A-@P PT@ Tp.P @7TX XT@R@LBLr`PE0 S`FvB AQ qA ` Q E P 3`Fv]tq`Q P `VH @X P  1 PUR@]p@ Q` Q  R `V@ AQ f T 1pW`V PAPPU Rpث )(! @*(ǫiv@!ѫ0H-l 1@T PHDcQ R APUP0 )(0H-@P P PP0H0A-@RP Q-Q\P9 Q-Q5U5PBQrQAP `pQ pG`WQ PMpPI GH@DX4aX< XBJX@D@ 1@hpp!PU:1S A@  0  R QB 1Q  PTP {M8T* x*`*d*h*Ȭ@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 GEx*T*|*P 0 @-T@H<QPP d*T*h*@-0A Q @P  @`*H-MPDP0 \ 0 0Ѝ`*1O- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  P@@1  /!?`PP0p @ P,` ` PP Ѝ:U H  `:`$PP>*([T!o!0H-@P 0P  PP P!P P@ @P^@P0 !)(*H- H긗*O-M X @ TO P @ T*` @,P( PpQP pP -P @Pᅒ qGA@T Ѝ)( "O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍp)(p8H-@   )(p@-@`4P P`P `0p)(O-MQ[@ @` P     @  B/o"D`{p @  pQ  n  [Ѝ)(*"p@-@MP@ Q `ბ P x "0`0` 1"2 `sTUJ(8 1$ 0! P)(T"ĮٮA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !)( )(H- 0g)(O-Mw D @ P$PP@;5P@-@-@-@-@-@-@--@-@-@-33- .3333h-h-.33.3$/ Q    Hj P KPEP2   sP5P!| P  sc&Pj  `PP pN `PPU pP pQ P,QB HT$P Z6 P -P 08A P0` P    ` P\P Ph埑P pQ`0     Rc   PQJ Q0P`p  4P1p QQ@p`0j P @Q* P QA P8 {  0P Q,QF f"0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  (@ ЍƐP PܰP0`p  ` P P ptp @R*PQ  )( )(")(ƭH-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8p     F    P `&)(@-@P@ 0/0S/00/"H-P@-@S(    @ )(O- M Q 0 ``hR@p` P'0. @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK At?PP9 @PP\ [PZPW#P'PTPl&U0@ETq*0Q0P@0QC0P@/ P Q@@p T"0`00a 00a!0a!pb(P_`P(V@A" @ T"0` 0a!0p 0a!AR P p@\ Rx Qx4 7P9 6TPU @DP)P @PA  0P  @QW @P@PP{P  `@{U@#P#P}P@cQ PP` T PQ PD0T000 00! 00B pᴩu)Pp! B!w @) 80R8(p!R\P`P?p@Py   0up\ ER 0p@ KVVVVKxE$IVdIpIVVVVVVVKVVV|IVIIIVI@"P $P }PQZ TV 0P@T @@9PUX r@D,Y p'@A@ TE X@P@o'UP @$@>PT` ုtf U "U `d @ 0F Q:8 !}P5P; PQ2 pAA\ QAQ A AAp0!1 eP U @ୟD@ 'U bUU`p`P] P?@<PY*?U \U\PTPn   p@P0@ QR A@Q7P@a@Q)WP@pW% m@@ TA0001x<"000a!0a! eUP8 6 P Po`PI%@p?P PpAu P P!\P 'Py P pPT/]@-+ P@p@%P%? %#@Q Q@ p B ?PP  `@` ` J)@P`P3P(0E Q)@P`P P0@ P3)( P`@PP")()(((""L* )@Pʟ`p=Y Y}U (P@Pʍp# #U%U #UPPsXH:U d ㏁PP)  cP 4 めP% P(@!R 긗*P IR'@3HY 圇P'P1P"@L T"1`Q 01 A0 @@A@AP `"Y @@%P%? %&@ R R@uJ%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Q Q p B  "U]J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??!P p: P pP 4p:-pP@P P P P@P` @pP<PT F ,@  PQp @@QPЍP P `P zpp"p WWp>U WpC &P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @|@Q qy m 0 rP*hm ahiDgLe<c0aL*)((()("""*'"*r[8**\w<*@*OO-M|P  P P<j  4b4r4R$80P@@T:T D P@WXXXXX YX$Y0Y PpTt 0\T P! R0% T T  :;T" |T>|P%0p ЍOt!)&P&P ;P    Ѝ)(*((**"p@-\Ppx@xPx`y P08 0Q 08  h\P p| p@^k)(((*p@-H@8Q 8P` AQ l`8  R8 p)(L*O-MM0$`(@0  0A,p P P!pFTW0A @0}@PP u`Vu ttpPlDlt(  P L `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0$  ""P` P\P\@PP`@PP̂(p`EP @PPPtVP`CV P   }PPu PAP`q@Z   }똁@ f0@P\P $ 81 1SP  AQ O @B AQ CTP@ @P 5@PEUMߍ 0 )x0P 0$0  )(\*)(d*h*)(((L**@-Q @@Q0H-d\Q T@PU U U <04 P00)(!* **((K-MP@ 4@T׃pPU ` G|Ѝ`uQ X<P ```)()(ě**$O-[M `p吡<րK|TP@ P T@րL4`PD PD ,> @`@`P PS@ P P Q QV  d`!V 0\X1hAp@ր8T`P[ߍd \* )(x*)(`*!"߯)( R/0S /<\/0S  R 0/Л*A-pW |@P`pQ@U U p 0PZ4Wț*H-p@PR T%`W VU V\Q@vYC0(   0sY)(H-p@P`Z @P`O-MP@   @ C3 U ppcppWWpP Pt ,P @T Q @P ᮻQ  R XF P Q?  ኻ"P|C PXP u@pI ,T @TJ g@0A p ȡRP KW PU~<P QB 8P Q  R6  +p3ꁇ P PP/ @pqP mP @p@ @T P|tЍ > PMJ4 Л*<*@*ԛ*d*̛*)(h*ț*@*(,*(D*(( R/0S /ԛ*0H-P @ ɺpQ  p  㺺p   㴺p  㮺p  P0ɲ̛*)(0H-P H@P PP0 2/喺P0̛*@- P@ T D|PZT@@ Py,, 0P Q10*()(gfff̛*K-MS`@ T@P $mxmmmmTlTlll pWJ0P  R 0 X`UP  R 0S T Wr!0po Pq[0|VP ppj `qp{   P#@wpp P_J`W    p ,ι`PYJV`T  V P ȹ Vo"0p!PP ḹP P ЍP ЍK薱  ᶱX㎲ p᪱߅@ዹۅ@<օ} ᙱd*ԛ*Л*h* )(*D)(H-M@ Cp`pV`#P P k P T`kN1.+( % I㭺)(p@-XPX`@PpP p@pd*Л*h* P/ț*p@-@LPU T `V PJ`PpЛ*p@-P|@QQQU  0Pp4` )(p@-`@ RR9  PZP P* R 㮸 P,UPU ᭸@p@*̛*)(0H-@ P P @ $0ԛ*@-<@P  R  -@臸ԛ*O-Mp$`@` `pR SࣟpvP sPV` pVG3  "P p+P -P  P00XU: ^P  Q PQm oᠢWg aQVo  % % _p@P0P`P~Pk$WWcZ  01,p- P [ !+"00Q  Q PWFr ȷpB   R 㼷p< Y  0O`VVQP J@@ 0>T@ }ЍQx尯t᭯᪯߃܃ Xփ <ᚯ 嘯/(а$/B"T"$B"d?հ@*<*@*(%O-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP 0 @S[U H u<ЍOpЍ@*(?!$B"|T"!!xG!B"6 p@-@Q? PAQp`R @P``D>Q <Q R <D@Q:P P r d' RHp@P-0"! 9p@-@PP QU,pP Q  R 㙶p `㓶p l pU  Up܂ (ᠮ  ԛ*Л*pұ@-@P @(P DPf"0H-P @PP$P$ 0WP03؛*!A-@Q @P) x`xpP  ?U U @P P@U, 6 O-M@P PP3,@~PP/P9~PE 4~PP#dtP@P TQ <PP ڭ@@T@@ U`t ~P d~PpPU`PE}P I:lPPEYU@U%Y cēSă@p WWp@WPT W0 T@Lp@@WroᠢYPi@YP P @㰲bR@P*pY Z P  P dDPwH D GP @PeP P W q|PlP T |8Qthah@pP P T j T@p@Wp@@WT p`@P P wE@@T@Ѝ-PPUPNY"# @*d*h**3@*(, nhM0"\D*(8)!6 BVH-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ 㭀p Q8NQ> T<'8 :V V V9p U`V D?P: 0p  P6QHQ `6QP`**L* )(X**H-@P`pP P `p W:8 Q P Hd***h*K-Pp@HoሐR`P P F PP `P:XK**d*h*HQ/8 0S 00S/ <R:/**0H-@PT P Q& P$!PP tQ PT TTT 016P T,PcP0** )(,*,*d*h*(*p@-H`@PP@Pp8<Up*,,PQ /PQ/**O- MqQ!1`Q@P(QAT  PာյhPl0d `P  P ҵ4P `00( @ Ѝ(*,*,***0**(? R3/1!@R/,*0H-8P@P0+(%@04*H- <*8*A-JM PPP !Q $@P@a$@P `X@PLQ@TP@8$@P@ `Vf  P@ PPPPR~F?PPPPP:~ 0` "@f峫8*(*0**<*,*\***d*@*(0H-@Q P@PU PP00HGD*(D*(p@-@ Q!- P ,Q$`P   p  AR \PY  R,P ԩ@pd*h*@*@- Q @R P J Bpp ӲD*(G-@'PnPPP Y`P3 P1 @P`'#cP@Pn"``E@P_`\'PpUWG 'W @PHpV @P:@P/@P$Z`P 'P p@P`V @P'PG7"D*(0H-D@ᴉP'JnP @ U0P0"H- H*(*(A-RP`p@ ᩰP P 1}P  T@:pGWPH0H-T@TP P f P0P 0H觨0d**(h*MH-M  0 ЍHЍ/@-M@P ^=Ѝ屨 MH-M(   ЍH Ѝ/@*(Mp@-MP@ , `,0 P@PO!@Ѝp@Ѝ/@-M@ @ 8 0,@, AL ЍP*ܟ*ȟ*p@-M`@P )P `% `PVH@H P@:Ѝp,"X* *A-P``Q=QR`V X@' h @A@pW P ZP @pPpX@A *p@-J\P@``w`@@TM%800 4T`00 p@ *ne[!ܧK-BMX@p`PP   p+PBߍ\*0H-P0SR0S `@00SS @0P0PSS@DR D0"H-M@P =`P$ pU )vp@pP AQ =U `!Ѝ b볳K-BMXpX@`PpP `PBߍ\*x*A-Mp @ PPTPPD `V Oq R < 2/`P   P00  !,BP!,V V P!P Ʀ :  #<0 `b`]  Ѝ ͦ )(˳d**l*h*H- M! 0  PP -P -P0Pc|Pfl6QiFQlHQpPs,  Ѝ`*X** )(8*޳p@-``PU @5PUPpP p@Dpd*h*0H-P @PPU0K-MP@-PP7  P p `  P0` ` =Q =NkP( ~ ' `c P/m P!W  =Q A _ L P P@0P Ѝd**P*T*)( )(ğ*h*0H- @P P Q 1/P @0p@-@ R 0`PU0=U=UV =jPp PkP ` Q 1/P ꬒ*0 R=R/="o/A- 0S p00S0W 0R:@`pPU Q Q 1/P`PpW: *H-P`@T p  岾 ᭾@ }@p@T`V:H *H-pW @q^PsUHOlPl`'W W ' jP p@ ?@;@pH3 !, JA-@`PQp5T W =P @ AQ ʆ 00 =PX xd@ AQ l 1/P PPth @*(\F!O- MP@0P `̀PPpZ T    U Wp[:L0 }g`W @ 0ppW Ѝ輟** *A-@Q)p`=]iP@=Yi@UPP@@Pʴ`P=P@Pʧ`AR)()(L*O- Mr`P@rUoP pP nPVk@`rUfT`@ aT PZ V   0O ЍPQF pWC `   P=XPP T  =X T=X P% T U R =X   pW8 _ᇣ! T*/H-rP |z먴0H-P xP@MPP IP@NP xP@@4PP 0TWT*EH-MP `P6 @  R/ pR P   媼᥼P P Ѝd*"h*A-`@T. PW P   j z R   02/ i b@Tğ*)( )(H-PH P 3Ţ[K-p`P+ePfP vP xPP ePe@o8p`hP /o"p@P³PW BPPP{T*0H-@PrPPErP0U*<<@LT`00P 0(S !S p o00)S R p0KIBP"˴ʹ״0H-MP@!PP `P Q (P)P .P U U Uo!PlP u P >Q  @(Q oЍ0EQ 爮 Ю  ,<L   \h     @  @  @  @  @  @pt q @ @啪D*H-M@P`tP2 Q/@PذHԱ4`ܲᠪ@P ᚪP@ `0pV @ P#P`'0Q(Q !Qop)QQon@P hP@ `0pV  P#S@`'@@nR@Ph LPc 0#"\ 0"#"qq@P qOFq@P@?@`&$oB3x@`t&$@@(m`piV@c`p_P@Y`pUP@@ N`pJV@@$ލ\t*H-M0 -R  Q Q Q  x Q PpH P  <4 $ ,  0Ѝ""t""@/ 0Q@/p@-M@t gP`tP t "Rq*P P 00@RQЍpG (H-@PᒩP QC C `%VA#pPpt`P @QAឹO-M`P@NT~pDP-PpkPPr -P)Pf lsP8 lP!PDZbZ<Y @P@DTD p@ P s@PPL PP P&PT僠p>ԟpDoPP [PXPZJtoPJZ]Pp @%P`P5 Mpv $@UU)=%s  k`P RP:9sP pYDA\ \@pZi!0"E@*((\+NY". |,"f"B"fH-M( 0  SJD*(*ĵ@-M @j R 1P ! PЍ ᦟuH-͟%뢵D*(0H-@M?@T P=dP @T @0@ >|| :x@p 5d0d P` ,PP, (H $@Ѝ0p**l1!,H*(B e[!nܧʧ@-颟P  @t   Q  =PH@HHH H0 0P  `****Л*)(,*(D*(*(@*(*(0H-㖕@@"f 0@S @@Q*lPJX R@@TP,P 0Hꘒ** )(((d**h*0H-MP @  zP   nPЍ0H-PW a@PPK ܾܾܾܾܾܾHܾܾľܾHHXX@@@@@@@ %  pW pW {l  olPUPU PU x"p@-P- P`@Pi|\\ @G 6 Q  00S) ! 0 00S px"P/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /uP/rO-M-(MP l@U!%aP EQ [p\  q%Pr%P  G}*Pt >}.X @*P|@@(+}@X `Xp.aHP((`(`````(````(``(`P j q" tV P  `P AHPT`IP $'Q"Q r A tH 1wpp$$@ ` P  L q t# L p t  4+S +S t  0\ZXX hP`P j0S0 pQ Q (0 8@a,&QQ' "Q& 'Q\Q ' P  M   Q?^n vbtfreQ^@-hgP`P pP PPP \R R PP0]S 0S MS ^R+ -R PPP^S" cS} " &PP0@pp 7TQP @P%PPPA P cl Hq+ t,  0m$5P0p 'psp dTt  +S+S K 0Gt  A PDdPTt  30 , pЮ@ T@ x ns0p w  0 0 wg   {p p|#pP\P PE `@]P 0P" MP^P -P `^P cP'   `#@ ?P `` 0pp 7S00CQ`n 84aR 6 {P \P ! A AQ ! 00 nP Pfpp$A AQ  ppR@!/  ך`p LPpp`E& $(ЍЍ垚%XNP pBT ` ! @*(**v"(**ֶ !*P****(*, *ݶ*D*(A-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P%@@@h@p@x@ @O@@@@0@@(8@@V6 "V? 'V '@8EV@4@2 @0R 6@& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRdXP@"@`EQRP(8*cp@-M`@T" Rm ㇺPpXU @@ BA ̙(PЍp*(ɷ**H-`@P p R 0BR0 00p pR AQ ʐ @*@*(H-Mp@T 'P"PЍHKP`l LdP`+P-PlЍD0 (BA V*(**K-`gPAU:DB<P0p@E S@@職**H-MP@ 9pf` 9p UP d\ XAA <4 4AA $Ѝ***p@-@P  P R A@tl tAAޘEl"Pp<<DP`A"&F0 ̘ p**^:*A-Mp@d\Q  0 P`P8  0P`P5 pW1 P<U uUgP P *P  PQpP ^U-P P?PPPHP,ЍL@4 c`_\""("}\0gp@-M@D 0h``Q TP `  Q'P Ѝp@ꦹ"ѹعO- M@:\P `pᏸPPp =t\Pm   kXcX' iX2 JgPO  EgP(p  v$?lX oX< 5gP= , 0gP  a(* $gP" gP' Q) PX gP QQ  : P P Ѝ "bh""!bh""H-PN  J p@-M`P 0@-Qo(@ P ( R  Q4 1/ЍpXU"-fH-M$ 8d0 }ЍH-(Q @0h D9+̌K<8<@0 8D0< "8 < D,$@@-@ D@09+̌@K<,@8<@0D$@@-@4}0P8 MD0K,8C D/H-M$ 8d0 #Ѝ@-M@(<P    \,Ѝ`tH-@ pѝPJ8, Pŝ`v;#PQ8Q<Q@QHPDQEpGwQ\Q`,ZW @-@4}8I,( 8R <  <  8< ,/@-@4~}8,@-@(P \D0@ )+̌K,8<@ D8)@  @,$@@-@4U}0 0&!H-80H H-M( ˞pЍ tBH-㿞pnt KH-㴞pot U0H-@ P@0#Phh 80P TT D0P@@ <0P ,00"X""t""H"""A-P`Q @< ]p8;"3 .`^P% ^P5  `pb"P+ 4   b"P ` _XJ XH pP : / P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMo<pQpXPEpUڈQWWaW&00;p pT&,P  JP  PG@P* T<@pU` :I%@5P0%0p PPq@UB<dU PP`U0P5 U$ Cp1PP@=P! U  pQQL  U @PTf/TT $  1@P @@ㄕS#h ptp@ FPp la#PP4FPJPUi PJP ӔoRUW  PO Pfh`C`V PPb =XS@P  @P p P NP P㏔A!XPA` d2@Pd@\ Pm 빔DH<**"6%F****$/uC rd******l*((**md&r , P*(W "a'jQ n|,"!z¾p@-@Pf\P  PQl `U UPT`LPLPLOo0BP 0@ p@p"fx*X***|*H-x`xP@tpo QQ P 0D;Q0 T ٮ@X*\**,rC G-M\P``@XLLPp  0` PVK\"R(8 @-M" @@P l塮d!0!@"pD0" N@!m@D"tI@Ѝ< "0H-0@v P P$0H$0H-@ P QP ]P3 yP 0H *p0ȨPCP PPtPK@P@  P ( P0(될*edA*s*"**P*O- MP|0X@ ? Rdd!P5P( 1, @-0 4)8 (%4 !40 P"!!4S !4S !4S !4S !P0S d!T0S lP= 4TqTa P1  0?Pa0p 0 0S !S1 P   0 Z:   ЍOQQA(l" x<! "!BB!O-M@(P* ,P) 0P( 4POPH8P,08<Q4<P (ZQ D2$ * Ѝ#P (mZQ 8 R* 8` aAQQp@BP p``Br 0v0hS pRa`P R (v<Q v۬< QvѬP PU*v` R 0 0R*0 Q*b ᵬp pR:ppW:|7FWj|ܿ*WO-,MM  (P 唬P pTcJP@?j@[& :NP(K (( ,j`V ( YP  YP9  YPf   PP PXV  I(@`P ᾪPg @`\V:  0,P 8 pV* 8JP% H`( ᙪP  ᔪP  ᏪP  (p YXV @P T  0P 8 ׫p\ @P({h@x(dV`(d\ YPd L YPb < XPj , XPx  XP  XP  XP  XP  XP  XP  XP  XP  XP  XP | XP a`@VP x  iHP:($| a@ Z5 N TP 0FPFPC ?( 03P3, 0&P&8 0P0 0 P L< 0P (4  4  0P  0P  0PXs  0P e 0PPX 0PTKV*V:   0( d"( Q` (  (dVV $9h(VP \@`V AV P P  9P @[: P ("! @V`(dP# <g(P  04P X 'p@"T:@  4@@ @(t P<( ( =tP P(  @(l!Q P ( y(@!Q V ( k @(!Q P ( _( Q V @ (R( Qpmp,Uo,Ѝۍ ᯩp긤*SA"]\ {!$Ghv*d* "(nV2T*""p@-MaP@H.Q)`P @9pZP ZPQ  &pڄPPH8 p4/@Ѝp$$喧긤*WEV*gdY*Hmd&p*(`H-$00S H訏Zl*(@-@Q f/mM@긤*YV@-@zZPP PD P P00@i@,j,  p*(md`*O-MS+4 *0ԯ R PШ8`KO놔X @+pkB I!  dfQ f/MP{4Q ,P(P  Q "1QPpQ: P |PM 0tF\!1QA0DP= H 0c5 P  0WP1 n P! @  @< f/LPɯcP d ߍT**T*VEWP*!}}*WEV*c*(**4O-M`p@ PPP@, P4UP6? QQQ Q Q8/PP@Z Y  QhP h ἧ@ߍ8P 0P ᨧꬠ* "CfH-P 踤*H-MP@P  5p X"QIЍ|*H-MP@P  p X"Q.Ѝx*H-`@PspP RR! P0R* R v LL fQ4> 똠*T*T**H- 0,S P耠*p@-Mh` R@4T[(0PЍpp4   T*T*H-MPRP@ p`ᔥpTX""Q  "QOQ QQ @Ѝ(0H-PP @P <]=P }dP@P0SG-M@PPQ 0/P ᚦЍ /Pt` 0/p8pP 0,`pP   긤*d*Vp@-M@PPQhbX` 0``P $S `Ѝpd*V Q 0P #:r/ Q 0P #:r/O-M-1MPldኟ\h0p!X (  P p ((D `Q KSP> @T1P@0@aT=:aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ gP `"V< BX " @]0S  3/0`@ " A@ mB*      p P' AP@haV :^aP @< |xP4"*  0"q "Q<!Q* , !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! 5,,C w4P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍ,?"!J"$>l{*(t*M0H-M@P 0厸\ P Q Q  IQ  Ѝ0HЍ/(0H-<<<@P ; PQ `0H1"!p@-fMMx0@+p <4< SP D 0 P yP<<fߍۍprdAp@-M\@`X\ 0S  P nP yPcۍpt* $!0H-@(( XP 0H(**O- MMb% XuU `P!TpY P ?P @ϢP @T0iP:88  @@@  0/p4 P  #  MT̄t `@(p P  P vtThpt `@( p P  tP ](Tt `@, p P  [P D,S堃s `@0 p P  BP +0`S<\s `@8 p P  )P 8S؂r `@4 p P  P 4Rtr `@< p P  P <DR@r `@$kpp P  P Q嬁q `@$RpW P  P QHq `@$9p> P  P 0Q䀟,q `@P  p% P  P |P@倀` PpT P : {P dT Ѝۍ (*4"2Xn"9^}+Kl )C"p@-M0@  0P  ëۍpR 0 Xꔠ*(p@-Mt@xpt 0S  PC@`P 6666*aۍpx*f! 0H-Mh@ PP yPP 0[ Qaۍ0vRDO- M@P P|X `@p`1NP@pX P`P1 BHP`H@NTP:daP `pP @P` XXX Xp As Z*MP@`pP @P` XX @T Ar`@P`XX  Z姘 ЍGzo9(gH-M@p $PP7 P`P_ bQJQ#KA P[ :;:;;;;;;:kA P :;:;;;;;;:D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0 Mă4#p `V00p d%Ѝ@x*H-P@| R!r0 m0 h 0CX   0CX  0CX  0C ᬡ( `D, T@0 H<8 <84 04< $0$,$ ($$$ P T   0vCl!R@p\`Pp pWx 0]CHDdk "vr"#3BTt2"!O-MpW `S 8@T,PU5a 0@ !R! @ Q8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:p脠*@-@8P wf/@C谠*@ 0S3?S q R3WEV*G-MP)ڤ 0P0 Kꈀ刐@p P pa &`;`@P`XXX VpGwЍ|*"zo(A-O dd0@T 0AD DDP`H0p`F v($[ " K-M@`KpP Q Kp||`   ;b`Pp  `2/ЍKl     "|***, K-MPJ@P ;PC* ; PA*O  Y`P8pO "Rq1*w1ڂO  P&tO"P p# 0 ` |p bЍT  H `T0 8$0  yd*'|*s wOO- MMP@($KP[ KP JPC/p   P} 开帀 p Y Ġ (ƎP [(DC Q P XT 0`pP @ppW` 0QBBR}  Ճp X  p@ 0(X RX媃pRZ` 0㴑`A嗃 pW |X9 `XP KpXoP&;$E p  0[, Pv[@ 0L 0V`pX Ѝڍ ` &t0(, D!I!*(wd|*xd @| x!+yAU@-MP@  9P*DD pЍ,0( O B*{dЀ|*s Rp@-M p9    P @`           t   \@ Ѝp< *td@|*!+O~}H-MPxx@ 墂p P`T 0 `<{Ѝm *zd@|*p@-MP%@ yp , qpxxW@P ` 0GH L0C 0 EЍp7  *d@d@|*p@-MP@p`IPP XIPHo"@  2pЍp$0  l$!*wd|*s O-$M@䑟Pq` IqP p eP]PW儑 @ @@p аP Q P*dP> @p  p Q# )0 ; p0R0P P`0p   `@V:Ld$Ѝ(( //(<*|d|*NXd!?@-MPH@D 匁8p  ,pЍb0*d@|*s p@-MPBPP? @`3HP .HP )HP $HP)` h `h`U\ HP`HH ;pЍp00, ujr Q Lp *ud|*s H-PM@` (*KpP( p (KV V(  ` 7 Tp` H0( PЍ(4 6 1*}d(@|*"@-M@ P PPG P<<  ӀpЍ 0  xQ吱 `    >P& @p > P (Pᕊ 㱗S@P pX  嵏Y*\Ѝ3X  T 4 `` s$/(}D %"yaratcid(\e, 8|D({D~DH-MJ ,$0    (O-$M@P)IHXA  5  p= `ᾉP7 p  p0 P/XpP`Y ZUVT  0XY$Ѝ D!!th 0H-P? @P' P P P P2{ P P)៓ P0HV(@0H؎} 00HPTXVhP04 scidtcidrbmngntsyaraloob, # P-"O-cMPo/00@ϟ娯00/0p☏嘟o40,00000(` PTŚH\  R w  ?B   Pz:g`P [/9P 0pP  pI 0W[ /9P9 `6H@~D0 UP t|P6J}p  4` V. V. *Y|P UP# l| D`P  p ,V /9PP  p (l ߨRP!a@Qjegfhhgbhbhh`ghhhhh`f|fhf$blfhh8b4 0@Q&A@Q`ehhhefhh$f/800gP8P~QxQeDf0f8fP <p<Qp ʃSP  `/9P p x p`/8P @|PH  P\8 Z<*?8P8P -oOP0 PEucߍldʴ/pMPQ+pQXQ@4Q@Q9$Q2 4 0墴 * D{4( R( R Q(  /o"Q`EQQ! P-b? 㙔p !P @b? ኔp\@( P D@9|PH  P?l 0[pno"@PT zpt~O0 ; pGP"塕w@|Q@|phOh/ |p8X8D/ |p.4uIH!L1  |p@pr   + R< 1>R B ?0|(p,00 4p.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rl 0 P H U,zp  y4M#z @ T 0LP 0-P P ]Ln/99o,U  @aE,| ,P P <|l\ PP,0p`0p`}0  P  P ;d ՒP: >@PEQeQ*(|*(*Q  T@mPP[3 [=J  L r .**.9"`, (|2P 8C0c4llsP?  D0P PPP   0P PPP 0 PPP P  P,PJJPU@P }!8O@|P pdR8bp? p ppp @P 1!P !Tʘ*(< >pؠaoUb_]  0* P J P  tPpW X#@ *******UUUU3333*(|*(**, *******t*(**( edA*J\[V*@***********H*a*e~A6*(SBe 0aaAf@- MB@_=< 4,0     00(!p@-`@Pip p0p  U ,`P @ ` RP , 0U`p*kK-!Mp @P? %` `p, \ 5  l P !  ^ R \A TP P Ѐ4P!ލ !ލKyg*qO-DMpl@h`t[8 ~ Pp4 P| ̂^ *p@pP<=<̀P@  $@9@p  ^ $ P~  0 p *@  0l p0 P yP@p@K\ @p@pF@ `@ 8oRPZ[X <, (p؀WP90@ PQP S `  \ % `P `  P @P0WptP PX PPo8PR D@ P 0P[ `@(4, P<P/ [- P4p<V H 2QU QV 0VP@`0 R :S p<4P pi4<, P p8P U?ᩐU0  W|f 0X 8i[P`[   [ 0 0  0` `5P 08@ S(pPQp[8p g t(<P P@^ QR@Px 0T ! 0pRppp`Y```pPVp` 0 0 Y U Pp<@ 2aV a10P`W```W@p 0 S44 W<PPH|z<@ 0S0QS R0pSppp`Y```pPVp0p0Y0 PP `X a \ 0 : P8@pVoppp"P @ )   0` pf<(0ePZ   0 @P v   0 @P  0R PP4 \M@-P< Z  0P@O 0P@ P<Q Z05 $QHDX )'@  4!,@Q 4   Z @  0P0* ,04 @0c(@ ;pPI;4 WE p'?Lp@p@;`PG: V*!0r@pIE?W f Qd `P_ P0 !C0ppp ppL@ 0pp@@ ppx? 0 pppk$?AP@ !0p pppU@ 0@pp ppIP|  ? 0 ppp=$?@P(@PP" `PUPE>QQQ<P`@Qb(,><0@DЍXRLO*!**Sd!**@***!*J? , *** +;GO- Mp @ R,PQ-t ЍOKPPXK@PbPP 0PUP  Q P 0 T * 0 ЍOP; KtQP5|t)`p  W  0*P Qn@  0W   0*@plWP " RJQQtgKd@P ЍL ЍO5** **%?!eK*6H-M<<Pp<,!,1, 0@L0$!1 0@$0ЍHK0P@ 0` p`P K|||p|` 0p@@ PpXX X ЍH**(*(**@******H**lu* M0H-M@@PP|qP P p @P_ Y@oЍ0H Ѝ/ 0(e G-M@Q/ Q, pP`% P%& \ K0 p \u< ) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ**#*HO- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ P!}(6B\S BP}(6m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @zP4 U ,   %Q QP P댰Pꀰ!R$ @@0 Ѝ4l@****B**0H-`P@T 2@ * $p@00*O- MLp`, PPؠ*@AP 0U $ 0 W PPPP@$ ?D 6U U E㊴` )\!` G l$!$1p2 @2G Y 1p@A 1p  Q@( ?D+! ?8  Ѝ*G***O-M p> pB1!?! goP 0-p  R,ЍOiiP 0- !  PG,P+) iP Ѝ|*(*(*O-kMM%嬵u崕eEP-0 800  ecPd @R/0HHHHHHtHH̯HHHH̯PP- TPoP :` p &P @T" 1P" @[I   8@$,  @   7 pcC3NPQ nR R oR|ᘂXCP   L ᎂP@Cep# U A`@  ᮸pPp/(P P"2 Pp%PP&  ㎸Pi p\@1P D1P 41P\  0P`:AT @PY.;㮾QpA  p%jP .jp7 h^p/Pa@P/"P,*<Y+h밐(!(1`kߍۍX/ 2 &xd.$.| |>!***$/! *xe,*B"fn $*(*(!;, zd@0*edA (#" X`H-`@P᝹pxu  p H-l4 0:2 (#A-`PV .p.@᜹( `0F``{ p@-@P3 P10P ,0P '0P#`V P0P `VpP \P P`V P0P `V@p;*,**O-MM0@TP `/P `V@@l/Pd \ Q vT p  0$N @P8  ڀP0 Sp@`@ F[`P -P = q$P p   L q᱀pP @ @  a "V  T JpBP W Ahp @P8 P x xV @ LhP x xЍڍ ^p P P!pPI ,QP 8  ρ @ P /P7 ?0010A4,Pp[`   3P [   0S3PP | p P hh!*;U w!(*!B"k * )!",""\ v"!  s q 0/**/*/* M@-M0 @   C ρP(G-p@Ԑ2QUP `Q P ῔tu`UP GUP @_2 $v** *R ` MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ӽO-uMMرNgp@ @, ep ppJ gP-JPJn@  P*  P oD @pP   p ؼpP' fPZ'%8%<5" #P Pfp   P 8D4(l uߍۍ*" , *    H-M P DD 000L 0 DЍ*  H-Q 1/ f*0H-10P0 @d@1x1P0#*@-r1@10h1@O-CMM@ (000 $4t0 0尀p,IP `P 4/P 8~P P0P  /4PY  (`  06/PR $P , P ,W WPYPYs C/; 哺 p 8 Pf`dv ᐰ X+H * @  `V P  ,PP `ε` ᩵0ş 1(<0A 41,Q,! yo8@`PoX @Pp0p W  AQ   P  mWNW YWyWnW Y@BߍHЍ/** *k (c $!G-MP娣c  Qo a@p P  a@PJ4W P  ɻP ûtrqPP\"QQ;\0/`c\p P:P   0`X  0p s`M PU:P :`PkP:`P^ `WP: \`KD pP  @0` ;T.a D)aPЍP+`xpW"% %UV ( PP ` ` ` 0M`Qr` D*** Y%  3       ) @ [   O- M0` 9bP pW PXp|p1pPPLp `pW!URQ <WIr`l, @THP OPLQ M 0 Ă1@! PX0@0 ,oPoP DpQD#r rqXYx `@@ P' ! `o 0D p Ѝ$^$(* X+HP#,30 4080# 00 C _P;L#HCPPP , (pPR #0 U($!#0Ap# 00 < _pP30P<@/lr X X $P, ,  RTPL@c'DPB QB* " ,B.0p40l# 40   _PA O A P3 X4$ P `0 R  `eV#3 %q #q "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@V n    RRaArrAa& g!I `    T  ,     H-MpP`n@P p00" 00 " ^P0< @0!10" 00  ^P p pЍ  I O-$M`lp 0@P PRjP pB* P PP7 L P p@0 @P` Rp@0@0@@@ LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:opo$Ѝ0   G Z  G-M@XpPiP  d 0!!  X ]X Q $x jor Ѝ< q 0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! 0 0<P O V 8 P/ p5/1/: V b "O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ f : V b "   g!@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍ  V  : V b "i K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `V O- M`XP@ gP 'Ul L p $ P&#t 6 H0/LpPWPwPP   mPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 !  PZ P @@ Y:@ll@ Ѝ q O-MPpP@P;:`@Q  Q P`V:&  e 0?@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P *6P PP:"R PVB@Ѝ40`Pl`<@ g!3r":  A-P W@Bhf`V` af@T@ |P p!00|kd(KHfP& (K%D8Q:PQ*" P:R R 0S% r:kkl\`8P $ 2 p p p **** Q # ~ a p@- @T 0@00T@@Q p 0S @0S0S8P8@@Uk(`Rk@@p*******G-`x0X@XPpP  0   p ***O-eM@0 !P R:PpR*h XL8oTHpP$\ 4@0P<@(DdpPR \0`0C !@Q@p0 ! ,`0PF Y P@ 2 Y`0`\PL@(dp( Q Q ( @HP YF iP- L(dpp(JD"`PH@ @P< 0lPB TPD @ P* P: ```0PdphP(`0((^a@ PD``@@X 4Q$P; X 8TRpW p T1 K$  P | Q@ P @QtQt9L@@ Q.  0 p R0 PHJ QFP B @ `O0#4X0 oS8T4 Tp 8PX TQD``P8@@p X @P< 0@@PD``pT  Z3q@ pq4Q X 8TR TX @ dPLq   0 T } ,+4hlXX2 \ D`T8``pL p;TB\@< P P0pD``!T2 8|`0 @QR g(hpX;`0L@P"P8 X HTTP P   Lq  !<p q``0P Pw P    XpTd | X  D dp$ Q*T 0l@ AL``PpWP pE@P?p pEPT0U: @ T:U\PL`*  @A0`PpWPs pE P?p pEPR0U: @Rd:L`U*\P p0SPZ 0pW?p00PQ Q:M$\PPP*<  Q0 ; <D`b Vi XP v|:<u | v J!T 0PQ dPLp `EPN  `I E\PL`Q*@dpD`X _d 8XpRTp T@D`P `@IWTp@` XpThpXppw`0 @Z`q`0W:PPW*<  `pX`0bP Pp)W W% P PW!*<dW/* !T0`0P  ' ''$qp P P.  `)(GPd Q: xt`0P PpAdPD`Q*<`P B PR:``0.Q  P+ D``P@TP R pP GdP `0 PLp}" vpP `0RV Q `lPc  PLp"  `%Ka@P  K/8$@P  1D`aP #`0@@PD`=\PD`\P<Qm*Q1  dP PL`0p ``<`"PD`P\P`0@gPphhX!`L@(dpPDP>  L@P<@ b"  2 dp@p0@,P 0a` ! e"@TP^0<@dpPPY h\ "R:P\ R: Xp0`TAb!HB P<@0aX ` TR8pp:p@p P   0P@p PDP  0,@ 0}! B wTPY\eߍxl 02* 9 m  *   { Y <     Z ***_ H    > b    v O-OM@ &`P ܢPC RpWd`PT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $ ! "d  TdPpPUP q OP PUPXp`SxOxMhKh x@! 0P` d 0QP,Q 4- f [ \0 Lp0  4 4    P ! Dd  Sd`P 0o`Oߍ ** **"* @-@P Le*A-ppP@/`P `FW @DTdPU@?d*O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0  ! * p 3SP" [* p 0 ! l P RP T D 0BT Ѝ* v O-ML@P HP PP+ Dp $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 !""D`6oD`#@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` =}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p -D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,0ЍTU  +0 BR!q p/G-MM`RQ:@ +[  T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  6P`@ Vl# 5_ Pq V 0AQ p Ѝ LABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# tl@1/p7 4P0PP R000 >@ 0@@ E` *=@P .^;  Pppp ЍۍQ0 ++x++D+p+@+H++O- M @ ` 4  R000 =p0Pp3Q  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`ܻQN ULVI  dPB0P`ǻp`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ+++p+ +H-M 0ЍH-AM`p(@P/N 㬥 0P@AU:P: @;P T0P ?s0@p:48 S /$/Aލth +p+Z!*X!  G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF j@PQ u %2/P |$Pd;P Q P wpЍT D ЍG8 P wppЍGp+H++h+ +*X! *(   {  +L+O-|MMBNX2 ^P` P /r 6* R . c pP dP`5 L$D:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 #03p@$ P$`4 0S R AqR AqA"tvPQ  a  0 [ Q p  P+?PI p `@  0 t `@P:f V<S @  0! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-x"e 0P0p$h`S?BL? @GR q?p9?   0T- p  0iP{ *xp+ *X!+L+ & +*(b0 H *(+ {  O + +    6 O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR (B(Q 8B r4 0S @PPPPB9P  @ pTQ p H24 P0`   4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `+p++*(D+*(L++*(O-MMZ:`P 0Z0*0V0: V* Hp@J@`` T)`pLWpPH<0@X@0 W t0 0Wt  (`_ 0; W X  Fp 0vW@X  F@ 0eT Fp 0YW  F@ 0MT@ FH >:G 0 <  @<@4 ([@  P 8   & P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE g ( 0`_\$ VSP p78 p(,tP 7 `X%p 0 pR" 2 /h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg Js0 ,07PPPT J_T0P q0?Ds`Dc00 Q(`  00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) TPQ$` KPH 0 8@pP 1qh 1H!0` R 4P1h 2/$B2/$`P $R?0, h PƟ$B0, 8 ; G)P 5P  xd ̲QP $$! ",pL ~7P P $@$$ PtX$2 p PIP $  ! R  $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R \PYPH1DD  H +t+L+`+ +p+   +d+O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0ƚ`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @ᇚ\5)S A0 0   QxP v``\ p?L/ 0[0 0T Ѝ+++ T? X   O-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰ?k#"\5 @++`#S !p0ϠB'`r! xpHFR d0! T!Q0ϫQSp ee7 @|"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hp oPp7PEuPp7PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P  T:@ 0  1<0h,Q ЍT0"++++++T+++++\++l+L+p++@+`+ G-00`P@ < !``0P0p P`H p8W P5aO<W0pT 0P `0p@ P` fYP  0d"8b"+ ++++++L++++++ @-@P P+O-M  @p WR 0 `B? P``P0V8iJP]  ?_t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q ppMQ d 8Ѝ !L+p+++ + +++  0H-PT@ ?@P !# " 0 0!+ ++ p@-`@P TQ HP`@^OV*YOPVOp + ++A-MP@`pBW(P q1 Q! !G`P H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝp+|," *X!+B + +L+8+++H-P 0@ᒗU :xP:@X儗TP HH Pp Q 0HP !  Pp P 1`PP qpVP N`Pp P  l0?P(Q 0!4H0H +Q +L+p+th 2"Y + b m @-p @08@ T 2/`@0 &  t  D ЀЀp+K-@@P`V DP pP 1QT 2/ЀX:P 6oV P:pPap++0H-8 B@$|0@P@00H-M@ Pd$0  P @ yn2 AR: Q Q Ѝ0! w  O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p -'!% U R-: Q ``W`1uKP p  ! P* F00 R0uP Ma1`$\5S !0 0 t  ?[- 嘄Q P QP T  \ P PP 1 0 p! Q\.0 p؃pG pL$  Rp$4 G  $*/lP  =*Ds  X  X  X80 p /W "pp R } z溯tQL 0P(r z溯H<emD Rzd (0XⰠ{t!Z !? T pb;wr0 RSrQ 0 Z   0   p3P(& dⰠCtP 1 ? T pb;wr RSrQP a 0 0  ph||| 0Ѐ Q 0 $Ѝ+++0+ T+p+l+U  H++L++D++O-tMPs0P 弐4#@`(3\%R !0 0 S  ?, Q P QP kPP X@Xx dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , VP @ P$0`PQ d h0PpppP PK1P  R0V : 0  pp!Q\.0P p@Lp$4 pp $   $*s-`P d(P P0@0/ PtЍ(`a++T+p+l+U  L+8++++H++O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PZP YP" 0 l? `R w Z2  R4 @00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  pQ( 0 Y *NQT 0 J w*  0P  0q@P p@  0qP 7@  0dP`0 9*JZ0 0PP Ѝ +p+L+  O-DMhh` pVWP W,PV@Pp0 ` W ` p A  hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R ,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `T Wp   @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R  0  R  9 0 ,  $h T 8P `",00 08?R00 "<@ R f40$ !   ),@`(  0MP  0B! R A  04Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P    0倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0L+p++' G +0H-HP@8+  0 t(@0@0+O-MP0@,b8P 76u$4dpppp cTP!a@Q'`zz,{{h~{h~h~h~h~h~h~{{h~||h~h~h~h~h~h~ |,|D|EP FP PP$UPl XP BPzp8Pe (P_  0pb X p PI x PG hc 0XP@8]Q&p m0  R *Ḑtpn  ghpaLTZpTdPKpp R`Y P  `P  Q`pPUW PP lP U3@Q]zPPXX  0/ppJk`5T@bT@+oyGJZ@P@Ѝ+Lg + *(F Y +    +! ++yS"+ C ry ($/ I +H- ⠐ㅍ( p@-M@P` oQ QЍp  0 O-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0 0~d@!!P 0v4$03 0 ̳-cPe s$ @R 0  PP 0 ,po0So7W'|c4@`/8P@`u/@p2'GP# ` X0u'  0  P PU B ڎPU 㛎BP ώPU B ȎPU ㉎$"0000pRP m\b @04*<y(0P # bP.' ,P ApQ E ,pW:E1 0 S P pVlP@P& PDIP 4DP $(P (  00($0@$@4P P)3@Ѝۍ++  h++   +3 H+Q t     $+ ++6 X + +   +  +X+H++p+d++0+ + I "w!i O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@HL$00P(Ο_^A`NP`PAUP Q pX, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  GQ P QP  hlQH@P  X pd,`4| 0` 0PPVX`Az T*d@A`0>P p(@-p,ppu`:hp(\ l`pQ @TQ`P +`P  (l0h T0  04%TP p` phpPW POK00!  Q :0QQ: \RVO:\P P 0᠌l`hp< 0o\@$"P Q, ,+؋V@(0 JhpPX XBPS l@0 C}"PQ0 @,/-h B,` DP1  @@pwQGZ"hPBl pR4 Q% }0# \l`dPY`:@hPQ ]0 ? ? 4`_P`LPp0 B?qJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@u( T`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? f pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN<P> *l`L@h0`P`D 0>L:0ST0= P!  P  0.* RT * P P  0 車t XR 1 届  P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 +++TPtXdpP4 `P TP0 `h@ \R 1Q LHQ  0 Pn ?PT@\ TPX \Q 0PP  TP0 @P@PU  8++++0+( TR\ 0\% 85 =LpT ? pb0 RSQT   % R <0t p2/+L+@TP@ P 4ᒡp  %PP l$ R hp p+l+DhQ 0hp 0! +  0 P?P ly `bP  PQ # R +H+Q 0hP 0 &$( Q 2/Hx-8+8+P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,j>Pr pYXP*(D p/+  B P P$ XP$\T T0 P@T0AX`+qX@`q,@T:T pk@T0gp` @0b  P?Ѝ؍| GC X 0( 9H  ++U p+L+++ 0+5 8+@+\+8+D +X +    ++  +H+@+P++ 6 ^  L# , o K t+O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;9PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P `t`P d lP@PPe<`P  ЍP ## @+ + ++! H+++   +O-lMPX堡1 0 X,QZ x@P Q  pd,` ( 0`Q4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ++P++ (L+p+O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp ЍP+! +O-gMMm"AP 缤H<H v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPR , , MP "( 0|Y|I,x9  XLT!DP8 78 X(p$А?@$P `pH@QdU$ 0p廆p(P `P4`(PE((PZ4(`  (RY Q_ !]A_  !'( R   GP @@d(P@ET(PP& (R Q Q  Q      4 84PU [ (@ 0 @[- (@0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  Z X (@  X (@  (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd 5    p+L++    D+ ++ȯ+j (+H+ 3 +{   x+ + N 00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V [PJ {Q 0KQ!(,K HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  \(@p TP  G A  PP@p`Y`Q 0\yQ!L(, (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qWpW KP/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0dGP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h`1 >B&PQ `@p 3 p-P  0 A@ 00 R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P THPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  L+@+p++""  +D+ + 7 E l }   +   ! R \ +  4 H+<    Q/0/p+O-MpQ\`s/0 AL0 Q @K `PDd 0`P`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍ+ ++ (+h+H+++ & L+p+Hb! cO-lM@Xc,Q B Q pd,P  0PQ p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_,`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  0~ ` 0`0 6 Pp@Tx:,`0@,XO:lЍD 0!++:! (0+L+p+! !  +b! ! +! O-,M<(@p`P? $P4\%R !0 0 s  ? QQ P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?LH0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!5,$P p@`YpUW(A*P &P P@ P,Ѝ(@ 8P `P?2 L` e"cc`c `US&Q0++T+p+l+U ! +++H++O-MMLLPp@$@$PdpQXP-$P'NP 1PXP N.$``*P v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pPZ2Pi L,pPP*   P , PZ pLq P 1PpQ؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@X$o PP0 XPUH%@D 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,P h0 Ps|p?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h h P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ 'P @Pd$P8 P`p(@FύT@! S0! R !X  xPh PPD,PLxX PJLp P2 PAP!<l+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dX)QD! !0)QHPE ++++ " #" H+<+PET d  aPp  EP R$P`\!08 818`VW$̷P1`P. \X0 p`  +p+Q $UQQPQPUp0t :" @" l" X" 0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  P0 P · A(h 0@x\P  E*P  < L+P 崐 |e|E p,pW:+U d  l`P%PDQ\T ZP# XkP d $P\TQD  D @++(+P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ 8P: PP5 0,"P\QL  !" T+l+" H@%^ PK  P D0<@`400 000( 0000$`,0 0w(pP 謀0 *J|P   ߍ؍++h 0 |`++<+H++p+" L+U +T++p+# +8 P+0# `+T# +q# # +# H+# $ '$ B$ " K-Q PPpP`2w`@-w@T vP V:"$ O-Mr!n bR@1% P#  w*CCCP 4d  ,  P P@P)  %, %*P 3  iPf@UIT ЍЍOAP P P,++$ $ *($ H++p++$ % 0/X+T+/T+/\+ M@-M0 @   x 7 t(G-p@ԐeQUP [v`Q PPv |Jt26`DvUP vUP @ $3vsX+T+ `+R ` MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    sO-uMMرNp@ @, jp ppJP-JPJn@  P*  P ᐂoD jpP   p rpP' PZ'%8%<5" #qP P}p   P 8D4(l uߍۍ\+" , d+    H-M 咕P DD 000 u 0 uЍd +  H-Q 1/ g +0H-A0P0 @@5P0p# +@-/@}%@O-MPO``(pVڤP 0  P  P `pEPK P t尯o         P5@ K5`X` E5p @5PT WV!<4 4 tߍ?pڜ|tt P R `&T~p 8~LR> JpA@@PV 4MPU/F+\P p)ʒP!" x  RYP9 %, %*P  P 5tI tQ>Y< `PvH/H0DSm4`PhX PPb8 r? L@pP= QP @ PI  R>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ౝ[^ `4P\ X[ QY 0p8 8Ė<\S$ P -@$PA` P9  @0X# *PET : H P h @X RQ!  @ %_ P0 < %  %*  P  P:= P *o0  $ P ` <dQ:( P < *P  P Aq P3Lq+ QQ%ڈG R hPHP*  P > P 0 Hq& F0 aRH P P*( o  P  4 Lq& , o F4 aRL P P*xC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | FPp .P*b P S Q,QS 0"!& 0C04eQ P P*,$ P M ( (R xQ+<Q) xCx P< (%P P P*Py DP  H8%<5#"( u8BH0/S8<%  PP*G |P  @L@%D5#"G BlQL0/S@D% <vP0^P2* P @ @ @ pP T++`++  L0N-H@?@@_!0/@QP,%R{PPF G\+ ++D% T% `++X+p+H++Lq4 QQ-0N R PP*! P B +Pm% % 1% f% Pz |.HPL0P4e00P@ XLPyTs *%P  Dxl``PTp 0PpR 1@L( /Q `V*Q:QsP h?PX'P y q Qt  cP PPb W [ ) 4) @0p @p 0P@@@`D  F? @D`P T P$"Q    YSPPT"2rRBpP@mtpqtQ QLR@  zm! !1`pppppY) 0 p0pWP!p01|A0 R  h!s0Pm`Ai"P@Pc"0UP j' `++ \++H++4++- * T% w& +p++l++++L+' ( / y(  +D+~) ) @+) ) <+0* ++0++ ++++ ++H++LBAL^+ }+  L# + '/ + + + &, +* ,+.+ + $+(+7+ * * m* H* * % % % % #& <& Y& . . g. ;. . O- MPU to*  0@P Vp'ʈuppphh@ ?P` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*P D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%፤W!\b ? D PuU! lRBF,PPq Q*mP _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h 5@P *,!\Q\UzP P @h Q p耟aP0 R DkP@pU:P@@]00|+H+\+Y, #4+l, l++, +, +, , , p+- +8 TP+L+p+++/ ?- n- +++T+%- ||   p \Q d Q\H\PQ 0 \Q , Q/\/+P+8 TT 8+! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R-L+H-P` < @0X@\p< p X@@0\p*?φu/" h H蚺p@-P` @  ^S>Q`p'`&p @T@T  @  0 00P@@ЍE ++/ K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ+ +`+ +\+O-MP PX `@V T p̠@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ4+/ / !H++p+`+O-M`@@P0r!p   /P0 PS X0 !@hTB4p   |/ R+ [Q 3 0%@ / ' % ?  p 00X@@d0gP  `Z ~gЍ4+M0 R0 8+ 0 O- MPJp`0@Pᐢ!(  /P Ѝ 0PgT P/ P Ɵ 00tg P`U ЍO1g4+ 0  X+G-PHP<4PJ,(PP? DP ,PP  ?{ 0ꬓFP$ P PJ t ? *lthP ] }0SyYSsSp@T TQB  PF rARP TbpNP-+pU @ U`P# P"  @P$T$X$*@ P . @ PP t!@@*\hPP ׻ @PP D0!00*ǿIP ḻ P @dP᪞0 Yf>( G LA@++`+\+H++T++/ / L++4++p+++ +0 ++@ ) 1 +r1 P++X1 + + +-0 A-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`Lp@-`D@PP e( 0Ppc+D1  O-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppP"\5 S !0_ 0 pb\B  ? f@@Q P QP  ' P PqPz `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`VP Hx P P PЍ, ++++T+p+l+U ! +H++p@-@P@`@  (P  p@茻p++p+H-XM pP`X@P` @/XЍO-\M`"p&P@ m!Q@P*  XH$% 84 \ЍOm& P' `D : @`@D - @K ᲽDP/  T `X H P4& ?eH+ᔽ\Ѝ +b Hb!"0H-@l P:\0P D D1S00 0++0+*(0 0H- Q$P@....@HP TLP @#8 P 0q, +1 0 0 /+O-M@\PUFP PJUM PVP V.P P8 Lpq|Q `  ` Z pWQ  p}W ׸ s 80H  \ ?p  `h / C΄L0P_?q`0P Pߍ+1 l+p+1 H-P|@paV Q PR P  `@.+(1 < 0 0!R  R//.+O-M`PL:@PpPE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ+^F$+ + +(+ @-` 0!% L#R 9.$P% "  / #"o  +^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WX###H-`0S5555 0 B A@o <1 2 H-`0S6D606\6   B o 1 2 H-`0S666600 B1 B 1 /2 H-`0SH7|7`7700 B1 B 1 <2 O-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MpR `r@Ph rr@X }P `P P  'pf (` 2|QTЀ  .P @0$" 0  ?  0 РP   j A0 Z)*?`@ `w @pTP` H1P  0XDP`@ 2V ޲ڲ@P 0 0R@P) d# 8@V p` ! `Q 0 R-JXP 03?R! 1w R o pP d\P pPT0pp+,++p+.+\5 F5 +/  +O-Mr`V1( !V   嗾P 0D0PP !V XXЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P P  Pp W@,+$ +$ (+$+[4 / !S4 +5 4 +O-LMp@Xp`P 70 P ,pxP p(PРP8`U @p '0$  ! Q pU+* # @" p> p $` p @p î$`微 0 P`,  `NP rP d P ᝮ(p ᗮ(p $ LЍp+5 +/  +0H-Q@!1 #R# @@P 53@@# # dP@L@P 08$@PW+^F4 + 5 5 O-M(`,@P 0ᨱV` 0p㡱P @h`0P " Z P`pUЍA-M`p@(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p ử ᶭ ᱭ ᫭ p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 X@VYJ WW: S p `y@PDp&Q:  PRPX ( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0   xXO@\Ѝ K;SSQ;D44 $80, (X,DS;!SR00;S%PU:A3 U0 @@<`E4Pc' &(@,TpP`0@$@ H,$ P0H`LpP,QW Q QPD@ p4a"0SQ@<8p<< ? ]400P P@TpX  # " P @D@X p8P8D@P 6@[48ppWqD@@ PPPTP PTP` )T PPUW D@Pp T`V ! ᫼PPp!T墼P=P:D` A "0SqW*P ? 40 0P 00#`(0 D08 R* B8 Q   D`PUYD`DH Hp'&,(&' @ t 0YWO@Y@4@ @0 0b+5 LBAW6 a6 7 !7 #6 +7 >7 MBAWNBAWOBAW7 f7 =8 7 @-@,P ` TN,y,&8P0@n 0 V+]8 a6 7 |7 @-@,PTP Y@V 0?a6 6 6 0H-0@PP 8 R B8 Q   :04PU8P0(( ,02  0a6 R7 f7 |7 O-M,P/ `p@0 QU    0"P  PPU@@4[ Ѝ 0F a6 6 6 O-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 0K ra6 -8 7 H-,P @NQ CP\ @`P'`&P @TQ$$ (0H 0a Ba6 6 6 6 G-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0q 0s a6 6 6 6 K-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0~ a6 7 7 H-M@\$P p` DD 0{U$ 0`Ѝ+`+v8 H-M@\$P p` DD 0\U$ 0`-Ѝ+\+8 H-P ,@rP NPR\PPQT`T@p  T 'UP pW +8 + 9  +,9 @-,@P ,Q +H-M0P,^Ѝ Ѝ+0H-P@ApX Qdd Q 0 D`QaQ 0! 0L+p++H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*iP ة @!. p   0[P" OhPQ \XTA 5d#, %*㵭47(P ᦩA @d AR *a#BP(:RQ% Q UP $@ d#a#*ロl`P t<@ @ЍQ+++Y9  t9 H++p+9 +9 9 9 O-MPt` (T P L H D @ < 8   `; VY ,˶2 80(`?"R10`@@8P? p oo4'@8P-`V* Z V, Y 8$ m0 ኿P!8P , !$  0 !( 4P , !$   pW75 ``$@F0*p, $ 0#p% 5p X p@ X 4; (T#zd@"< l< <  K< (< ; ; ; ; ; K- @PPpW ` d0`W0 Z0 0KO-M`PHr@ v#pPApOPp AP4PP fP.pWppP"~P`]P [P TP  0s@pM pI Y> @E$@@ 0@@H+  0@hP+  @U   0   0 @ qpX DHp@(@Ѝ< (h#< = = < G-`P@tq "fP p rP@@P  p  `P  U GoP I`W $ w p VP$ i p Z `P$ Z p z'!(|#f= = = J= -= Q/H-$ r0Q0#1"$##O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-MXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BЍK-Mp($D` #P f$P 0ø!   PЍK-M@P$i' 0垸 !`  P`Ѝ= MH-M 0 0 cЍHЍ/O-M p@P p ǞP H`t `Ѝ  Q 3 P`rQ "$  R($HP    0V [P PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ ` P [ a w P`| [zP@`Tv T( Z+ -P/ pD 0 PPT $@ 0@PP  A P P < PA P@ PZ:9Q $ 0#s'#= &> I> ^> b> `#, f> > = M0H-MP@ 0   0YЍ0HЍ/M@-M@P 0 (M" MЍ@Ѝ/ᄶ O-MPp`PO @@d`LH $<08TP0$40 ;,(ZIp P ;IIpI p@ p H  P PpW| Р !x p Р p@|,d Pn$tРW|p s   0㯹`p 0NVT ^PM+: i/CP l 0` pE 0 pq  $F   0PPp]  0PpV P? V0K .p pWyxLJl@pd+p785갤崴 0;/  0p,'<& pp ; P P $ R*0p|PXXp m@Ѝ> d@d@O? 9? "? ? e? ? ? ,@ @ A@ ? > > > > O-M P4P% @ UP!? "R R$ P PP 0v ]P `  0i`P @  0GP   0U  0 @RPm P 1SS@[ prs,|` pPp| 0 pXP!D! 1S SS@H L0  0 `p* 0 P P @ \ 0`A 0 @P*`ЍD E E )E PE bE FE = P/@-M@BBQ L p 8$ ^Ѝ@/d@N@ m@ K-@`P p ||PQL x LLGL< pMT $ K:L K ( ay@-@P P  QP((B A @ @ K- @PT0S Pp`v 0S"&d  0XS |p `rP0S`%a"$&` p p  `#A 5A H-$HMA $ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 wK@T(ꟼ% ᏸ P㐀p0PPpp0 0[KT :H`@D 04PMK@TЍ>(Y !mA wA A H-(4$$,0PO-$M@PP |UP $Ѝ 0P+ $tU` H0!p *Sᙷ 0 U0P`p0h pUppp R0W0 Q pPp\ 0R`_  0Pp $8PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`pa P`pV:LP PXRM 0.pF 0  0  0 P  4$$  儮 $@ `A A PARTEFI jB JB %B B A O-Mp@Q W PPB$P `  0PPkPP H< ?$ <PЍgD D D p@-M|` @PRh%]p 0r   Ѝp$/B B B 0H-hRLR aR bR*#iR sR tR! P ֘@PfP@0D RP ( Op @$@0`#$/B B H-M@PP`غppPP  QP ȺPĺ PЍ$/B 0H-P@Q 0,cQ00$/D K-M`P@pЍq UPRQ sQ bQ SQ  R bQ Q BQP ]PJ $t  0㧴 $ # $t  0  >@$/E O-M` oR r 0(Q0Qw @pPp Pl Pg P P\PY (QQU R 0#"L R " 0#B$p@0 PT + p8$ m00 pѵP+ 㼗P   㶗P@ @  9/ p'   T 9/$  }p 40 ` @PUpЍ@ r ㄗP|p`#B A-`p@0PP  7/p  7/$ Ep 4 PC H- sR iR aR : pc C A-M@ P $T`p 0㧳  0PE,(p 0`㓳 XP 04`ЍW 0`JC C 6C O-M@P p儠刀P`P `V    PP Ѝ$/B"#C H-0p0P@` 0F`V#C O-$M @̤P`   Pጤ ሤPU \ `uF8 P$r n$Ѝ!# C O-M`Q (,@pP 0Ѝ#P P0S* |0D0 T ) SP"   ip $ 0 T0 У0  0 p ( c F`#2D D C C p@-M@ P$`P  0kS  R `0 iR  0bS 4R P  Ѝp$/RD B H-`PP @P 4p{P  @`#$/eD p@-M`lP  @[Ap8 0EP E EЍp!D p@-MPP0($,4$E$$(,0@ 0&P ` "r E"#| P80hEP\E(Ѝp@@@Ѝp( #F F F eG F G #G !6G HG zG O-DM@P8`᫶r<  rP>aB P?ܩܩ ܩP\ E눡P  4FPJ  #P5 , 0|E@0,Z r  9PsBP:-LR p%{r0S P  t mPZ r@ D<^DЍG H $/@(r  H D (ܪ4 # 8$ 4O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  p "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$P@Q QT H 0@ TX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@PsP$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O HI H #H H H ;H ,H P/@-@$P g@dO-,MX TP\0R, `Pp@ @P  07TPTP  0@- ` p 0@#V 0  0 $X(F P=@T9(P5$P (PR`pu  0nW0 `P p  VV VX,ЍRV0 000PyO-MS9J TPHpl (,GR2X*(q588w88s<8p 4P4i +<1Wp000S !'4X00T88PX*(v@ ?X*yX*t@iP bP@ bR@P$ {㈤4<PD ,DP P(.P *P [),p (,P(8 8@[u $X[m Ba  Q ڮP P@Q ЮPPPX  H0PPJH36-Q J `0  3/p7 @V5 2, < ( 8 0 pP" `4P ( * ';$$3UP0  R /+$0+4!q# @ЍPQ`T Q Q0Y eJ $/NK ((?qJ (@#l #|,"J J J p@-^l@Ql`d \0dPP %AL  0უ<`<@PPEu=Y J &K ( K CK l #."O-,M`P(Ls(@ pP \p&ePp AP fP sPP (@P` {P   x?,Ѝ  0$ @p   `P$Rr@s` p 㰠P1!Q P!@?10  !HRR&t 8 H0X p(` P@‰XR R R Q R  (  00 p| px $@\ᨰ 0 ?pl@ eb4 _^K #( #+K K X8K K K O-M` 0P 8QQ ; 7Ѝ(庨 Z @ 0S 0 0S000S@ R@P< 0&뺨$$ 0p_Z  P0#S:@ @>01 B<0 3/p (8 H0 (唠$D;  倀PTPpW:WEVL &L #P+K 1L K @-@RR R R @ R R@@@PL p@-0@P R CP0plpSp#S:``` @:> pp pppa  0cp#P+K oL K-MQ @P`P <ЍK $R 0 "0# " ) ( Q   o/o"R P 0 ЍP U0ap  Q P  0P  0p ^Q 0ppf)  0pP# pU   0 0 pp 80$#L &M YM = = < L L M-M`@Q V$ĀP ꬀P {ؠ `  P Tp T 0 D s,  jЍgM M M M O-M`Pp? V V2k쀟䐟 BЀА Bn@0$$  ? p H  L 0$@p L 0;8    ЍgN M M A-8M P@8`>xpp4 fp p @P4 008Ѝ賜mN (#( `#O-LMP`D@<840(,@s8@,0@ -bP p qP   0Ep$ (P8<P%P 8< 0S0S @p"`!p PTPLЍ,00@ D04,p p#Pp @@D,`P pF $QP $$ 0p弨 P pP pWtUh P Y " # # T 0 0 ᒨ 0 0  0@!$ + !(PP$p  >pv $ PnN (<#`#O N N D O-TM(P`HLusH@ JsP  0fpHp qP+P%HL  0P Pg@p1 T  @ D$$0Pp P  , D @0PH L0 ` < P   PTЍ0 4 P* P&  $ p,   QP hD @0,'p! P Z`p  % 哒 Y8*`pT  &P  V  Rp`8倐Y:D p@0RV _(P<pVZ`,pV࠳ t  V $V @`D  00Y PQ;08 @`D <0tP(0  @`xpT  0  V0 0 P  4$$  Ο  h%d2p 0@D   0 Y0@  `R\ y $@0 `@P p 4P$ (0 r  #  R000 POp0$V>`#  |P~ Px@D` P P` P  PPU?>VP_ P Le7$$`0`f`$$0@ ^L$OO0T4$`0MP O O<@ 67#07.7G@8$ m0 $7"7# D(  @`V`3`P?U?P# s"P06U"P4P6ZP p4RD0 ` +P 06  P 46`pP @P` XX`X 8`pP @P` XX`X 7Q <646`pP @P` XX`X 7`pP @P` XX`X 7  `@P`XX X 7pW&P" 8pP  `C i6 ```@P`XXX 7PU+xQ x#C.!(ht@#(|S Q !J? S Q Q Q , !"Q !Q +Q Q th Q +!w!Q Q Q S R 7S NS F TS Q Q R S lS Q xS H-BMMP`@6 6 6P  6PGaP0 5!p0 05ƣP p5`!P0ᵣP 45#  5P. @5'5 @@/` AQ` X X X 6@P @ @80,5BߍۍR $R 0R ;R IR (!Q , Q Q SR VR eR Q K-M`PAP $<X<ЍKl5 pi h5@f` d_5\\5 ̌rPpXPpP% p'PA `@V G5C B5@h !80pP?KЍK05.5@ Q  Q `$ m0=D5@PP@(5**!!p`0'q1  W 5@)@4@W#!  p`  04@p p`0`4@pV V 'Ѝ`P`= R R !SR R R R R !!R R R R R < R S O-DMP$$hp0 e(` Hlphp`0"@ PL4P~hpz "0 T 4phUp lp`p@@!g_  @YU /05h!`! 0[ T< R 0" R  $ 4p:Pl P+*@p$@UT@ _ T+* kh@ppPp lQ 0/PxJlp,P PqDЍPl!S D S Q Q 0H-xMQ P$ m0@@t ewT txЍ0uR K-XM|xP`@ P @ 0  0)pP$ h p#p2/p8 03P 3 3XЍ!cS O-LM P@ 8`Ԥ$8 㚘p4  kPLBP PT 8rp sBP!*T  kppLЍrT P8 IP PPD 80!lR`p`#T T ` #."(H IG- Mq@`P  aP bP iPT  ` T T  p^ ЍlP&p PP  0S0S `p"`!p P0T 8P 0 H[T ."#(O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P 㤂P *Z48 尐p+lP`p<@P ㍂P p*W48 噐pJ`FG `(`H0Ip4 4800KP`,`$P `M2LЍ#qT G-8MP' PP# (L 00 `@Q0  ppT P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`/P p*W1 00(pbRp`P0 T #O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @1 :/p*WlЍ#qT H-0p0P@` 02`*V#cT A-t A `pP@ `Pp @PP@TR 0 A#A-MPP )ep `p @ VpG PH WJ:pW@hp`0< 0?p`9p0$904$0p`0S00:8t00N , 8 8$ :  0p` P p0 P`XcD]00XЍ耜Sؼ׀ZW gW QW 7W W O-TMP+ P@8`uq @L  U@P  p'P LR  pTЍOZrxPl  0P P H  0f ATЍW W 0p#$/( @-@R  R 0   +@-@R  8+O-AMfvP@ %oPpgPc`P $$rt@Py &P7 p @@P- X Pa 0 <P -PX ePp@pPPa xP/  NP' !P! ! P !P !P !4P  !lP !XP !DP  , P r P   P s P WpP lP @@T Wp @PP` t9P d  P P #80 FP P rڼ=P  sP P $PW @P X  PP "`0 Py "@ 0 Pl  0Pe  x0P^  `0PW @$ m0P ( PH /PC $ H@ T: P4 @ ԡ`P@ pWP9 pK4 WP#  G0P& PXU \AߍO/\ H @`' @`# 8X` 4AߍX HH H0z4h h0u ` `0p@W $/(#W Y "X 8X  P   P, s/ P& (P'U , 0哖!  $$ $P $P @PV 8 0( $D`t | $P |[P8 | P |$PP$ xP  rP @ lP , | P | $  ,2P !R$@ 㧑P$D0  !  0$   P$8 4@!1# !  $  P$ 0媝< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`8X \4$$0`ƕ! Y $$ $PR,<`(4`8 \$4#S#ᥕ! : $$ $P3ppAߍ| h<p| t0@_Y $/(#cY L yY 8X Y NX X Y : X Y Y VX DY A"`#!y!Z `Z < UU"DX Pp p`( 뜂 p8 PV  P @ p <4Q ) P? ` 0SR+ R+ PЎ pZ @TJ xP QRR T@ Pp6P$2! Nm7P# p PP`! RQp n+ /`V UP:ЍxPD.TT .8i(lh !*!i 0#"!!xh h h _h Kh i#g i ;h .h [ ;[ @-mP$@$@.h t+DJ 0H:(i @-M@L iPHH0 Ѝ 0C)i h &i D!l+H-(MP`P& @ P  p( pP\ ܶP D(ЍD .8$.   . 3i l+8i(_h =i Zi mi ;[ H-@P `@pP7P @Pp,   0Ҍ믥!l+i h i /0"0H-M@P 0P-i p@-M@~P @Pt7P d`@ _PLPu, Ѝp 0㓌h l+h+&h i /0"p@-M@J^P @Pt@7P \`@ +PDPu$ %Ѝph l+p+&A-@0P @pRPD7P @Pp `P,, ,022 ai l+> h i /0"H-`P @Pp 0p A @H-M`P P p@  0P P  0p @Aꨍꥍ ЍH- P Q   Q 1/pK-M`(P ( p@Pp:x"Q P oЍ TP`"P , 0 gp AM O-MQU$& Q UP Q N@PtH ⃵@PHpGTp@W Wf Wh W @ЍW W<6P  ĄP@Q  /DP@@(@ 0($0  ,pЄP `P$@( [ ᖘP (QM VK( ( 0ᲄ`P$QD @@``P`ыQp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:iꁌ@ @ `V   Q Q@P:f@" TW T4=@ 0a<P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ ~$PP ރ`\V  0@p PP @P `@?T  PU @D8 0@1+( ++gs"B"0",j e Sj d 4j A-@T `Pp.P:᛼P  0p A詋 O-$Mp@ὊP @UK H`pP#  0@`4/P( P+P Q㠊<P D㓊 pH`V 0{  PPUZ Z TYM P aA$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q P 0P -PֆP цP `VЍ @(@Q QQ Q R-0\[[[[[ g;P P0 0  0p 4 ꣊ )_j p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP p`$@ #H-`P@puP pP @B#0H-@P P  R$ Q  0H/00Q /  Q /K-p@P`P QpjU P `PUP QpNA-p@(`P P@ @p 2P#A-MpP,`P T @$ $0(0 0Pp@Ѝ#O- M0Y$ P 8pP J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  E@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6/y P@T p@-@`PP P V  P PT  ˈP pG-FM@PU`P` H봈@&P R  pF` pp P{ppPƘ {{@ @p(Fߍ '~j wj j Jij j j 0H-D@D4@4,P,0H|+(2(+He+xfG-NMMP@Fp`)u(qt [V pp/ ) +4 `P*(k) 0p| 1JO 0p{0P,0Q,* 1U(() *0NߍۍX+Kio j  07-y(k H- 1p]'Iij 0H-hP@P p T p @墻T@ ռp@@0T2(+O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW xP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@ំP$ @Ѝ({k (_k Hk p@-P@QU 0PxQ  000  @UP ` XUQ p@?,=U `7PUp(( x k A- M `Pp@CW W# `@`Up@JV:U` (  R@P P`  yP ЍH-p@Pp `P   H3&;[ [ H-M pP`@ @ЍO-MMMPc Pp` `K<p] @F҅ r`,\qXpYE @P9 P5 pp y $ ᣻p !@ !P 0 o" 000 3 ;AzP 3P t3 l``iY,\Mߍۍ<0$ %x"k iX+ k k k [ 7[ H-M`@Bp pP]  pp yt Ep A*@+P H|%"@1P /PtЍ ik t"H- RH\+k A-Q P`p@ցP PP`V@- M  @p l 3P T q4'%ͅ Ѝ %l 9i$l l l @- M  @kp&  ۯP   qP p P T q8$땅 Ѝ $ l l 9i$l [ Sl 0H-D@D4@4,P,0H+2(+ q+|q@-M@ p  QR 0R@ ZЍ]l sl  0#lv(zl H-`@Pe$P ` pPLU,$ Rpl (:i0l @-M\@ ᢭P L  pЍ0h$ 0NJl o q D!iq @-MP @GP  1pЍ(I$ 0M,("o p D!p @-MT @*P IpЍ,,$ 0Aq o p D!p 0H-(M P@!T  0p < p(Ѝ0$ #G"i}p ap sp 0H- M| @P tP p  p Ѝ04# 0qłxq o sq D!iQp 2p K-M <pn \XH` 1P P~P> | jP XPT :Q00@\p@P`0  `XP0 @P TP #0 @DP AAq X \!PdH qHb#ݍ(( P#l Bq Jq (B"Sq i8o $q 7q @-0M| 0@ p 4P L! p0Ѝ(2#$$  ##l il p p p p@-t@tlP!P@PHPH@`@#p@'+2(2(+Dx+@}+D}G-BMPP(㻂` pp `  t8㭂8㪂`!㦂 p !R*}cW%  zp P P d gp P l\P XQ  T)p |p Q$BP ;I >p Q.P '`8Ar 'pP  pZ PQ p OH!PPPP pm `V !RAqpP!0   :R P hPpta@T ,EqSo@DP0 }$8P p$ $ p @ q`P\P  Q  WQ BߍXkx!8i(iq iq W+q q q q q q q i8q (Bq r 1 i r r v@!ii%#0r :r &r q / 0zs(Cr 0H-M P@s$ ZpЍ0!il 0H-8M@ P [$ Bp8Ѝ0!i8o O-UMMd8 @2p*   " p$P QPJ+㢵PJnP PiP +㓵PZ ᫵  Pp|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `((Y:!0(!    004g2P8 P@T: 0% PPO 4^ |f @DpP `dPN  PEp U ADQ) Pxp4 `@z``v\T DP 0  k@T >,k4euP )P  0O@@TPUUP @ @0P:@TP> P .Q P=@QG簆TTTTTTTTTTTTTTT $,4<DLT:%PP[ P  P   P  @Q $`TXHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S""" PE@ U$K @{Px PA 4 딲嘢@R 0 p   `'b 0 pp` @T>A aLrth\ P D8, P  K[  ,I'Y.0<Q  20fp3H , x  0 ` P/Ṳ!%# 0 ` P /S!0%#@-M< @P  LЍ 0L|p o p D!@-M< @P  5Ѝ 05|q o &p D!0H- M@ Pp t ҥP  qD Ѝ0$$ $0 |"iGp o Bp D!Qp 2p O-dMpʼpʬp2P cp P < Kpy <Q |TPh"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps ܰ<@{| } `T\X T0\pyp ;}QQ 1/dЍ+ J㟱h報P\@᝱PPP0TpPH   `p`> 1 /r ! s :s u u !W\u u #u :u l4(̖ +A-hM8P(P /P @ D@(@ 0p( d @@{@( | | bp4 @P^ 0r0bP Jp PP5 P2)E|Q#P Q Q" ( | }|D JP( o| k|hЍ$PQ P PX@d`\X@P߰PX dP`P\PXPͯ\ TX  P_+H@/<vOb+t s -s :s ОV\Gs !s l4($t s >t Mp@-M,,Q P`@Ao ``` `{QЍp@ Ѝ/H- 0R0+@-@.JOs /l4(/ MH-M@Q P`pA?Q:{P!0QЍH Ѝ/ MH-M   ЍH Ѝ/@-Mh@P  0p @Ѝ+lt @-@fL0*p p$㬰㧰x%#t t MH-M    zЍH Ѝ/ MH-M    zjNЍH Ѝ/O-MpfV尦@ fPl@ Q! 甙 -P gFP RPP?PZ ` gPV#Q  MP nP&  #Q  7P D1P  'P &  P p[0 PN tD尔娴PU`P vPq q  wP `XP PpGPG U*@ᾮQ @pP cP bP  XUp*Y GP*U5pvz    PhzP UZ'@[X/vP X Pp ZpP P !d  6/ R{  @Y @P>W  0gp3zPUPR P `( `W HL` !(   ߮V  0< Q P 곭p%ڸ qr ԭpЍ.x d ll@ <(ttPu $/u ]ou \u (++, *w >w u (u u v u 0H-~y@<< PK, 0j B'(v Yv w H-M 0 P 9 \R  D 0P ,Ѝp4( ++@-P@  t0< 4 S 0 p00S$0000%#%#%#H-M( 0  PЍx4(HtP Qp0q#4 S $$0 Q 0! 00/%#%#%#@-P P$   #Q\:0|\! 0  sS Q :00@0 \! S! %#w w %#%#H-P pS Q $$0 Q0 00%#%#%#P  S\:$0$\! /%#%#%#@-P@ q 0$SQ:$ %#%#%#P H  #Q\:(0(\! /%#%#%#P H  #Q\:(0(\! /%#%#%#O-qMMpW嘇` 0@  cPd@PDججججججججججججЦx% 0AP aP" 0@@@@ 0P B[| 0pu<<&GP 60Sv0C000PU Pd P^Y P P*u앟쥟`sP  sP  sP  P P PP*PsPP(8   P 0 0000 000P` P `[xcP h['o/P=U ;`P`P 1`P`P p3sP .sP )sPp#sP U AP(<P( {P `U /`P()`P( Ȁ{P P rP p P`  SP    A  z(P @P`Pk( P(-P@T`b|pp$vPm'P+b/!jPP?qP qQ r'PWpp( xQp ΫP \( ƫ\Py qPaP:a@P !PQFPPU 4 0 0`qߍۍdA t < ` (#w +w $/+(+ax  zd@+edAt'#, w ;?x x +!w v 0H-MP0@U , ᕻ#Ѝ0 { H-Mv 0 4{ (G-P@pnQoQ PppP \@nQ`oQ ``)P @PTB"K-MP Pp@Ȑ`KqP qP p`VЍO-AMM `p@-P ,$ (IQ $uTzTM $gPjPP/P$ yPO 0 PL @. P( PPB FȰ p` [qȀZ UqPY  LqP PU  `Tq+,$ @P P   0`Wp $ $ $ $UZN 8pᨠ@HP (  pP $L8P0%(%B 0B$L4BT2 ` H P, ȤȄP@@pゾGT)p`P -P =QePU @Q PP@@@`4 `oS嬃`0` S0!P t CV`ppV r@PdZ (&pHYpL @Py $ P ZP- , 8y8 tP\Zn( `PG P(PE` PUP(  PZtX bBp P P!p@T N$ P 嘹E@Aߍۍ ,QP@Z@PPP 7p h  t ]P<  Q ( §, ㉨p 0@Pp[n B sP  0SsPB 0rx "zx ++x x v xw!| | } '} O-Mp,P( 尰尀`@ oP 0P pDEQ A O/(W $/x+#{ H-p (;} 0H-P@(P /P0$᭾0H詾 k| | | H-0H-M@AP" 04 0Np P\h} O-M,(帠帰`@pP 1oP 0P phDQ @ A +[ЍO `W $/X-#{ (H- 03`R(u} 0H-P@'P /P0$60H2 | | | 0H-P@A-M@ PA> )$0Σpt 0@ D `L,<\PPaw\/#} { O-MPp @0lnbx LPg@Q!0ddddddddt9P GP8||||MP' UPw| ||| 0Pc ||| ppPQD0Z  S S  Z`PY[` ᴣp' [<pY@tZ (Z PP$||Ѝ   } $/h.#{ ( ,!H-qn @%(} 0H-MP @ RQ pЍ0  0 g| @-@ƫP@/ @-@oP@ꊯ!@-M @Q QpЍ y| 0H-P@9&P /P0$ɼ0Hż | | | 0H-P@u0G-JMM 4P@00 0 0H`pa4@PpnKPVP S QP0 P Y0 0Bp 2@E P!ʎq8P 0<p 00 ; paP ea<0 h@D L0\`dpl`pPt@TX P$@`p QJލڍ0 0 E |+2#I Y x { p@-@ P PP p@߲(P`l`p "+"O- Mp`H@0lH X`뀶嘆否 @P@A@7P0hx$<P`pLP\2P/ 3P6PI$D]@ IT( RG a58 yltp l,gPp[4P a@]Y 0P P    @B P  P  @           "   $      p $ L <  ( 8   @   , 0 @rd$ tW, wK xB0P }pGQQ0`+W4R 7 ЍT( -4(]~ H5($/D5(0#t+x+|+ę"+"~ ~ ~ ~ ~ ~ ~ { (H- ~ 0H-M@ PQPЍ0  0 ~ @-MkH@ <0 @  00@@J/ 2 ( π h 0H-P@~#P /P0$0H  | | | H- RR  A-M`PPJ  <pPJ@@ RR0  P 0pЍ~  p@-M`P@ 㲞Q 0ЍpO- Mp@PFp8 p0`pF<8j$ $  04O79 2/< &   4@K<0 p P 1Q 2/R 44jH Ѝ @p+8 * H-BMjo^# 0142/10 >p0p @0 0 P j吸 ,,jH<Ͽ Bߍs 3 A-MP@` p$j XPh 2/R1QP5_U @4Orj@pj 0 kЍp+? _ (0P0/O-Mp ejP `@ p{P`DH @0@3/p@=jP;p@DWP ` p@y)0 @ 3/ qZ㋐r "P P aYR*$$0j<Ѝg O-M@[ U@ZP p:2]Po pP0`P h d,@8  0aP a < `$Bt`p PT P p  P 0  p8 hd@ P @!0x \ D  0zp PQ 1 UP ,P ziQ @P+Tt Pyqp` hD U 000  Pߍ+ ++|+ O-M-M`p(PMhT 0 ؚ݊@C 00000   Zg@Ql     0   8 H p  0Py @@ dP , dP | ph  @ B 0SPb@ ] @ B 0SPZ@ SI P  p GQ$A+tT@  }p, 0(<S00 p@ Ppp 0ЍЍ)` dXL 4 H /(݁ $/  > Bl ?x3#{ ) H-*h ( 0H-8MMA.NP$ 0 (0{p. @' P@!  (rP ((x0,嗥P ` ,(L00@8Ѝۍ0, N\F S c t : 0H-P@50H--MX 0@8CP       Ѝ % 0H-MP @ RQ pЍ0  0g| @-@P@/ @-@ᰦP@ꊯ!@-M @Q QpЍ y| 0H-P@zP /P0$ 0H | | | O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4quI"X3\cs2/3?6o7"X3\csfIbI^I ??j VI p OI p HI, p AI$ 0p :I( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,eI@ 8p  I< Hp ID`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@PH H!H!H0A-P H  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 H!H"H"D`6oD`xH#@`6o@`pH#H`6oH`hHL`L2/3?6oLX8<\L01`\XM`Mpp` X}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p GD!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,L0ЍTU  +0 BR!q p/G-MM`RQ:@ +X T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_:G ЍۍLABLK-M,(pQ@Ppp  PH_`c Vl# 5_ P[  G 0AQ p Ѝ LABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@xpd=P PP \`PpGPPlllo ,8 Q`40,( B@4Q @,,,@L,,,,,x,,,4,,,,,,,,,,,d,,, |(T,,x@_Pc _P @#P+ 2 10  0#DlO 08P `D` 10   0 <-@Q  $$/0PP  v 10   0 80  *0l4 TL 80   0 c00  0 @v_P q_P q#[ @Q ܠP T 10   0  10   0 0>@wT@ Ἇ@,_P@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:SPX/SPSPf PJ<Py/10 1@@(.  T av, s^P' ^Pe !  !  0 T X L 4v( F`  Ap8 @x P P D %#pP[otQaxB AG@P T@P UHH,H<T @   x00[?⦖p+X zkagap& P\P T+| KP pp W,ĕp`T @ pt !z ]Pz? jJ p$ zpN(pxPt @#@z *P;PJzppm*l j ?\P@@[ot   zp PؖpTf) ?[|)@Pt@x$ P )P*   0Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$Ip $@$p QZ0$Pl, ٔp$ D[LP ᴯPt pP`H `q!'P  0P!$@V U   ሔ`Vp V ^po+ QʌPtfP  RL+㉯P  Q(*〯fP3'PP[oQ,P VP &0aQ 0Q 3,80(  @w W `y \P BEP @p1叭 =P+  T+ 1 %0Bd=뾔;97%0 Tp txB@ [?ĔpPp`,%B d0@{ȀB_<`  #p- 0\PZ \P P)  M.p! P< pP &p0B/pPPI@4B/X}$/C  xr 0+ 8+L5(<+ l+Ԋ @d  =PT*[`Y p, K[PrG @  [Pm  [Ph [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4,+@+!$"0QSQ% @PP(+   6(!/ L+`+ e=P  0QQ[oXQ <$!@1H!0[o͋ [oPu  0 p+Ƅ 6((a \+*!d+P+ T+$/D+Q H+ (' ܆ x+C - L+<+{ z!ʤ"|,"  4+ t+6(p+ W 6((+l+,+8+@+2 h+ 6(`+X+( څ ++* 4#ffs 4# r _ : ( s K y Ї  U ` "+ qy ‡ _ 0 Ȇ  A-P@^ T0xht @0pPXX`P`P pPWT+( 1 [ h 5#[O-$Mp^``  㗬 P@p0S$ P| PaSKC P0 x x x x x x @ kC P0 x x x x x x @ P PBS GSPbS gS x0(P` \  ` b R40rbpSjQ72VP~^ZƟQVQ"P) ()% @P W P%  p@H0L S P  p`0$Ѝ\ 0@ 0<p@0p`0  07 V y \+ ʍ O-M-]MMԠԠ1 P@ P< TU CA`@0: P`P P`BEpC 0p: P P`6Ep 0 D: #Epp# Wp"  TkP @\ JP \ +P Px0 <0o (5,%(,D D R$, $ P @P  P @Z B0 4  P @4A | P @4D QpX P @0 Q*e, P @0Ql(Z P @04 Q@O P ,`@TD ! / P*0\PB\C0\@PXPt#U XQ`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1P9 `4  (08Pp8 h#pφW @ T 威 dQЀY48R T?QYQQP0Xd@Q4!U:8 P `4@"8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?pV 0A0E HP? V !"p@!G0Ep/(50$u 噚z"@0S @!1R\Pu DP x@8P@UW8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0!V? A@pQ`1A P PPP*!1VPP! !Q :AWPܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a1A1QpP!a!! 0`APpWp#Xp1G 0U!0B@1UDᡞ@/X0^ 0@a@/.!PV`0PT3_>QQ10Q0U@A!`? JUp 0@0a@ V㸀!` 1ؑT/ a!R, T+`+x+h+++++6(+H+6(6(~ \+ ,+(+؎ ؑa Q @Pp$ x帀@8d<`P0V GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  A_Бp 4Y?@ so H44p0o0 /LP0@%X\V Qph? ~  P\% R\%R`d~  - [ 0+UUUU33338+P+ ~0: P`P P`@p@J P  0P P`@p qXPDPl`F r0ETP R&0 댏`H pJPE@T`VA P !1L%H [+0`' X TE >@ 딇Q DL+0 P LX 1+0j@PV.KP f@ PJ WBP%xeP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0M_ ,Pz/⫍#QPP\  P0R0CP0R1,@,@STl @`XAJp@8<$Ϡᔆ P0QP\PZ! @Va dJ\j y t+4 `@, Z !/@ ZJjNe Pf pz?WE h [$Q`0pP tx R !x p+ PJ,@P |TX\`/$%R0Q@h$l` R/dPdT P  Pk P P P` <$P plQ>dR4-QTT! !-QPeXPeV d! ! !NS@pR!!G ASR$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.49U0P  UZ H4P   0x 0S0# !T P`\u%Wl`L+^F ++P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82QPC@ 0p@ A尜DL`$lP`PD !LlZ?#\Q @0`d0 80 0h93H P XaAQ 0SApTP尫Aa[+d唫AP@ aPT@TK.!DT@@C7 5#a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0/@P`D+PaP ,  PPc @`,V:T  PQ T  R P _E EP: _I` :X+ _A E嘉0 l dR 07E\@!U04@0vPLj @D5Lp0? dLgS (ht@Ή@`ALi_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  _ے U 0- AF0q Q0 ,Pp@X  h6` @ PTP` FX  2/X S64  꽒 0 XPq#P|QXp  96`@ UOFKS\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / ڈw dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !ឈp ; @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.FVDVHRP PP\(` PJ -R ?LM 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daDɇ4ć(KЍn 0_&a%_(] X+U6('RP+HFDB@><:86 4`+T+h++++6(P+T+++++L++++X+!!O 6(8(d+8 p X v p@-M@P`P   9tPt!"$! ۧPЍpMR7, 0F$`+T+h+++1 M-MMԠԠ@`PSTQ LpW@@! 04#'p( Pl P;T] P*06 q`V 7Q  QWC@_lM\ F0KMq/*0hK`++++h+x++6#H-M@`P P P!p_'"$" BP Q垟T 0"K(( !8ЍT+`+h+++ `0S @ @ @ @ 0/PP @B1 B/0 //( p@-`t[@P\PTPC/EBpH+6(O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQRB B B B `@1 .Ha@aV&`aV Qd\8 _Y0<LH^P Ѝ S`R C C C D  0yH!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQJ QTT! B! QPuXPuW&d  R  b9 Q?SJ먠   0 H? ᄡtJ !?oJA0 P9 4{@8l0 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_++X+U z (Ñ +6( * T O- M\T`0dP p e7@ PUSQDP sP Q \P Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0aP @ث 0`5?ᐛ#"2++\%R !`0Ϡ|' r! xHJ0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0p4SQE `z(1!2/pG w( X q13?A qX0/x 0 @4TQ% @p`p %1!p`Z`p@1!p@W   Al,A8@P0 0 ЍO;P N++X+U z \++ T+p@-t`P@P }A@P 0Ppp6(X+G- MpR `@Ph @X uP `P P  vpf (`SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#JfJX f ,pP T pW Lp"'D P& ;:fPJᮀp @ &ᤀp8 Pe p_ P P,@ u 0EP@@th l @D 0E@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@zF`PVpFVeP64} # p, {R  h0`P!`V5P P+02 q`V 7Q  QWL ?\ D0ۍG{>+0ۍ+0&,++++,&+9#H-MPLp`@%G!  ᝘PЍ c++} G-`p BW @ ` pP @  5PUB@D`Rq@ 5 +0&+G-x`0FQR vWO:ኂPK P 0@  T 0Q0 pW S Q @p0 pW`! 70fF&0؇0 A0 @ `  + d\"O-MlpV*P} ` W%:( =@0Qx  0+u06&000A@`(`WO*@WP 0'p&!&T $&0f?'#0(  h0" XQ S 0$&?'LP5Q0ᒀ$ 4 P (( &d 0DЍO7hT PH .D4  00&  + :(Ř G- MpR `*@Ph @X iP `P P  vpf (`JP Q7G@ Qg@ P1 L L L  ` $ L L ` L L 4  L L L  ` $ L L ` L L 4 'a 'k 'fkЍ 0mF ; H-@`pP? P  V  0S; H-> XX@L 00P R0 r*PP . "* ݍ8 I2 d@2 3 2 2 2 3 3 edAzd@x2 `2 K-M@ ;PpP`p @0 P3pqW `2! ݍO-MM010`PD0?;p4;t0F0`p\`h0S0&a'0000x01'udTPpo`oorbpb4P`oobpP`@`oobp00>~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT 7 P*V [aAi/K  ppp 0PP4  pP 0AP4 pp ^rP0 p[@e(QP @ 젍 9P QZ rPPV ` 8Pp pFo8Pv 8Pq  P@TPV젝q0(Q  @oow A 0  0b40($sU @8P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP //P@0S  000A B0SR @A@T`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>ap d(G,w0gP nJqp `/ [PT5 T@7*<?W?p#PW :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< <QuPsPqC   TpKp I @ eP P hPR ^A ZhPN8PhPI Q@P AK( (@@ 8  P2 HP)  Q8! Q/GP- 8 PDh T+SD( , `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@ps8P u@   W!DppZF0SXm&  W &Jf0 vD0g"Q"\P Fȕp  D0 hpXU D0 hpР D0 hp D0 |hp岠  0%00<000%00  \E @( 0 00'a0 U@(0<0p&D0 Hhp  @3DC`p pp0VPP  p0Pd  0 hpL[ 00 A 00SQ: !Q8H@(0 0, $084p0P@ 0<0 0 4$ P p6P$Q (#@0D q0S0pPd U BDppPU   HH0 gpʠV C0 gplx 0 gp0 0BP`p\j 0pgp P1 *og92PAPPP P!!\P PH H@LPPPTPXPx22P,APgPUm8&,<&,j $/&, @&, p&,`&, x _ C H&,% \&,X&, P&, Ѣ (D&, ۣ 2-(2-L !&,&,',',',',',(N ', x ( 2--@=B''- '-'-'-դ  < _ A(@ '- (-(-| u & U A-pP! @=`P T  ĊPP ԊP QT P A0{(0 H  D@&, (/ H-1 ㇽ( H-DQ 8Q ,n1(( RH(-h(-T 0(-D&,H- @ep(- O-M-Mfv @% $=; < #P!qE 0 UfpLt 0< PepL @|0 P:fp3;f< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0dP Pu 0#C ,3`Sp 's  `ß `P pPdXs`P4 Z 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  Z H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPDeA0(-(- (-','-<&,',@&, Mb','-8&,p&, &,٬ ((-8(-H(-X(-0-P&, 2-(2-ɚ;6e5wK',2--@=B'O-M-8MNdϛ@  ˟   A 08˟I۟帍席]`d@   A  0@:Q3@˵0  P  A B* 0 @Pt M P  A B* 0@INH˴LN   1H @M  ~P  A B*  0@8H˴LN@ bbp  ( *cPUx<D. $ ߨ | _ C ѩ '-(-(-h(-(-(-A((-0-'-0- C A(h ',',', !$ (-(- ۦ Ӧ ȥ A-@+aP!Qp0p.p `p Q0AQ`0X X pX.㱺Pp!pP0pp C `p Q0AQ`0X X PX㑺qT @P ` AQ` X X X w@4@X$$'+l(-p(-t(-((-x(-@-@*CP@ᳶh(-K--@@`pw묐$ 0(PX p   ` (+Sp  X4Ky@@@&, ' - 5 (A--0M@>T ʸ|B|ƸtRt¸lbQ `弸P PH崸 @ w(+   +S쨸 lQh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S Kt6 (  0PwpWBAi$b l  3P xX0 V! P HX0 88 0M J  P hP X0  04H>W d2-C'j H2-D2-l2-$/ A(Y s `2-K P2-A(T2-" A(@2-0e-L2- <2-82-h2-˯ ( (p2-7 $A(\2- x2- "" ۰ '  0H-+%@XX PH < 0 $ Ͱ(G K O-MM/?@@`,, l`ll|<M∯\x``T@PP P LL塲 @@  P ,P NQ/P5=ꈰ$븎n~P  @ᄳ /  cs  Q P@P<%@P Q Q @̌Q-  ` -͎@0F @@ 0ᰯp%P,0?u u u h WD` L < < 0  PP  ,@ : P La@Q?⌌ t L t t t t t t t t D t t t $ P @ Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoPr Pf[P} F@b, PV(& P] ✲@L P@}PN ሲP8t P,w  P H @@# P * :$(,048<t th,C@ QPV P: P P @1, d PP% @ P P @ `P cP Pp `P$ @(0P PK o ``\PXPLPt @1 0PP DPP 0P PX^0\ P  ᱱ +  >`Pj P@N@ PBPD  危@= 0@6 P* P* PVP% |0 @@D tP @  (iPe  M0 z` 2 |0 sM ` @PP @80 jiP` 됕xV[ 4  -V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  q 4g 0@pQ"QT@l@hPyppdhPn 㘷  @們Q p o d |P AQ  QD PB   (AP AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰPᩰ@ThX 堰坰 up[x弱夀P @ P:@D `p f`=  p` P @`)Ѝۍ "40  P / 6-X2-7-7-(z 6-:-Y!" C=" @2- ׵ D2- Ƶ *d!C \ |^"6- zo!""  V 8< X0pحV`Ѝ6-A(D2-\ ( a K-pMll`@B 0 &P8iP0PA $吐P! d`P囬Y  0n .P*  X◭$! P p P  0 P  0 PYIT@pЍA(6-T2-D2-A( @2-(k @-\\0 B@0 1 D P  R T@6-A(O-MQP  X0 P# @P pt X0dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  PW  `$`VP@U:ЍD2-( 6-6-6-@2- >-O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  X∬P@0  P P PU    P P  ,   ( l ( P ( l $HP$H 0[W ] QDP nK `V  6ZdU  TpP $PX $C(ppp 9X pP B0"  !d"X W> L  0< @ZpPu BP/ 0 ⽫pf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0T Ѝ6- @2-(ٷ >- |NIL" B >-_ 0 |INOFND۸ 0H-@P |0x   `0\   D J0( 0HA>-|NIL|ONTAPE|INOFND" "O-MP  X0a 뀑P0:dpp@PXp}PQP@U: E 1 `V P P  Ϊ9 `@T" `圀堐XP pW PP  P  ᪪ p$@TЍD2-( 6-6-@2- >-. H-P  X0  P@T `p P $p$J `@TV4@T (P$@TD2-(F >-g O-M  RRP  X0"  P  X0  W D븁就P` R]*唑唡lp1P` U *@P  0G   %0&  @P *  " 0PP 40 R:ЍT2-D2-( X2- 6-2- ȹ ߹  O-MP  X0# Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  PYU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*ЍD2-(. 2-6-X2- ȹ G-MMP @8P ,, X0T  @TP  X0 > ȠP':P ^P `pV  r@T@ `PU:ЍۍD2-(G V 6-A-P  X0 딀P8`@PP p RFP pWP@U:D2-(a 6-z H-P`pZP @o"@/o"PPoR T 0RP P ,t  FP誺 ( O-cM@P  X0 t$0``c rP6 S0# rp 딓P T @0x#0 rPTD @C0@#Op P s AP/ $  PuJ(8 Т0\`PI@/0`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQ PF! 0P [eP P2@ PH  P +P6Pf RP P PcߍcߍOHX`XT$ H0 ҷD2-(غ 6-d2-&A( T2-Q  8>-&E(W e <>-9  2-z @>-پ PB-l% ' T L>-H>-P>-D>- &I( O-CM@(PP& UP`p㰐Y AbP y o py@T:]U[ ptXp `P 0<PP P `X:P*P  0  P  0  0SP lᗦP f [:P Cߍ<2-e-`-D2-(_ s H-$ 0S  P/<>-&E(p@-P@`  P ll l0 a P  ``4`pH>-L>-8>-P>-&A(H-M<億P,0 $0 $/  d2-; (^ @-H@Jp `  'WP p@` KЀ&A(@-$@   P2-O- MM`@P/0 [ !  0 01/ Ѝۍ0 01/P ! @0Ȥ댁P epP dP TT ⽥pW 0P  ⭥rp` 0XW @`尠0 P  Ꭵ +0 0} D`p 0+@`WPB-!D>-""(ʻ  p@-M@P 0`@P `Fv\\ NP ?   +JЍp( O-MP `4,㰠Q +IP+Q!R 0KS p@T0P T:P |  pP T  pP 8 0OpЍ"6-@2-(u Q 8 O- MM@-nD/Q 8cpPC @P? `P/0젟 !EP. # "  G`PqP pU P cpP  PbP @(0/Pp Ѝۍ"MbPB-D>-H-P /0`@HqW !  p@@@ PB-@-@RI@ZO-Mp P  X0& rP#@0#03#P 0)G먓P `I0 P` ㍣@`@( p`@  xPU T TZxP UP@`@0T d@  Y@ $txPiPZO P@G $ TP@Z 0P4p lP Ih Ix0ST ! 0᳣ $02   $ !P h0t x nt H0` @v ˁ$ 0 TZAЍb @l h) 0ЍO|\妁tXD堁P P 0< 0D2-( T2-6-d2-&E(W r <>-# ^ p \2-P2-ҽ `2-9! = Լ K-MMP@`/0p0P # "  0Pp ,Gp(tA CH@PTD` Tp{ Gp# P Gp) KTGG @ݢ  b ԢЍۍp P@Ǣ al PTpL P@Ḣa (ᱢ㖟PB- D>-P2-2-* (T U J p@-/0@P`8P # " `VpPB-@-4 T#P D@ 0NiH,#P@ 0Ci@H&E(&A(p@-`@ dPV*P ?j<P # " $@p6-Q-Q-p@-P` U: 0 ?D0P  " , $P 0@0#@$0$0$  p 0p@6- Q-Q- G-M@PP-:P ? qW!   $p P@`@`TV/VPW P pV pWPۍ6-Q-Q-O-MP0p`Р L@DUZ: 0P " $U /dP$ T &ЍQ-6-Q-Q-Ŀ O-Mq(@PT̡@R`P @@(@V($@@`Q(@A$( ]P `/q  ` @$ >  P  2( #P!: ?PP " $ PPh @ \0 @ ZЍU-p2-ۿ  1 6-Q-Q- A-/@/P PpPP `P PP O-MPt 딀 q`P Q@Phc  BT0aP@U ЍOj U-p2- H-`@p V: 09| ?hh`1Q$0A$@T @P! $@T6- Q-Q-@2- p@-@P P P  P ` PPU U PUP` R P{P 400 P@$ pB U r U-U- R /R  R/T @-@  @U-p@-@P`P>V  ` @/`P XP ` u o p U-O-tM@4PP $$ X0BPtЍPP _ ˟L@P` @`GP p 0 @p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(pWX@ T *P@,` Pq ``D@ 0QD`V `@ 0p@@ pp @0 08p@ oY^ (T"L tЍOD2-( P2-Q 6-Q-Q-h2-6-x2-, 8 G-MPdP XX X0bU[  C`p ;%^ oAEp +^ ޞ_x0@ # H-@!0S Kaq:p.P P@2P Ϛ PP" ] P0ԝtP lP\Hg \44 0Ὕ82-h2-X-6-(X-@ћr !X- X-p@-dP@`@QpP`P :TNP @p$$ 0&z4I(h2- \-( G-M P  X0 DP  ypʻ\0\#P  S刓嘣 00+|P0 `%`V Q %B P "% P X,B PbŸ"0Pp0CA00G0LP 0& qP d"pk0 <`rR pp1  R8"BP$tP } R ` Cp4ڈ  B? P B2 P2AP P t!( XȜJaP"A|PЍ A3 [ 00!p0 [ L⒜ dd00{p⊜0 iD2-() X- X-X-8I(X2-h2-82-X- \- e-! 2-<2-\-\-c \-TIT2-x2-6-"" ᐗ|* 0ll$ᇗ2 fW ,< P. ( P t`"P@P  c  <<p#WDP PR 5,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $厶 p@冶 P $", X 0aL@B` #0 0Q a0 X(P%tPPW (P  PP(@PEUʐ[Ps x `U! V0pG V@Q  1T0Ѱ ᛖT`G(@n`FVʴP``(@a`FVʧX-0 `-`-X2-\-T2-2-( */" Q s ) 6-g } X-] X-8I(h2-X- 6-x2-4 M @2-\-Y ~ !d2-$`- A P/AQ y @;8I(X-H-h``PP QLLP 僕@ @0@P@P0 z2- `-  6-8 $`-O- M3p R cģCȓPXQ0 U0SWluP 5 P :P [Xڗ# R [ P 0 <[P[} Pl  pGWt"P{Bx px0pP P P\ DHP ᨕ ,, ᢕ$ 0P5 Pj  P B P ZU? 5pK [(lP 0 P-lqPP<0p RPA P 5 T+ + 0  Ѝ  t%+u_Tl )e-X- \-h2-X-8I(X-@2-( D2- ' 2-| n U > H2-q \-X2- \-\-O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0DK:pP A  Py`@PP D X▔<P(P :9p:  99ZU P@   0@ PDH 0'P LP  ,P   XMP }:P-9pԴP@P 1/T  ``9 p_9 D@$rZ 0P 8[  (2/P pDXP`)0 pW`P @SP 989P @ 0@C |8x# PP @P 9@ `PU ;88  88Z 0{Pr p 00P $ X⎓L `PP  X} ЍOE`P=  Xn7R0|& P څ8ׅdPD tt Up@8{R0<tR0 < `Ѝl8"8T8 vU ᝅ8ᚅpP tp@ 0W82-D2-( l2-P2-,e-L2-0e-8e-X | ( b `2-!F T  A % F%"c" (e-$a- | | x" A( p U   42-T pC-M`@ P *P gICPhUP @PP L PPH؀P 040  P赒Ѝpe-e-e- 2- (O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  hˑQ Q  EPRPA P P< P P 0夑PP!PPy P P`gQ8j@P!0嶃P ,Ѝۍ2-V Tk `-$`-(O< 4 0`ӌL2-0e-8e-P2-,e-2-* (p@-M@P  03/P x 0p ЍpL@P`N< 4 0`帏㝌L2-0e-8e-P2-,e-2-_ (H-4P4`4@pPP p2-2-T MH-M(   dЍH Ѝ/( : ;rnyy;sq{{Yz0H-MQ  13?  Q 1 Q <R 040,@P0^Ѝ0e-I2-s (K-M/@/P Pp/P Pp/`P\ 0`PЍ0H-PP NN@PZ5p `P TT X0H0@P:N0  0H P2-D2-( 0H-M@  h  P=Xb,ۍ0 e-0H-@  Pώ Ɏ ÎP  Ỏ P  ᳎P  ᫎ$P p ᣎ0d\` S ᛎ Lᗎ<<0H(M t \ l ~ κ $ i- p@-MP@ P`P ``PPP8,@, ,0 `VЍp* e-: C 0H-MP@Pf3p \P PP X0Ѝ0HBqM$ ( 08Ѝ0P2-D2-(o J @-@P Q P K G@tP3p XP LL X@ N8M0 $ @ P2-D2-( @-@P  @pP4p TP HH X@׍M0  @̍ P2-D2-( H-M`@PR P2pL"VP2pڐpP x0x| V X0P嗍@ L,, 0 ልpЍ P2-R (D2- ! MH-Md   DHP<P ЍH Ѝ/ PC(H2-" 0H-PP 0@2p T@P DD X@nL0  60P2-D2-( @-@P O K@pP!2p TP HH X@R#O-LMPNoP@ i[cPRPSP TP:n@QĚ p p p $  p 0 LPfP dPpo/P  i. " /ԏ 0)/pgp PD@TK @ QRD D D @ |P   <= =$=(=`,=@0=p4=X8 QZ VT WP%L㹙P   pLЍ)P /P  <4$> 0   p  gP -Xo   P`qE@-P*    P @PH @P\ \\- XP2 @P$ 00-H`FP@:Pa0@3S) `@BK  $ T l ̡  H T p | Ȣ Ԣ `R 0A@@ S3T T T T T T T T   T ( T 8  @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   PF!X  aQ QP 7o/oP" Wt`Q pp@paT gT cT\'  p(P ` p]  (@AP @R p pQx `xp@@P@ P PD  @ P@@  zP P( @ P@@  _(P P(t , @ P@@  EP P, 4 @ P@@  ,\P LP4  0 @ P@@  P P0T`K`Q PP $`@P`XX X hp@P_ +p7P `P 7P P  P`L\\dETFt3PP 9kp@PP2p@P- <P R' $0 0` `QV1AbV0v QV  `d>#m-m-p@gPD P@'P2P " 0P  V3$DP TU 7U Um-m-$Qi L H m-m-m-m-m-m-(n-D4 7<$5<(3<,1<0/<4-<8+<x!+n-b`^m-m-m-m-m-m-m-n-/"n-!n-" 0" n-(n-xn- n-$n-n- n-J(n-(q- (o A [ N Q P9"! E -  r t"0H-0P@P PgPP0HI(O-4Mp`P@P,P>*!,0 $"00 (P PPPPCp0P 6P P00 Cp0<P 0iP ?0pPp UX*` P, R  PyPP `V::x  )p 7P ,Q>8  PP M 0@P  /;P 7P P|Ct]Dp4ЍLX n-n- m- < m-m-m- !o A [ N Q  O-\MM@`P QH 0@<$\ЍۍO蓃呃ᎃ@P}      0 X ȱ ȱ ȱ 0l#\P~tX`d](\s ~8P  ~ x5 8?!p4,0,#W W\P oH~X  &Q, Q-)""\P~0X\ЍۍdAP ( 0 8 H | WT   Q\ЍۍO8j@Q:g@P189 :0T;p<`=Pp`P‚%8;=E4@APBpC`D9 :0<>?($ `pPP4如jP8 @0蛂 \ЍۍO\\唂 P吂 m- 8, p># ?#(/ >#8  . S K F 8 +  ! } Z 7 4@#a@#># !?#O-DMMQ `XPaL"@P}4rX`@P`XX  ᇃ 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hX0 qQ4\f0 .pA~hX pP  .0*O 0 .㓁  ZP@`@P`XX X X5DЍۍ" @#(p-, m-)!O-Mp@`V` ` GP @ d l t W W` ``hP; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P 爹 d p | \ X X "Pp p P@ P:0WW``- [a( Y //P1 W/`P p!`Wx 0`Zp @`Ѝp 0  zЍOC/`P WP ߤp1P YKP  / Fe`P9`W  ?( n-J(n-ثn-a R p@-@`HP R!PU e1 E op n-o n-a H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0n-0H-P@U U d D` 0*0  #X0H  (O-dM 4"p(0P$8,$<0 0p| @<PT(<@Q3 P18E> 6p PP%  P| tw PP xlwPpWP 80 T TH<00 07/P<AQ  l @ 8   8pW P 48 @<(P @P<  @0g6p|. ' P@(@PP`00(w<@P @ 44 wD#wB v@vPHppp$p \G GP,,GpppP hW,`,}LGp  ,W,r(,nGp  V,e,aFp  V,W,SFp  V,I,EhFp  PV,;h,7\0Fp  V,-8,),Ep  U,,Ep  U,, Ep  pU,,PEp 8U,x,lEpW \%@P 0ut,,$$$'vHQ "v(v u[I8@ E> @@@J5pt @ 0G8 @@PE>  PPP75pM P4 Pj8P@ E> @@@$5pN d@ 0!'8PH @E>  5p; P$0H8@ E> @@@5p+ @ 0@_0uPXT^ 8Pp 0`L PPm'P @E>  4p i7"Lv18<@@[@T' ,$4Y3,4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $&0 PP  0 PX4 R-5 r {-8~-*/"""!K(!lK(z-{- 5 $" ? $ J U o f ~- B"  ! ) 3 ; E I S 0"q z-z- hK( {- O-MMp=P @TT?QD@)oP.PQQT o P 弿 (c$,,$ `( 0p+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD P; =PP4H=PppP `P`Td00@DM,dD`DDD,@pP _@ = @P  tP W ,Pz @@ P p@  PI  P^  Pb  P  P  PT @Pt hBQ0  h h h h h  h 8 h h ( h  0 aRm p p QrT 2P PP@{ @pQv U@TXPY S @PW MPV HPU CPR >PO TZ 2 @Qo PlJP8 gRi3T> 2PP P@.PUTdP @ P @ Z PL@ =PPF=P@P 0P0c` X>FtM.p ``X `p0 `d0`F> ` 2p D`@P;!9Ut (`0wd P` =PP[ =P  =P  P9 =`0@P`0c <BM. p  FnX 0 A``P`d40 `1p hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP  < ,(P  PTTT$P >P`ppd "P1 (P P7 P% ( { @PUPL(,P\@pW`,P* X 1 L Ll  Pb Q vQ Q Q \PTtR:"#PT ``F> 0p H`4 G 0@ 1  =UO qJ(qB &&PW  @Q s0{ppP ppy pP.` 堠 P  0 PJ 0pPI c 7M. 0- X q 5 q'  @P LQWP P b(  F0 ̔0pT@` A$ M> P&0p @@_@PT!L0  G @Q  {-PP   `PP @lK(`PP PP  R%  {-K( {- ФZ PZPZQ)Z&PxtL 44@Pz- d p (| :0PP P z-` M `0 /p P P, PC 0VM.0(Z AP |C 0= 0ꘜ 4C0 0,F.0% # D X iдps[ [*  h3<" A"J? o" ;d`Q PP= \P]\  /PP P  6,3@POUJTH TP@PU*%o , `d @ PP, @ PP M"F @PmY"-\/ tH |@ H@:"= F z- {-{-{-" z-{-8~-~ O = \ o D# h h &  <"  [ =     U : M0H-M0@P00n 0P P AAЍ0HЍ/K-GMP AN` X'pF` 0 @1.p`PV`v  XQ:6&X`Gލ Q( Q `O-$MPP/P tPt@` /pF   9#Pⰰ`P$ЍO9lK( {-|-O-\M@ ` QqX: O/P 0:P P  # " P@*Xp\Ѝ` @0D4` @0D 0|-z 8B#Z j Mp@-Mx`@P4d oX R LL0n  o,Ѝp@ Ѝ/hK( z-{- {-@-@P )@Q 0 %  . pp@P PP - 80T(Pk{-z- {-"z-A-M`P @1P(p 0 WЍRWP& XW mЍA X0ЍA`P P# PE  X3 DW W m! m X   m# X  0m    0|m  l\\ymWPЍAsm ЍA5m{-{-{- pK(! {- gS h[ !"p(K-`pPP``1@ p 0 WRW P9 4PW mKd X0KQP ,mU`PEP !mQ P mU PE@W hKmW W0m Kl  m{-{-{- pK(! {-x p(A-PLP <PX2e``8 0`&p VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝz- {- {-{-H-0 l 0@  @ @ \R $0@BR(O-MĀ弐`Pp @` 0 T  0  p C@`VTD@P Ѝ 7xi Op u ! O-dM`PP Z8 p@ ^|]J 0if  0  \f 0  .[0<P @Z P  dЍOf x ( 0H-P @P08PU 4P 48`PU:XP0PQ4P8P:XP00,Q$/  {-{-tK( {-O-MMP`0 @#P @u앟 F쥟 8TP0U@%P& ( ( ( ( ( ( ( ( ( ( ( x' ( (' ' ( ' & T' ( ( ' & ' ' ( ' ' ( ( ' ( ( ( ( ( `' PAP DPYPwPr@Pi PaP[PS PMPG 8GP1PspP#jppW  FP P:   L8W`V LP,P 2X WWWP RP MPWGP;P) D* + p* + + + * |PgFWڀWI  WV  WpBpR'pPj `%P  P8 @ev W; @Wr!0 0  0=Wd A M p[ A bZP) qv\P'ZIH D!00 0  0f8 '  p  C0P&b r d*㛙@dT 0 !$!6q0pdfb  --$/-!--------(# 5 ! ; u v \ , K-P@(a(q( 6tPP>aPp'D Q Q`Q@@eP! @P:bQ@T tOP dJPO@HH Pe8 ea 롙 -$/(# 5 -( 0H-5@ Pe d| dp dd dX dL d@ d4 da(  ) H c v H-MM@P  WYP*  P%J $ $`pPP 7P ``P   ` p4B`Ѝۍ}a ---, 0H-M@  YP DPP 4   pBPۍ0--, O-oMM 0@@@Pj 0@P.P PpB ;_p $  . pI @(,P $P* P: @$h  .{ p0P' 7P!1  `cP p,danXaP ' >c,аX:(P.  .C P(P% @P 0a P `bX `7|`P  c@T: (w-PPkJoߍۍE#!|d!- edAO"O-MMmP``d D t PP P  XP PY  A  ePY T \P 5p4p0 QP `P oPa ,P P }`, t p*8  ` @ozPBp1 }`V P Y p"p2@`b-P D ")8"$H SA "2a@pPU oo `A`qm`PTEY @P U ` 0b<P U  b  0b@p V L  0bl@lpP 8-P x"PP {_y_8&s ! - -# |,"2 P9" ! 5 ( ? l , @-@pP dP   p , a@-j = O-M-Mh `d @Pp׵WH"PJHP  pP X: J._PV V V| t(   P< 4( 0 ((P (P4 toU\,@D0 Pp@ ` pG@oY1W4P t0@H @L3 ?WD) @ R 4) @ R $)@R @t0S0t@  )yiY@ @@H  P`@p`HXL@\0Dߋ0@` lp8hP dP tl0 P @lpo/\p P0T`PX@` \J ;G$ `@`\p ;$`\p H0' @`#}[ pp E;$x@`[8p t0$ `ZL } 06 ?t0 g`H0@!!@ ! 0< E 0` 0L@Z L@<0 Q   9`\` X@T`DP0HJXP,0P# ;4p$P h @P0y[p? ;$ p0n[p4 \ `'Y@P~ pP4pP @` ;$ `BPPL[p ;$APA[p H@0 P! l0#D!}1[p `@ X$;`!x![p vpPv A{EL}x t0#   @_ 0 0 p l(0p @`0lUᮻ4厔P; P` `pA 0Zp ;$p`Zp `X$; xpZpy  x0ktiV(4P^$ 0x  0r 0k( 0 BH @`@!l0_`! 0Xp V 0Ol uhdu Ahd$+ A 0 ) 8` 01lt0p L ` ^ 0PЍЍx.pY@$D :h- 0h& &h F !kz Tɚ;4 R hY ] f h oo z t n O   p@-P R @P` Vp@tBppO-MM@Ppb 0fPpp RPqPk !Rc P`p SP\ @@ ]P APP  a@P@ 3  P  P O@@ FP# < ]Pt*P &=Qpl= R< Ѝۍ $ `o -( أ , H- ^[( O-M@@PZ ,qvgP! `P ǀ`H~A@U U @B P P `FpV<`ЍP@P `@`P(B.RP n---, v H-P P P||| H^tC4hh h0LPd@dp`:^0 SD H ̫- =.|5.E#!y."!kr 0H-@P=P PQ ^x0 RP\4&H0&P0< #00 0E#y."̫- |5.( 3 =.=.=.H-P@P@T`p|T Q\ enTDP 80 %,%P@pp-=.ܫ-E# 8>.( 3 H-P H3 ; |5.H-P H3 y."|5.H-P Hr3 B |5.H-P$$$ ]3̫-H >.|5.H-P$$$ t]q3̫-i =.|5.H-P$$$ b]_3̫- =.|5.H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0%!T Tp =@P P H 2@P PP 2Aލ |5.h5.x5.t5. O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXNP +㗸 lЍ((5.5.5.9.̫- O-DMMP<@l P$ <>Pc @@:xuMP <<\ PT <@ AP 0 P3 <P. < 00< B@0Qo0TA0#PP <!@P@PQyY,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< 5Y@PQY 9DЍۍ |5.F.. P5.̫- 3 @- 0$ 0 @JP5. Q O-MMP P";P 2B  00$P P Q7PxJP t\r P>Pt P6-0Ѝۍdh 0/O8 |5.E P5.F.d>..t5.p5.x5. \- Q 3 ȫ-̫-L  K-AMP-@WP) `P +0Ѐ``=p pPJP  0`E+0=pm -8 4W Aލ|5.r "P5. Q ̫-q  P/iv@!H-P ,,, ,0}Wy-̫- |5.p@-P@P Po`t P `P X-pU , `P$00 HWpiv@!̫- H- 0 0- |5.H-P 0P $$H*-p-̫- |5.H- 0 - |5.H-P P!,$!A?o2Q@0!`@PhP pbP @P( 00 ,@P Vh@P \h V\PL  D  Viv@!`5.-̫- & < j t-|5.H- 0H p-R |5.H- 0> -_ |5.@-(@(0 3  Rt-u |5.`5.H- 0# \- |5.p@-MP P P h/o"Q ) @a/|,F@PP aP}<P@,ሳ@@T P x` h0P t0@  T0@VLDL 06㚸(0ЍpT-iv@!-ī-x-̫- |5.H- 0 X- |5.H- 0 l- |5.H-P PP@PiP dP ?0pʨ U+xo200pP`TT @S@p L`@``0`UQ ܫ-iv@!̫- 3 ث-|5.H-MP) P'P  8P P}Q xP ll|\P PPP 000+ЍM |5.p-̫-^ B.F.\>.0H-P P  P<P @:p ;ll0P \T iU 0Hc+0<3($ 㾷0H |5. -̫->. H-MP PPL  q8P 4mP$6+Ѝ \>.|5.O- MPS PX!P8PK HaHPP34BGP  P ;P0 @pP P P &PPP pPpP ];pP3P* Ѝ8 |5.F..ȫ-\-H-MP$ P  7P P|  7P PTP@P4P * Ѝ  \>.|5.G-Mp`pJoR@P WC P㌑P' W4 lW&T{:p`pZH0P( PP0Q$V/ ;`P cP%) 0,ЍG裶W`p7*P@ :|` Od0  $V ЍG Ѝ ; 4 A d>.6 @L |5.F ]Q ̫- O-$MP P" *7P{ P! !7Pr  @@  P |P %;P^ PY @xqxPP2@`EP  @P3 .̫-! H-MP# P!P  V5P xRPl}Q `P TTDAP8 (Ѝ6 p |5.p-̫-E o \>.H-MP# P!P  5P xPl}Q `P TTD P8'Ѝ6 |5.p-̫-w \>.H-M P P<  4P $ 'Ѝ |5.!K-M@P +ɮUppE`  +㏮V +㉮`U0 Pۍ!, \>.H-M P P<  4P $f'Ѝ |5. H-MP Pt  4P P T  x4P P,qP <'Ѝ> |5.0H-P D@ PP 4Y&'(0PP0p- |5.0H- @R:'L00@ PP  95P0p-  |5.0H-P D@ PP 4$&(0P0p-$  |5.@-PQ &P<@P  %P M-|5.H-PQ &4P H06-, |5.H-M@-M P  PP@ &L 4CY@P@$EЍ1 |5.H-P>/@PK%,,PC%BH---d5.-K-MP P!3P +P p\`&S&&HH!p P 8uBP(/@% P P %.ЍPᚦP `л@ ᩨP ;P @2/LP$. |5.̫-O : - -{ (-Sd5.b H- 0~ p5. |5.H- 0t - |5.0H-P PP U@  p%`0L @HH000 0,U0 0Hݬt5.|5.5.5.̫- 0H-MP< P @  t3P,  2P( P%ʴP @P  P  @嵱@d+㞬 P L+㗬P i%Ѝ0̫-x5. |5. @5.-5.9.p@-P P!0PoobQP``@'`@ P P P  P 6%|| hP  \\ @HHP 88 0O piv@!-!h-d-̫- |5.H-,0, (0\ 0 p-- |5.-H-,0, (0\ 0 p-- |5.-H-d`P` `0@P0lHpPD D0``P0_$`p-- |5.- --H- 0O h5.% |5.H- 0E l5.2 |5.O-MPPR@Pڣ$Ѝp` P  P p P`U j8PJ`U c8PF-B- U`T P 0 0p S p[N U`T pP x0dl `p0h`P S `AN - -!"\"--p-A ̫-v@!i--} H- w|5.H-P |PPt}Q hP \\TAPHHH 000$  |5.p-̫- B.F.\>.@-MP P@ Q P QJ R  M#Ѝp| 0/Ѝ@0L DD@0  0 Ѝ@M Ѝ@d>.P5.̫- '  |5.0H-P ,@,PP0#0p-W |5.K-MP0 8RQ4LtP%" 0P! PP Sܑ 㟪P !p p W'P e#Jq p||AjPjzpF p P  W2  WR3 pV@ AQ Iz P p AQ 7z P\lhЍpG$- \-̫- F.G.( \ |5.0H-MP  PP| 0P W4@Pp @ 80Lt"Ѝ0 ̫- |5.0H-MP # P!P /P 4p `@ PK:5L0 Lq"Ѝ0 ̫-) |5.H-P P"(HH/ |5.4 @-00 @P 0 @uLQ ̫-< H-MP PP  /P 3P @(P PPPP"P``2 phP 4 0,Ѝ F ]!|5.O-MP  PP  G/P (P PPP "$Pặ`p2|@ & lPll Ѐ`pDD0Xp`|Ѝ F ]P5.p-`5.3 |5.0H-P)@P5 P 0 P + PPPP5p 0PT0H004 4K! 0m !"t --̫-| |5.A-M─  RPx0S lpl@lP` QK0`SЍA|! Ѝ|5.DR(̫- !H-@`p&P PP w10@0PT,, HTK HNKp-̫- p@-|`@PT&P PP < 83Kpp@-! p@(K|5.̫- 0H-P \P H@LPGP0!80   0,0Hlp-d>. ̫- |5.0H- @R: 0`  R L@ PP @ 88 0,0HIP0p-d>.R M ̫- |5.0H- R R l@0 PP ` @0@@ 0,0H P0p-|5.d>. ̫-Z O-$MMpPQ %P $ -P XCP` 㡷P P@XPU  {J$Ѝٍt)㚧`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)f P@P@0 0@ @ AQ`@)AɵP]%z%P Pp  P P  T@pP Ha8 @P   ]J` ` 2/PP )%| @P  P *JY& Z2 -F.(-(-̫-O |5.: -{ p-(-0-"!O- MPl@;P LP P9( 6(P Pp  ЍаАЀ:`P 爫P `P"pW p_P|P PP `--hX X ԫ---@p@-MP @P  P  P ` PU PP 0PЍpd%PPЍp@ 4 P F0yYJ!R!V!Z!a! G- M p` p. { P/P:P" 5p P RP N ЍPP `A`pD@cP'`PXOp 0p/ 幥  ᅥ 㰥 /pP p. P : P p`./ PPp ,@cPP 2Ph \"|5.9!"O-wMMp`qq|qxq`T```tq```````|`hpx`l`h`gppd``0`` ``S:P p &p  &|p |&xp x&P; 5= x@0  p x.|d .h.Px(UlpP'PQVPQUu UyQu - _PG Ptp tPP 1/dQP Px d   P AP :P 3P ,wߍۍP &/P--P P  PPPo؀PppPPP\PXP PP/?04P 4P@ ~\ X 4 pq3dP XO T0G  @*G80P `QpQ P %x%^ R Q OP Q P Qa-/|@p |%|#P@P' PO }5P v E%peV "P WJ@n Q;Q  @n qQ QɳPxW p@nPP j  R ? 0  R (` U/? (`͟(` R 0m S썢 Ρ0 <4P  P 0( 0 `p Wp  p #PP   X`̌ PP ̟P ,P P P&@復,P  X̟ R 0E nS3 nH0ppT0(p:@P0 `#p @P  P  p  R `@[F#p0 P0`+ P@ @@=R$ j/5ue0SG/ rP@HE` j/5euS FPP T&@p3Po P``@@P y #4PS 嘲PRVU PQ`@P > 88_x,ႢQPUQPM PNJDAdP |P$ $`=P H4 0 %0&   P 0 '0* 5@`0P&@#P `P0P  0 jJ#! hRp Pl PxP(!P RL *pᘰn+P9 $p Ln_: P  _P j EQ Q(P mZ:  AᴛP PPL$pXPW 5QP PP  P d*P!x0P x`%ẦP  ! jo 0 VpD PPP7j5-R 0 (0) "'* $^DP l+X6PL{@? "Fu" P~P"!|AP) lP% P ! P @P  P: #t @P   uDx1P /"ꀧ- 厧-X\0S  ! jO`aX\ 0!3/`-p@X\1*, Cl@ pP" pD Z  @ 0R;!!-H5.P5.qW P ᶰP0( )n `Lx|Peeee޳TUPv?  Pe嚬P Pif\5.r !p-̫-7!B!6 -B $ -ؕUYP^ HhOP b[jo ^  00 0NP  _ [P P  0%C Op0Po2  .pm[.k?g#p~ - G!Y 0x `,ꐧ--- `P UPU ᕮCP rUU ᇮ5P dP ګtatp1ڠ!^|Q<s!th0T2j!P<f!P < BPP P@ x0  .x `pB6x| I /x//}Q m@!/ R:m MH 9 To/ D\B c/d P =,QT/ PLP  K/`5.t-,<C/똀P` h|YpQ`U P  Bt */ PLV P H BP8 /UP |  //p {ȰP^( `j? "   P pn qD Q! (+ @  0p P `@ 0 J[0   P `?@'DPz <`n?9PP6 0   P$ P P Q'P Q'H P.  c!@Q @` 0 pP `8Dp@`@0 4P (v_uP9PMPX PgP Pg !PP PTn? <P _! X!!b \'Q\J04PP 0` TB"PU *Q/p0 P؆0@Ijo,U;M)Py Ptj*1\Xo& 0  0`l,PG \(b!j `QJpP-Qj  0QeJ0@Pf pP /P *R ` W!!j 0`Q9JP 0 `  4Dp! tf !!,!PP n& 00`4  H @ <Pn? P 0 p P ` 0  P>!!p!!8K@P  4p PWP#)Ad b!8Q6 Q; W   00H Q <   00P!8 1R#P 4 ? x4P0 P  00,@P @`#L@!P hL4 ?4Px  00H=`  004P: p  00`"  0pY P  P 00H 0C 0pC긧-Q 0  깲!F0  04P@`pH@ P0 DV U P `W+ W! Wx| x  p  04P@`{ P P !گH5.P5.p-̫-!`--F. (- !-(-!! - !-!)!9!K!]!k!Ы-z&!!!-!!!!! !P!/!J! R((d!t! !!!!; ! !!6!J!\!-!!!!b!!!!!!O-LMM@  P0P(P,PPPRPЕP  $@PP  40 ,0$P:P $P (0Pp ,P P PP*pUP( LЍۍ`P@V= P@P8 /  PQ# P* P#PQ ;P PP P P  +4P u `PQ  @`P P `P`U P PTP ߛ`P`` `cs@@P J@=8 +5 P8@<( @D\Cp8 pP P,0 ^!P X `X8; 0"S K8!`U. [,B尲8p `P /P`` P P +ޚ@.|5.(!"--\-E V !!9!O-MPQ RSM P   P   P (Q| P P P PP /P @@`@# p P@@"@l"p@P PpQ  P"@p:P P"@oPl:ڞP PPPpU  Q QP P* 0X P P P  J @lPUTPy"@P <Qo"ЍJ!Z!R!*!ԫ-:!!P-L-"!0H-P@["W"S" ! !00H-P0S0 %S S Q PP@@ ^00 PP  V060 /00(H-hM\P )L 0d:P 00<P.ȫ-!̫--H-hMp`P P 0d:P 40<P-H-ȫ-I!̫--@-@P RP LP F0H-@P =PU RP /0p@-`P@:ƝP !`'P %㻝Px (` ( P P !PR! R r(p@n(!!5!H-Mp@`PP< 0 R*0SJ  0C @P 00S  P Ѝ-0!K-pԦ@`E P AQ P Q AR0Q  qQ  PO-lMMP@3   H   X$\$`$d$T$H L@PD0P P`]D,@P,QDYC ` @k.!p-̫-!r [.Q [. !o !; !|5.!!" !/O-. (@-e@ lP ` \,P @@  Q H@,*H-ȫ-̫-6 (-,-0-@-:@hP \ X,P <<  Q  @*ȫ-̫-6 4-,-0- MH-MpP $0P& `@  8` ϤoPP PP jHtDPЍH Ѝ/4/[.(-4 -, !|5.O-Md P@80/`p@ a.8--<-`5. ! !-|-A-MXt` PP p   $P  pW  pPpQpCP P8 P7 P P{&P1 P&P|yt@@ɡ`cP Q PPQ h 0SPY Yd_V Mr   0P3 P-y:   D0P0 P(B`m i   0`C4C   =P< o P P6 oP h P pHb4P,@)'PP Ѝ (P  !PPP C3 l5. =.>.>.=.8 !̫- !- !8-0- P5. !|,"@- ,---@-|5.[.! ! !@-hM@x0 @@rP sPxl@d Ԑ`d 㠐 PPV0%(.DH-\5.(-F.$!-!U!̫-@-3!O-MM̨P 崘@  똈p>ڌ 0 xP]TP2 HP.<x p00P `` p%SP|xt4$q p1$P!~00p! P P4 `_ 000G~`pRpQ_` Qa Qb Q F@[@Ѝۍ <  @0p@P>Pd"|x$t4q px0$P!~0p0d-P--|-ث---ܫ-p- !-̫-\W.|5. !8 !h-= ! !8-_ !j !-E !* ! ! !T ! !3 ! ! !- ! ! ! ! !x !O-LMTLQ LЍO\ @pD P p= (P4(, С mP<=iP(, ! 00( S00@BSCC /Xp *P &#P ,#P @LЍ  <P@p< pP #P   p P Pp =P0  g\@ |-d--MbW !6 !-z !O-LM`Ptpp̣ǿ[ǿS@0PW 0뵡@P}@   8ppʣP #P  )pPJW~ PP  @pʀP |#Pe @PJpGPWppP  <# R ȓ  0PQr" @P  P P ء ?$  R# Pw0p#@Wx 0 08 (P4$p0SE/ppP r_ P=@AiJpPP'  P #!P0  @P  P # @P   +0@0MoBPwLЍ#00ꈧ-̫-O-CM-`/@P,M\<|LЬ0 P  @Ꮬo" 4Q P0P&| PP3h   PP4 t!PP@" \P @WPY-P !./[  '/ $  Y ph PG PB8(P< |P7/㎓p@P < PkW @W /*PpSڈzP  PpP  P LzP < Q  ( 0 p0 P, Q P   PJ  LIPc d P P Ro 8  p G `p  @ dIPJdHXPP 1/P ([P`CߍP [P lw T0sP@ lP0 P Y㰗 E.P (CP |P  &P? 'pN dt&XP\P@Lp H  P gP Q @VP tQ P Q?P P  R @@Q(*P  Lv `P! R &0p \UP P P  $UP @pEPT#p PI P pHRY"  @T @P  P p   0--,  0  P`P  ,p @ V v V  ,p #tSYi @ TT @P  PI #E0 pP000ṕqK,t\ 0 CP!JPp`Pc P pP p`U  0!pI M#Q- @P   C-Q@ @@ P 0  @ A"@ b P 1/]YP $A ,Z0 S R P_ P QP >0 !0  <8 @`p,`(p0PpLAP80 L,ꐧ-3 l--\5.!t-H5.p-̫- ! !--@--|5.B @l5.# !"""5 !=.=.P5. !|,", r t Q f (D--H-`5.F !c!!-[ ! ! ! |-G-/P/p㥐P @T`pU`v+ܠ+ ! . V%@1dp1PpW u`9P PP0PPJu0QT.Q@DP 8  圼"""D-̫-;!# !0H-hM@\s LPd ܈ 8PbnH-!̫-@-A-MLQ@PC `lP    0FP  +. %PP uʴ P4T P+P:PyP`Ps qۍ@,0P(ۍA[.!![.@-|5.b!@-醜,@ {@H-(-G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,6Q00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRR AYP\  l@ l!+؇+ԇ@W+χW+ˇ k P  G/(- -`-Й--|>.[.--[.h5.=.-=.l5.p5.t5.5.5.x5.5.9.0H-tP2 `P T P,P "88 80(@PP H-ȫ-̫-6 0-@-F.(-p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q tt`H@ PJP (S@[. !|5.̫-!Ѻ̫-!O-4MM0,a@ A,잟~^.>@0@^~n.Q ^n~^@^pp@[|>Pn~ @@n.@@\>@0\@@lΟPp>x~Pt.Xn@@@@@@嬂P @ +Ć PD*(.(ᝂ .P  喂P& @P P P P L<厚xၖP d {P4 W0P R Q P  DP XP@@lP\P&,X PP T P``0 `0,P 4p@DW, @ 0 4(  4( 4( 4( & 4( 4( 4( 4( & 4(  4( 4( 4( 4( 4( 4( $ 4( 4( 4( 4( 4( < 4( h 4( x 4( D 4(  4( 4( 4( 4( 4( 4( 4( 4( 4( 4( 4(     4( h! 4( 4( 4( 4( ! ! P!  t!  !   4( ! 8z( %P?( 0P 7z +Å 0 P:5   0 t 4  0 o L)0 eH<y4 Dwq pwcjp စ댉pip$$P\ Qc pWS @,y( XP ( 0P! 7=,(E 0P& tx( |P( 0P <xp 0 8p $}  0'4Ѝۍpq`@ 0;I'7w0UA0,@@,  xd7 ېPZ@W@w@@@嬀PQ 0뤕P @P2@P P PQ PQ +᠄@ Ttx+i P:?P X@@Q@w P , @ႄ  N]&PP uRP  uIP  u@P  u7P  t/p%pP \&X%XP D@%P  ($P  DD0Po[,:RP ,WPd |Pld ,@p@P `p00 ?Q  0&`+ԃ,tp帓r帣 DV@@04 V P R P 04@ &kP [0,p.8 5    ?@0 6? 0 6 Pz0, f@LP P^#Bp0 6!!T-H-L-^!P-o!!`-\--!X-d-h--l-p-t-x--|-------------!-W -'j! !" -!! !R!!ī-!4"[!(ȫ-̫-Ы-`! /1!!!$/--!-%1!B"!-!-!@s -ث-ܫ-R(!ԫ-!(-----`!- -5!!!"v!bx ! !!F ]!mL!!!!!!B h h -hX X --!G!O- M((B44R4bP  yP  %G )0 p  Q PSP pp W| P lPdET! 㑂$  2/PP P  @P  P %   ЍP  @P  v %sȫ-̫-$-(-th ((-/!(--: O -{ ,-0-@0 hX X p@-xPPlP `@`jP PH5F(@( P gp -DR(mL!$-!!p@-@P 0`PP EP @pDR(p@-xPPlP `@`0P PH[5F(@( P -p$-DR(!(-! !p@-d`dl0`` 0HP\@ @T p(--4-85.8-(-<5.H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUWK(O-Mp@`xV, PPV( V)JtQ@\p1pdd!W B$X!P  `Q R L 8`PG ЍOyЍO#V,ⴰp`P p| 0U 0\ $HX ` $ `2/Ѝe ̫-!! -O!~!!K(0H- $R!R!0S S1!Q0t100 R R R@!084!0S S0100@ P@\U "UPU "U P@PU& P@P!UU U UT 00 0S S 4 0( 04-85.<5.@5.R(R(0H-P T@P PP PP  30 3DR(!!@-D@px0P8@oR(̫-O-M-Mp$  $p P+(<8@ d(P@N/(P(5N/<@8 DP  jP u 0S l%(!P@T3  8 A8  A%( (  _dUdPj0!`Q-@AP :@D T$tdPp?DA( jg! j X`@ pP:j)0$  uK!uPP:S0:UP$j( ?!P(10A,qS @Dw8 -T=IBJ P@   APЀX0 7 A  QzV@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0  PR,@@X!@R : P\" R8`p 8 AkG   H 0 JT!e P$P!e Px ,(P jލЍ P*p!e  Y@LL!@Q5?e ,AQ%.v w,BD@b"(r02r 7"cA qdt P꩒| (@0`j  `P%%3,.A[.P5.[.[.--!̫--t-4= X5., H5.!D5.Q!E#!hF#!,!ų[!!`!A!N!6 @- M @ @  Ѝ0H-0MP@㐑 XPC0Ѝ0@-e@a@O-M-JMPP- F`1F?pPQ @C57 -T=IBJ   Ah@T0@`p 7 A  Q47`pX p $ # 0 F=P9[ڼ#!HP1 e0 PK xP?@K P*8#ePvw @#` pp7cDep|V0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0K`Z pX@"f< ZPJߍЍ.A Y ! P@PPPP^6@PY6 AKE4 H 0  Q%ᡏ,!p@Pf@ U: d0@vw @ ` pp7cGdpqQ`  W 0Pp Q0pSh f`t-p-[.-n!\5.!dE.!ų[!!hF#!H5.P5.!![.!6 ̫-@-\@ RHP < 8,P d@舧-ȫ-̫-6 O-kMPpPN `@xP/ >:pӫ.㽁뀥p4P| ZP  P PQ P p  HP P  @PHD D E `E :P p P| tP  %P hP PPJ?P p P(EPPJ?P p P.Qs AQ  L Q  Q Q q R sP PQ Kp @ U Ph | hrP PP P H @ Zq AQ  K Q q[ܡ Q KpK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P ꥏP  p Kp#KpkߍXhLdd`T\8깧-r \.!|>.-̫-|!-F.(!G.!\ !K! \.v!!!!A-PR@`  P,P AQ  KP @Q:p '"P%a@ AQ  K\P p"P HQ Jp; F@Ddt08A`p AQ  J[P \PQ  Q P ,P Jp D`Fdvx~@DFX@@P HH8@PᶊP PP @q@o\. \.!F#ثH-`tPP .@P pP 4`pG ntPoB@ \.p@-MP) QQ  RPʌ! yQpap@l1 R0P0R LP R 8-0Ѝp4P PP   ``?z 0` `7z ` 1z ` +z ` %z P  Ѝp@^-|>.̫-&!|5.b!x-T-L-ī-Q!p-n!=.y."=.=.=.!>.>.I"4>.=.!=.8>.k"`-X>.K-MpP`}뼐@? T*  ` ?,` B0pdd Q`Ѝ@uJ $ 0D(-̫-!(-(-T!!r!O-dMPp@`QP PPP `W P 4P V  U ~  0ppW ̳̃ԓP `0S  P L P 0jpPVpP \P PP pTy y yP pK`P: Q $@P@$ ῇm 5 P@ᵇcTQ d$@P@ᣇQP4 $P@ᖇD`@T&QPP!@PvpWEQaۈP3 PpW:T@ xt1p@P : PU O P , PU AP dЍ)x PoEP|| ԫ-v! ̫--9!H!(x-bx e!F.---F. (- !-(->.F.B.T! |5.A-ā`PqPKV q@q P:.P Btt0,Xd @(rP L "rP 888!P V  #jP߫ pP 0RP @@#xV  @ OpP  1s0b Br`ܫ-p-W W.!̫-!!mw ->.>.!!=.; =. d>.-V  0H-@Q @QPP  qP tP dP TP0 0(x!d>.M }!7P"!@-@P IG x0 t@Rdh0HT P <Q,[.>.ԫ-->.--F.|---H-P @P 4 0,P l H-ȫ-̫-6 -H-@{PaP pP P0FpPJ& P |pP PF@qT:P *-[.|-d5.!H-P Y4P*t*N!(!H-P`p @P ႅ@ R* T 0pRpp`FPt` AQ F PpT,`T (!!!@-@P (*!@-@~CP>.O-MMP`QQ P RP 3F@@P \@ R B@P{  {P@@{Q`@T``rp+hvP/P +0vp++vXpU"!1TpppUp Xo R 818a8pw 0R @dP:TU o P    RT E@@p@Ѝۍ-X-F.p`.t`.-"!p-t-`5.-Q A |5.W.r p\.!!p@-0MPP `, 0@P L| 0Ѝp@P @ 0ЍpX- A-MXaPPLAPpP 0P, z@P;  ~ R/ 00 @ @,@U(  0(z!P}Pp@U PlPlP @ pЍܫ-p-d>.!|5.̫-W.(!O-,M(rPbP@PB IPGq `KzP.EzPểP` gP a 2t0   ` ,RៃP<@ .P6 ? !0  * @3U.  0(3z'P}PpU PP哨P  9< 8L ,Ѝ|5.p-ܫ-d>.K!̫-W.S!W!!!!"!H-0 2(P  (x`.!!H-`Ph@\ ~.pP D w.pP, p.p!!-!G!A-P  ЀQp`@P yPQp`"QQ l@0L"Q "R  Q S0:  @F.|5.p-ܫ-B.W.H-MM P@+:t*`.PP G@P /P᳂`p PP o/@oP3PЍۍ""]!O-M@T `Pp䍂PPpWPP`]U@D` UVR:PAPp  P@ * aV ၧQ#*ZP*` @P  P `V: Q* XP  00S 0ЍD5.̫-@-M⭇P@ ,<P Ḽ( QPpP嚇@Ѝ̫-ht@D5.H-P P#Q  P p\Q H QA@P ,P@&똧----!@-M @!   R Q Rd fQgQ mQ kQ Q bQO OЍ((0H-M@PP *0pd\P LP *0ջp Ѝ0Ѝ0H-!-!O-pW% Q" S AP\ ` @GT ^ *p\W ^p2P`pW ^U1:O- MCPpA`A%[ [ V* `Pb[.KP :%[ M[c n[ m[^ c[P QDP8c[.[0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^0BQ- 4 BV*.0.[NV|* R07 2R10v*`.a!QPP V  m[.P| R_ `PtꀡlAEVS*% iLPHPb V  RA `PVV8*% RL:2V-*/   R)*<00 QR937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ-F.@|>.F.B.!/O-\MMp`@ 0  ;7 yP HS +7q qP P R PUP Zp8  5p* P .pG <8HP ]  p0  q(((7 0]wYp0@   ; yP  +(qD!@A[T;$P+8pP! H0 m=iS00@,a@ SBCc / 㲀᫸pP #P #X! AQ"P<`  P*T0Ἱp ThV} ``<7 \Ѝۍ蹲!-!-Mb1!\!^!Lp g0H-@P0H芹p@-P@@P`p``@PP #P `Qw@p `T H-`pv@@P`PP Tp`@P~P z#P `@P@U i@p@-`XP@:P @5P P $S@@pB 0"!H-P#!@-@p #!MO-DM@h h l0 /Qa 0넱04|A `=p04P (80 0 S0 0@BSCS /$pP #P "P  UP$ pP ܃#P  Q  A<@̃@ƃ  DЍOЍ/ @-Mb/(/H-M$Q 0 pЍ0H-@8P JP0P @PC0p@-MP0``P @$`P '0+A@ЍpP @-@@/O- QP Pp6P` P8|OP s? p0t V0lW8`8 bP ЍO!+i.vel.T i.i.,m.U(4i.!l.k.>!!!i.hi.O-M`@ @1 [P) P  RP ||p  [    6PЍ4i.U(l.!a.A-MP  P ۍ@@P:ۍA訉Qt`M P P`[0 @PP P  < ,ۍAd !l.a.r U(!!!!R!H-{ l l.H-BM` 0BR`0p0R2 P0 X 0X0,PGxx 妯{{T!@`*DD 崯{ap`P. )@PpKPPXQ 1POP p P0C m .*{{Bߍdez{w{@, {(!i.vei.i.,m.4i.,!j!U(>!i.hi.H-BM` 0BR`0p0R2 P0 X 0X0,BPG #B{?{`!@)PP 1`p`P. @PpPPX 守POP p P0  ){{Bߍp@߯bzz@$,W (!i.vei.i.,m.4i.,!j!U(>!i.hi.0H-Mgzz`p @P PgTCRzzЍ0 0x;x8xA0! KpA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dP !S(0m.Dm. h.f.`m.0i.,i.!!m.$/_!!B!!Q"$i.D"j/!! 2 !! !f.(!!9! f.!!!!!!(F#U(!! "!H- 0@1i("!H- 0 &i(["!O-4MPw`oP7 pppqt`@``P- P  #4 Pxp Q ፬Q :@P`@OwpP@4ЍzmX P %4@ Ḭ4w| f.,i.f.0i.4i. t , H- f.f.K-M܅@P @GTB_@PV =_P /Q%꯯ -P,JppUp` PPQDP4U0 ᩳp  U ᡳp UP(J: ӯP"dPP /P@屫P 4td@0$S \TQ DdP RP (P : 㘯tP RQ P ro#@: {P: sP: l|kPh: `cPH: D[P(: (SP: , KP: <CP: <;P: 3P: +Ph: @#PH: `PX: HP 4Q,(Q Q  Q Q  Q A ᫲pA ᣲpA ᛲp @@T ,(gP |@Ѝ<0 u4ru u u h.g.$!$!T($!F#G#!A" h.bJ ƥ!\m.`m.h%!0m.Dm.$i.k ,i.m.Xm."U(|"C )"!~,xk$$ @ @ ß #ul#0SZpQ PRU(C PJ p<kPdbhr`嬒 vP 0@ Q :p   0@EQQ@U+  o P : y,~=@a,aP  @RXX!0@` DQttttp PDX`\ P  i@P PPP P@P  | h h. h.h.h.\%! h.h.(($h.$i.&!%! !!!!(&!(i.T(j,i.U(&! &!%!%!h.0i.4i.*&!8i.i.hi.i.i.i.l A&!, M&!i.T!0H-~t@(( PK G,(&!&!H- P  㕩㠩i.tA-,aPATP qP @BpP! ``:ppP 4pPP .pP )pP  ᰀfXPpTT 00#000`VU(pl.jk.9!D"(&!`T(k.p@-0M`@Pi<M 0P  R l/ R R   ,B  c/r P("0Ѝp4i.0i.U( "hi.O-MQGP .Glallp@w l Z  &0p/oS"0 0Q Q Q P  P Ӏ oRQp\P R R P  L P HU(h.4i.! (( !8i.O-M@0$!rp r ` ![HP@PP/p p PUh  m!rr(P  @oЍ\ i.8i., i.(hi.@-@r@9 i. i.H-Mlpp=0 R `p@r R VQ  `RpPwP  Nw P:P \ pPP@ ? ^  4,PP1/ЍU(R(h.k., 4i.H-PQ (.p  Q *(k. P:P 4(@ P? ^  /k.@-d00S R P0@^@@@pȉrP @ k.k.w"&! Q0S S /H-PU( 0\^?@` pW p`WU@PPPPU `BlV U@`P  j.Z&!O-M:P9 @` p^P WP)l P:P @P?P  W P:P @P? W0* P  QЍg&!R(h.U(k.l&!p&!@-((@ ^ @vi.,m.i.G-BM` k XPp@ \ Q UP:@`G 0 SP <- XPP yn$ Bߍi.U(tl. i.o /U(O-MMP#q q`BqqHH"LBX `pP  P#  PBP SP WPQ ʤ o hJ +դPP=4`HP   Q: ᡤGP0S* P* U%P @q_Q:|P  0BR00R P 00P U:Fu qP @4 b H40 i.4i.,m.U(i.i.k.tl.H-$GPP b,}U(tl.G-MMP @PT XP @P \1@lP" @ RP p刐`PlP  cP 9P,uuЍۍU(&!r h.&!G-pclPU 唁 `=naP @?P4 P@GlP@?SaP %P @ :փ!QP &@ WP <pVp@PdW}H@P   @ 9P !H!'!U(m. A-apG!PQp @p`pP @P` XX@X ?p#PpPcj @PI @ l @ @ @ @  P6 g$P-` p0RBR` X X !  P p@ j TX!0#QA|m.(, &'! 0H-0SS@6@sP\U  ^U%0S! @0C@#0 0RP00C 0R1P00C 0R!00B@ n@t@S @ T^0@0@00SS S@ 0'!p@-@`P P @!kPp‚@pH!p@-P`P@P kP P kP @pU(H-@P # p@P5 $ ` 8 ` ` ` L `V jP& PN(P    P \H|!P P P Q ='!.'!p@-0M@PN OP X+aaPd   l $dQP , =R RPi  @ @P- 1P T@P @P{0EP   0 8 @ H | x jXL@Da,_0ЍpU(((!(4i.4(! :(!?(!-)!m(!b(! |(!"(!m.O-Mట@Pp ` 㰡A  M R (R( 0_PO_P K_P   1 -pW$`Ѝxt 4i. )!f@n. )!O- M@mp `PP,. အ (  VhP  XPP nmimp Ѝ m.m.U(4i.0H-MP@ ٢A ӢmP A !0P3P tp@` ⵢT @e 㨢?Ѝ04i.xt (!(!(!(!f@)!H- H4i. H-z zE(!m.m.O-{MMPPm4`CiP $>iP 9iPfv䆟䦟薟@  1@ Q*0@cP @dP lP nP @@@p VP hPPap U@p-PP2 @P" pYP mPqgPŬPY  _  p Pt   P  PhP,,P)lpPZJUPi zQHQE  P@ P P@PpGPV HBp7 `PPTL$0K P %%P -)PpZ U.P#Pp5P%' P P ygwrs}ppYTeX`+P,;X  PPPfPP@%hPS PP  ͟P p5k2P#'@/ 0cP(P -㯟P P㿟qP P 0ᬟ@Y I`VT 0`P唟PtV ፟PD % " P`P cp p٠P P⮠A 0 !P  ᝠ 5U>H 7<\\\n.n.0)!n.0W((.gz+!n.!+!-!(R,!K ,!,!/,!=,!,!,!~,!h,!)!+!+!+!n.H- /\(bG#@-0(, @#Nk \(bG#-!A-MPlpڐ`pV`  PpP6 P  0O&0"vpq#@ Ğp P pW@p0Fs SP H4 hЍn.@)!Y)!H)! MH-M  QЍH Ѝ/n. MH-M  xK-MAP`P x 0@Lb  @p  aP p H   0LL@p 00P`T 0 RJT`f0d `@Vp@p:H0  }.e@\ `07H 0P<.pp@0@X 9(}Ѝn.R-!y)!)!)!)!(0" MH-M  pQЍH Ѝ/n.O-dM$@pP hP P(0ji8`4f (p p,@PLH,/o[ "QP X ( jQ$(h(P媝P pA,@,X* Z 0 t $ X | $ 0 p  XXY (Q'H(,  |(QQ.H,(q(QH,(g(H (,  P (H,( @ P u (H ,( C( ($H , P _(H,( @ +  P (H ,R    C (H  ,R ( P 2(H,( @ '( 80aP  (1bp48P@ Y 9( 0 Q(X,  Y ^( 0 Qm(H,P ZeP$ , 4 < 8p ` %  y P^a  X( k84YZ lf c Z:(jPdЍTCtptthhx.`'\4L)!3+!Y+!+!+!*!*!*!u*!*!*!Y*!_*!>*!$*! *!n.)!)!)!H-rpq#@W P` p P pWPgO-lM $$!YPL[0p88Ppg  CHH0 @ <0 0@ PpP @PpD ,T,0`P@p(@P $ (P#P@<4P ,(᠛ppP' ( /4p@ pp(0uP:P@p, = ;XPlЍ0h @`uP*@<  p@$ Up P PT@`<0gpP pP @ @(`$$4$,t@&x @p&Ds& w t v0PP$   p,P @P @Z 0W(XG#Y*!m+!w"+!+!+!+!)!G-@cS $$PXgLcP` ]l?G#1R# k:Q[.06cP0`vX$$ R$P N`DTp P-P+PPQPr p c`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhhbP1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN-!n.n.]n.n..G!-!NY"-!n.-!o.-!o.-!8.0o.-!.}(@@..o.o.t.@..!-!@-pʈ@@x@t%,P nRTPDP <5R%#Ifo. o.8o.. m(@-@`^P @GH-WPH- Tr  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t P[p!\ŸQP PKPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@ 0Ѝ.!@-@P @txP @E{.@-M A @R@          D (Q  |p"ЍXP<(Po.f.!c.!`.!].!Z.!W.!T.!Q.!N.!K.!0H-@POP0 Q 00HE{.G-M$!!o" ! & F P00DPPT%%봕먅%%HuEPt%t5xU|exutEtTT  HP P<4,%,E,P%P{$u$P  m$4tPp pR P P\dV Rl0$ Pd \ CTPP@$4 6, R PP@ 'P P#̣P  PD 3cs  0@00||#|3 pS dh#h30P0L#L3<4#4PP PP PUP`Q  `EV `] "" |"P `R PQPR L ` AD0 `] r " P!PzP@tP Q@@PЍi.!PW(4"o.{."|.!M"{..!{..!{."{.$"{..!{. {.{.{.{.{.{.{.{. .w."!{.Z/oz{.!{N!{..!4o..!{..!.!|.n.<..!.!|."|. |.0o."|.Q!|.!%!|..!,!|. |.$|.EA""(|.,|.RpPX B\Ѝ.!8 o.|.0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[o.@..o.|.|.{.L|.8o..{..{.,.X|.P|.GL|.BP|.@-@PPP|P pp ,dPLT #HP(8 X|.@.o..o.|..{..|.P/n.X|.H|. o.T|./H- BH|.,P/ Q /$.@|.o.P|M . o.|. |.@- P p@T ``` P @9000 P @꤫.L|.P|.\|.{.|. |.@-|@ p X @ (|Q!\|.$|.<|.4|.,|.0H-P P!`@ l \ LP < P;@0Y((|.0|.8|.Ы. |.\|.H-MPP+ pP' +P@p%`Z-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 X  , , ,  , , , 0 ,  /QPB@ Q* L , , , 4 , , , < , D /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 @MPJQ00 `/Y(0H- P:P @+PP+P00H00H|@-M@P x[P!  +P PPJpP JX Q8U[QJ(~ЍЍ@wQ!.!.!.!.!@-@@@   p P@Y(\|.< 0  !1``@o/Y( P LPW(.!D|.H-@M@P `PU [P P PYXp "P 8 P@0dp@ЍPW(`|.>".!   /d|.p@- M<` P @P0@ ЍpTW(P/xG#K-`Rp@N r P TPq Pp PpEUT T|KM t8/p pPw p PWpG8/p,PTP K-0/!G/!d  a/!/!/!0H-$Pp@p L@0XW(u/!0H-@P!J R| 809 0  r \ MLPp  ,P嶣0HW(h|.l|./!.n.0H-lP@P Dp 0 )0 (<R   0 @ 0l|.O-MP3JԠ 0p`/)0S0"&᐀IP`pQ !0# "  WcLp |P`U ЍHW(l|./!O-M<@pW% `PKVJ r P@ ɀ Р +0*  ( EPЍ , "0 S !  0 U Z4pZp  Ql|..` R L00S/ 8 //l|.p|.#0H-|P@P   $ 809 r 0Ht$Pp  @0l|..@-\  0 S @ 0FI&0@P@@@T0 ^@E@l|.C-@=P \( ) R 0aЁ@`V p 0T!@@Ѓl|.4P/( &)/l|.O-M4Z% ( PЀ P !) ( Q*) b@pF T  ! 5 @@ T  ! 0 hP  HPJ Q P @ 0  @@@ @Q*@ Ѐ   p@ @Pv)fp0!p 0S V PY)&   0S !   `q    *b0GPp H8`DPpUpwpJE P PJW ⟏   0W )u 8 `Q XPOl!J02CH@P 8P)#P6$P5P  00  @ B  @ @0 PP:( Ѐ7 ?4JDЍl|.0.`.\W(/!XW(G#/!n.HW(p|., .0..@-Q# (  R B@ PRPPY RP0<020Q @p@$p'p 㰀$l|.PJ Q/\W(0H-M@P) P 8 PP R 0PP So" 09@@0@(@ @@ @R!  Ѝ0Ѝ0HIl|./!H-M 0RPЍ0H-48 0s 0@@Q@0l|.K-M @PD&`P3@ p p(p,p P  0 P00  0YR!     & q@ЍKan.l|.A-P@T5 p "  `VP       P  @py S@V A%l|.n.P//l|.H-PPp`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP n:KPPPPt|.O-MEZ댣 ZZsZXPT hch@P uP+P G-Q   uQ+P  GP TH :P KHbPP .P bP wP pP cP P@ Z Z,PP"ŸBp`Pp`aq0!001qQPp0P  A1 PP1 PЍd@PD 3㮦P8@P (@P@P 7P2P -P(P yP 0p`P 0p` V!4!}.}.}.~.4!4!}.}.}.}.4!4!4!4!4!{R /!2!2!(|.f4!x|.Y(q4!z4!||.4! Q p/t|.|.0H-p@PP\PPHP 8PP(PPP0}.}. e(4.i( p/|.H-p0S :Q   h \  S@D4S@#   0t|.|.}.4!ESCx|.@-MP&@PP tTQ @0$44    0N Ѝ|.x|.}.4!||.ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?t|. R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:' ' ( (( \( ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```t|.0H-p@PP\PPHP 8PP ( PPP0}.}.d(4.i(H-^Q R RA 10S* Q1S@-,@QP}.h(4 1S10S/ R/꤄#H-@P/ `P+ PQ pRP pQ`tQ pRP  pQU <@EV@P@\X(`W( 5!O-MWP D T: DP.P bP cP$T*@z UЍ|. 5!05!0H-LL444 40<@PPPPPP0i( ...~...(( (0/i(.$. .O-M@PPP- 帠帰p  `@pT*BP P PPPЍt|..$.p@-ML@@jPPP ` iPPЍp~.K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍ..o.G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( Ѝ$...~..p@-M`P@O   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZY~..$...o. 0P/,.(.K-P3 `P p PU @PP@ PpUp W PP ps pp贫.0H-8@P(P0 PP0i((.~.O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb8 8 8 8 9 \9 9 9 9 9 : t: h6 h6 5 <7 5 5 : : 4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` OPvVp@P0FP e[ ^eP .ENEp  Q  p PY  P PY PXeU `E`HuPP Ir A;  @ QpP ``pPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* NP T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iIt|. .8.0..(.i(<.D.@..~.i(i(T.P.H.!5!"i(.!p@-`P@L ,Q:Epd P:00@T0Q: Fp~..i(O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$Ѝ~.H5! Q/ .8.~.P /(.  0B O-MM@PzP(8Po pᣆPjJ  Pfx`V^  =PV p d/PO 0PI PpQ Q Q   G/P  A/P  ;/P mP "PX Z P@⨠℀ ⤠|   4/ P  4/Ѝۍn.r h5!5!i(5!i(|5!Q  FR/2G-MPcQaPP2 fPX K }K Q PQQ<Z  @ P? @ T@ PJ  PJP sdPdP% dpPp Q@`@ Pxx p  0 T 22 K  ᔄ Ѝn.أ.i(i(Q [5!\h5!D |5!p@-Px @(P U p@lPL`P <zLP p@T\`P p5!@!p@-P@Q `P Pz`V V 0U  p@)Up\P XD 8Y4P ,$ p@Mp5!i(i(5!\5!H-M@pRGPJ`pP`P T`P`ЍP 0 !P `P`~.p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍp..o.G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@Ѝ.$.o.~..p@-xPx@`V ?F RH 8 @o/o"pp.~.i(,.@-PP D@@88 @ ~...i(,.H-P ;H.p@-MPI@PP ` @PPPЍpA-@  `pP t P  PpnW<r  pP A5!5!5!5!5!H-` R V`:zLpT" PHao@DTB 4o.\.H-P`P p@pTPP P P7P @WN@T @g@\.X.@-@9  \.@-@.( @ R  \.@-P @P@-u@ \.O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ [ $\ 8\ TV hV V l\ V V \ \ ] $] W t] ] ^ ^ (_ D_ l\ _ _ \ ([ S $` X` ` ` ` a 0a DU DU J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p o.(o.`.X.h.@. lpp0>K6Dp.\.. o.x.? 9P@ Pe $ Pe  Pe  Pe  Pe >6*n..,.pe=6:{k ˟ 0` 0`<;ꘆ.et=A6=),pˡ=26QM PEHpˡw=66ꀆ.p=6$$ ( P 7 P44 P@@ pˡ Pe$ D!p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qacn.Ie`pPk ^Pj  Yi(ܧP" pˡiHP I̫.i( pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p ! LW( "$6!xo.>0=xPe= \Pe7 @Pe1  Pe-  Pe) (@o.|o.I<d4 (꠆.@<[4t +ꔆ.0#@1e`ln.u/%<@4P 0C .b/<-4 N? (h6؂ i(5!| pˡk Pe 32P zP h"p| pB;4t6! pˡP Pe `"p P ^Ꙇ.:eA,CP` P 6`jw;K48P&3i(``/P4!`0V(0F`˱0/P p0pF7! 5eT>e;.(T(b(o.`..x.n.@....|o.@o.xo..07!!7!.i(.0.o..n.5!i(P"6!6!6!6!t.6!6!v6!_6!6!R6!g6!@'6!o. 6!-!...4...}(5!, ..p.D.G-p8;13`W@̠̐̀@q WP`RU  i PU 8W2e Qe舊..p|.K-`Pq@  A  P.@  <`堐V VJ  .  P  |<`@,4T KK`..7!H-@PPPw7P 0s  xPQ`@`PP`p p` HLW(@.o.o.0.,.p|.p@-/ ` k@P@U@ p@`PV P U U@44p@Iꔆ.X.."@.7!|P",.0H-":=2OPY @"P.P=#PV $PZ %PPI:%0Hf4 P8 P P< P9!P QP T \P0\\PT@+Q Q LQP =Q2 0/P% 7P. EPP (70H~$P PP$ 00H 0  0 0HxptP 0.0X!0HV@^0HBX.n..f7!`7!.Z7!!h...p.n.`.A-M   7  ?  I  D  ? :  5  0`@xP1  0"@TP P0P <Ѝ`.X.l7!w7!7!7!7!7!7!"7!!,.Q/t|.0H-P@U JD0O-$M@`S   ?P `nH@@P @ pT W QlAQ >P : 0AS R 2@P ^P  P *Pp Q:Y@ P >P ᯑp /@P  JI Z P Y:HUq P@TA$Ѝt|.H-, $ Hꨆ....O-MP9 `pJP,@ PP P>PPP@P PPW@ppP@ W:PЍ8!@-~2FP @ᔉlll 0OP \\\ 0H<PP 0CP ,<< 0@;j(k(7!Xz 7!7! x 7! 8!8!$8!-8!58!0H-Q P@ 3P $  00 0HZ2ꨆ.;8!0H-Q P@ P $  00 0HC2ꬆ.[8!A-@`PQ ?PT pP 5/@(*PQp$PQ  pP4  pW8!5!8!K-MP@QA9wP=J` pp4@㶆P.  0:p"  w2w$ 'WPMP+P PQ P@P M@᷈w@ЍᯈGP`@VEPVnPVdPUppPuP cP ePPU*6vP#PU*PU* @xP@n...p@-``P@PC C  0C 04 Up踆... ꨆ.K-PG @`pAQ"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi ꬆ.@-M@d P[*PQ( QЍ谆..Po//p@-R @P `ᕅP pp@08!H-M 0Ѝ, G-Mp|`PhPЍT`P D@`PQ hp p>iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`@o.xo.|o..p@-`Pe@V p#U `U aU`B@PC@HC@PB@( @Q!@#%" o.0..p@-M`6e@P-JP;P)-P%;P"&PV@U AU hB@PC@PC@PB@ mQ 0Q@#!Ѝp踫.o.0.O-MPPp/w YXpP YP ! 0@@ wBPP Ѝ`wp 0G?@ BPp/w P ?wp@ UBP O-M@`;pP;PUP)GPWP* <P Z P@T: <P PP @Ѝi(i(0H-@Q Pw; R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@ P PE00H 0@-MP3 p Q, @T T pQ#  :, /PPH  Tp <, .Ѝ.:!':!I:!v{", @-0P(@P P @.n.P H-5 Hn.O-M★P@P P  Z `z P 4U Z z @U Z @{ P  P``pPPJ5P @~.  0p@Z` @ L D  PN G 6 8. 0 p PPQ;t 3 0. r, `@ ᜉP P:ZZ P ;P T :@T( PU ` PQ@;P tP0,P (@ @P D0:,P / 4, l;P g;P @D ф,P ʄ@ЍM;P G;`P  HP``P T6;pPp`4.;P );P $;P "P -厄ppprpڈpPJ P*P X@- YP r* n.n.-!8!@, l.8!.9!o.$o....G#:!n.n...n..i(ԫ.@- @P  n.0H-MPP" n/p   P @ @ $$   Ѝ0n...P/ H-@P`Q p  T,Hp@-M@B(rOPP J  0@V2p6 `,onP/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލt|.h.H-M`@P ЍHP P5`4`PpLD 0!0 @Ѝ被r P9"zG-@dd3P EHP & `k 4Pp@Pppw W 0H-@@6PP ,6P 6oR0@-!8!p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PD5PI De  %R R   0%S sS4P-+@ H4`E4` 0p{!`pV3 U @ T@ ImP`p(p4@^P pWp[ :P <@@Np~Ѝn..I6!@:!8!A-MP8P Ѝ`P @ %R R   0%S sSPЍA'P3p3`3p 0`P~~@~T ЍAn.;!;!H-M np   @o Ѝ0H-MP@P  np&PP%  P! y3*Pt mPJ  Pf3P$Np$PЍ0l.l(l(@-M@mPJx| 0E0ЍpC-M@P `mP h  #D Ѐ # "q p RЍpn.../z@-@3Pp/Q@0H-$4 @0!P 00 00S 0Hs0H . .p@-l@P pp `t(@P!$ %$oB@p|.@-@P ](P@3Q/~(.O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍܫ..o.o..{.@-@ ,Q' @ܫ.O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍO(.o.T. ..P.p|.,. m(LW(x;!Ī.n..,.ܫ.G-M,@(P`Q Q p tP h@q  P T < P0Pp P 1 0  V0S0/Yp@m+_`P!&X &Z)-"@YT Z xЍGt(..P.,.o.ܫ. ..P.HQ/8p/(Pq /@/.P.,.o.G-MK P P uP ЍG& p 0=ЍpZ @&P P & Pl`@P% 0P@(% !0" ЍG8 o.p|..A-MP`%p@p  0@ЍV %ЍAp@-TP@` R ` r `V V@po.P/@-@ R P R0 S   XQ 0 0C0R,  B zz@zn.m(4., P0SQP/m(P R/m(P R/m(/4.G-P8ap@T 1P2 @z8@ UP  @0 0$00PP0000040@    QdO n/j/Y*Jz EzT m(4.P/P //H- P PH- P P// ////0/0/0H-P4@PP z4@04/O-$M 0 H%UeE(+5 P D/ P ?  . ) P p P Y   uY ) ` p 0P `pP@P U U`p P P @`Vp@@DTʀCV ' p ` F FoopP V Vv p  P0 P)P V VU PPB` @`PTP; lP< L@P 4BP`} Pp`PP`3P) V V{ P P A PsP P`xXP (+ PP`AWP  P0 &  P /( P`PP  0  #PW   P P p $ЍOS  $Ѝ ..p|.P..|..@..H.O-M D@<`8p@PP  Pp   0m(PpP  0`(@TU<=U>   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ0脊.O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 P ..P.H..|..@.H-@p PP~p P P @P@PD@0`kp@P@TP@W(8W(p@-/P p@ `@P@!! p@Q! 0s B @!! pp@p@;!o.O- M`@"N"PJ@@T{! 000qP P ЍOtPb! !d0Pw  ЍO%PQ!M!  pq V  Pᴑ@XI% !0  @ *&`P T@XP)+ Y `@!& PXPp  0  @ 00 0 @ 0H9`@P `pp! 0@, Ѝ 0x5S<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`t娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dP pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP pD*P pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. $$Ѝۍ$8!8.Hm(Xo(@.D.<.}(@(r &?!1?!#env??!E?!?!!?!@!u?!?!N?!A-MM@Phhh `0ᬻ Q ` 0᣻(Ѝۍ8.@.?!<.H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0` X X l X X X t X | Q- `0TS8bCPE h  $ $   , 4   <      D  L T   \ NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 㵺(P``H.p(?!?!!." 6 ~"0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40@!T.t +@!X.<@!\.P.܉....P3// .p@-  | 0 0  0 R @ `P``@@ @@P@ pppp0@@P@ @@@@@@,h,dP, @$TPp\.܉.X.T.L.0. .(.,.4.8.<.@.D.H.P....K-M p`PP/ PA5 g P 0s  W  R !Q |q!P|0p a@0|@(p |P 0pa@|@0(p|PP7    @ 0u&AQ 0p|`QQ@`|@0(pP 0<|pPPa@p|@P(0P|0!|0 ((0|Ѝ\.ث..8W(@W(X.\.ȫ.ī.(.000 00 SR/ᔫ.ī.ȫ.\.p@-\P` VH@!R', `V`| `p\.܉.(.H-pP0O H%`XPPVv@)@PFyPAeaP@@ P P 4@P' P Pxx |pt0 @@ @@ ,P *@P@@t|.\.{.{.{.{.H-f@@0/88 0 {.{.{.{. 0 /\.(.`.\. 0 /\.`.(.\.Q/H-PH/T.0H-@P P4P @P@0T.X.p@-@P` KP*P p@-@Q T3 Q \T,QJ  R  R DoQQ P T  PU@!T.Q/H- JH/oA-$b@PP  Td p  P\p TPAP   P C P<taP, TqP! Q@QH!@ Q(("P8 A_ A4  P @  0*0 S P P P L P$H..4.@.p.x.h.t|.|.O-MXLfLF pRP P -P' P$   PP= P^ @Pd @P[Pw(*PW|PK TQPF 0 0S S CQ= e Pd b @P"nT@w@)d=*)Q@tTttQd8*@PqDP w?P P4#@3#Q pp P  QPA)vn@@ PQ_W  P_p_W PpP_PP W$P& QP! 2 |q`0RFNQL Bp1Q0BR @EXPW]i _p CpW p!0 2lPQ> PoSk 5ܑPp P^@ )`  0PPAJt!A@&Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPEꐊ.8.h.\.<.t|..4.p(T.(. p(!.P..4.܉....VUUUT.A-\PPL`@p/2 0PpW@x.|.@-(@P@.p.G-`B`PH8PY( VP(BRr R! } @R a   @R |`aQdqQ88!   A Q 0 0S  v  QPP YPQ PX  S   KxX@ PPP@.p.H.h..o.4.(.0.,.\..X.ث.{.{.h.P.0H-PmKP lP@ p@TDP08P@ p @T0h.T..!T.Z@!A-`xpp@ PP ʟP`88 0QT$0 pp\.P.(.0.,.@-< 0RA ^01 0 R\. (/\.H- R  R P @ P X |0S1(00 P  B! ~ D.\.. /4.D.G- p`r) P%\p" `p堠@P@UP@PF@t T}`pYXPo`Pp갹.P.\.G-餐pPi@i`TV V kPT kH T!OkkPPPP.\.O-M Pp` >PQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`pP.\..G-M`VQ &p@  lPP  㵿  @P@@@ 7k 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P`脊.\.P.G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  Vo.o.(.p@-@PPJ` PP  P v}Ppp(P, '/ 2S/Q/2S Pl"R PH"R P$"R P/Ы.p(H-PCp(A-M@P`pP P p P@"PPЍp@-L 0 S < <0<@ P` F P ph.(.4.o.O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍ<.ث.X.P..L..VUUU.\..4. .܉.(.0.,..0H-MP P@QP@p2 0QЍ0h.H-l cR:TH0P Dc 0>:0   蠊....K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0訣...O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  Ѝ\..ȣ.У..4p/(P    У.\.0.b@!@-X@PJdP 0  0PУ.ȣ.z@!O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B Ѝ訣..O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍo.K-@P뀀倐`PpP 0 0@p`.P ^P@PPPP [P @PoP (ePIP @pt@TPD@ HP 00P e@0..n.;!o.@!0H-MPP @ 4p D0P0P&0 d ꈾЍ0n.أ.H-Ma@QdA@QLN@<'P #P j  Ѝ.@!H-P  q  HPأ.@-M  r @@@0 k΄0P6 dЍ.n.أ.p@-3P5 P@jTp `f fP& kdfP P`\d`<P`@P Pp p@kp.n.t.0H-@P 0 R < PA0n.@!0H-l0d 4 0 S@0%@$0 :p05Qa#3Q'.n.H-(0N A R q.G-\P@rJP z`Pcc@D6t.O-$MP&   E@唐唀` P r 0I pWp QP  0 p% ` V$Ѝ.\.@@!p@-MPmPH PP``P= @ P Q `@ P-JPUP UP R Q @ ` QJ 0 S  0 S  B0`S`# ic `ηЍpo.0H-M@Q Ѝ0HW P P PᶷcPJp ڄ 9 Ѝ0pd᯷LP@P )c\@"c3Ѝ0H莿n.A!HW(n.kA!_A!0A!DA! 00n.@- MP P P=.P(1  R& "0s" @ IP DP0@0S |  @t Q \<8 Ѝ 00@q(A!A!t.A!"A!yA!H-M< R J0 ==90 Ѝ@q(o.t.@- MP P P=.P(1 3 R& "0s" @ ܪP DP0@0S |  @t Q \<8^ Ѝ 00Dq(A!  <P S$P Ѝ0謫.@E!7n .@Q*P/o.0E!P/P Q긫.@-P@Pp輫.@-MP ,@P  eЍī.AE!@-MP ,@P  QЍȫ.nE!H-P0P(PBpHNԫ.n.H-MP P P D^R Q  ЍHq(E!0H-0MP, P P+@P,P0,, AQ  @0Ld@X, *Q @0Ѝ0,,P ܫ..0 !E! E!E!@-MP Pb P0QSSEC ^: !!P"P"P"P"!P"P""dSeC ^/ !!P"P"P"P"!P"P""C ^& !!P"P"P"P"!P"P"" #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0Ѝ.!F!F!<<< 0 PQR0/.x.ܫ.$ 0AP/ܫ.o.p.@-鱿@ |Ȫ.xG!O-MP H@P Q Q 2/P d@@P EQ H'8%8%8%H'8%8%8%8%8%8%\'8%'8%8%0%0%0%0%0%0%0%0%0%0%zP@ T  pPaGQ3Q Q =QU QQ D aEP3P@U @PA<&P&'x&'''& o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T 4]QS?@+پ4  0P. @+PP ]|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @...Ī.Ȫ.xG!n.4F!F!^F!H-M0S8< 0*ЍH% *Ѝ.|G!wG!H-M`P@6p-W0A Q:UT h pU-W` U T  @ЍG!G!A-M`P) @pPQ$ pP \Q`P \$Q T  `P `Q,  [``Ѝ訫.G!A-MP @pP`@W @ h ЍA9W  Yhh -QQW W!  @PN+,,\,,,,,W4 W/ W>oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ X.F!F!8G! G!\G!0.F!P/So/Q  /Ṳ!H-oP0A! P/.H-M  cЍ..G!H-MPp`կ 0B PW# &`0a@ S``3S0D0@B` T:V S     b RWV  `&ЍG!  RQ/<..@-h8P\TQ @P T 2/$@PG!.Lq(@ 0S/ S  C Q $0/Lq(O-M`Q0S@ ` pW) OP@AAQ:-P X T T Do᠂P p  p$PZ  RQ   Q P   ЍLq(H-P (PZ!}(/O-M4\`@pPP`pP/  pp@P Q@  Q P H ?PJ |QpQ Q? C  kHPP 0!U QZu P #P UQ      &H\P P 8Ѝ....0...}(.Hq(.p|..H-.H-M ዁H-M@wabP``0 0pPЍs 0H-@UbPPP &0.Z!O-M(,P 0`p @ !W 0!u(  &*9#Wu(":#%"0p  0j`VPP3UЍK-P@p`%"Wd$!y (0$5# 4!0 W0 0dp W2O-M@p 0P` = @$ U!'  % 0$7#z4#j& D@0[pTpp3WЍH-MDQA#| "B -=)/ IGЍMbH-M |pP `@P&VI `@PЍ谹.0.4.0H-@XQ 冲@P@P: $ @0<.}(8.8.@-4 4@P ( FP}(8.}(0.@-@@}(Q/O<.@-P @PG-M h!O`P 0a  Gp  E y-P!kЍZ!G-M h!O`P 0=  Gp  E y-PjЍZ!K-Mh@Y p`piB P)PGpEy-PjЍZ!O-$M¿P`p@0@ Ya@QW@A@Q7@2YJY 0@  0@G@P PPT$ЍO-M¿P`p0@ Ya@QW@A@Q7@2YJY @?@ @o @@? PPPXЍO-MŸ@`Pp@0@ Xa@QW@A@Q7@2XJX 0@ @9 p 0 @pPPPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `ypP%rP `ipP 0P `[P E p@pЍ@-M@ P @@P* ЍH- @Q 0% pH2H-P@mP' PDְ며 `n@|P PdPdp@`댰Q<HR H@..{.@!o.{.0.H-M0 0Ѝ-Z!!H-@P`pᗰj 㼰1P PPPP @PP @Pv<.0H-M@P P 8,00( (0 0Ѝ0Hq(FZ!LZ!-Z!!0H-@P߯P !^@֯P 8P0՟ ~QT㊪0o.0.K-M@jPPPV U p㧪 0PppV"㛪`o"Q _pP VX TP  V`WpU VЍX.n..dZ!@-@P Uo/O-|Mⰰ夀堐P@ ;/Q00PP 0  0`joP  #` 0V pB `CR JS0@  S pwp`pppp@@P0S 2<` U,0 [Q0 02@Q0R0s0Z0PU p[W 2@WRp0pqQ 0S @PE T:000    @0+t`` '`# (; 1q0WQ|ЍX./"p p p@@0@@/o.D.N-DD p0SC P Q 堎D.o.K-pDD0 Q 1PC010CSPʁ蠋D.o.H- P  o.D.O-MpP1PQ Р +0* 0 P Р@+0`* ` BTH@@P@ *+@Ѝo.H.D.A- R*AQA 1 0# "  l0`0AP 0$ p%0 @1a^ @ p%` $ @P@o.D.0H-\ @0\0H0^00N @@\@ 0^0D.o.0H-HQ 0 @0P0s0: Q00D.o. @- R <0A01$ P r :0Q D. P@PP@/o.@-|嗨xx@x 0tS፨`ቨTᅨH Hဨ< <{0e#.L.#ԃ#!##}(#}(T#}(O-M`P V p9P:P ?P \P@P  `%P6 .P P  @T `OTgaDQ} O4OS:S Q\S 0SS/.SQ?S/}(p@-@@@P@`@oPBa p0..L.}($o.}(H-@@pP<` Q P  cX.X.p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮o./`.H-@P dPT`VxP lpP@" r &n@@T렪@`(.t.|.o.O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍOD8W(@W(|.(.o.@-@PLT !P 0o@a@`.x.t.tZ!@-@P P@x.p@-P@U `PPPV,,     p萹..꘹.p@-@`ҰP , 0 P PVPp蘹.H- P BR Q9 bR4Q& ^ R N Q P@pR @pR Q Q PPPP P0H-P@u < 0P !T @0蘹.0H-P@]P 0P  0T00 @R P@P0蘹.K-$P Y@pP0`#( P%`$ % `U0"0^Q  %0$  ! R (QYD 00 R 0 PR@W(8W(.x. .t.H-$  PHx. .t.0H-M @ Pp q 0+Ѝ0@-,@ P @`.X..0H-Pd@^|P D 0@APJ0P P @0i(`.t. .O-,MQP@P@@P:   3 TP Q SPP ) 1 PJcs lljQ Po HP P8bP `p[0`p!&TFP'P PP P@'  P"P@`ppP`p&')`p!& PU`p 0`p ! ȑPU`p!&P & ' `$ps[! P 00  0P" AoPPZ/  P P  ,Ѝ0  !   $ 0  !  T 0P P `.. .t.x.Z!(.o.t.Z!tZ!H-, loP`.G-M`Q `gP@pP f]UPQ:PP  P PQ00P00 0PJP NpVp /ㄢ`pЍX..O-M`4P84@p`yP  0 P Po? 0 0pD I4@Р08ؐ`@+(oP LH$` &@P p D, (0HL !y  W` HTLY  ` HPLY YIV  0@@ [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,KKP @< ro.o.t..ܫ..\....4..h.....`. .x..0.O- 0 7 0|E W ) @(pWQ p< 000  00B P4PЍ`.O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝx.H-0,$ Q  Hx..H-P  PlXHHyn. zxTzH-@<4P Hy..H-0,$ Q  H z..㬜A-@T<  P뤡 86(@P xxpP`uQP P00PAj谹. z0.o.o.(o..0H-TP@T   HHH 00000}(...0H-P@P" P P t}P dxP .6P JC6@@@@@0}(Z!Z!Z!Z!@O-MM@P `pP T |VN|||  QP  HP P @ Q^f Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ kP 0<40   mPPkX ညP  `刐PGU l` EPPv p!P  kP  4PPd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 ᯼PA ppp!7p;0yPᗾP5`FpV1cp{Wp`vɚ 0`pW KF0EFXP  p00pGPd2Ѝۍ0pX ᎉ꼹."[!#1[!r }(}((.(}(..#O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 0E`E 0X , Ѝ费..\.h.[!@-P\\\ 0S @T 0@0000 BR费.}(.@-P\\\ 0S @T 0@0C000 BR费.}(./Ἱ./ḹ.P/卿괹.H-P p`˙@př XPaU b㷙WG-t`P@Np QQ  QQ  费.H-ԁP X3pS3PCћH-.//H-MXp@G p P`p-VUPPЍ./@-@P D/p@-P@P`Q/ ! R:3+`Q  GD`@pH-M 0*PЍp@-R@P`@TpQ/ A/p@-@PU`PUp/@-@ R Q Q! R * Q QS@SJ@0K-M,`(S@Žx0V"@^QpP` 0000040 00P0ЍO-MMMP <Z ,⠰P P @ @;PP#P 㳃  P 㤃 `ZN 0R p``@F  R00Q P/p`{ R  `R S RQ @!Qp R0簍 X̘ė| E,R @Q @<.0P Qi @ Q^Q @ P 8.P Pg P0PL pp@;P }PaJ\PP# $  EPI P@P PU[N D @Jpp˂@`@`P pI p\P T P  P"T   0@ Q*\00ASp 0S:Q5\P&P\@PPPP B@I @P p @pA P喂``[P SPBY`\PP   IP @ PP Q @QK 0Hp @IJ 0Hpw P P9 PP (08PP, P @k P  @@QfPPd   P @Z  @tHP@ TQ  iHp*P  aHp*@UT H ف!q !Q p $@(|(;P }PJP P  A 奁 ⠰PI_@ `T R t` @ R``1 A R*PJ I@B"P tڄ@`@@@hQ HQIQ gQPiQ pQ*Q Q;QvP <&PP=  @ P3;P1P=-wQT  R 0 @ JA PR R Q JV `@  Q  ,h/pF$ PQ @@ Q @  `0pW P P`0@\W0S5 00@ 0@Q @ @Qq @@Q @PP P> @0"@S6 f`  @TPQ P@Z  \R R  0S S  @P7 E PPi`  -P),@`qW PPl p "@ D  ,.p;x11.̹.ȹ.PN``LBQU pPd3@PW`VP Mߍۍ(,t*'%(L"t\PU  $ Y[!\ H< ڙ̹.ȹ.(Ą#x[!\! .]!.]!%^!., ^!S^!^!^!\!$.g]!\!z\!m\!Q\!c\!^!h_!(\!C_!_!\![![![![!g[!<[!_!d.h...O-MPC ,P@qP{P tP rP 2aP bP.`V P p0"pS ppX PP  b?@TЍl._!d.A-MM@0 A R * /GPЍۍ.Q$Q +Q$/Q \Q `<P P IQPR IAo`AP)']!:]!p@-@lP  P @ 0S SR (*P~ `p(S]!O-M[a [c \[c p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00Ѝ]!|]!mO-M`(~Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" @P ]Q [QY[[Y][Y   P R  P R[   @R`  GP4 R5Ѝ`#.]!.H-M@`PpmPn@ P2T| aP dP fP       P pЍO-M@Pp`$ V ?P [P PE@ Z *?P  pP P@Ѝ00@?6SC ЦЦЦЦЦЦЦЦȦȦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦԦ?Q7@?QW@Q?0|/O- M`PF{LD@@sXL4X 2XHPa@Q%簧ЩЩЩpЩЩЩЩ̨ЩЩЩܧЩЩبEP GPX IPvHP\!X|@O  |"@ P 0㰧P d 0㣧P \wd @w|\!@~p%<0APU _| @PyPU O|p00 0p.`@p@| pP PUl宲PTƂD{!._!(_!._!$/..}(..(}(ȹ.d.H- 0…㧂(`!O-M袟rಟ`P P P5 EPgn&Pr PQ Qx孅P X H P" >#TΟXnP>P:.AoRy Ο$n>PsPQn\͟m=PV;hP >0  M=m͟P PzPQKQPPEPPA Pn (>0  M = m͟PP, PTP(p PU =P0PP P M `8 pP0V 0P 0=@P@tp:ppv@p P W Q:0  d$bA _APV>Q >P Q:0D  JPp0 C P<P =p   P p Q:0  +P G P`P:0t  PpllP  ᨀPU ` PPp`Vpz KP✻P:0  $@ @@N PZpWW L PWp+ P:"@ Z 0  0 z@TQ*W  0pʟj: JPt 0  `p  ??  쉟IP G PP  E    v@P !   uv@PP9ɟH@p `P pPPP (p0( pp p [KP 8htȟP `h@LȟT T4Q0  p"p!`$0` 0 @!P"P R 00 p[JXPQ P `P   JP Pz{V`P  0@&A`T  W: P\P @THhV 0@,` ($ 8V0` @pW 0 `?p?0   ``堅EeşH. .(<.l.d.h.ȹ.@T5 L0 p !"P' p[JpPW p`.`P ppPpp` ^J4dğP xpD.tDd0 @0 KP\ 0# 0 8d  p??  弃P 0!  P  >\Cp PP  3cDßRRq   ,T#p   %#P p#Ÿ c3P1 ePQ0 $` pP$[UU$B pp\2`bŸ L2PbŸpA02= 8A Q  PqP  0! e P  `> \1`aPЍ ぎ~$  0! @> P  9>cz@Q <0 Zt d .d cD Rk6 .H.l...]!'a!<.(.p.!6 , ...Aa!d.`.h..}(C.!ht@! #_a![a!ga!@.s H-P`@ pRsW   G-MM<P2 000q@P!R R"0j}P `*0|P 0*0| P@T:l@hЍڍD@nQ iS< 0 ᳍`.h.r <.@.s .DP  R {RP 0pȹ.p.!p@-P! P@`{P wP sPp !P` p !P`@Tp  p, O-Mءԑ` @P 0p&W \W1p2 `/W-0G`2p#  pp'  p@ Q :s2  W `p0\W&W``\pQ :rlppQ :rЍ.(.K-P–V-Y`P||!|@0p@Sp` @P`P" P@p@@: AR 0<h\h 3!Q , p0:DP! PBQpPP Tp  X P K2 z..ma!ta!p@-@PU, `P P PU P|PP PPP@p.X/A-M @~ PJP `+p  PL p0-RۍA}  #, a!L 0Q0p0Qp \ 0 /{(@-,AvP \0^R S0QQ 0QQP|P P# Dp?   @蜚. @-00\ 0S 0^ @T P PP Q QP RR  P \ 0S?o\p/.@-|t  0  L@Q  @ TQ Q  .p/K-8Q <P  Q0AQѸ0ڰ = ({!< Q P嬁q@`\P P  V  @T( Q0AQѸ0ڰ  zP  (P  ,P  4PP Q X@P @PѸ ڰ  zKľp/(0.,.H-M@P)@P om@P /PPP~P@-@?PP+@ p`pPQ Q 9 @p Ѝ*P&z4""a!a!O-M젟@`/pԐTPP`T   y 0g 9P  PPQP@T Ѝ  9v(a!a!.O-MP pt& ğ 3Bp/ P  @7PpW% xxğxQ `p-QW-Q0eCQ Q  `eS kS iS` ``Wc೟@p  JPPa@Q%t4`p@DPEP IPH-P<@QP5 SP <p^WP p?Pp^ZP ?P^YP ?P<{ pEQ`T"AQ聟 (  QPPQ ! -P  oP, P P  sxP  L H D P iP P@yP00 w2u..X/(",.}(}(}(b!$/4b!-b!%b!(p/4.0.ht@gt(>b!Tb!Zb!_b!e!b!ib!b!b!4|"a!H-T #xu(b!p@-@0PPUp00 ` xP UP UU@ %t0p@wUT D p@w,  0p@E..b!D"(b!p/b!b!b!b!b!O-TMPRPbpP  \IuPP}p GP gPwPPUl@X (P p^ Z u@pY P@ dQP`@5P Q WA ap aDp p W pZ ypX pP a @P@0デd Q H,ڇ Շ7c!$/(yc!B">c!""ec!oc! , vc!!H-Z )wt(c!@-M@%P   p Ѝ ᨇc!0H-M@PQ P P BЍ0<"Pp H-P@P Q `UCP <P` P CCP rQ <`V@-@P w P  嗚 唫呚H-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0C萊( p@- `!R 0@T 0RpQt@tQ  tt 0Rp Bp萊(@-Q@L@@-R@L@@-S@L@H- 0C}r(c!0H-@Q0uP0 ˍ띏띾P ľ }Pͣ ̣ tl@@Q*XP L  B<*r0008./<.@.D.H.(O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$嗐P , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  P` @`Y pPP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP P8P XPU PPN(0 ,sQ  Q0@@0R A (0內P7 s[P {ә (0 m ʫ Q 彨$ @p|PlPPfvQ/P!AQ2SP RPF@Q  X  P P     =P P. <Pg>P) ?Pt ; 4PPa 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0SXP"P0A@0 B0!ARP !@ B/!+u $pW eP¡ 0㟦P P(P epPU$pP X PQ XtH5 㾚 0Ṛ fx PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  3xP EPPAqP(PᏒIFt cpp|r0S! B  3 3Dcp| xPQ zPaPxP@a@(P(@P  3t ~3bmQCt P U4Rpf  R  2/p[ P!PU   M t `P  Ɩ `ħ`aA7 s P ئ尧P [)Q P`P N) P`qV4 R  2/厖 PPP  P,Ѝ蘍 0 ꎍ (0  ꃍD 1`P p zr_oUD.H. <.@./((/f!(f!mf!f!O-M@QspR'P- `P@Ug 0.UP` p` vP@U 0UQ  1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PV !VPrU V!   P ( 0q> `PqUP T0 Ἐ r!A ЍO]f! /H.Q/A R /D.H.O-MPp*@0 T` Y&P3 `  늠`P   @<%P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@ЍD.H.)d!@-PJ@Q 4A P <D.H.Q/Q//0H-@LLP@U U,U0=/1//bx H-l0 cH=od!@- Q/@ ,@P\h|P` / ,* C( #  +x P `,L L0SP   @`6/z$/@1/ftp|7/y%/&/H-M  f8=Ѝ.tgzQ/ p|H  8 ( C  |7/y%/&/|"/7/g Q/ $L 8 $ Q  `6/z$/p"/0/H-M  h=Ѝ.tgzQ/ 8 $   C~|7/y%/&/0/H-M  o<Ѝ.tgzQ/ 8DP\htX  H  8 ( CW  P|7/y%/&/{#/7/ 1/H-M  p<Ѝ.tgzQ/ 8 $  + C(|7/y%/&/{#// Q @-Q$@|Qa ) ,$ M"+| h L, 8 <0SP  @(/re!ftp'/O  @-Q@8PlQa ,+ | 0SP  P @4 P  8/`6/z$/ftp./X܃Q Q Q/,  i{ w0?/|"/7/0H-Q@ DThQa 0r ,P\ 1PP,+  ; 0H=^!0?/s h Q Q Q/,  r+ '0?/7/ 1/aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-97d!H-YH-9Gd!H-7H-x.H-̄1/H-HH-8Ud!H-X:H-R:H-L:H-F:////H-,!BW=/H-,!8W=/H-,!@-W=/H-, #W=///@-@0@-@@-@@-@@-@N@-@/@-@1@-@1///H-.H-.H-.H-.1H-MH P`0 0   0 Ѝ@1/H-M@     0 Ѝ@1/H-M4 C 0 Ѝ&/H-M8    0n Ѝy%/H-M8    0[ Ѝ|7/0H-MD@   0PPF SЍ0@1/H-Mll"R \, 07   d 0% Ѝ@1/ftp!0H-M|P  K  0@ P < N0 J,7*7Ѝ0@1/ H-M8    0 Ѝz$/H-m5`6/H-#x./p@-P@`0  p@icd!H-M8    0 Ѝ7/H-M8    0 Ѝ|"/H-M4 C 0 Ѝ&/H-M8    0{ Ѝy%/H-M8    0h Ѝ|7/H-x./////// /p"/w\ /p"/w!H-M4 e 0# Ѝ0/H-M8    0 Ѝz$/H-4`6//H-M4 e 0Ѝ0/H-M4 C 0Ѝ&/H-M8    0Ѝy%/H-M8    0Ѝ|7///H-M4 e 0Ѝ 1/H-M4 q 0Ѝ7/H-M8    0{Ѝ{#/H-M4 C 0iЍ&/H-M8    0VЍy%/H-M8    0CЍ|7//H-M8<    0,Ѝ{#/H-M4< C 0Ѝ&/H-M8<    0Ѝy%/H-M8<    0Ѝ|7////////!/ e!/e!/Ze!/`e!/oe!H-ML 00 Qa  0Ѝ(/H-M@     0Ѝ(/H-M4 M 0Ѝ'/0H-MD@   0PPjSЍ0(/H-Mll"R \, 0[   d 0IЍ(/ftp!0H-M|P  K  0@3P < r0 nP4N4Ѝ0(/ H-M0 00  0Ѝre!H-Px.$$ " A/(//H-ML 00 Qa  0Ѝ8/H-M4  0Ѝ./0H-MD@   0PPSЍ08/H-Mll"R \, 0   d 0Ѝ8/ftp!0H-M|P  K  0@~P < 㽉0 㹉33Ѝ08/ H-M8    0YЍz$/H-1`6/$$ " A/8// /7/! /7/ e! /7/e!///////H-N@-M} @P  z]ЍH-よ0H-P{p @} }00H-@lp P}%{0H- |z=/@-$@~P tz=/H-=~H-7~0H-,P@ |!~ Yz0=/p@-X`P)Q N,@  @|ADz 0}p=/p@-h`P)Q N,@  @|A*z 0} n}p=/p@-``P)Q N+@  @|A z 0}|p=/H- ~=/0H-HP@ |! y)Q !~ 0k}0=//////e!/e!/e!/e!/e!/e!/e!/e!/e!/e!/e!/e!/j/!/aJ /Y /w!/e!////////H-M8    0Ѝ7/H-M8    0~Ѝ|"/H-M8 k   0kЍ0?//H-M 00 Qa   0OЍH-M8 r   0=Ѝ0?/0H-M@   0PP(SЍ0@-M@d *,P H 0  d 0 Ѝ^!!0H-MP  K  0@P 8 3, /11Ѝ0 /H-M4 e 0Ѝ 1/H-M4 q 0Ѝ7/H-M8 r   0Ѝ0?//K-@`!PpR "  "r  Q0rk0lQ P9cx Q Ua rwQb ( dr (cY `80S  3/PKR!)g!f!!A-PU@" P`xpPU.PWP:@p`P P`$$ L.P.T.\.X.A-M`Pp 9 @U@,  p p& P 0눀 0p pPg Pu LP  @@@Ѝx(`.x!d.0H-@u T\PuTPA04P:zP P*@d.x(`.(H- f L.X.\.匑L.夑L.@-@4f,, @L.X.\., MH-M    $ЍH Ѝ/M0H-MP`@ 0fLL % Ѝ0HЍ/L.X.\.O-M@S0 &dT @P ܢbRܒܲ 0@ @@ 0@0S 0p0@ @ P P0PlP ՒP ={P 7{WP弒P ${ !{   BQ<QY `D pᦒW 塒HPZ za Y`p zpGW fT Ȱ!@pP32PnP|@_P zX=T@ 88 ЍO3P.T.(l.L.\.X.h.VUUU @H-H, M@-M@ 0"$ Ѝ@Ѝ/H-M Ѝ!H-Mpd`@P|ePP , |(#  0`ЍL.X.\.O-4MXop"oP`/뼤@b\ U`W,@p P  d巊崊L届, (4 `娊,@P嶑(巑`đ$` D@@ 0`0Ps1I P@I [@I[PP P tP@QP@@sKQ,$`(@0 ᜊ哑U 3 ᮊ @Z@ `juP~PZZ@ Z`~뭚kAZ1Z7 AZYYIb`Z ZP\Y  AR0 B00@PPPAP @ @ P, `K  ` Z  Z#`w Y&, K APIK`l[Y [P ,P fP`Y Z [  #` P G,P K ⳻ P`=0P $( 0 @|hy  P QP ,    ,4ЍOL.!˴!|((X.\.p@-M(0@,4PP `pЍp!O-MH@p`ᨐ塐H<8PW @ WPQ!&L@w"0 a<p QPDp W  p  TDP3Kyu PP  PPUPH/V` R` 0@@P7 ᐔP wizinq c E G0P`i`i`SVrc  0@ _PL iH!D 0 < T QcX *ЍD P^p XL./X.\.!H-M Ѝ!p@-M`$@P , !  0@ЍpH-M Ѝ!H-Mpd`@PcPP , (!  0`ЍL.X.\.!M@-M@ 0m! cЍ@Ѝ/0H-Pd@i0L.O-OMp0(7ǟ W@ '@b@00 @bFPP P  夾kPP&V6@EE E oP |Ff分8P,  2ePoP pPP rP lCPN DP_DfPU@XaPM  !P@ @ PEp  6P @T`V p=Q @Tp<p~ *$0Q ῍40pDdmP ,p]HU8P@  PP圭P @PնP  PPU:00 PT刎@剎 D@ 0eCP <P cx,h^Curo?@@@D@P8@U<K p`PH z,P 8FD@T 8@D@T8:D@ZT+P& `8"1P2T    0p P<e`8`<Tp P@T ZP @k p K"G在P_X P `v'tT<Oߍ8@)8 %@ _{\< 0,=\p 04h6/p"/w\`6/7/1/&/(#0/4"p6/(/8/@1/!1/$/!r S! !(\./!%!!B ///\CXDDP"/""\!F4!l6/./p.!!H- 0E\(!0H-M =囸TF$#zP@T + _-HtP@T +` r_8<P00 0Ѝ05!t"/!0/!p.(!H-(PP Hu1\0/d6/H-,\H-XLP P @+F? !PqH5!"O-MM @PO `"PI 4P/ p  &P; P ^(ᰰ(P)8pP!  [P  P ppQy  Ny / شPЍۍw!H-A-M D/*P~ Q upI Ph Y] 0%Pa 1GP\I% @I`')G^PPRJ_68SP!"p"P7 FP. @`\Fp $a FP!""Pu_| X)P )P P  P |FP! d,Ѝ pP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p`FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0pp`W:U `pEP pPUUpR}1/=/./, @- M(P: @1  P1JA$*!P RQ 1/P $1/$+R @LFP JPAP=P + Ѝ)Pb  Ѝ@!FP @ 厪^ {P Z_ 0$PEPHF#&1/=/8!C!//A-(MM@(P+P+(`+G+DPP (|DP l 0 @@@@ @@@@@ P((B(ЍۍN!"w 0H-MK+P+ P+ 0+عFDP Bۍ0N!"@- M4C;(P @O PJ*Q $Q *(P * Ѝ P ` 0#P#e%1/=/O-MQ   0P  P P .X @Padq% P: P Rp pQ %R R!"  @G  hR%R; dR `W p!01p+Qp(iR* sRH" 0 ``@`Q \Q`V Q 0p1p%Q^p  R P P Q Qx@QcP aP<0  3/P3 BP$PPHp ` RPX Q Q   1 PP$PPP`V: @T2  Q:Ѝ(0H-M 9P@T ' [7R[P @ '| x[# d@0T HH [Ѝ044 a[FXt"/!t! !//!bA!(!0H-M 9@P v' P% PttT[P d% `'T %ܾs]00 0[Ѝ00/! !Q !'!!@!@-(M 0  00 0@ @np@.(Ѝ@@@ 0Y00S  QW|(V(U!t"/p@- QD0 @8``P Q 0 p@Wt"/0/s MO-jMp1s? 0YW, >S`P6 Z PD @p0p4 pEZ :[2U0*Pt@P,  p/ppP‱ZP `[ PP  0|Z  pW iT2X4P 0( 0^ZjߍOЍ/r t"/!!!$MO-M H"/0PL2< 0@T 'P P  @'mpPp  P Q G0|P P * %R@RA* p`'P`V*PKP/ᖾP pæ/ὦpX5 ,P& G(, @ .P  P P U P7 4( 0! U Wݤ芟X@u wT4p  PQP @ 04IP Ǧ> IZx/0x  0p>p Hɟ< @$YP   PP P P p PP( ~OP 0 缨   "" $ ,P~v\p\\\ 0hh `l`p`P @pW (@PWP4(v  0N  p P[` ,@P @ ||`Wr0D7-@ $o @Q k(P4( P (pW[@ [@P" 0XP  P P" ,QPTi@P 6@[  yXp7!뜵2db\P tu (P P! `  P    ,QPt- X@`Y V044X* P,DX \ ~Y P@pQZ ,~&c(p PC{u `HX\ 5`~υ료V u! X ᲅ@ ` `Z tf~c~뉌@P 4 `jU x_AuX {[  XvJd0LP @GPBY  ߍOЍ/ T``E WX 1h0@P @W@h hqo S4nre BvI0P , [WA"P  QW kP  eP @< @ @   <  E<P A<qP @0hm54< De5ht@/!bt0/(~"f@t"/0/!!\"!z$/!!!d6/D"!"(6 a!d!L!!!H-MLaP@%Xㄈv뜋' p}˂j} }uS\}S各P 0ApmP @USTP ^]|{ bЍ$$ 0+ S/, !(k!O-oM M Q8 /p⊯P`D<PB @2U<*O vTPPD@ uPpW<⊯< iqY3⊯Y iD   Y 8P  P `.`@ 0lPp0Y u   u 0,@qԽԍ4p80@tp8@(V@ps `D\ @ @ Pa  P P@0 8-@ @0T ( +0ypP0- [aP  @  (0^p !@sP }]lP 4 A|\8 MP$<@P T/ 4H40`뀜 O ,㧲x 0ww 0r P L V<` 0PP VUt`wv (P K! p   PP J0 =P J0 PN IUP @:    | tL* P{ \  yy0 V z 4c |*QpP:?Q` \P 4*{0}  0 | 099yɟ Pp9 QR @V iY 0pt)S0` 0Wp pV tL9p@ip 0 S0 0W   8p㠘=P p h `  ZPH 6P  P~  0{ ㌣P5   ㆣP/  〣P)   zP#   tP   nP P P  0P p' 0yP < 4 ,/!.u!~..}..!! !.} { "!?!Q P!m!!!!t"/(!"."!! !%!@!^!l6/!1!H-MHA0 PDP 5 [0 PDP 5 M Np. P@(~ > mPUDx .DP `X@\pP`  DPPЍ!i}..|.8i(.h B"0H-BMlPP .PQP @0 P  Bߍ0~..H-@rpPn` ,ݮP EPQ.P@ P 4@P0\ ᘮ H蓮~...""P/!#K-!MP<|ᦾPPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ 1P!ލ^!~!!!#!G-PB@U% 堀嘠`pW Y /W P EQ 0 P@  GP p`T:(!H-M(Q DD6<8 4 0/S 0OЍx7/@~z$///" v8/p@-M@P1  @ Q ||| E 5pPt@0h` /QO50</Q PPOЍpx.@1/x7/<z$/x6/"-/@-@ @2@1/p@-MFP Q 㰭 㬭 @P dd d0!PXX@L40  ]O<<0 XO@ލp&/nfs!7/|"/x6/7/!-/y%/H-BMP P RxPhhdP X5TrP H5D"D2 @"O4N6@P$ 95 0 bP !"5 0P !1`  l?!1{hxxx6P, P4d mXaiLfc8aP ,$![  WP  O K|FPPcP ^H[T x|YBߍx.|.""!.>/?!.*!!|.Q !* .!!!}..!r!~!-! 8!!'!.B!Z!th \~.R!_!.!!H-pP@ p `ڿ8 p噬 @^|.G-BM@`}PP hp? P LLL X    0@PBߍp^! !!|7/!x&/ PP  P/ ,P  ,P\/PQ !PHH/ Q Q O J\ 3r"̈#H-M, 0 0 QЍ谆H-MP@ 0 pppn p% P! ` 0 ppp_ p dP Pp4/P Pcp_Ѝl#!p@-@D `[PP߫ 謫UPp! 0H-@PP Q P P [oP P0d#X#H- 蠞(O-M`V! @P2p ᏻP P PP `VЍH- 謞(K-Mpp$am0< PCFP H@L! 0 p4/P pP 1/$qp 8 @1/pЍ!O-lMP P< 8p@ L03/P' H$  0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-QMMz@L@30hXh/ @P@H`plg,"@V@{@P#^4@4@LTN/ Wg0^ N/*P  ᱺP P0 }PTX\ ᣪ "➪4  㚪 @0!pK`048q00[,aH!L1`A [@[R$()!( H!L!,!0!4!8!(`` V< dV*aTfPYb$;b咽4@$ $(!0P,qP,q048!HLQP0 5P`V'#EG pP@pPGde$;$BPG<P H!L1  L@$ p$B :0q<8<<P P4h8 kP  _ P P $1/$@Q() Z}P $}PK? @$؃LPLPX @$48!LHATY0H Y \#0?n?! 100T(=0_pX bPp  zoB 4@` N_T0PL@ Z0z<2p0`1 0 0 4@|@wpLp0P``z~ V?201   z0@~p,P @L , L@5LpB zx   0Xp  L@L0P`p PXJ,(P z n@ "@@ hp zP@Qߍۍ0ZJ4Z 8Pu @s1//(, h6/&/=/ 1/!t"/S!(Q 0/ ,Q//BO-CMMf  *Q Cߍۍ)Q5 %AO0kJ P f Pc A/  4E0p%A_0MJ\ 1P <5@A/\5p wP4 4`A/p4@00Wp`X:@P ;xPB 5/P  /P  xP;B 5/A/;xP 5/< PRp B<@R0DܗA3|plp<@RRi R|00S #IxA \pkR` 0<RdAp[00S "I(0S "pI<,0S "pI1$x"P Pth A0Xr@Pp)(P,Q !aIA p$PAxphtAlp\0)pR00 A ^hA? Y  2$P A/A/@T pEh/A I0A/P A/\0=/!w!!"Q"!!~!!!f!r!w!H!T!\!.!w\@!!!!(!!!!B !> *!!!!!|,"1/K-MMpQ4 @`P  - P* P b#PP" HVP0jp RW V` ~ 0`D@PpЍڍ yp p *d YldP UFPPJl@Q0 0'  0"|!w!T!!!!H-PP 0 S,0S ,\ SHu S:8 80S:^3O-}MM0FP`*P.  X/E. pW <. 0$IY=  D)QB ^ P FodP`t  yP 쩝䙝Z @P ,uPJm@U @`PF^=  T:U0S d >{ P TLPP@T: (P P P$TT 0^ x`   H 0 0 ;6/`PV<u `QppP P ģ弓 ܟܟܟܟܟ<3P+㯥3D YP  P sZDPO8pXP <p8፵PH - < } 0P@`TpD8p rŸ@㨒B@ b`RP"  < P( H h, 8 @0$`@PLPp[N: r0D ^h Z蹍䉍Iy/ P`V XD^.먁P FD@|ttqlnP X@!gLPFP 0``僔1q(Q4s 0 !P R---P - -Btf}ߍۍ=/!7 Q !t"/!!P!g!w\w!!!!T!!!!!!"o 9!2!*!%!]!B!I!U!!0/e!~!!!o!!ܧ!! !!!!!O-$MMP $ЍۍXXD`p P!|P`pGw$ @y|P`@P `s@paCSģ@p Pa# 4@8 $(PaDPP@<@`TXcP p E|P P =| a4 @ 2| a4@ $(8PEuB P |~P  P |pab ` @ |pda4` $(@8\p KAP}?+P. D@<.P 41.P $"B-p@@/-  02 \@Y@pW T? LU 5)Q x! @0E^#P1 @P+P@pPT:  ' ,T*d0`48 xP 0 ;`5/P b LL L0t#%!T!4!F!!w!#X!j!~!m۶!!!P"/=/Q"!7 , 0w0u0H-P0 @\P0. 0H,w!q !@-@  p8@.0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ PkPPЍ0.0H-$@P  P\P0.O-MP PPX@JPK  CPFJ@ ᅱTC  q` JIJP%  ϔP  ɔP   P @DPPP  pPJ J @T Ѝ(`@-M@ #Q Q P 0 㠥Ѝ$0H-*JTR0G-MM@08T<4,[ QP0 `$P P0A`T4`0 P{ ,Ph ,T8Tr 00<Ÿ`A@T   0pC8 R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TB?P0< `Y P K?  9P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:03 ߍڍ`_h6/( LH-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z `Pp Pk (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H   0```Rp <`8`$`4P4`8P  P 8 <0p!0$` b`PtЍO-MpPPE `  Q7 pp @p  L0 3/P! ppt`0 P 0! #dxP P v `qpY:  `Ѝ1/!0H-@P P 0H0p@-Po@`Q0  p@ @s A-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0{oBЍۍ !G-M`L@HpP OP PN ٟ! Q Qm sP! a\'Pbp$`Q a$qU(1,!04# H` UP P%`0@꿳PC P?Q; H=P7 P 2 ;p^ `p$P  H\$H0bPT4U?H\. P5 .P2H4P- (P) .P$ K?t # Fop<qǭ G0PPA@# 0`@HYt\ [nWH  Q圑oP P1 JJPBHp T>S`q L0 P H  hPd`UMP P K?tb # `W<\"pru{AP1 p/67NPEQ* FPXQ&o !0.p A0y 0sK?a # F_`!<! p; ,70H` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p F_p; ` 0,@PPPNލX#!((ffs1!}D%P @ 0 +X `@ $ Pت P( ;Ѝ1/!!!..., o/G-Mla0T!TqTS@q@!0`PW0C's`0Pppp0$@ PࠟԐ`P`ᇪ@pცPP@p}PP@pwPphPq`0P PP=DЍGQ&.ĉ#ʉ###..... .f!!$.H-M !oЍ@-M@ !oЍH-M !oЍ@-Md@  0   !Ѝ(.0H-LPh4P@## 0H긅!u o!M0H-M@ P$0 傼 R 40@ Ѝ0HЍ/  N!!0H-MLQ PP(#L@0@DP P=#0, P<Ѝ0x7/x6/"z$/-/O-$MttxQxqaXa @`"P 4 V 0n  P7 0㝰P"@`pP P " 0Pp` @ _뜰P!yP! a! @$Ѝ)g!!7/!!!p"/!0/!|7/z$/x&/p@-MMd @?rP  8 㑌Q  RЍۍp"\udfH-MM roЍۍ"G-M(@`T`P㾭LL$0 PP$P``pXP`  PmP <4 e00 aP|P㗭 aaaP `k@ PeJPcqWW `gP1iz|;h! 0@ 0 t@TP" l 0 PPPPPPPp* `mUT Tt㐁!,3PW @P ynjQUU oRP܍$$ $0'7&/x6/-/y%/0.!!!0/7/!!p@-M@P"  EP`t@tP  0};d\ 0v;!oBЍp0/!!x6/"7/!&/-/y%//@- @P 7/!!@-@P @q//p@-M u @P || |0Px| h@hP\h`00  0`";PH 0`;@Ѝp!7/ 1/x6/!!7/{#/&/-/y%/0H-M>Q H@HPH8 0:4, 0:Ѝ0x6/!{#/&/-/y%/( r/0A B0 /.$ P/ @/.( 0Q00A B r  /.   /.H-M6(@/"x 0` \\0 060I0P``` @Vߍp($.@K-@؀ؐ` 0U Pp`1VW pG0VpPPE P P P/U1US 0p``0 p.A-q 0R"@0 `pP0U 1US 0CP 0pT@T @ @pGD0Hp <0p@Pf 40A7 @.... .".f!p@-MP@Q PP<`Z 00`2P` 0Ѝp!"!O-kM4@`P = PpDP1!000P9dPQ 1/pPdбP  P [ p@_RPH[8 Y PUX  0N I`]/V [  #8opP|P p &`[p  (kߍx7/z$/|7/!x&/?/!%!N!, //`6/r!.@-4@{P 1 Q!//-/x6/H- P|7/x&/O-,M@p$@mP @`$(P (``@ `$VQQ P*Х( p@@A$M@P@PE pp$@P@* `$PA( (```h$VPP Z*`H  p@ `7 略(p@$PPpP %ქ@D@P,Ѝ 0BD!O!]!P 0/S/<S0S 00S/0 /S/p(.@-M4  0@@A POЍx!O-MM(00 0.QQQ 00 0PPP b堒 p0@%  PO`$&TRa @b ᐈ bgRP u} 08P R`dQ  Y9m PJ P Pa4} P  00嬅Q8Q5Q3 }~PU P P  P Pd  00zPPPd@TsЍۍx!A!~!!F!//މ#M!""!O-WM$@ 0S  무 /ZXꈄ 0S   R /R/Z@Xk 4D@DtDTQ` Q]` PE `jcW`mP `0 0a V`XP P P+ P `00S 1S /S$Q AP` `$PX @D`   @/Z$T P p pW~|P0T` `*X,lX$ AP PK]P P + t)d  nv|Ph(P( ,0"# 4\0 P $YuQP@P M(( 0@@?X  Qo P T1 $Wߍ@!0/!?/p(.//7/!!!x7/!//!!?!k!!"!!!!!x!!H-M Ѝ M0H-MtP@dmP PXD  d Ѝ0H Ѝ/T! !!p@-PU |@ `P ]P  PUQppp(, 0H-MhFP *P@ PJ< /,܍0!p.!!,?/H-M#A ᐢh`JQXqXQX!05@ $WS0㠧<DK   H0 0   0 ` @ P`0P!JP@Z"Ky0 *@5)P 㹓 K`ߍ!o.p.,?/t.x.!^ !(!!A-M`BO $P @ ㋓ 㘘P`00U0($ @ލt.,?/! H-c<HJO-M☒@T@tP`9TP Hr@TP@@T ` ͡PU J!00 Va PX @epeTK .PH   )p@ PPP UP: " CP/ 0 ! 7  P  Pp   ᴒpP(PlpᰋPƀ4pL0  ЕЍ.(..o.p.(p"0@-M@P   Y6P R6Ѝ0/MH-M  0 ЍHЍ/O-MM@  ⻳PJ ⳳPzJtd ⫳prtpv?@^5Pp tp| P aPz p P`P ̲`ޠ ;P `=P  ` P aaV%  P @wP!+P  PP 3 2,PP y wuP p P l`3  f(T{iPЍڍ a aT!, "!:! Q S//H-M ھЍ M0H-MtP@dP PD  Ya Ѝ0H Ѝ/R! c!!@p8 <`PU 8Qn4P@ PP0 3/q8r L0 3/, p@D0@ 0| x@T0 XpH, \ \<@T!a8 RK B!a"pτ(PT!B"ƄA@x8pQ9 p7d 0@ 3/P2 T `Q4P- 0 pW2  0S$ d@0p 7/P ,PA P p #@!(pSߍ@ `P <  `Q APpRpW,@    e0 0h 0M 0¹PJ`Ⴕ (Ѝ#NL\OH-P0 @ `0  pV0p0PpSp`K-@MP L0 3/P 0@P p`@ Q J !pRpR@Ѝ( (/HP!P/HP!P/H-(MH`@ P   0pp`` PP P 0@0p0P`PWU`V HHPP(ЍXԗP H/V /H ˇHP(@p@- M` D0P@  `)!  0P `HDd Ѝp"b*8nH-<0@SH`4PV99VV0;:!HGp@- y@y@y@y@HPp up//K-MP1@Cp (0AS*d`0 6/ 0( ,0 pp 7/Qh0 3/ލO-M@P[4`崁崑帱Pp P RF V P P> d!PQ9 P P;P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍ G-`MFPpW ,P $PŁ hPł HPk, PGPHPI|PJtPŃ kPacٔPŅ Z`ДP$ R p`(H p`P$ V:pp0  Y4Qq$ Q $Q$QzY 4D h 48PQ Ql$ Q\ `$Qj X$Q P$Q H$Q @$Q P 0 %HL %HL %HL }%HL v%HL o%HL  h%HL@ |a%HLR d`ЍGX%PB 0 02)( @P 3"Q 2 `ЍG<%H\"@PP!t@0 ܓ2P@0 ӓ14b 0P(b# H!@PPt 0 %`ЍH \ CH ` 0 Hd0S? ! ' Q 0P 0DP$HQ,  P`pdp``I 7/(,0  !Pp 0\@P 8H 0\ ///////////// X!!1/./g!^!H~!!!!!!!!!"u!O-4MPp PD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S PpfRp 㒋8` 4Ѝ 4ЍOhl6/A-@P> P\1/0 ` 1`0F?o2SP) p aP+ 1 `P! pbH"Pq h P 1  C0"@AC)O-$M@\1/Pp`Q `V` YIP( pW D3 0P  $0Y0 01q0<0  08 1V0 010<0  B 0u ŸPCP\P Epl`rPC" ppJ0`LŸL\(P0ppp,f< 0 @ᱰ0Pc (`pPV pPP Yp`Vp 8I ᇓPpuY  PW`PW:ioup0 pP 8P {pP R 2/pW,0U0Pp(p(p p(,(ʹWp,$Ѝ(( (0㐕 .)*\+1Y!!!.14"K-@Pap `P6 pp Q h`"pv~hpE P bI"pc~`  p(p崁Te` A-M@P `03/P !  0P ` 2/ލO-EM@($B3PP B@@Lg`pPr WT.E @ P2P @ P*0 簀GCp0@P\ @ pPT00@D00 $0 PX 00Pp PñWUȀUuuuuA ⸴  u  0 吳Rٳ P J 8PP P Lp,TH1/PD `'@@LL X4P0PPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DPh k Hh 4pl0 0p0<80`  0T@4PVD@hpL<8 PU:@PD`KPd Tp!@ a@(@!<PU  AL " |iPB U Efa"| @Ѝ/H-hMP; a!1P@pPP P  P P P 0PPp 0 0@dp}P d .pPhЍ 㤡Px7/"m!v!!/!!!P"/!!/H- H!r!///p@-`Q  0@RPU @T00Q0SR ps㬱p@x0H-0M@l    ,($RP P  Pi 0Ѝ0///H-R p`@PTPQ #P `Vp@8$ PR PXP!/0H-PR00@f@Q" % %!$# 01/./H-@@P`P $( ps H/H- P Wx.0H-@P0,?/0H-P@Ġ0 =P V0!0H-P@P ('V ,PN/ 0 !O-GM  ͆ƿP @젟P`쀟p兠P$ P   Pp |P h M ; O Gߍ(/|!;D/'/!!!!!G-MR@pLOo2  P PP PPU ;`l` Ѝ!'!G-!M`P@90:pa!P<|ᨁpQpP/ p P d gPy` ւP=P%  P }B XPP2  0Ry+@0[ 09G @0} QBX@P L *y4 3!ލr T!Χ !SE!t"/a!, Z!S!!H-P@Apph P9:0X`̌<` 0P0 < Ox,, T|!t"/!!!!0H-M @㝅c  0հP YTP@PT@ T8 @0ʺ$ ƺ܍07/e!*!Q!o!H-~H-0Gd!H-v H諺 !O-aMp@P[U cP b,PY Y Y$G=P d" P m1P0 H"1P0 P:9 )`!0X ,`g0 ,`_p@WN#=3 3La!0̹8Y```!p`P P P pppp @`+I@ Pa!IK F0 0 & 0'p 0ppPPĢ,@ᆞ aߍ45 ㉮rPJPS1/($!E!t"/z! /!!,?/;D/(/'///ppJ 㤮p@-@Pf`@b 0p@!H-M8Q@pW(,P `W1`V G AF ( 0[v @NP 0 0P\#dPP 0` w@L PhoЍ!Q &!!O!t"/!!!! !"/H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝ=/O-M@P )`Qc(P`TP%5qyPUR Qn (ᜅP RPF0Pn|ş|R0 ``pp``2p &0PHpTPPP@H@Q>@ LPLPJ=P `P TPQ `" R pQ 2 !0PpW:T`V:P Q :TP :@PP2T@PT:P季(婣$妣壣c&3pP"0 @@.`!0$(0 f`$Ф$}$wH`@PPy0S @8 3/P PTH`H , lŸp2R0 :HP ,u `AH  0` `````]p^ PL,᠗PR P`NxKP t ᑗpLob@P P  P+ pPH` L03/P PU:X\P P`=V `P hP R 2/@`Ѝ `.T0S H2 j=/1/!!HE/̦//t"/!V!!!O-LM@ PpPD@ P r ``@`zr` `s ᵽr P?*0,OP<   0jp V@*XP*@W DP䈽pWo ~D|<z@xt ᓕ Wߍ$$ $0ZvHE/LE/!!V! !!/////G-P\1/ pW P W  Z A0`0 @V*PV`:0W r , 0Y0  01q0<0 @` A|0|pbu`PH0 lpP1`\rP,p 0`B Q$$ $0yu X /̯V!0!J!O-Mp@僠@P` p P v|  0P\r0 qLLB <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0onVp@PL[:`@uB ",  PH⃿`Cߍ̵//O-MPQ `$@@`(P `"pfU $Q 8 Q "f@p@Ѝ蘍#LH-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*8G-M,PPVCdmP\mP SmP KmPŁ BmPł 9hmPk1LmP$ R p`( m p`P$ V:< 0 RZf 琺$HlȻ!|qQ0 pq|R8`pdp``J 7/ $@P(0  9@0 $m @0 m ` 0 P0m xpP0` pPL `p 0Q $0ppAލ / / / / / / / /^!1/./g!@K-MP1< @Cp(0AS*d`80 6/ 0( M80 pp 7/Qh08 3/ލp@-(M@,0/`サPV    Rx 0  0k`p *AᯏᎷ(ЍpHpK-0M8q L0 3/P  @ p|1/ P@ p` U0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  ] 0P``PP 凝P p@ 2/Pw 0``PP mP`@-@Q 0 A2/@P 0 @ x @, @-M@8q 0 3/P:  Ѝ@/O-MMX Pg[P BP] OP 6p ʘ8@+]4Pd*`0 㑥D@ b$@+\P 0 o@+\ bP"0[P tBP`+\L r0 A,+\0 2 +Pf !P\@+\T0 PJ( @+\0Po P,g PP.묰 +f\Uܠ@唐`p  0 CP  0ФPE u P + Ѝۍ&e"n"y""""t"""/!"f"""""!"""D("O- Mp`K@T: PY Y4PTP, pQ:  kP  01}p|TPP Y Y 40lUI Ѝ"" "O-MM@p/PP P僣pX`P` P "0@+[ PS*A@/cPP `P FQ Q/R 5P8JP ᰤP) P Xh  3P&J/Pi!0@E+u[`+p[ PP J P+d[ P:~o?{o`@%$to@PЍۍ (P /PP) @P`P iPi PT x+[ P*+Z P*pP?o>@&T  R q p5@`TP7 K50 `0-` R4@$ X,`0P4$@,p0@Tw  00`Xh`P(D00L`,!<HHAC ` jP4<xP@jP;8Z CiP p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#ٖX 0 0h@@P尙 X `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`gU`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(8! "1/|./!=/!"(0H-0MP   !0Rd @P6U7C @ @$P Xb0Ѝ01/gS ./!/H-(MP@o0(P(p,p10 (0R0< 0F0P0 000```Ppp, 0,H('0bP`((`(Ѝ/t!/ /G-0M@(@ kP(p U d1`0 p  0`Qp@810 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P2,p(EAp(E@0Ѝ#p@-M)@P7 P 0`000S0P`pP %+,@,) P0  ,+ P X|^* dW-0TT Z@F.44 40 0Ѝp"6 !./K /"#G-pMQJ@PPe : 0 ` V " 2p 0f": r`T Pv#㽔x"p` X0 eH":0 w8"J&` ,Pg 㟔p0 "(H0  R P5 ` p=TXp!0 Q 4 t R8qS TX`  P  k"J"O-M)$qQ `W W PQ% P!T11/PPP(0`o"P Pp`H!L1 ` 01/P p$qP P `pp@ L03/P P P@ `V:@V?@ Q<@pR  7p0S P1Ta(h lP`0 0S h 3/, :0 0S O +&0RPU  vUP QU}QU/e  +PPQTQXQ\Q})<, XE "SE P a/Qb&b}XdZ [ `tP }AQ  Q  Qa/@T[V  0@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8 @  PU: p| @ TP xtlhp| h0 xXT\| T0 @d@`@ P  D .@  0 ,, , P H4| @0 L@<@8@P ($ | 0 | ,p"   pp}o(0db   QARQaߍ"/h6/?"0C/@U/"&/XE ?/U/`U/U/DU/?/U/8I(-!Q/Ѵ!/ "/O-Maa8@P&&'8((@))*P   PxpW   R/07/P- L03/xP P ~Q ŀ`48O00PS L%`_p $ 0R 8Rt;$ _`p " P"  PIPnDP`,Iph!P RP,1U A =C 9C0UP @P 40$<IP!@D$ L0/3/PT"0 P  I. `QP @P  FPIPHRHQP #I 0@ @pRoP  B BP8p@T*0x 0SU C"T3_"IR/P0"I`0;$ r _@pV 56 @[|! R0" ߍOpU Ro B B B$ +A @s`d;? @s \0 +`0S @ h0S @Bl0S @C p0Sp @sP 0 E @st`Qs0 SBߍb"H!!l""w"K-MP Pk@ I`lXpP\x\\\\`]](]8]H]T]]]] FP P 0,!< G 0@0Po0:4Po448P P 0@v'dPod!J`l\p K`l`pohpM`llp0  0P  v]PWލpP PptPotPP P!=/@-@ QDQH-@ P`ppp p4I@`g$Q"d  @H Q"p@-@MP@PJDP R ,@! p``P T X05P @Ѝp"/$"/O-MM|?thX0(P pW pW rebq(@@BP   ,0RuU   0  0``fp pzbghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ$"/O-}p6  8}p3 $D ?>P 4 vP1x@pW W   kP"  cP vP 8 R |88d08 vP PJD[0`V: <@P1 DP 8 880p W P p8 Pp8 p\v@    `;`V0   ႹPGߍۍd@""""F "` "!} """$ "O-_MMPP xP #v@P _ߍۍPH'`Z0u@PHƄP GDh(PpPd T 0,`@f$<YOp84PpHLP\e`qPG P [ [( [TP*T  ;`/\  2P \%eXePP  ,  ,PX  P d! 0   `T`p  eP P  P  P \P}Pd\ 4 @ $8H@W$,L 0HPp><eP X\HLP8 Y P0D` T0,T0`PP0XԐ84\<P <T0<P< Rp0< 0( Pd'HLPp <@84,0DP<h 40p8@<8@օ0`v?E(D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W sPЬP0ᐅ@,0a[/ 0plHuP<tPpql0 [/ `7u`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R +`xp W:E sD@5$$ $0 D0%>" " "(?/& "8"/8 "6 S!R R R #|d "G-8M@( [`P HP P``\P|8`X&&q8Z`0  $08Ѝ 0="V "0"H#/ /H-0`@V PpDj;P e;P `pV@p@-P 0P@U  ߴ„`忄PV庄p@跄 0="e "n "@- @s@| "A-PP`@pW P嚄嘄,0LQHA04q8a5W X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝ=/UO-\M RW  dLA p0P 8 P0=g N`@>PQ @0P & P0+gMp@P@P?HL P PU@P 4 04/%$X P@10`d5/p`\Ѝ!=/@-@P0 @"/0H-|P@Q& Q0XT D 0"!Q@ PRUR0 0@"/U/H-@P*p- 02 HA  0E;8\#8 " "P0H-P@P |T T TEU P *P0T T 00 0 0@"/U/t#0H-MP@P  PPT  bP @"QQ Ѝ0QЍ0H @"/U/Q /^ U//0  S :H-M 0 ЍH /hH-M @0 Ѝ 0 `0H-0MB"0T00    000&P0Ѝ0H-M0 0 Ѝ@-M, $@0 0 @ ЍH-M0 0 ЍtH-M 0 ЍO-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0G0P QD∠ 娰X\`@dPp7 !0@0 ;@@@cPJP Pmpplw  $$`刵P!1 6  $@(`@(P L03/P X( \,0"# #" 0@ T:$`0 0xp 7/@j"yd!"Q"8 " " "p@-M4  ?0PBT T TT bRPU 0 Q T TT @  0M PCЍpO-R R@> 0 pTЍU/8 "w "P " " "O-tM8^P] 40@ SD0AQ0R^E0` p@S[ PPTTT  rp 0`:T X0W0-0Q0*0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^ Q @ P`P ``P`  T3^ [ :^ q0p<|pp2 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QmB`0Dp  W T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ zP^  85 `p$0p LQ Q= `V@  @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP^  P $040wP 00U pldD`dh VQ? " `>,0`Ģ,4`@08 ;VPJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@ @B R R R (0"r" " 09 0YR0pW ,@$`PBStP T `p W,4,㨆ppP" @0g 4嗆 pP,| #Pv `0 W UPD (p4P OP,0Ra* V0  "P 0τm@8Ѝ 09.8 "F" "X#O-TM $H0$P L0nPHJ0H 4LP`P0 4<($D @0WP.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0P'"X$! `VQZu  吵" ?#*@Lp?`HL Q pWp  * 0 *%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍ=//p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0!8Ѝp=/UUUU3333O-M4@pPo? FFPP Z QPکPW   pP p*P JzPP PBPTW Ѝ"G- 4pq<pW PT \ '0 ?@`RU U UU R, @"0R YW P  GP:YW ᜉP?6"R 22  G=/4/O-MMPP TQ4pAn 县 @P w  ; pp - J yc@XpZw b0P 1/ BT _`s`VsOPsPUs sЍۍ 0k p,{dЀ8 "U"n "H-MM@0P 1/ ;㲷p `P3qP p a\sazЍۍO-M@吰px| Q94`0ᢻ`H pG0w@0P@PЍЖ#U/"D"/@"/Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @@"/U/K-M─ Q @4` 0Ks Vh p0(@ADD0  p"!@@@@ЍU/"!D"/@"/K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`o`Vo4W  4 ^@@PXRU PPO`o`Vos "O-M⾀@p_`EfPP V QPکP"0@QKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0(8 ""."p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P㤕Eu  ωpPePfP lP zP6bP eP  0$ 0ppW @T  \p / Z8 X6T4 <F D6,gPl 9^P$   P #`@p wPI $ | x#῱p]pQnZ' I}]pʔPMp|KP(e] b]$\(\#0P 5$ R]$\(\ bŸ2 pRp@ Xpf@ p PF/]pt!P  xhPt pI0]pTp<$[ A]$G\(E\U =\ ( \p@P P( [px(Q P 0@T k(P 8$( \@^Y ቩ`   R0q0 P0R0v 1D(P V V A Y 'mP@˳//^"$/i" (t"r "z"ht@( ////4"&"""H"""""", @-M'@u"0   Ṷ㞳T"(!H- '] H[@-D@p[0P~@o( /O-M-RMp |V\x&hd ^\L~@Ɵ`@ R0`RWF`&W@A X *``eP7 p P. 408 [ P&.r'` P &.g'480 [P zP t 0S $  @T2  AB  A$ @ ( _dUdPh0`XQ-pAP !pGW$$$$d$TP`?G!hҴj Z` P @p:j)0$  u[!EPp:S0:Wp#hP@ ૴p  1(A$QS @D -T=IBJp   A@T0 A  Q@*P :0 %k!%Pp :S0: ` p2&1p|pd`"g P" `'uh 0\ P R,pX!@ R :P! R`@~ AkD `  H 0 JT!e)PPp!e!P` , P YRߍЍ P* e Y@ @Q5?eAQ%.v w,BD@b"(r02r 7"cAt qdP.A(// /8////, /!/Q!#!#!,!ų[!!`!A!N!6 /0H-0MP@.% %PC0Ѝ0@-&@%%@@- M @ @ -Z ЍG-RS PP%7 `QLp@: `T0 {@`P: !"A-M`@@P1 pP@P P:PUPP$-P  U    TP V  ɒ`@P%@Ѝ(H-`@YPp  p YP%YUs%P7p@-P @Xp  `X@ Ypp@-M@ HZp D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM hp !Ѝۍ"p/H-M`P@R   `PY pT1Ѝ0H-@ B vXP  PU P R jjP  R iiPU0HiO-MMRO @ PT k p`PH`Vp@U+   0p &s$P o$#P* PT" P U p PF@P R@XL O$D <0J$( (700Ѝۍo""""p@-@$P`cP 1 Z Pppp@-M>P`@*p! 0 @pll0< p D0 @pЍp,""<O-lM K @oP `2p- @ Jp X Xp Wp XP XX" Wp Xp  [ ! 4 cW X lЍ} - 0 |0 x0H-@P q  AW}PpPPq 1W! p000H-Pu#@@aXpn#@P@0p@-pM`0 @p P Wp @WpЍpO- M@ `p j\"p tl0Tlp0pPZX0TPZPT@ @Ph0PѰ Ѝ!:"2"!""B"k3!G-MMQ#7QPp@s ` VPZp` gVЍۍH-MR @PpP `V  R: `QP "5e`P.`P  QQ*JfP  P  pp `pH0   P`@ggЍlA-MM@ P|| M P1`    Up* P ` `P  0 @;pl ,UP ppD" P @"9P H<V bЍۍ"_"l"}""s"p@-xMP`@S  j  Up/  `Up$  Up  Up  Up  P ! P0 p 8, U xЍp"""l"p@- % P ( DZj$$ UPV  QpP$%%pH-8qP :&PP P P *U eZ0A-(MpP@`v7LP$pP  s=oP. Vi P " U PP tPQ` V7tP P P hGE PA | R@ xA P9 P6PXP%7P  ]tM((ЍAU- PO-EP $P  FpP tbU(ЍH!QV L'-(ЍA%A (ЍA"/"@""J"")"_""e(!@-M@tQ0$e2p    ,ЍM";"H-MP@p"P= + 0 + );P  0i `xQ Q RQ 0 0 R\  PUP DJЍ ЍH""w"@-M@pP Q Y pP t 0!Ѝo"@-M@ P Ѝ| \ xHQ  P Ѝ@#@-@:df,PP PILP P@N,"@"e(!p@-@`LPp P$  P<: !$P gp,FA p >p@"G-M@q + =p` 0 pPB PPG x PE p P  > $> >$Q **@XxP P P  @ , CP  5pOLLx!vpE&p8 Q   x  Rx s| R xH!Q pV   P,Q   6P6c  Ѝ"""""YO-MM` *0Rp <<r0},@P+DQ` !p@ZKv7P  PP@ `Z 8\!`1 pPU PxP `@P T`V0 @Px  0Px` xQ@ | R xH!Q 0 ` `VbxMxP Qx}vЍۍ" "4"Mbv"$\@-@ x`P $ L@j@-@1@RA-@Mp@PR `VP V :07  @ЍAP"R P 0wr>pWU# * P P `* <0 \ p] <0 8TX>P * @Ѝs """"O-$MP@PJ PI pP tPD T PE `Tp Pp`VU\PB `T9 f  PT- `` p T PX` 0A $ЍOj\`PPPppEaU `p p  0`&yjPMP 4P 6PoP kP nPNP UPqpP xPpzp _   ZP x`V  PB P Z P T 2X0  0 Q  R R R0 PK  P0 PA0`PV_ Pp88x PPU!  P Z ` @lP @W @Z (p2 PU  NP$xPU P Z ` @@P @W @Z  w(p P88P88P$ЍF Z$Px@T s@@ 0< <,PPP Pq 0`P xMPM Z ""*":"C"("#"Y"G-8@0P@ `0R`0+ j`0`V" pȐ̠ P   : X  @`V"Y@-@ P  oP@<p@-M@ 0P* `HD1 8!@ 08P0@00ȌP 080  P 090 00 Ѝp@ЍpO- MxpWY 0@ PY ` PAP PXP X U@ PZ9 `' !  0x?U   |_X|P< |x6XQpW Ѝ""O-M`PP,`(` @P P, 0p)/{ `\bMpRMpK}Mp &KFA&KNo弯弿($ 0v?PMPpY 4P, 6PN@Qf@ Q%| !L!\!,!` @Q P;  P7 %zoLpsP & aLpeP \& 0P p$x00 l   @0P T 0S 8p P p&T0 -6p 0p +  \JFKp l@P t p[  A\!J\45 p$ Ph ppD$ 4 030@> pX +6(p 4 @pd{ !1R0,- P7 @$@P4t4 P P e !@T$@@T  0S7 QPK [0%:86Jp p \3 Rp TN $!@T p P  pp@T!0@,P ]  p,p@0PU p P M PpPU/0  Q PU9KW" ( W!1 R  1@\ "Ī(p"|0y0 bPU HA P  0P@PUp$ @KĪ(#"""U"4"N"<"$/("""!""k3!!""!#04"ݺP"3k"""8@8""""""J"a" 3""l"}"u"""4|"""" 5"/"Z"x" "t""""$""""" """(^"ؙ#"0H-@H Ip PIp$0H+I0H !"pC-M@`8!QQQ*Q8 Qq cPYЍpC,pQP  0㘾pJxxFQ" Q/ QQXtt!0 Q< QF,,,!@\p-ЍpC  ! 0P kD!\H1B  P0 P Ѝp@LL {x@T -@DЍpC"""c"k"y"R"Z"K"5"9"A"1"("!""@-M@q $0d @*ЍЍ@[h3@-@ p ?`@K"0H-M@ n, :HP pT<,,HH,Ѝ0R |l0P`XLЍ0H<PЍ0HU""'"g"A"@-@Q  pp*}.p c7P _ P@XVPTP @"|"O-M@`PP Р,(po R ` `0IP    !  H@k9 P P  @ P@Ѝ""0H-@LP PPNYLPLPHYPTP PX=YTPTX7YXdP Ph,YdPdh&YhtRU xP  x,PPxtRYt\RU `P  `,PP`\RY\0@-@j@9"@-M@Q  \b (Gp PQ `0 @kpЍH<Ѝ@4 /Ѝ@ ""9"p@-M@Q  *] Fp `PPJ|XSP| h0 ! @.pЍp@4Ѝp@7`C`Ѝp@""9"p@-M@Q  44_? BFPP p FЍp@!Q| A0S|l `XPnP `@P` XX  P 380 @p Ѝp Ѝp@""(9"p@-@>P PR <`0p`> *>@p耼H-M@pP tq^$"P)P pPpPP QbRPJ@!TU8 >pQ: `l!R pP 0 P 00.(p$$lP >P p *P> C>'WptqЍ x`V >P`lP x>P p *`> >p@ "", ""g"";"/O-MqP E@pT `P `V`V P@Q`P T @`ⴱp`(  P [ Q    ``q崑Ѝ@-M1@T T @@@ @ @@0 S 0CÃ0 0   S  T `0,EpЍ0H-Mq P@U P PxuЍ0"   0     P @ 0@ 000P`0Dp qAH-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^ 0Ѝʚ;O-M,(@0p`W P P p bPp< 8pW P<PpP ,P4 Gp @0 `P Q   Q4PPp4p PppVPЍH-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-0^ @PQ`V`V ^R`V`^`4``<`PP#AA-M P`@p   It vAPp !wv PP 0aApPЍi$  L r /Q/ !/p@-XM>PU U( 7% V)@T @`Q 3T TPUA @>@P@ <0 8 i> "P> *@XЍp}"@-@T `C@A-M`V @P P  nP Q  0R p kC`VЍ SQ/@-@T 6C@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`F  @GKPp P!pl XZj  NRpR P$ PP dP ZP@T .P @X @$P @X@Tx  T@PY( PX HP TP UT\X @` 7P \@T\X,LP P "P L[LDo,  U( Q P[PPPp"P P$R$RPLPH (MP @` ,P PU$, 0 @  pp 0  @D?pA@ 0@S/,PCP !5SO S1 >,PTpP5TdP @h 礥P d@T!P( P,PSʇCP#:SS S (UP|P U P(@X TT@,PP 帒*> -@RU p @ !H }!pHP}H PR! P 00L ` _ PD@ZOPaߍ P"i"&" ""k A- MP `P @ P P P: ` Ѝ:P `  p8W p8  P  !00:P PPA`p ``0`P iQ.Q  ` ``lQ4(0H-M P@  \  0>pЍ0~iH-@MP @P`R gp `V pT 1P P `VK `@Ѝ xQ/$ /H- M@0 P:`V 0 PpP P R: R #0`P`VxP Q   Ѝ+=p@-@ ON PP ` `,PV:P@N($P`P` ` (`,PV:$P/N$(pO- ( 6@0  00  @W8    p C< 4= _X+ `P[,@Ks PPA  @lh<@(@P0:d@80 P`8@P4E 8`0p4LU4@ Q P A P PP 4 ,(   0kP4P4PP  P P 0 s\P 4P S  ` P`Atp` @xR `,@V:@;M @ pP ``,@V:@)MA `0 \2`0<@  8p0 @` R ,P00 oP (,8@p80QP4 L4T4`Q P @A P P2@P@4@@[ U  *BP OP0 JP; EPA $PN WL|;P [G 4P  P P  @r\P 4@ R @PT Q2  QPPT P $PT $PPw Ps[o, (0@Jc` dhⅶP @4hA'dhP dI$P W LpP0! R *B <Ѝ؍ܠ#H/!"d#S2 G"Jp "s !"i""G- P@p`P `mV?@ QZ 0  GGZ#x""Q/K-PBxP Q @K@QKP Q @K@QKxP@TF | KKK,(VP X,,PP,(VK40VP J4,PP40VK<8VP <<,PP<8VKD@VP .D,PPD@VzK xK KuK` P T PT@PH- D0\ CϠ%AˌDq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 bp 0 P @@0pU   `p` Ѝ(#""$/O-4M1CPP<    x ``\@Xps|sssss; 85\ ?GX\xrtB 0PP `P0  0P P  0P \ ?X\FxrtR0 0 `P 0PP\v =@ `P Q P Q QQ,0 @ PP/P<0@ NP <, @!0 <,0 @ PPb/P408 1P 4, 8!0 4 \% XU X\ LP @H 0@ `p PP PS ]P8\6 ,`P@@TP" P PD PDH ✱P D, T!DHP  P PP @\ L @MG'PLS\y ?X&\6txp`@p @vP P3 P     TS  \4  \) :` ]~PP x\  P ($z\ gqxx{wt"p li f\ @>P X]\ ?ROL\ ?HX\FtRxrp 0 `P 0P 0 0P" f\ SP$ 0!`L#"/'"`VP P P0FP!  p @\0P{ di}'"$"PUP P PE : @P p0!p  pp p[`0P "#"\=  0Mp 4@"#" \( 0P"   @[0 R \ 0P"   @[0 R d;%jT6Q" w#"#"#"Q 0 Q QnQ  "PQV Q QPP@QO  Q QjQG=7P p``0    @_[0 R0  0PJP* ' P  "1x"" 444 0A; 4 /P `@P /P@ T P/P PP2-XPPvKp.Ph PĪ("""" >"ef"""`p @HLP` 4LP `PLP LP LP3 LPx ``LP LP LP LPP LPP LP pLP `LP P{LP @vLP 0qLP lLP gLP bLP ]LP XLP SL\UP LLP~ GLP{ BLPx =LPu x8LPr h3LPr X Um Pj P P#"Ub P_ P PP1P@ P+VP G A  @P@ e bVP 2  0jp 4/#"p"@L PC 8 PN $ Pm  |PF  vP@  pP:  jP4  dP  P]Ph  WPb  QP oB"#"Y@ Q@ IPPXY $Y P.PV4 P1 P P3X,p4 PY:F7#"Y  PPP[ lPUPX P P@@EQ  Q QQ`` P PP(V8 P5 P P$Pd P P\Pl @P XP HP `C$"`CU@ P PQ@l-B -@P&4 )A0Zp P 4*d_` P PtP`P P P`I%%"YqP&4, 0 '7p`4PF(@P P PF\@@,0 Hp$ ( Ap E P ,P 0 8(  4@P B  E@PYPTPPF P_ P PFP P P HRY( 0D P "   AX0,Q  %"Y8 , Pp P @0P0% " 8,  P B  P P P M 5S4*BjP%%"P"P P@PX U  U [ \ W W\\'"'"'"V@ Q Pp8 P   <+8@ W "P PQ  Q QQPP@%"Q Q Q@{IP ᇥP|P4ЍB PP$P  PQ `0S0S  ,PQRU, ,P㯫P % $( o#"iA""W  w@ P:@@` d `\0@P  PPP$"""!"k'"e'"0!r"s'"I'"%"\%"%"!."%"&" xP@ p 0pp  0@  P5 U 3  h.U!   0RP P  hU P U U P X: PpPPU [7 Ѝ(O-MP`£P6 =@P5 U ``V p=p@W FP! `V? ᙣP @ P5  A ЍЍO  'P {P p? qp =P      ЍOx?'"'"H-M@PR `P / P p   Q &UT `` pU P W /G`T i-PT`U z-`Ѝ ("("G-M`PP FP P p @P @ q FPPP<[ 0X T>>Ѝ 1("K-@M @P  `  p  .P t t"@ЍG-p` V1`@P5P X FGCZ : J 0pQ00@T*Hh Q3/K-T`V0 TpW1 @LL Q Pbqp ||PPPP HHPQPQP3P]PPPWY $0H 0C8("S)"x)"d)"@-@c g@# #@-@P @H-Q# @PP gP  P ` TpP`W9P  0>8("{("("H-P TP gHH= 0o8("("V*"p@-P @ P`UP T P`p@p@-P @c g@ 0Y8("("("0H- @4P P= (PP00H-P g_ P @g8@P p0 @ 0u("8("("H-P QT$$ $0cx 0r8("("l)"V*"@-P @PT@ 0_8("("l)"@-@PP V@H-T R H 0=8("("("H-P @ c_P ` pTP&`Wp@- MQ @T R R" PcoP Pp ` 0m  Ѝp<< D0z(( ,0 0 )"8("("("("V*"O-MQJ pRL P@ < 8P< {ZPTt`P ` PP LP U U t U  pp  `  0#ЍHH L044 40)")")"'*"!/*"*")")"8(")"V*")"O-4MP8@ % $d p P \\$`a+P $ lbP ̠$`  pT Q a P P T8pPPN9PPJPETc|X P)|TTQ88pP4  P& P P P TT R P HG[8 8:YP XX3PxxQ tpvVP #c_ (P< Ȱ` p`PP+9PP'a 9PT P    $p :P 6P vV P p@`-ZP `\ pP$he4Ѝ##)"()"1)"?)"*"*"a0Q03Q/A-Q TPp Q 8P @Pd`PC TTQtt PuPttkP88fPC XXW t  t  @p'P M p P BW @k pP .@V T$xxQ8 @(( (0;i*""r*"*"a*"*"8("N*"U*"H-P QM/ 0;*"*"+"H-P Q9/ 0Qq*" +"+"H-P Q Qo/ 0}V*"+"+"@-P @Q QoB/ 0;*"(+"+"@-P @Q Q@@oB/ 0*"6+"+"H- MP6 @PP 0@_oP!PU ` eP `/PpP `VP ` Ѝ(( ,0 0'P/*"E+"Q+"+"K-PP*~@.`DTǁ `YiT d\`QP_/ 0nP/*"i+"w+"H-P Q  ^  N/o"1\ 01 CR #^ HN$$ (0s 0in*"+"+"+"H-@PpEUa 6@WgxUȀe.p@-Q( PR+ `@P P pQ  0p@ 0 p@(OH 0ᔁPp(( ,0{ 0_ *"+"+"j"H-P Q!. $$ $0v 0*"+"s"+"0H-  @PᴁQ0#2 +"O-TM @PP@zpR P P0zp@@@@zPU A`@?P: @PUPU @`@?P:p @PU pza  0Pl'PNzU QPP TЍ̙##ԙ#Й#M0H-M  P0 ͂p @VBp@@Ѝ0HЍ/G-R'P@U`  R R* R/ `PPPpV# P* ㎢P a ZpP dd d0;YE R  @T:q 0%+",">,"*,"H-Rp`@PWU L0 p P `p``P QH RU p`ꅪ"e(!@"0H-P@p 0H0H-@Q pPWP @QH` YPPPU:XR,"(A-M@`PPPT  up' p 2P$ !R* | 0 p PP ` Pp1FP , $#ЍA QU p` !2qPUЍ P PP!p0S < ,Q ?0$ h,"m,"s -"-"."."q,"W,"O-M`Q @U %AuvRSP P;@@<<'P p &  p Y  |p p P% P P P P P zP tuPY H Dp 0!,<p x;@ . PP 0S , p @ p DP Rkps @Yu   Pok@%@54  p` L0  e%S S pS H pM P pG $ pA  p9 PP tQ0$p t p'  P Pp ;@0 !x`V# P P   P`@Ѝ`Cp D `Rp|p  P `  wV 44#op T hp  d`P?p xvP4 HqP+ 8lP& (gP! |bP ]P XPn S!P PP_ P[  !px   pr r%P  ph %P x`V ^%P`V <pP J@ pH PP 0S  ep4 @ 0p-LH О,",",",",""e(!@")"","","L# -"-"-"P(-"f!"}"5-"A-"O-"Z-"c-"m-"#x-", !Y-"-"-"-"-""Q"-"A-R 0S P`@8p p 0S-"H-@PpP$  `P.P! P P x tP HE .P``P @ !."H-@'Qʘb(PA p`pP @P` XXpX ~P:HR`pP @P` XX X ~ Z} U} P}  K}!!!! !@!! !!! !!!! ! !! |40,($   }  }  | | | |`@P`XX X ~XHB(*."{%";T f1."8.">."F."M."U."\."'" g."!q."x."."." ."."."!."."? A;0S /A+ R 0S,0`Q \2 R Q,0 /H-QM`@Pop 0| <|` *Q pPE E *Q:ǖ`G$$ 0"|Qލ."""."O-4M$\(P Pᒗ< 00e;Px `B0`,p@PPd   P  PU@ P PY@T,P P.   WI,P P(@$PT= P   >I,P P @T,P%Y" `P#PX  0X  0\@P:P 43 034Ѝ (3 ."."0H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \ \0O-MSXP` @ Z8*@p` `V3 P@PH V :QG TE?YP>@Z8@VD*p^ [A @@I@ .Z:p WA @'*^^@NY `Z:`^ ^ N 6V3"`Q V`FЍ%"7O-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ \Y!V< WW\pG`5V/ WLH! pG)" `( P /Y YV W50 )\0!00 0000pG` V W! pG``0@ U:@`V W  P P@~7@Ѝ (A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P 8p2Xp H"p(H-M`P @P pRW PP t-Q0# <8 W 0yЍ."."O-,MP0 @ \pP(P  0p P P( `p P   0 p0P"L`  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'$!p 0!pth 0,ЍOL@W 0( u0,Ѝ'/"-"[/"//"/"/"/"O-KMMPT@` p, pBNpZ  ypQ T  ypI =:pD W  P   * Q+V42 0<p' P 9p!  t OP  x    @  0ppB N KߍۍxzWhRh@ p W 9p 46<@ H@KN x  DR  d .0EP  *yp P PX%yp p.   yp p"p  p yp p  2/ 2/\ xp pW:Wm@`PpTP0P 1P!x 2 19pa PEu7 Y, F B !" @- @  Q T  D03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p 10 BSA-M `P+p@ Pۍ@@P `Y)P @///p@-MP A)`P: @"3 p1 0)``/p0@ `!ptl 0" p@ `p Ѝph#/"/"/"/"0H-QU @p }.h0Hx.0G-FM@>P+ pF`8   " P `hp F?`> * F? `Fߍi0H-@M@Q@8 @PoQ Q@Ѝ0q t#H-Q  RRP` 0/"!0",0"$ /Lo/0H-@QP  P t 0H-(M `Pp!@\ 0cPP pT !W:7 jP(ЍiH-M `P@( S p  Q(`!}Ppy 9( ``gPЍ8i(iH-M P@a` p\ $ (PJPqЍ:iA-M P`p@B  @0ЍO-OMMQ PT@P Z @@%Btp8T CPLHp`P+PL  P TLXP3LU ,V|0 px Hp{HpPpt`(xPLT`p `GW@pxP X " ` P p ` @pFV`PL ` qFVL`P  ( `\L P  X T@PPEq pOߍۍ88 @0$$ (0 0/"<0"("("V*"G-MP"᠀@`P P 0PPe4p Q *P p 0PPT4p ` P d,4`,0@`P'@xPԑP   "P\P  P (P .@T:/,TЍ)"A-(M P @`Q Pp(Ѝ0'x Bp pWtN   QD    RQ|@|  8y  Q& Xp0Qx x: pPTPP8xPT 0/"`0"j0"\!A-@Mp @`P@ n . !U4 P$! U @0@Ѝi@iA-p@0G0lhp"PWP`R*)P lpbh `EpV *llp@-Ml`Q H 99p lh2" ЍpX%#G-vMM@ p+pPp U U``U`QQR ARj*Py(Q`Zv $` r xqPm   Em? pc SP$  RR}RppuQ  RQ  RRn@ P g!.  4uph Q s AR:Q*wP$0`P$R p7 P " ( RQ QP P) P  &PJ`vߍۍxP @@,PPP` -V`P` `RP RN% &5 P 1P P*,E/F?0  0GpR^   0 p : $L 4ii@v0"0"H-M 02Ѝp@- @0 Q*P`E``U`@ Tppp@-MQ @P P R xЍp@Q4PPP' @)/$PU ` ex@PU x@T `>P* 3P @T`@ЍpQ/@-P@@@JV@-P@@@;VP/  ꘫ#O-Mp(@@B$@P>'P] @xPPpTpp`  0qppP :pP   p- Q'P$ (`   p ) p  7/P$ p $#P 8p o)@Ѝ0"0"fB@lB0"O-M`P    4Q4:  0Qp@T W pPP VP   i 00 R :   q Ѝ蘫#H-M0 tЍgB@- M^ *@ @  0 Ѝ@-@ (@(@-@p  p <p~B G-ZMP  x Y    D   d`!.Zߍ蠫##gB#0#K-Pp@`pQx™\ tr崀`T 0R ,0TQ p2x™`,p V:T 4` p#,P@TH#4"0"0"O-MRpЍ@PU.* U 1p `p!W*P%W Q  `PPT  0'qpp T  qp|1pppY"!*")!G-MMRp @`0GP P Pp  pP7PЍۍ -PzTt pPp XpG`W 61p gT ppGp'1, @-MA/( R r@Ѝ @R S 000P Qp@DTD@O-,M`P$  h  @  _@  y0XP 4ou 0HPk PP*P`JP=`p  Z8PP6@iP4 Z( Q( t j0$p t$ ( $8  eP`X@: ` P"P ` @v hXp T`Y@ !0PP pLPJP `Q( # Pm ( Q   Q  Q$ t (=$:8 7 P`pW:0p QQ 0p$t@P- 0pP$ p P$($ P P(  8  P`W:`,Ѝ!5"5"O-M PP"@40$5P $Q``pW pWJ R0l  Ep P" 0P` $Q:` `R0  +p 0  "p P" 0P$P R0  p R0x  `p 0lP p$`,$ 0 `p 0,P ,@$`%  0p @xQ tb@;,`@xT:A{s R @`(,`@T:`Q \bp,`p`W:x Q F tB`0 P1 ,@`xV:6Q pW Q, P" ZP X!(p   0@}P(P:0P (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍ0"0" 1"1"61"K1"Z1"p O-$MQRf @cPPSP ZVp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 Q"P  BR    pP   H  0 0\P rW~0H-@T P PPPPPP@P*"0x2S @t"PU 0S, 0 00H-PU @L0@-@\Q \W\@-@`q `7`H-M`# @p4 P0 pp8p% 0 p0p 0)&p   V  p @Ѝp@-M`@P5 0hh \P  R h0@v P L0DH   gP $ Ѝp@tl1"1"1"<8"p@-@`hP >P:&Tx R RQ TQ  p >P:  p@95"@-@A@U wp@-`V @@PpPX 0'$P 8L p@TpQ5"AK-MP@p `$PH` " 0 `` 0  0  *@0`PHvH V  `0`8PG PK:j @   *@$O`(0p  d$O T LH0:HP[P hI 00RNHЍK$48{O  j@   4P 8P  @  * @  PdQ Phq $KO 00 xP<PPfH0p 4 1@28 1@,0 1@&4 80 348@P\i`  "0.p(ah`H/# OP hdP ЍKNЍWN 00D 8@??1"1"1"1"2"%2"E2"2"2" 2","6"2"2"2"$2"$3":3""A-MR @`  0Q 8p0 0S  R-  . 0P Q :  PN  0P Q:3 P 0 P:P 0 P;P 0 P  60P Q:Ѝ}  03"j5"t5"H-@ P`p08 l A.\ 0/080L<c u`H]5"5"AP P<P  0ЍA.t$L X a  00 @ BP* 8P4(`  P [[ nfF S ((!Q [[ (`8P4T00pS 5$ AR$) DQ&[ [d0S h`(`0R 2$$Q D  RKo<P[$ @PB8 `48P4[   `DPx[ $ @P:24 zD[ 8P[,Q $ AQ:30$ @Pz:  7` xQ[ t40p0P + ` ,`  ` "4 `",` `P`  `[ :R $` VB `40pP4 `x,0P:$$ AP.+ P 40ps$ @P:8P6<40pDP40plP N h6`U  PppU R: 0pp,P P P P!  0p4P P",PP 4[P:P $P4 plP 4P0p `,0V:4 P,W$@P:9? 0ppP`DP ,Y $APM 0p 8P8P(P $ APx8P= `( (40p[    ,W`DP $ APU<  40p P :, Z $ @P6:40pP[Q   L , < `4CP Y Y6 $ P@ `P4P p`  ` $ ARQY 4P`C   40pP (` ,^ $ @P:(`0pt(`[   DPL)JP FK EKhPZ p p8P_ (`  C p PE ŧw@ }\P 0p7w/` 0p(`2@P' S:" 07DdP $` k PPU P(` e0p(`.<(`P:!.C$P!+C$H! Nr / @<R8HND\XTPL@<< TD@a p+ 0p yV $ AP 4(0pX  0@YߍP `E0p(`%( 11"6"`#Z6"=6"cSc0""7"6"6""6"6"6"A-`@pPP P H PPP PxhPdP o   $AdA6"K-M`pP@P P 0ЍKpG ?W:@Q Q ЍqW:<Q:Pp R:pP P p pXP H P   `    a: ov5P0q!A @"4"A4"M4"H-` P@R :Tp `G0 HFpPd@ 0H;7"H- pP9P @T `dPG0 H#HHQ \Q0 H0 Hw4"j4"O-M@p xPU% `;U PQPUT P> R* P(  0Ѝ9"p@-@PkU ``ca _(][`@xP P QQ|q n||p ;p0H-M@H PX P  Rm (>P: ' P 0+' P P0    }nPZL @  +S00 @Ѝ0Ѝ0HzD4"4O-M M @(P8|p< pH PUP P`i`H 0ȀpPp-@ ((q. `DQ& P(  "1p| 6 @p3 pЍ ۍO  N>@tP([ @(((> * (P >Q 0*< 0<   QpF @L@4 @@ S! ` iP'   60 ;  (taP( (((1pt!c4 Ѝ ۍO] +P0Pp U$ WPP   >;@  50CP   a$'P PP    cQ0S0SS 0 PcQP 0$P @Qi cQQSQcQ0p i P Py cQQtSQcPo l@TP LP P * `EP PP cQQ}SQcPx$OE L }  0<^@Qf k2c "\( P `PP  h dPh{0cSceSPcPhe    q.dd@? r 0 `0 P0R  $@ @@480 BAC0 48\ $D  4Ѝ ۍl0 X %S"9""9"9":".:":"(\:"D:"s 9""g:":"xT$S9"0H-@0 0PUhP00H4O-MP@pWQЍP PdPd  0Pd  P@Q P;8< h $Qhhd@ P  T Q $'<HHsP P P2D B`h0 |`{P P  0 Q 00S A AR:   `:"1"4""K-M@`p P P$PQ6C Di@P-  %PP y 0UP H<8(! H0 @Ѝ hh:""  A0H-M@0P Q  RU 1Ѝ0  R *P   0ЍOLPQ Pf0 Q U 0S: @oB hDQ Hf0 Q UY 0S:  50P Q  Q P r P P  K a$P` Lp 0  0P_PI`VP6@G   60MPP<`4 @B ЍOO`0 0   01PP6V`VP l 0KPD P P= P @  02p 0   9P P  P P :iP 5@妾PP < <Q 1P PP  0,%`#JPK?0\ 0 QPP 0 C  P `  aQ ]iV 0o L4TP PPN  P `"PQ Q@ QUPL`@`$QDL   60_PC Q@:P<>h 0 P hh` 02 @ZP(   P0%PQY QP<`:   P0 P  :( 0 6 0  Q* !P A  >:>!0ἽPO ( R x1@叽h!  RP*} P     0@㊽Pa p` H `哽\PPPj7"7"7"7"7"#8"8"58"a8"8"Q8"8"" 8"9"8"9"8"8","tSS8"A8"L8"H8"O-IM \pP HLaP p` X! @vP IߍOn P @"at Pj ,0 60$@@/$ oR003p 40@!'P $ R ", R QP ,@$`%0S P?Z   `W @@ ` P?Z x@dX A P@0  IߍIߍOL8" 9"> !)9"L9"99"H-M0080PP@UЍ`P  P  p@0H-0M@: 0{P P ,,P    ,I? l wL 0P 0M90Ѝ0y9"0H-@, Pt !L 0HY9" rS H-p@`PQ ^P P P( P H "HHM3"3"0H-@0 PvhLh0HB:"0@Pop/A-`@ P:xP qP@P fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-TMxPUp ࠠ P @Th$ ࠠPUY@C P P. $P* 8 P% ` @oV V  P P < 0  # P  P@T  ݶP$p <`5#Sh0O P ptt1P`P+8P&dxQ XSh06 Y 㟶P `@ V@ ㍶P `@@׵ `P5  < X5  < MdP  ᆴd P oP `d|@p |@d @ 9z ;P$  4P" `8EPPe  pR# | W `P rpK $  P@ @p`@pmd8idXe ++p  P ` 5|xp |h|dXHUP [  ɵ`PTЍ 0*?#;"<"<" <"H<"p@-PE P$ V@p1P P P P  ↼`V  R 0S `Vp0QP    U dPdh 0R;"s E;";"s"@-Q @b P  Fm;"G-M`@pP# PPPU4< P P p  PQnU`@MT  R PP ;00@ Po @V$  `p㠠p;  0ᕻp  PP@ P 88ɻ@ cЍ!*";"l\ ;"{;"K-M`pVo @P d$P R3( ,0 aP  h d JPFPPU Ⓕ=hP dPHK0Q RQ PU( Q,Qh  XQhdP`PHpЍ;";"PP    Q/G-MPPU @ `xq 00  0 PTЍO- M0@< Rx!R ሼP PP p`PP"Y Y V' P PA 130 ЍV P PP1T= 0S; Q4P5 ` P` ` R:00@ Po U[P: `Y ЍO. `` ЍO膺!*";"@-P@TQ    P@ p@-P= `(${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P ps p\/X/(`/p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V Rw4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  `[ W8[ L= K4@P@K @! ,P  = (0,P $ HA[ i P )  ` Z `<Ѝۍ , @P o  ,P g8X/\/خ("/خ(H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P ((( 0000p@d/`/h/l/@-8@P   0000d/`/h/l/O-MM``CP P R4T Pq sP 0SA  "0S͐P   AQ 2 000@:R#RP\@o"t `P @O  Pq SPq P Q ` QjPPpQ\Q ᆐPQA:Q @] T\ `@: P90 D+  R :R|R   0v`P P $` d`PЍۍ00S\S000h/d/!`/X/(l/K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS ` vLvlvvvpqP%mRb0BS` vLvlvvv:NR RR TR nR rR tR     @Ed P P EP P   ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP   dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  Pp/t/@-<@< P )RPp//l<"r O-M8P R`$$r UZ  PK oA쑟`  P( p-[ P#P  OP J Q   P Q  @P~ PpPZЍp0 p+P ,P S 00P P P S0RS0ꈚ/p//t//H-pS 8@ P ll@p@-@8P  PG@DP8`8PP ~Tpp脚/p//t/0H- @ PPP }P0p//p@-@ P  P@DP8`8PP }Tpp脚/p//t/H-P脚/@-@P@脚/O- M`p[ pPP[@ @P! X P P P[ X Q UP0@0``P }`P Ѝ脚/p////////@-MPPP <4@ 0PЍ갡///@-<@< P PP谡//w<"r O-M`Q<@8p PG[ V``P 8bo ㈲P8 0pZ cP(P  PJ Q@oP mP  PJ Q  @P} PpP) EP ?P :P 5P /P )P$ :PPЍ//?H-MP`@`pP0P  0p`=PPoPЍ갡/H-M(( 00;PЍ踡//K-M`p@PP  0p(`pPPooP@@pP C|U@@Ѝ///0H- @ PPP -|P0谡//H-M(( 00;PЍ踡//K-M`p@PP  0p(`pPPooP@@pP {U@@Ѝ///H-P/@-@P@/H-@P`pῺ Ṻ ᳺ ᭺ H0H-M@6PT PP P Ѝ0 P@T@P @@P P (@$ 04/s///ܮ(<"!O-,MM@P ,ЍۍlE0,((  pn  %$5@ 8E,e$U/oP b(  P P P+Kp X( uP P (((H@2Q6 4\d4444x4444 444444ȉ444444(4Љ؉44440844L4T4OAPL PN pH3 7/B\?P;88AP2AP+(&!P@P@x P@XH`q(PI(  Qj 2pR R0Pb0P@@`ņ`1 0`apAp 1`p`q1@qP""/// " QQ"S !>"//// "j[ {S!>"/gfff !">")>",/8>"/G>"8/X>"(e>" j>"G-Mpp W@@P`AV`0P pPW  @0: p TP @00PP(PЍd/"!// A/O- M`PAᳳ0@pq EWzO0pp@@ppPEᖳ@01 ES U0U0 S=0S:p $ Ѝ/L/0SA/A/K-`P*?`P P P(tPA    ((o!`X3%,P*A     # 388 0op8W` "2 08@ @0Q  R 0!pW- `G`oo `fTPD@2v'&p{4p jP Pᵢ@HP( P @PP'  01pP:P`"pW*1 P0U `E`ooT0 `fD@F% 0@2&p@``C`; L 0 c03"  P R 0B0?o 0cD`T@p#"00& P0 R* pW 0G0?oD`T@ 0c'01& `VA` F/4//0/( /($////A-P@T- `V p`@P@P`@V P p| p@3lP `P P` "6 /@/d/"6 /8/|///l/d//(/(Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^ 0`SQ 0CP1S 0Q  /1S 0Q  //(p0p CS  S \ 00 / #Cp/(p/(p /(p/(p/(p/(p/(p /(p /(p@/(p/(p /(p@/(p@-0`P@NP @ T@p蔮#Q Q //ᔮ#Q R !R/ R/ RQ/ r P/(P/p /(P/@ RRR/@-@R !p/(p/(K-MLp@P@@@`PU0` 0AЍ!"!( R/QQ/$( 3P/!3!H-0A CANr R 02| R 2 s~ Rs~ Q QO-MP `R+V@Qu r% rj[l $ Rh@`QeL@ pU `W:` ㆥ`pG`PP`@~T~ Ps 0ЍO[ @PD:`QB弡 `p `P㙱[ P   ( X Q  IҬ@ @U  @[P`~Y `PX+@['[@Q B@Ѝ0pR `~Q-@ 0Q @Q0@U Z 1V U X ꨻#Q//4c$3?"(Q//W$H?"(///MH-M  0 ЍHЍ/0H-TP@tADP ߱( @ 0H:(t MH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M0@!Ax !l ! R Q: P @g@dЍUUUU3333p@-8`@P.P P Upp#Q/ /#O-M`P P@ ᠫpP:p@L `P xW!* =P$  $P`P㄀( @,(V`' Q `0 0pp0000 00pP偀  $[@   P * @ F P:P  $ A  @` P R@ p`0p`"=SLP xxxxxxxxxxx@@< VQ<`J 0 @7QP30  @/< V"Q<`"J 0 @" PW >#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X  PUP P P,H Aq PV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R ```ЍTUUH/A-M@``>Q$A QA 8      * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ $]?P^ {P=`0P*0,Q < (0VP 0 DQ* }R X g. `A $  $ zPh 0 @-0  @&0@  @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP  8 P  }RP P P* *0BS p`v P D {R P*$Ѝ茦/(K-M @\Y  P:PH```JY0JIPAPddddddddd$d0/y`qPLP  O$  F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0Q @0 F @Q*\S{Q $YЍR`0Q* 0,R<Q*X :0VP  V RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n ꌦ/(@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A Ѝ茦/O-4MP@Q * ӦP2  ͦP/ @  {ZP  S00@  <P* ^R 8 P*]Q -Q- P &  ] d0  $ 4 Q }*x0]Sy  R*-S]P$i-S! [S'R%* =R9 :R Q:P ]R-RPP KjpPA*0-S=Q;* ]R8 -Q/-`.Q:P]P-PP=p PJ*Q* =R]Q P'`W Qw:\P_:WP WW w  ppQ PW YP 0!p`PxuQ*x50 `@V:P  Üp p 篥P> p WP PIF!  p`2PP !  p P !  `Py ?yQ:fP`6/P  u ,PuQQ`P XP 0  P\*P* :R]P  PP s P g r0p00B^NP  - Q|*]PwP{8 P 8< Q  P  0`0`&$PxiU `P P ] PS `P`` P PV`pP x P`{P'wP' w? (p P@ۧ@@P  APt4Ѝ,PP  E@#4ЍOPP(p^?"e?"/(#(((p@-(M@     pdrP(Ѝp@r`] N`(Ѝp(((p@-PPp@`Xa!EA(0S0"(0%P0S0"P0% q 0 !↏app@- S* @`PPP Q PP@ 0A U R  Q R    p(/K-P@ S@SpP@ WW`P   PpGP P pppXXXXXhx(XXXXXX0F 0v @ P!A># " P>   oPp  hPpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ Kf 茦/H-q`@PPQ  ,( VP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  (/((@-@ P*Q* [R .R. Q 2R1:QPP00.S ]R茦/A-@X 2R1 :P`q0pSWp]W `00S:llpP ဢPP pPWVP茦/#l?"A-@TPPQ 801 ,P !(0# RR: -'R:0ttt||p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  ,0  X:  ` > ,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$),0P pKZ-p`P0 ḟ,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:,0P $PKP#RR>p&A Q        D d  R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp t t  `ht t t t t t t t t ,Lt t t t t <2 Q@  0p@ @P> @ X:} P7$ XlX>S 0ph `Rd\cA^^ p @ |0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00((((A"O-,MP`TQX PX p00'$@  D | @(@p-+R0(x 0@T`    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q  h#h#  h#h# h#|!h# "@"`"R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp%P$P$%<&D&d&&'P$P$P$P$P$P$P$P$P$(((d(((P$P$P$P$P$*2 Q@  0p@ @P> @ X:} P7%*4*H****4++>S 0ph `Rd\cA^^ p @ &v0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00((((A"O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0-8.-`.h.x..../////////.../$/---x/-----M> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ (((O-DM,(`0 4$᪔   Dh  0lP\P  ^ 8P P X8l@Q$ ! ̌X <<(l@P  p sP@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ rP@Q) (@[%P  <@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍ(O-M8@S*P`  >#RR>p&A Q l7<:<:l7l7<:<:7<:P8<:8949R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Spp<$;$;<==8=X=d>$;$;$;$;$;$;$;$;$;>>8?x??$;$;$;$;$;@2 Q@  0p@ @P> @ X:} P7;AAAAAABtB>S 0ph `Rd\cA^^ p @ qp0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00((((A"O-,MP`TQX PX p00'$@  D | @(@p-+R0D(EDlEtEEEEETGTGTGTGTGTGTGTGTGEEEFFDDD`FDDDDD    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,Ѝ(((///H-o // //0H-HQT HyD Cy , @@ p TP  @; h\Y @ \9 @U $ 2DЍۍ/dev/XtyFtHgtM NC ^ 0H-MP @0 0Cp [pPp U 媾 PP 堾Ѝ00H-p @@PT 0PEp xȿ PԊP\@@P{HHU @ Š@P0HTLTLXLSS8LG-CMH@T@P@T /{Pꊊ@!1@0@ 0H P:?,'@p)  `pᆊPP1w !  00SP@U VU P hP@dPCލKU Z 0H-MMQ@PPap[ T /;{P*@!1@@ 0 P:7?@Xp LP :4p i/㸽p- +u2 0@Dp 0@up   .Pp@@PЍۍ0P#P0p @P%@xNdQI8QQ |I`IPPs IPH-nPO-M@`p‰PVjoT4 `mP `PmOP `P˟8   8 0 H 0@0(  @P``PX@0`$P _? Ÿ ,@8d`\XTP  WA q *   0TS dS S Q  QTQ tQ "j"S"d .R  \    zRNQ @K  JpP?TP`Yp zQ d 0,0" (00" $0" (0"    8@2P `PdQP RXQP@㾈PRP TP(/ "D p :}.0Q\P "baXd P /p+p3 0W0  TG勈 PP  ( !p0 0$ ,p@ W@R6 @ @!yPB  " 0! <R5:0V/ `Vt`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp T@P3/H%P  BzP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻȽMnO-MT2PXPPV@P" p PP. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@ P9P P 0P @PPP`PpPPP P# dstdayminsec,`7$ E 4y~ z x { ~ ~ ޼ d}~d ;  W @} ν W 4 X A *  {0H-PX @p YVSU:ჲ00at T0T0 P <  Q/0P  Q/ /,$ $0H-|0|0 @ R@ P  0P @PU UPP@T0 0$. H-H  P 0S !  P"p@-t0h0Q L F P0Q P`VP  pp)H-PP @p PP `QeP`H-d`@`P p `P PQIPP!H-d`@`P p `P PQ,PP!O-M`.'P6 PtP5 @p`P  P QP{  `RpPY W {`Ѝۍ 0wp `P    0x `{X  0n  `lzd@ i 8B ~ 7 C0 HCZj 6j C jn H H-M   0pЍH-M>   0pЍH-M?   0 p ЍH-M8  0V pЍ覴 P  / H-0H-@%gPP :>{? $  0(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(408 0@S4 0@P4*# 44P*``404 R*>(4 8 0BpS4  @P4*# 4 4 R*p4 @ P@p(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(04p8`@Q4 @P4*# 44P*4 Q@<84pA 4  4  P0R:X @4 Pj R*>0 v04 R*#004  4 (P4 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  R4 $P: #  @P:  R*004  R4 P: #  @P   @4 QBLЍ%#jo%juH-M00^ЍH-MPЍrO-MR @ `pPJP/<>gaP D  0Mp4 Ѝ;v8vЍܠ P8 PPP   0P p-pvP  0p vP vP8  0 ЍR. Q  fo W hN L p@-MP @0`0 5/ЍpK-MMp `@,ep P/P /iP @ Q$  P `  ] h`W ᥪPp   PP00 PPPuPuOЍۍ:, O-dMMp XqP /h R: rRP;Kd`+XaX hP7  >>>V \K V 帻P VVK ajY 塻P BB`qV 勻P >>>>||||AW vP nnnnT aT `P  AV JP T B T 3P hh p?@ hȠHČ pp`p P@ P @0( 0 000h 0 00P00

Pp\0` f`V2 Q1 p P @T,@\0  V 封LP:4P0psP   pW   Pp\0 H`P!!rAD |  ?p , @QPJD$A,pP @pCPA!X!F P ADX   P P峲U`,   X Aq P:P`P  `V    H`  HY `P R 0'ACH``PAD | !  K?p ,H PE U @D⼀d$[@\$D忹pWpC幹PCL岹PpUPC嬹@`H ᧹PCT@C H UT4``0`W`@ PP\ph4`pV,APF`D |  >p3 ,H PU@a @L`8PA PP VP`p Vd,PFA`D |  >p  d,H P U@a Q  `Q`800P \0P `䰝p,`KY \`B AXZA`@,pd @ T5   P P嘱U`,p  T డXP: PP  X    T0 `VEg\pW QD<   P @ST`,` W\[:P @㱫P^  @T  48qL` TAX@0ZG`,@di Y: d q PP @T`,@d YdడXP:TP@bP d [    8P0P `V4H`,ZI \`开 q, @HXJ@T6 Q  P `尰V`H`, Z X:\PX P  [   ,LPJ `唰p,`K SSdgLpW5 dQ$   P @_T`,`d WdL[:P @㻪Ph d @T   0HYZh `l q, @K\X \>,?O-,MPP,Ѝ冶P |80Ip$p 2;`tP D V kP `Q: PpA pW ` PQP V ;P! 0p ?c00D |LW0H0 ;T;PQ``VP,@PqP@U  k; ,Ѝ =<p@-`T@PUPpPUf@p<p@-PP`@PpյP=N@pH-Q$ H ?30000S 00840 SX0  | D0R 0R0 0S ; ;:H-P$ H ?30000S |00840 SX0  | D0R  0R0 0Sh:: /O-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`pl mTpn`PPD\ 8pЂT X0 0p`lmn Q s(   MЍ:,9`9:x:T:999<9::9L9X88898p98T98T98(88h9p7h88A-MpPPOPP J`P @ T  ``> /`*p㉧`zPY } pU ipP pQhPG  0PPPPP(P:  0PPP(P/ p+ $p'  0(P  'QGPP =P  P ^PpW Wp壬ᡬ@Ѝ 1 ,6p@-@ PP z^(`V (V`!@僬\偬Qp@x$5A-MDQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0Ep!!QЍX2 p 11Q/PG-M`pP+``(P Up㻳bPಳ3㺳࿳뀕P ^ >B<?^<v98#6:30'0#- #(H##p--_|o pbrvy/z{M|}9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0uD'0'>C 0( Pp Ѝ Z1 /f H,H-0' 0 ( Q(      /T,O-HZ p`Q "P !?>`APQ0H P P p @`v @@ KQ t p  `!>0@!Q QJ q" R R !0`Qq  0׮Q`Q 0 ɮpxAT `Ta  0 ᶮ`pdQa @ K. A7Z Q "P  P P p9 @D`vX @V@ KQ p(  `` ?>0 B!0 dp;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!|SQ<(p&%##"h"R 0""!O-M@0f  P`R`P vYp|0 R 6L Z 0 R )LPm E( $ x!R  Dlh<p$(IP  'KTIP  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj [HPd P``p$V <P>cRPV[(P P`@`p$V <P>ER@PV @ ᖦ ᔦT [  ]PEQ  ]P E W ]P~? @ pA `pP _P \[ P TP#  ZЍ\[  \PP@Y\PPPV \PQ \PP @Y \PP P PV \P(  # ;Q Q 8|0H-L@\PJ 8\PD [Q08 QP@Q8 P  a\P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@00* L K @-"TXl@000  |@' ,0d@@0XX00H<0 0@W `\L(Q/  X/p@-@P`` V PJpQ PPJPUDp@AO-MM@PP㪟PT M,P AqDD!D1 0prppp P 0 "pPU) aV !Z W ,K ZpPHX`  0"`VpЍۍ |*ܺ H O-M@PQ PsPp8$Q  BQ   BQQ9&0 P "P  0 P 0`0Q 0`0(2`N  ojQ @8YLЍ Q  A AP ̡P o8<Q q Q Q) q-(p  P@ x!@@; ^P7P3 L'xp  <PJp LP  XYX X PO@`1{Hd,@ 8@- (@:p @ 0@-@z:p @H-M0< R    ЍTO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# Xp@P@DT P` 0"`Vp 0 "LK-P`p Pp W PJpAP P QO-M`$P@ `QPLU VQ"V Pp ppp@ ]PhP LD8|  @[ }p] w  !>qP( PU hpD yp P wd U Xp8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ \PPojPP xp|`Ѝ|| 0 MwQD   İhLH4<pl<4k=  xtPįp@-P@p p@@ \PLPojPP 0(Lp D  H-PPQ oj@ S pP 00A  BC @ H-PPQ oj@ S p֟P 00A  BC @ H-M@ R  0 Ѝ (Q/  T/A-`q@P qpp借PB 㱛PG      papUqP U㑛P , Aq@ll0L 440 LC>8 H.8 8 \8 p4O-MXK ,  1!q1saqQ P `ƠV EP j W*  0sp Ws: W`D0H |-p ap W 0@ .ЍЍ@- (@'7p @@-@7p @0H-(M$ P@ b(Ѝ0P0H-(M P@ U(Ѝ0p@-(MP D@6p `~ @(Ѝp(Ѝpp@-(MP@6p `j ,(Ѝp(ЍpH-M   ЍH-MT P ,00  ЍЍH-M P ,0 1 00 0 ЍЍ0H-MP h@6p T  ,0 P Ѝ0Ѝ0<0H-MP@k6p T  ,0 P Ѝ0Ѝ0(Q/6 ±@-D@@p lm$  ` O-M   @LP OP  POP Ѝ6*0lm0hF p 0  P, PЍ4p@-@= @P l 0 \  /*4 ` 01SPPD@-@= @ P  l?:X01S6 ` PPL@-@= @ P o t Q 0OS*` PPtA-,A=~z@ P D _ZQ8 ``: P - P  08 PaQ 6 0po8PQ*P8` HP@-@= @P  R  "+ 8 P"Pp@-@@PP%`= ` P   P  0oS*` PP p(P8<@8p$A-P=njPQ z@Q$  "+ 8 PP Q v@Q  ,-  @-`@=@Q [Q  ,-  $A-P=njPQ ?z@Q$ @BK@8 PmP Q !@Q  ,-  @-L@=@Q Q 0 .G-`=P`Q @ Q+  @0p,@-PP@P@8 0pPP Q  @Q  ,-  pH-4=P pH-4=P (lH-@= @P  R):d@ `H  P t PpLpp pppPA-@= @P U R dP0@ȀplPdp<L 0pLl 4p0pP0sP $@-P' @=@Q Q,@0A,@A1@0L 4P@@ \0H-P5 P=@ PP  R0 T,  0P!, ! !0P!, ! ! @P0PL P0P00`t@-P' @=@Q Q,@0A,@A1@0L 4P@dH-M@ PHmQ DQZ QP1DQ?PP@DQ 0p  tP P05 0 }5:  < 0 0p5PqЍ@4=P/H-չ\H-L R ,PKP8H-P  Q PBP( Rs3 /( Ru3 /L8 0S s3/,/* Ru3//*/p@- M  P@ ` ```1 `` `'E  ЍpA- MRPQ =nj R Ѝ Ѝ POKA@PUP ^Up! Q` SULDA@P p$ 0  BpR( qp|P  5P: 8  ~5@@ v5 Xp5G 0@P @*PTP ЍP8@XHA-Mb=`Pg A@PTP!   Tp`| Pp QP5PH@@PQQ  lQQ  a PsJ  P0TЍp00 R/* P@@H0S 0PPht@ltd<,P@-4@@P$SP0@-(@@PS0H-MP@ P,P Yp PQ \  TLPP  Ѝ01/Ѝ0ht@dH-M\P ЍHH    SЍ܋̋H-M\P S<  Q, SЍ蠋`HPH-L= R ,PIPH-8  PPH-4 , PuIP@@-P xQ |@Px@P @  34/*@E@d/0H-P PQ @ Q Q00tQt0QL0Q 00  3E0X$d@-@ @P P P tPl P L  d3@E$ PxH$H-P" p8 v8P, (@0`P0``` 0CV@`V0PpW0H-P ^, 0( P@PPP 0UPAU^0P/0 S/,/p@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V P  B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pQ  R/, B0BR P/0H-^, 0( P@PPP 0UPAU^000H-^, 0( P@PPP 0UPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-QQ,0 (@0`P ``` V@`PF`VPQpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^, 0( P@PPP 0UPAU^0P/  9uP/0H-PX@tQT X0,P /*P /L ,P ?:P A/ ,P /*P / ,P ?:P 0/,P /*P /T 0P ?:P 0+/@-tP MpP @pQ 6@0tP a"t@*0P /*P ,/L@ R Q/*0S/ 0/ ,P P ./P P #/H-<P P p H>\H-@T& mpP @tQ C6Hk0tP |Q pPpp|PUw tH0 HO- MPE ZCz P=S;p0R@P @pQ  KxJ`p 0᎛PJTP  `FPGP  J0  Ѝ2 ,P P /O-MPpW!  K`  0᫛* ႏP  0`埛p   0zPP Ѝp@- ]P >|P @`|`0@Vߔpx& @P@|0㝒P Q @XPPpD X|$pp@pApnndp@-@ P P P`皔`0PVp@蒔G-P @?zPP  X `x@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`npP `VO-M  Bp T P  [6I`p 0KPBJ} [`Fp P bP P P(@ PJ JP Q P@U  MJ@W  rA J@Z   M @ЍO-TM +p R TЍ]p!R @ 0 t0J4TЍOq.tATW |! BR8   P,`H 0TЍ € 1,` `VS@4p  pʀY`t 0@ 00 0Sp pٚ t1 Q 0 0J+p ǚ YpG-` PPp ᾚ@AAP@Y ZXT  P@P ᩚQK-P pP2@_P+`P:yP$JupP $L`V(LV QX !`z@pNpPV GpPV @pPH-?Lp0 S @ 1  0  PL 0H-@P  R"4坒P PUX P R 0P R 0 0R00|0z,x`Q Q QP ca0H/D  R/P@0?30Q/@ 0<( /P/0Q@?R/@0</Q/ \R/Q/ >$R/9R/p@-@@P?`-pS/p@-P?`@pH-h  0S QX @4  @8 R ($@ HH-P RX0-@ 40 @ 80S 84@ QlOP0H-@PU XTP@? @<8P@@'00t0H-@PP XTP@? @88P@@0p@-Px @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP \  X0m@ 0$`0 @ 80S@pp0H-PP @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@  !   08Q@ @00P@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQ0H-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQh0H-@ P%E 0H"0H-@PR J 0 P  S  E 0H0H-P@E 0H0H-@PQP J P  Q D 0H0H-@ 8P`&p D 0H00H-@PP&p P J Q  P0D 0H0H-@P5&p D 0H0p@-@ l`P &p V J P  V pD p@O-MP`V7 p@"IT( `㔀I 0 ᜠ堀+ @D PT ` 0jpڔX ЍO-MP 0: @p`PHU) 㔀H 0 ᠀ PE `U  0'pڔX ЍO-MP9 p`P@HT( `㔀H 0 ᜠ堀 @D PT ` 0pڔX ЍH-M 0 0ЍO-M@P0%p4 U2 p`NHV)  㔀CH 0 ᠀X `F @V 0ᗔpڔX ЍO-MP09 p@`PHU(@ 㜐H 0 ᤀ娐 PE `U @ 0VpڜY ЍO-4MP @,X0\ PaqQ @Q@ \ XHXPI @X0P{uPX @X`  TPT8`F  V P p `VTT8   =&P @X0 T P8  $X0p qX@T PPz 0 @T (0 pQ 0 Q  0|\Z Ua, D0|@0縀<p+ H L@ PE`FU`(0`   X0Q婔[CA[TQ8 X@Q h (0  `0S0 RPD|p HLPpP ( 0Ap Q0@ TP,X@p (0 P P X@ @ hdH0S #P0ᰱ`P:X`@@ PPu @`V@ @X0[P`F `F?PV P X0 Q/Q^  pW,PapD|P@pJ HL p!`W(0G Q R0T R 8 + $P ( 0@ pP0@ 1TP,0( 0A  4ЍQ`V4, , q O-MP @pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,PsEBp@㤰iE 0ⰰ~ pG @W ڤ 0 `ὑpڤ[xj @Q _ T P 8 O Ѝ, X? @`忒xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q HILP/88!R!RQ@@/ጮP/48!R!RQ@@/ᰮ<Q/(!R@ ,@ /XP/$!R@ ,@ /LP/X-(!R!RQ@@/XP/X-(!R!RQ@@/P@/ḬP@/A-PP8@ `@Q Pp !fp 4P P@@ 갫40S \/A R QPT/ᘫ\ Q/A0SRPT /$  RP00T/$PP00T/0Q Q//`0Q Q//$XO-M@T Q lP\PHX P\T \ ARA `PhVTV[Z IQpI W @ Z+ Y  0@IYʔ ` 0!!47G W`Fp,0!PPPPPPP,!PJ ZQ`p,D |    SpM p`WQI P pIV 0!!6`V,0 !PSPPPPP!,Z!p WPP`,D | 尡  p `PVЍP U 0@!PYP ЍhH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A/P/P/P/P /P/P/ꈥO-MPF @P H?A,0DP   p@Y*  Xaq | Pcp pW:0@   ЍЍP@-T0 0SQR,,r@  @ AGGG( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ ЍHG$GlF\FA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`U(`VpH-H  R <0Q0 R@E,EG-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $4d lO- M@(ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, PPl j,0 Pe ,Q4PY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`Ҍ| `[p 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/ܛp@-`@/P`*P0T0p$ R Q P8Uo%Pp蜛G-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@$@xt0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P aPU   VPUP0 P EP/8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(P(0H-M @0P@0Ѝ0p@-MP @lP```Foo0 b` P `PЍpPP̔O-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP oDQ HHP `P$p(PPX`@p MpW ,[D 0`@P"0S  P갓8DؑH-M  @ 0Ѝ舒P Q/H-M$000kЍ4O- MQ@R ЍP~P @~P, `jP0w 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp89P4D p}P= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R} !Ry$Rv RdQ8p# !@f8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0pW(`p@-X ]80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8pP:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMP@PQDЍl`hS`F@RN@^A@VL@`t0 L`SC 0 0RPPppP oRPB 0Ap0 pSPVPP( x b 1p 0 V` ,  [P P [Z x@  $P  0!P 0  Q: 4P/H-Mp@pQo :  tx 0P`a%PC9 D 0` FA/   Ѝ蘊H-M 0  ЍO-TMP X0pW8  Q$0 I 0|  S S pJ0J$pp`S0p@Q Qx00CJ$00pQ@  $80@0808@8$80<808p080:0 {0r R  p$z WpPPtPPPp A R :X,@PPu@Xp p`,0p`G1```0pp 0`,p00C1@@@000 |0Q(PpPz WP,,p(P1uP8800 ,p`(0!p@@Q8@@@8 /8@8hP P _Pv P QTO`@   `0vS0U0U 0pW00 R9 ,0, qQP ,   P00D|H  p2 pLHpPvP",  A, 0000f  , ` 0XJX\0 PVJ AR , OP@P!, Q0 `  AX0$0 L R( & P$P P  `a P? `aJZ `$L(,௟X ,` 0PUUp OPR( @ R `p Q44 dlP ڃq p0 @`, VT  0 0,X@0` P(P1 $V.(P)X P@ P   /`Af$(2T P  QOX @ PQ P8 0p q @RQ,X/V$P . i P^ ,XW PR !QqQ`Q  Q@XV`@(, 0 ``V /  R@X,0DV     A,X0 ? :X  \ g8 8@  0W0G00 Q PPPWZ !R0СZT,  ZPPdPH @F  0|  0"p , 0F m 0P| Z P X/ L P <X @($ (/   @@TD, Q o ` d p QU @T" 0Pu X@pP1, D0GUV pp p A B O@ & 0P\ @u,P  Pn d@Q / PP($Kb @T ]@TlPP PdP 4/ Pn / bQH @pP`,WT   0Y @Q?@@tQ8, Q P3, p0q0ppspP'Q!ET 9P]p`@J,UW   0@ |/ R5/"@Q0ڸQ<,~,~p0X01!0 `p,pqPV$@T P`P @T`Pp,!00 b"HPy0 Y4,l}<}~00 IY) @!0 `@p,p qPV@T `pP @Tp`l, !0 | @0R,C0IX,p0!1 0`00&03 ,01p@`GP0qV& 0 ! {03  @nh@'@p@<Ѝ } 0 /, @BQB!00Pp{p `P0@, @Q 0!@!F@V`V|0$`0V'0@P(p\|P@ U&TX @,,`pP Xp`p 0$`0@P UW  S0(p00 Q 0吭0 z| Pl! @!,Q0D p P DP EP& |p Pp` ` VpP L D0|0p̈ pPx U $xzXy(yw U :qxpD! $P= 0Q@P L@T.dn R! ,0 0 SR ` R  ,0 0 S,,!,1] 0/0lm0ljtkkDk\kix i 8up4@P9$e`  v @pPUG/@TPP PCA| 8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P   P oPCA 4Wf D@# D @ P    Ѝ@PT~P D" 4P ( *PCA  @T(QapP` qpWMGxPP PCApp1GlXD0$F| 4,El DEDt \@4X4l\(dTLt@hdT@H4<0 HdX>T4L,\H-LP @y88 PC B:tlTLx8 RDQ/lP h%R!R/!Rt%RQ/,; P/:G- 80SDpWlUUhUUQU  xğx@ S `< P\lT`1ppp0v4DP@\0``` $  P # ' 0 p@0@lP h0P0P0P   0 00'ΠTʌ Pʝp ,T,(PHJr |\ R```ǡP?R``o`ǡP8Ro``aǡP1Ro&`bǡP+Rg2``cǡP$Rg>`ocǡPRogJ``dPR/'V /% P   pppp` R R /*P`p`P0p W1/+P0#'1qa0( x1p`Z0 0 PP! TqH  Z% PP H 1\0 H @,PP U !T``` `  R00QUtUUUU 5S t0Q%|:0,:<9@9t8P87DX8@568A-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1oj'NJ Pr`"qpWpr`V  044$5O-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pW32t3@-^:J00`0S4'>:00?:0S0C^@1,0 0(0AS@1,0 0(H2p@-M@P)J\ R ڌP v`P!lP0ok Pr`l R -P 0 0 @ LЍp411P/@-\JP\@ T،r@L@@vl0H-  0S h0/+0 #''.*8P , <0P/H-8!?: 0S%0@S 14 (400AS 14 (40 0 00S `0/+0#''> :8P , P/-|P@/-G-" R t" @  " \R@P P hP9 P{'r"QJpP p! g @1@q Pᴖ ql! P  QEZ8'QJr0"<p(P p! / @1@qPᴆ q   r"Q ]=  q l  ` f@0@$,-8-++,`+X,**+*4*)0H-xP@PPPTP <  0@@0+*p)L*/t*0H-h@ Q pP QpP U  ᧳P0X*0H-@ Q pP QpP U  ጳP00H-$@GpP0x)0H-@>pP0@-  0 S QPSZ\^@, T@@@!\@@@@ (@-0P RQSZ\^@,0T@@@1\ @@@@0p@-P0SpP ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```&O-Mxx#p X  Y cpPCZ @P@P0DUEp ЍO` F@P pppTT8  =,!!g1Rv`@ @Z}0 @00(@P0S0jP@`p' U!` P @hT D|_pN HPEU KPE[*Pp?P P尡 : @`@bP+ P `VP Z 0p`!pp 0p B Q( 0A pQ 0@;pЍpp <&0H-@ ,Pp 0H 0#0H-@Pp 0H0 "  p"O-TMP" `Qo pWoPC[ RbP @P G PPR0@[gTЍP$0 A pR? 0` L  $op WpCI 吇(+$P @ P TU8  P PP P P PXppH$pnPCK $nPC P  Q$`$P@$V`FnPCYIKP3 @Q! ||h n@H$pPuT@CEt!)+ $$`nPC  APQ J $ ,(pQ1@P0W1Pu p@W1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PP P( A Q PQ p}fTЍ ! 0H-@ 0P p  0Hn0H0H-@Pp  0H`0p@-P 4@`p  p@Mp0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>YP [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr pP P@7/@DT PH`DpP PPЍP qpMP@7/@DT 00`B/P[^ p Q H-M0 R!R Q L ЍH/ $ R p\H-M<<000 0ЍbdH-M0@@ (Ѝ 0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0L@A-M@Q,@PA P0 @1 2"!1K`p@pA% a!a @ paP `V $Pp`Vp fPP@ @Ѝ赁N A-M @ R  $ P? PV0 1 2" 0C`p@pA ?> @paP `V $Pp`Vp nPPOЍkL, A-MPQA@PPX `0 81H!2" @ pA0p$4|q@Ap " a@qDP* aV$ @T $P pp@T WsP ,P`V X PU Qv`PЍ-?L*Sf P 0 O-DM4lP]Pw $@4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1 k 80084U<%%!1KP@%A % a!a@pQ `P =P P4pq`o1- 80f084T<%% @ 0A0P$\4@$A #" a@QqP8  [P01   80+08PS<%% 0CP@<#A ?>@pQ =`P g ` +P2  % PP.  P*  P& | P" h  P T P @ P , P P   ! sY nP P P`P=T ,@ t @Y  t@V ,b@ ,=pG w P`Q6@t/P@t'@DЍV aDЍ-?L*SkLNX ,   8 f h ? . .? ? ? 6X O- M` T\P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` !0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ PL` @ $<p zr/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*P p 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0(O-Mp@`PDpQ$ %QpPp1@ Q:/PsPplP T TX " @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ Y<[ 00@4@PpYP, 0pp$P PJ PQ$ %QpPP1@ Q:sPPlP Z Zڼ 0@Z @8PH T p@T` Q Rc ,Pd  4 @ `@%T TP`%V `40 P:,P]PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @  Z pPS&FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo@ Z4 0 pP*,P W,`S[P 4,0` 0ipp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 Bp6Ppp2@or.Ppp*PWpp$pp!p W _ppP}P}PA~V OQ  p OPq  P %A@Q" OQ}a ARI/A AR @40 P*,P _,`ZPY 4,0`T @4 @y APT:rk%Q Q    ;R ?R eRP P @Z ,pYP 4,0p  0p444,  ,p+psߍ|\ MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//ᨈK-Mp`PQ``P# P Wp PpYP  @TpT Q# X+kX)X! T tXX P XE X9 X6 Ѝ JpP Q  (P EP  㰂p(9P  㤂pXЍ<4ఴ, ᫴ht@$ ! ! |! W" ̆l G @-M0S H@P - ЍA-P`P p N@~ZT  DpWP P P P P |P 0A     n O- MM pP /P  0 ЍۍOP= Q/Q9 P6 @`ZV.ݽ`P& @YT  Pp  0`YM V Wg@? CP$ @P`t@:PUppGTP:PW g U gL  0PF]P P9 P 0 P 0FP% @P@`t@:PppGTP:PW g U g  0PF"P P Ѝۍ     ^   O-MR `@P pP %%WP P  !WP  P  VP  GP ^WP   rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P | $P`P PR X$POX$ lVP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ `ЍG-MtPp!` 0០ P4#@PpP+ Q#@P ;  0$p pRa%Ѝ P 0$P  0pP  Pp p| <H-@`nP! V  PP`P |rP p@U BoQW U 0oO-$MP@  PP,PRP  `2`WPF p|,P  刣P  Pt @@P,P `QP  P`  Px p@UPg  MW p[GW P pPPWP PX P `(, (, PpW< 岰P`VZ`VJ $ X @TP LUP $PyQP ( $@X㰰( ( `P~@IVC$~PV@L@@PDPTHPLP3 Pp`sV nV fV    Pl &  0qP @T pV $Ѝ,v3F  b " A-@P P|``P,P PPP  pP $ A-@p P`UP TPPPP !Vpఀ  O-M` 8P. LpW @@fP@pW P Pr @sP nP P@@ PZ  0| pW: 0Po4sY nY fY  P H DPUP @TP'@P#APP H @DP pH@HVH@sY H  nY fY,H (@0H0%P' ,Q0@H <P00@H 0ఀH @ H  'HH @HHLPLЍ   0H-@ PUP S0OP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW P `P sP nP fP` P``M0H-M@P 0 ^Ѝ0HЍ/K-P p@P  @P  `( `8 H0]OP*  `pQ`   sp@Q  kp岐Q  c pP @p T@,@P ,(` @ ?`<@P <8`0@ ,`L@P L@HP@ PA@-0@@@@ @@0 @DS  @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@p `PVP mRP!PNP A pP  H-@`PpWP 8RPPfNP `  P  O-DMp @ P  ,P ^P00\P00 PII|P|@LP@P\P:  DЍZ P:  0 T P: 0cPPIQP `< P`P,PMPH  P<`TP#Z4 @ P@ ` ,P= ^P00\P00 P`F2``P,PMP  P<`P P S<@SSS@SS S0SSq `FYP S8Zd Pc #0UP< P @ppp Z <8,P < R  0 S PC @ qzP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @L80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p <0PP Yz0R < @O Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p <0PP84 PUR <0O @pPePPЍ0kLH  0!S/᯴ 0H-M@0 W 2" @ PA0P$4\lP@APH " aP@0cPPЍ0-?L*S 0H-0M@PR?P 0Ѝ0`P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,P | p` `Q  W|`pQ  P|37`2`F``nn\|nTn@-P @NN N N$ N,NN(Q\mHm/(mQ/m& Q R/$ R R 0S/0 0S 0ˀS0000 M <@$0pPT/Q R/$ R R 0S/0 0S 0ˀS0000 M,04 <@$0pPT/K-@P P P $ RpWPHP`q&0V`v`fVP8Q(P(` (2/8 (` P $PP QQ @R 0 ) /+ 0 M,@0@4@ @@@@<@@@$@@0pPTH-`R @1P8S T, 0PS(00 0$.*P$(3/P `p8`@ jP P$ (2/`HH-PQ @1P8R T+ 0S(00 0$.*P$(3/P P`8P@ +P p$ (2/PLH-^ 0S$0S\ 0Sd00SQ q Q@0 ^<@<<@O-lM@Tph P $P[hPlЍͯP T/ R R \ /+ @ / M/+(  A?04 \ ?< /P0p$ t , X <@` p 8D   P\pDppH < 00LTtX`P R!\|,<L0d< H dp $L@ <  Pf `PV*U 0EV*S  `PEV *`PU X EV*R `PE`PV`PV `P! V*`0S]  CV*R  CVR  CVR 0C`0`9V`PU4  EV*Ry  EVRp  EV P`V*`PU 0EV(*S  PE#`l`P Q?:P`$`0Q`P A p w:lX(, Pp PAW P <L Q? XTp`PP`lPL` PD V*0` PV p`F0pS:L `^ XN\ U Qu V`0S 0CV*S  `0V 0CS  `0V 0C~S  ``@`w  `PX`P VL7`Py !P28B`?P`P C? PXU ` U PUPU`   P` p`4T AP`@PJL\pv `PYQ? LP`F? lP<dh\ Uy*XP 0V* `` V `F 10P:``QP@9lPPLQ Q) P*V `F P:99@ઑ@( P*V `F P:90@U !0CP0 P*V `F P:99@ઓ @P 0Sd,00PQlP``LP`U:P X(p,Pp P`$`0 ` `PP <` >H? 9`0P  Pp8"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PEP$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  H0Tp?? `PHp  \kT\`0pV aHp  \[T\`0Vd V)dHPed `pHTp P00C\ Q  LTp HP)ed d `p'Tp`& H` TpL`  ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P E Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@`U ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ F P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:ꈳ d  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1 ! `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#` P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PNB X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `p|Tp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q  % " Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍ R,2 0S0S@@T:S@?LRl/@ <@010<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPThLQ R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 꾔 t O-  0@  % ,QP @0Y 0  pWpW   0  LQP. IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW   0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0vpWpW  e 0  LQQ0 p $0 00Q ,P Pg,P7   R!4pWpW  # 0  LQPI0 00 0  00 > 0q pWpW   0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ7$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z` 800 00 1pp t l Bt lQ\ 0R8UP @Ch l\ pWpW~   0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\n pWpW  ] 0  LQQQ P<V Vd  0p V LD  p]tP\l$ pWpW   0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (Ѝ[Ѝ  <pp0  000  4pp0 00` pWpW   0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\^ pWpW  M 0  LQPQ(ЍNxO9@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T   0  LQW 8\ W p \`F P,\  C0V   0  B0s@ `R' , V&*<l@P 80Al0 lPP8 0 Ct, l@V`l l 08Ca,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l :l P,R@ T@T 8  %, l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T   0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8 c 0(/+3/PP p/+pQ 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 #, @@ L DD  ! 0 b $ 0 BP`kp@-P@P@T `@ P P 0 0 "0pO-MKP tP tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCzl`\pWpW!   0 PAU PЍlP#Q.\ 0R8UP @CDplP\`V`V   0 @ATPPPQ/ \ 0PR8UP @C`l@\pWpW   0  LQPPPh::O- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC`l\ pWpW  o 0 PAU`@l h Q\ 0R8U@P @Cl`\LpWpW  ; 0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CiplP\`V`V   0 @ATPPPQ/ \ 0PR8UP @C6`l@\pWpW   0  LQPPvPt34O- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ /@ Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. t@ C > < ,< G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" O G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" N H-P! 0  @^   @`AQp#pP` pE  M H-P! 0  @^   @`AQp#pP` pE  LM @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/+ U/ Q `2/h !!'XX X080b$0 ;0,+   H @ H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   H- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p V@ (E |E O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@PdpRppS /SFPPQ PpP`p,`>PX` P\ P/Q PY (>Q (>Q $Qx PQq  Q&  Q@=R(  P R0!$PP"Q qR  PR "R $PP>Q  0 0 ) ? O- MpQo*0`QP@ QT "QM  \Q_" @SRH 0!Php|ePWeh_  \  Y  V @P ?+6 R 7 R P ?+7 R P#P P.0  4 T1?.! T 1 ?.!00 (R ) Ơ?1? .1  PW [* P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X\@P ЍX\@ 0 0R$ L _ O-IMp@ T'pP90PP4 <T<Tp T" TP! P`Ge P AQ @PZQ+[0A S2 1\@60@"Q3 6+Q0: 6-Q06 |60A P01:PaQlQsQeQ( PrQuQeQ(50@50 @P5"Q0(50 3/Pu E/F?PO 1A 4/Pa  E@ @Q p<Pl` ޾P"  ׾P  оP\PR PM -R-P >Rpp<pP> >P pPP4  0 0CS!  E/F?PP0P! `~EFP1A P4/ 0PP Q {PPIߍ< pPP (PP Q XP[ PP P@GEF@PxT4"Q6 $"Q6 Pd\010 $P'   PO PDH P9< $0 A3/P  0@P 1a 6/P  aPVa  +P PXU E/F?``[P P~EF`1A `4/ 0`GPtruedatadict | (xp ) D8p:č  O-MP`,@Kp? Pp F0f pW*S0  0PרCz  [  0 : 㿨p l@   hЍ G-p0\WG@0uSČA0IS*V0 a0I S:00I S3'P `A0ES:a0E S:00E S%'pA0GS:a0G S:00G S'@A0DS:a0DS* `00D S'` 0000H-@@P 4P,P0P4P8P(P;"P5 0 ]P, P3*P "Q :Q  P  P x  0ppP pЍ,, ,0 0  T $ B  /  x 1xp@-M@004 R;P,S Q R& `V7 P)  0Q 4,A4P- A `ЍpQ 0j 0঺aЍp`Ѝphh h0 0Z㑺TT T0y 0<< <0 0c〺& M ) > H-4Q , 0A40Q H @@ @0 0^(( (0 0U  1 O-M@T*P `4P  p4P pP P Ѝ ЍOP HD `P <  *@P<Pe4P,Q\ @ pPX pP\ }P H¨PpWpWv  @ PW-  rP% P  P  P  2/P 4!T  R! P R ph N @ a pP^ ( pXTT!T1 0!1 0)w!1 0n 0 0e 0 0\ 0 0TDD D0 0Kuu(tss\ Ԩ r k $u" C X j F 1 p ޾ K-P: P`VA@V U1U144P pP' 5 , !$ ,,P  Q,Q 0S p( pQDD D0! 0ָ,, ,07 0͸Pp  ¼ Ծ @-@@~H-H,55H-$F55Do74p@-@P ``QPKP Q < `R4 Q ,a5p`` `0 0lLL L0 0)d88 80 0[n> ޼  q 0H-@P P H  Q< 0H 0 03dmZ @-@DP*5 0 03  $ H- Q 8H 0  0랹  & l@o/K-S, `pP@V  cP u P,Q 0Ke^ \  01 0÷뚸 H-Pp?@P `, W  /P  `M`, kH-P@`P oop, WP@P @jH-P@`P oop,WP@P @jH-PP@pQPP T@ p`P  @p jA-@P PQ P`@V pPW P  PʫPP (`@P i iQ/ 0 S /hQ/ 0 S/hH-0S L RQ R0SRძhhH-@P  R  `PV U IP  pg@U DD D0 0౶,, ,0 0ਸ਼h θ ո q ظ Q/ 0 S/(gP 0(  SQ 0S /gH-^ 40 S 0SQ ofH-MPm (PPi@P* !0 8P$P\   M`p  "PL $ PF"P 00!01 09 0 BP1 `pP+ `0 2P Q P P!` pPP \}` pЍV P K Z IdO-Mp쒟(` P@pW=Q@1  A ҪQd AU P V T+* U UP V P* 3! P V P* 2!0 V T6*P }-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q Ѝ谩 @-@P 64G-MPt*Po PPb  Pd  PU%:p@`* PR $  PJ & PB ? P< PEUU+  00U@p` `$P$ ' P =U ( |P =wP d ЍG ЍG8 `@Ѝ(( (0 0t㞴0a@ h _I  H-0S RR oP P88 80 0w$$ $0 0o뭯 } ] k 0H-@44s ((PTPP0 $$@-@T  R ^Q  0 S/P/]Q  0 S/P/]P 0(  SQ 0S /X]0H-P 0(PP @ 0 P xPP h 0 P TPPPP nP000 00 0녢 0#^ #X ܮ p@-@@@P@PN,``Gp"T\t"/ 0 SJ(\\ R 00 SQ 0 S/Bo/[0H-@*@P K  H-4QA4 0 0^2 b y O-MY*@P`4P x p@P p$P D P Ѝ8ЍO P ` PU < X*P7< P$4Z:, qW P  2/P 48!Y Z!Pp @ pP $p 0Q 0Я 0V 0ǯ 0w 0ྯpp p0 0㶯44 40 0㮯xN$Nt|M Lr ϟ N  G ę o ֞ K K-P! PpW1@W U1DU1?44`P`P53 , $! ,DD D0 0[ 0 0S & , ; @-@@p@-@P ``QPP Q < `R4 Q ,aphh h0i 0PP P0Q 088 80V 0(J J k қ G p@-@P ``QPP Q< p@DD D0 0ٮ,, ,0w 0ЮI o f K-S1 p@W' `V" P Pt` nV 7Ps,Q K&$ 0 0H Ϝ  //H-UP 0 0pv뛜 ֜ O-GM  VEF  0PV QUU Q 1/`@uUP pO T 4/  2/pT 4/W MUW WqWq> PQ 1/`@MUPP>  2/P T 4/*UPpPp# T 4/U. 1/Gߍ 0 0 0 0xx x0 0|| |0 0hh h0 0TT T0 0ح냚 : Ú  c  ˚ C  # ښ '* P/ O-KMP( @p$TQ QFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( tP Qq $q(QQ T JI/0P @J_Io($  2/ 0PKߍ 0# 0N q //@-@@Q0H- R PP @Q~P  ,  @00XX X0 09DD D0 0:00 00 0;  S h 3 ` ؗ  ] 0H- R @PrP  R00G-MPP*@PlЂp/W5`x (08<<bp\W W  0<P `p[PX Ptpnpfprp\KPH FPC @QC >P; @;Q <Q >Q&1`P. g&Q&&`P# a P mP p &`P l P tP ;P`Ѝ` 0 03Y t !  0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H 0 0I㹫댒 ] ' p@-@P1*`PPQP& `pcPP P<YPP /SP P `pIP P>p@@p 0E 0v뀑 o  H-@PP*`P%PQG P ppP> P QP,PQP0 `p PP) P%<PP P `pP P/P >HppP P 0 0Y  A-`PY P @TT pQQPM  lPC W` p 4/P5  P0 P" P( `)@<pP P  P  P @L P  zP`D 8 d8K-MPP @ҦpUPQ. pƦ  Q:T?` O`KPGPۍ!1 X 0Pzp  `P p `LJ  p ppp`P`P W  PwP @Q/Q /Q @P*U @U P/Q A`lP`1 p ʞistX/.plXXXX kj/A-`@PpP P P @*QrP@ LL L0 0B 0 0A < I * d @-AT \ T'@QARS ^ DQ B@R S ^   0 0Z㠩 G-(M@RPU tP0  ` p  8P PPT(Ѝx z     /     / 2/ / /     / 2/ / /     /K-(M@PP `P T/$P-P (Ѝ(ЍK* 0  B0  ppZ P QPT T (Ѝzx Q   /@-@7T p00*@-@P @-@PH-P :@H-P /t@H-P $H@H-P @H-P ?H-P ?H-P ?H-P l?H-P @?H-P ש?@-?^ ʎ ! 0@T 0 @S^ 0@T 0 ^# O$-A(? b  @0l  /@ /$/ @-@P 1/p@-`H@PP v P pp=/H-P _-4=H-5H-P Q<@o//0H-MP@p 8 PsЍ0 0 0;㺧vt ؄ ߄ @-M@p L [qpЍ 0 0;㜧wt@x g 0H-MP@p U U UЍ0DD D0 0:yU  Ѝ0t2 g ۃ @-@p 0 @ 0 08Z^t - _ 0H-@PP $@(@0 0 07D  ș 0H-@PP (@0 0 070ڃ  x 0H-@PP $@0 0 07ԃ ( @-@P X A    0 0; ك @-@P ( 0 07(蜃 Ճ ` @-@P $ 0 07צ$蚃 Ӄ  R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P 800 @  0  /UUUU3333  P0H-@PQj   @  Q d8@HHPHXHtH|Hpc? b Aa-lswr  - w-! Q -QxsSr - w-  Q -QxsSr - w-  Q -QxtT    0 0 09pH~ |~ : G-PB P) p㷐P6  pyP.*@`qPqP`@pW   ᪢P =PѦUp@qPT 0 0><} q} J 830H-M4"424R 0PPHD@P< 80*  て@po  zp ttd PP|PxPp \PXPPTPPP P\oBK S O?@QPN-P-d-0p-8 0  [P<-U ?P L@ ?tp5P L  d L@Ѝ0d'pm  0j 000O-MP@P T D "P pXsЍ`ᜟP+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0呋@I" 0¥ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?kx x x _00.O-MP@P T D "P bpXsЍ`P+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0@I" 0 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?>kv jv Yv _p@-M($`P4@`P 08PpЍpp+O- M80`<4P P@]:@p[c WpVpT D#P:PCꠤ`垤D0  @ᕤP 厤`P Q < 80 Y*P" S*P"PPPV < 80W Y: S3P@ P  Ѝ@@ @0 0K㸢(( (0 0M㯢gt t t Ct t t |A-MdP`dp@|@@` R |0RЍL tC( p@-M(0@,4PP`pЍpO-MP@P HU P[ LXh#  T`E@ pP"P "" oPi b ARE0!X    t            $w t!'/w '%w u'*w z wTp'!w qPQ( xQ*Q@  D  0L j0 Q)! P! ,!` L01Ѝ P   @`DpL0 V    Ѝdd d0 0㫡6LL L0 0㢡044 40 0㙡*p p p up p p Qp p p $(s q q q ( 9  /mNA/|O-MP0`Q S U Y S + @T@@ лЋP VP` 0싟ػ + 0@@@PP Z@ TT QT P-PZ4 4`$ ptP+P -Pp 0j `@v/ 䪟 z PJ @ F Q FQ`@hX\ P p0 R ``e 0SAA@ i`ĩ z YA J @@ EQ EQ@hX\ P 0Q R``k 0SqQPq4 PkH@( 䈟丟B  ``Xq q@-ZPP PE =PPu `@vp:Z P+@op0 P WZ;Q :Q0( Q ,PP:P=?v` ЍЧ z GY@ J pE ;EQ 5EQEgX^\Y P 0Q R``k 0SAQPA `PU @ppPU  BPܛPE t  0S 0S Q@Z2 LPZ :PV , P50% BpP @@TPPa@00t RP)S' ` @P:PKQ 8-P+P]X8P :P ?+ @R[SG 0O:PDD#P :PaW@@T R#P :P|-P+P::Q :P?P!30| PpP  P@P@< `P:PZQ 30 # A-P+PPW0``!@\1_ 0Ş0SU88!@41 0㹞0UK!@1a 0ଞ0Y@ @0 0㠞0S6 @0 0㔞0+\ 0r 0 000!01 0vTe f f e e f ze e e Je e e e e ne #$"p!j Ժd >e e ̹̹<! !л8# |LR  M $H   L 0 6 h 8(d e d D@(P N hL$HiL 4O K-@PQ T 4P+ ,,00 P!-Q ``pWp% -W -pR)"2 0 xpW "` p`::W 1\b-p``-UP pOP! :Q1Q `:P $$ P>a" 1 `0P?PP:P lP < 80-  $$:P:P ?PP  0DD D0 0RRT?(( (0 0SH6` ` S` s` ` ` (ȯ@  XR  a ||xXX 84` 83a x@-@P  @  0 0/2` c` y @-@P @E 0 0/` M` N` H-MP`QP3@P AP p 0PP 0PP PP5P ` PP_`PY`PR`Ѝ\A-@ ` 0Q pS P1Q*P pEO Pp pAWp   Q! H-Q Q Q+s$ 0 0GsAQT 0 01Ϡq  0 R1 R010 ܝ,^ f^ q^ ] ^ "^ H-! XV-0 X;p@-@P`P o 0p@M 0 04] H] A @-@P  0@M 0 0A\ \  0H-@PP o ;0HM 0 06\ \  @-M@P  0kPЍ 0 00ěr\ \ \ 0 H-P@P pe0UaU V`qԒ 0 0/㞛&\ W\ } A-@`pQ PTPPT ׉P  0ՁPW Z Y t@ ;$UP9tP6 0 p6T x0 p-x?p+PPs T | g@ 0@!@噑PЍۍB P@@HH#H3 0iWS,,#,3 0jJ#3 0kD"2 0l>"2z 0Zt"2{ 0ߗYk"2 0_՗bPJpڄTp|pPLOnx|~p P$tiP!P"  Pt$AQ@@/q!0P0 @ 02;tp l/P/YPPT LL HX X,! (! 1 0   07 R >S S R S R R R R hR R  Dy O; `T @R T tR R T XR Q T  V U U U U U HT T T mS S  4XES H  #R MR O-tMMFp`@Xp\ Qd Vl TWr Uz P @@0 DHLp  $p`,$p,{ @v@pT ` /pPJ   pY [0P ,@,R#P`J=PQ4 B p h 0h`P  -*@ 0h  P    &@[ TYk@@p,圤@Z,9 , $P@T(rJ,0$`  % U  V` NVVX@崅PpؗP fP\̗P{ pApKP 2,$P@d& '  ! ` 5P`P `@ +P  ` P,P `0.pTB0 @pPtЍۍ<@h( xiPP(h 0%P`۪0 P xH, 0P 0㡕 0 0㗕V 0 0㍕ 0 0ㄕU 0 0z{@t0  %8I J J H J I H cJ I H ?J H H J  O O N N [N mN % lCL oM K K K @-M@@PЍG-PMԁ`PpVLG UO pZU x@Y[ !w,pp0  l$ $(  0@噎P @q L8@t@Q $q,p|p 0@@\LPPЍS? 0 0Utt t0 0ܔ\\ \0 0ӔDD D0 0ʔ0F F ZF F mF @F E IF ,F E %F T ,k 7Ī@-@P  @  0 0~㨔8E E E K-M⼑@Pp T^ LW W&U```U` 0 pP:JWPW Up ڲp)/$@@ pp p0P @ Pߕ#PЍ> 0 00xXC C C K-(M@PP. U6 T? Dp$p pppp 0 pp响P`V  0@6P `Vpp^(Ѝtt t0 0UXX X0] 0T88 80^ 0֓HB B B B B B A B B , O-MMR@P`X Y [ T$P  0@pPWT PK < ;PpP\<PY  @+8+р;P< _< )<U#P @@pH  P᧌@p\P <PH' ppT pH@8$pYP QPPЍۍ= 0Qptt t0 0^\\ \0 0[X<< <0 0 N? ? ? > ? ? > ? q? 1B HA @ @ @ @ 0A @- MX@ @ !0 0 Q Ѝ<=O-M x eyZ7 BX> TF  - 0P PU  PRK  - 0P +P  0` Op Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P.!P/ @P/P  P  0 !!PQ @PQP  Pp  0 `   :-P +P&TP- @P,T"` 0*TP! @P3T"` 0` Fo `7oXP p x XP! - 0PP `K@X Pߍ; tt t0 0XX X0 01}T<< <0 0r@8 ): 1: 8 : E9 `8 9 9 l@- MT@@    ! 0 0z Q Ѝ;O-;$$ $0 0А5 9 6 84 9 \G-!M⨁`@pV<N TW 0;; P;TP P7`P4P0P,P(P$P 0P PP$pW @`K:P;pW  0:``@P PPPډ<P!ݍ:LL L0 0cT,, ,0 0:Y$4 K7 4 3 #7 ,7 \ O-M@P`P B0p P  0 WN* 0 A Ra ARWAA AR7A Q P A BR:P P @a 0X4@dL\LLLX 2 0 0G Z :!1` 0@ 0GA Q : 0 0}֏G PG@!U: U *PЍHH H0 0CuDD D0 0㶏5 F5 l2 5 5 5 l5 5 5 4 5 r5 K-(a@`p?PU ?U` ?`#  @04``P >U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35M%͙L I1p@-<`P@`(00 h@p0H-M@P 0PX@X P@ PtЍ0 0 03"G3 w3 Mu ɘp@-(M`P  00 0 @PP@@Q d`$P @N 0`@P(Ѝp 0 0B{2 2 $m ;3 O-dMRXP` Y 0p`@" F `@3Zz  0@@Pi ,P` p I  0@`PP P& X?   0 :@P,0@@pf  @L``bc <pdc gPb!5_|Pb!cQ fQH00gQ%P3?gQ%b!0`1 Pf1#0-5_f1#gq 0=pa1`1#PP0`1#5_fa0=`b1a1#P P0a1#5_`g1b1#$P0b1#5_a f1P(Pg1#05_g1#b! -,0PP`!f!" 3?0f!"g1 -00pa!`!" 3?0f1`!" e1a1#4`0a1#6o`-g1t`8`e1# 06oe1#a b1<@g1#0`4og1#eA0@=@.P`1b1# @$` `$0OgAb1#0pp`=`p)@a1`1#p' p'0xϠ`1#b! - |`pp e1`+a1#`&p&0oa1#` 0c h p p"p'4`da'ea&`pea&a@p't  p'/'.od `dq8` `.`&&hqdq'/eap'p /}@ xaq` cq'`&o&Ph!p' -0Ppp P`n!p'_'opPPl"d!a!"`c1`%o&& " ?-o D`da0(`xl1d1#@&dP0#O$$Oa|l0@bA` nA$o&o&l@$ @tp`p`p!d''i cb 쿠nq ~ p$`'o&&caP(h pmvmzA-MhP@? @p !R/(0H-MP @|P*JDU ?P :|?P:|p  P0 D  P0  |Ѝ0踊/ Mp@-M@|`0T` P P J P J 0` 06 PP  : @@`Q Ѝp@ Ѝ/dLPL(" LgS0H-@PP^ I \ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0 0 0bsz  # O-LMPP @<8400 t` kD D#@{@{PD0@G0 ppPaIQ+  T`8 ' (8] 0 z =+IP} =YP|0 ` 0D0P`X@ PISp  @\* p- p @1I? GP;#GP<#|#0I0PpH 0H  #-{+{PDH0 @D  }D=Y@+Y @V \*p"H  H"zzPDH@Dp\$ WXD\P:H H`"@z@zPDH @D:$4] 0 @&y Sp=Y[ p@*=Y\* p@H pH@}"zzPxDH 0 @p@D  DV \* p@ pGp%H HpM"qzozPDH @ Dp@G\ WXD0YV ,YPyIz) CzH qPH@9zT "PP : U*D@T*  z@ oz@LЍz  !`z` zPD @@D@TH + - P XA X+- 0p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T AATDD D0 0]xDD D0 0ox긇  = a H-P`p@PY WW/XGQQ <<<<<<<<<<<<<<x<<<<<<<x<<<<<xVp & +W-WVp=U -U +U=W  ,V-  @+p 0 0]w 0H-M@PP  0P@VpЍ0 0 0:xwm P/H-0&xP//// /  / ,  //// /   0/   $0(,/A-M@PPU T] `pP- ԁ@P T\b4p PP PobrP %3 `xP`bP `7߽ :8xPЍ 3 p( P@Q Ѝ 0 0vTll l0 0v \PPP P0 0 `p:g  H :g y z CCH-`P@e ip+iP W 0`FPZrakpp WpP   Wp ʷPxP宫嬫wP`M5p@-`P@`V 囫`VrP哫P Z匫+Ppp@Q僫P Jp@{pAG-M@pP 0R TZ P `P* @ P W8p PN `rP*2 PwPP 0=@>wPЍ2 p. `@Q Ѝhh h0 0uTLL L0 0u b  u = `  Rc u,??4H-MPPD @a`P 0(A@T P p@T P P #wЍp2 WR P  E`pwP SvЍ 0 0Zu; y y tT>4> H-HMP`P6 @0 ᛴp pP" @0 ፴pp PpvPP  YPPPT PHЍ 0 0> uU O-  gP =P=\Psl gP =P =\Pb ^ 10P! wT P M J @G D A#PP P P P P\P Ѝ( Kʩ xxkOHQ$q xf7 a J z H-4P '$0P pPH-pPPD @!P0"S S, Q\S `  "P `Q`P@P `CV: S #S P@P00 0CS   T#P 0 0ip  H-RM@a` %P fPRލ P  0 Kppp x PP 0\PD%PQRލhD8J O-MH`@PY U VjPxx(x8 0_5iUX  HY8p@<8a x( @`p4` $H ǟT T Pp`,Pp(P2$x, iY d  @4pU {EP) ,`0 @  `  GG@`,Pp(PUpw@8< 4,$`Mx ๝,p pG@GP) P 0 ALHHɝp0 P$  㾝P(} GRRQ RRQ RRQ RRQ RRQ RRQ RRQZ RRQS RRQ RRQ RRQ RRQ RRQ R RG@Q P G@Q RRQ RRQGY :U V^GP^Y\ I,p PYgP, 4ppP; PGGP GL 4GPG G G GP QQ G@"   㼜,p pP @ జY IP  ࢜a` 㚜Y `P  4p$p(P`p i<iY$4p`pp(P hx G*G@h@V +U hG唜G@h@V ,P@@,` @[  hh4gT@P@PЍ\ .U08C8 i p  ; 8>>=\==R;:H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpFJ`<v` > Q`PLO-MPP? ($P  `p. Q  p" Ԡ԰@K   RQ Ꮽpp`P  Ȝp``Ѝ 0 0<fї  tX<0$$@-h෽`@@PP`PJ4@T@@࠽P9lp@-@P``Pp<pTIb"`P<`g` tp8mH-   G-MP yOLP. `P*  PJ00P Q- ,q@pqApSڀ0  TdL<pU DD! p$Z@$ЍG@&Ppp@T T P PP`P00XX0 0 0cc 7 b >Y\ H- P n @0O-$M`p@Pf Zn Vv F `   p P`pP X pZQ*Q) ?QHp/Pm PJ .PkPh ZB Vc Z/P`<[Q+ \Q Q X qP @#X p*Q"p *RX  p/R0 R0 @Q X A.Q  R pZ V  Z/R p/PV /4U @P~V @xVX\\ `^ @!@/oo"`0p\]\4R0`pX  @@  r@OoB=r\P /P ; P pX  @r R, -PX ```\\ PUP\`X pppP PR0@S@@pt `T[` @[PVpRP pPK /TpPpDp@X  q`V, 0  P/VP  p/P PpXX X0 0{aZ<< <0 0|aVp$Ѝ G  $ l++&'@-@P PT Ts P T 0i P 5cε0H-@lP_P X^P c0T 0T 0^)O-MBp`@ 0 kPP ub`-Pc``᳢PP `  0QpQ  㥢PM PPG p p  `  <1   0@9p) XIPP1   0p%p @  0 P  `Z:p@@ `L@@`ާ P ߍQ #!"O-MBp`@ 0 ږPP ukb`-Pc``%PP `  0pQ  PM PPG p p  `  MH-M  0 PQ R /O-,MZ@TP(<  CP8J|jf`_ R :R|R  P :     PJ @0\P *\P pXX Xᒥ: PX@ Xd Xp ,(  y p 0(q p , i p 4PJ PU qHP@ hxPp `P ZP TP NP HP BP| <Px p6Pt \0Pp H*Pl 4$Ph Pm Pi Pn  Pj Pf Pb P^ PZ PV lPR L rI  PD:8 6420. ,$*((,&0$%5 0h]48%5 0]+< @ DHLPTX@@\%  rL k, 00p,p 8p`4 80pp P @SP >P $@SP >P{ (@SP >Ps ,@SP >Pl Z piB`@vSP >P' @lSP >P! @bSP >P @XSP >P @NSP >P @DSP >P  @:SP >P Y `p  0@ Q0!  /S` `6^  3:S3    ϟ0Bp5Q p "UUp zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   <pG@3T 0@ P>pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@tQP <P @jQP <  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`px`0@ V:T@`  @V0A`@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A 5P@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ       phɟ B  } xR3 800``@h JQ. eT 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, axyZ jZ `   P pP@ P?$(PpzUH0^'Y 4 9PP  9PK ( @9PE  9P? ` 9PA  9P<  @9P6  9P0 @VN 9P6 @LN 9P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 iQ Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "Qߍ8QQ )\P ף$I <\ J XI ,@h  I I I I hI 8O-M@<PTHPP% (( P p1 R 0Q1W䀟 Sp |* W 1  DPh`at  G `P:@TPQPЍ- p @ 10B KB B ͷ@-0M@ iP0Ѝ@-0M@P0ЍH-&P HUO-4My0 [   0 0:P[ 0 0; P P P P H@4 ំQ0 Q4ЍJt,@ A K& @ @ < 0H-@PP T PP@P0@0DD D0 07OT(( (0 08O? @ @ ? ? ? K-PP( X0 pW! K@`@DU QF |8@DQ F 0S  SQ``DD D0 0HzOX(( (0 0IpO? 8? =? > ? %? @-R 0@T@ 0R@B@Q PO-M@PPE TM 8PS `p:PR  Z9p1 3(`$[ܙ[A-qPpW1 @EaV P $QPXHP* V(̉`01/P- V;  $P5@`@`P pWpQ 1/|tV@V X   0$PuX@迿LHPYYG-@Pa `DP\ qPpW  U` "= ,@ QU ZkEPC HP U' $ P1= 㝌pWpQ 1/U((PP   >51/P $@Z $81/P />3\ԖؖWXLVDWG-@P_ `CPZ qPpW  U` x @ QU ZDPB DP U& P0pWpQ 1/U(㨈PP   41/P $@Z $81/P 꿿XؔܔU`TTHUG-R`SPP 0/`p{G`V @@ P ``@@T p P эl``` `0`p`@ 0p@``PT$ܒxSSSSK-R@SPP 0/``V ppGw P ``ppW `Fv P {l`` `0`p```0p`  P@(SԑP(PR`RTRHRO-MMP `Q 㽇P P/P P GG z|pv KBP PPj ``p/P PZ @@/QQ.P`T T.P  PX P/ : |pC  P /Q P J P [ { P/P PB  e ,{P$J @PA  P2 p `:p'p/P  P [ /. ᴌ Ѝۍ\G? [/ RGeOG>bLG?_p@-P Q @{p@p @TC {pp1G9-G"P/㵊PP- {ppG"P 㤊`P {pp G"P㓊@P {pF@pp@-PE `ZA\⬆H\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 00  pF phPH|\PA-PpP. U6 @R" Q `p:Q 0S R p 0SRpGS@R :XR :R@PDD D0 0DU(( (0 0D  ,   p@-M`@PP T V   0`'Ѝpll l0 0DTPP P0 0DV44 40 0wD E t  "   + O-LMM p`WH* Z3 pY9 tDPA  TT!I@T pQG  R 0S Q:Q |Q P @Q:Q |Qp ㍅Po 0PS @ p,VJ 0%=)H` [ 0&P 7y`VJ(H` p$0P4``Jp [ :H+Py@PfH P7W4 @0P@ppP 0#P pQ 0 R 0S Q:QX |QV P@Q:Q |Qp'7 0CpW4``9P P P :P \PpVp ``p,Z:0P,@K᳈PD ,J0$pW x(t40P@P ``0SLZ4($4`D@ p ⿄P p@@4,P (Vt @PP `@:PtPp  0pSR@S@Rq =R @R @Ri @:R  RD( 40@@H $0H@[ {{$:d 0[  F B 0S:S 0A0pQ:W:,0` AV` A 0pP , D@0 A I` I @p+  +@孉@F$UD ,@\ 4w  T K ЇP ᐉ=D  XDHP LЍۍ(D@0w삟"D@`npP @>@8P pD 07/p P 8p@T <@p@1/g>PẃP  ;+1/pDoᠲ 1/.$ @P wC@#C@<P h`X X`P:  PBa 0P`  R :R|R   0@P P Yp`M `PЍۍyPP P0 0 @Y00 00 0@ꐢ u w  I  {{{t{x{FYy8{,{zwylzw2Xw(z z{8y|y,y,yxY! 0 0>Uhh h0 0>WLL L0 0> ^ D 2    0 X  0 ` e K-`pP[ Vd Xm Wv V~ @PPH 0p:P R Q 0 RQpCR@Q1 =Q`@V, dd@P Pp `@T @Ed ᯃP Pd@`V:V EpT @  ᗃP W9 R 0" 0\>V 0# 0Q>X 0$ 0F>W 0 0<>Vtt t0 02>w\\ \0 0F)>D    I   Q.   8   x   A-PpPL UU X^ Wg Uo @Q> `p:Q 0S R p 0SRpGS@R' #R @R! 0R xP 0/p0`C V:a`CVpV:A`C6pV0S0" 0q 0=U 0r 0=X 0s 0=Whh h0 0=ULL L0 0=j (> `  8h@EO-MMp @PW$  P t9( //P,D 0t  b4 `S&bKP``$pN4 "2 0EJ=($@VQ:QX@`P@F` P0 =r 9r 4r=K$N ; K$N/0 1K,D$N `Y  Ir>P @PFLdL:P `  P ؀ `AР BpT1 r($:P4 ~ 4P [> X>PT>H$PK G(vH-  lMH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 q QKHЍ/dȏO-$M`xxrp ` GTP"  0 `币 PPP U: @ P  E p  pM1AP\ qp X#p &Q!&H@v00 cP"3q"  Q$ЍE8 P9$ LP2 @P QX" 0# " !  P P9PHP  \)P* H "[ T0,pp P $Ѝ-)hHl6xg؀ H-8`N, , fmYj@-M$@;0@03P@Ѝe@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T <PT ,0 0#0ЍH- M +pP ЍH- M pP ЍH-M  pЍ 6q =q05qG-MpPW# U+ `@$A AaO:  |x 0dA`A\Aqpqp@!Qލ&LL L0 0F:U00 00 0G:B! "0 0MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/ЈG-M<pPW* U2 `@$A Aa夑O͑dA`A\Aqpqh6pp#   0qtq@Y!Qލll l0 0GE:UPP P0 0H;:88 80 0N2:Q fRBu+/0 (p@-P@`0( 0@:1pH-`@Pp0 0@'1O-M࿟P@p Ua Wi 0 @Q@,$8p`V]   5@P Q AQLP 4P%Vp@` p@WzP2!  ,p,|8DP0`@py@pv@ps lKpkKphJpeJpbpPPnVA%LQ AQwP "4P%`@ @x@u(``-^[ ` @9[ p)0<0<- 4 p-Q*-0][ 4oO `@PJpp W  pp pP<-Q ]Q0  $$    I II 8PP  3 3P @PPYi \PV`_Pu  0 P iV`Wt -΍ DQ %  0A D`V P @PGQ  0 @BD D `VD @Qw ,V`!S @ D@ 3P0A``D ``SD PPP DDH,,FPϐl# MD`V +@MQ l4l44LLLLLLL44444448888884444444444444444444444444888888444444444444444448 Q;M+8 M8#@/ @@8  BR#:M     0$(D QL88QL M8 MD D @PjPi  @@F3 Tl#ϰ@04  (( T<@D*<@`+Vd -Vb Y} $4< <+VPIF%P:$$4  ,2P 21P0VK0V_ xP<( 4<@( @8Qʔ V VQQ @(@( }P?4P aQMdVEV PV" M 0 @ P_< < @ UpV eV74 @PV 5( <4 @8 <~ <( 9( @ )V  %0P@ _V i  @ nQ b(V( @]4 @  1P < 4 ԅ 0PC < `@P`uP2(`T<@:- pFp @ @ (`nP4a  <a(  4  <@Vk`F@<P T{-Q/  Rq @V0A h QPt 0@PV@` 0@`PKY0A  QP @<V7 [ AH` @ 6< 0偂p `P p4 ` 4P<4P< `F<,@PP [4 @,@ N@<4VB Ể[~ AH@`  5<0 08p P pf <@ `<@<@ 8p 3-P 4 ` 4(`IP@<@PkP [>4@T` (еP ,< @< 0P6 4P<,,l \ ^^(`@K(`V*TSV:@V + n WD  VD N@ )T AH(` ` 75<@ 0奁p (`P p <(`< }P4`FP<@<PP /PV@q@D  PDP,,  T@,Q[J 0`@`V@T@T ,,<8Dq XRD,D 8 0-8 0     0 0 0 0,0 0,D H$$ @T @i`Vs@T T # 尀 D Q   !1 03@U'@İ $P, QADQ3ll l0 03WPP P0 0y3t , Rߍt4wdullrDw`qpp b  p@LkO-M@Qs y{ P")0PPW  'PQ0PpyW `P9  RQ8@<B,@W P1xP' p  '0pP pR RtP   JJ * 00 00 0`2yЍ]tXl0H-@Px) ۓ@)0H-MPp$lVP dd d0 082@@T 0 4/P @54@Ѝ'`pH-MPp$lVP hh h0 082@@T 0 4/P @ 4@ЍhA-M`P$|WP ll l0 0pW2$@$@T  04/P @3@ЍXkA-M`P$|WP pp p0 0p*2$@$@T  04/P @3@Ѝg#A-M`P$|WP ll l0 0y1(@(@T  04/P @3@ЍsBSA-M`P$|WP pp p0 0y1(@(@T  04/P @Y3@Ѝ$fA-M`P$|WP ll l0 014@4@T  04/P @-3@Ѝ(;A-M`P$|WP pp p0 0x14@4@T  04/P @3@Ѝd[tG-M1PPU   05/PP1 Wp$LTP  0 01HPHPU  0p5/P @2@ЍLL L0 0}0W88 80 0[0Ps3EH-MP|Ѝ bH-MPp$lVP dd d0 008@8@T 0 4/P @Q2@Ѝ&H-MPp$lVP hh h0 008@8@T 0 4/P @'2@ЍTam~A-p@P1l h`T  < 0"#  ᝽`60lep@-Md`(P`@ @0$  0  Q CQЍpl_O-KMH`P@pV( TUX[ XZ:1 `tPf p rtP ^ QtPg P!XpIPpp(0 `Z! (W pZ* Z # 0 }PJ P!PpPpZ:ZP`$ F@X@! +`tP {0T%$0  }p }`$`p `P P `F@ ~xFp@$V V`PQ   #[ ?0*``0   @ ^ ~@ | D!)0$ {( 0<('0$\]`}@RB`  0 H"><&`;@RB    "@\DDeD%` ` `X @  6/P X@ m}P P$Y:0D`@p v v vv(PKߍw04D`@ (/@Y P W p$0Q+* @ LpRp( |`P W Pg* [# PpvN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%*  0U 0'x@?Z\^ H-M,`0@pPr.\Pp$ ]`p 8  "! @  "!+]`z(tu(@!\q(@`ЍO-P P#P#PP (y(Ei CiAi#@PPЍۍnfs('.0H-M PX@p   P  vWp  @#Ѝ0O-M`$pL @ KP Y  PP@ocP T pPP pp`P`&Y P gP8 `E 0  0Xp `FPt#PP h 0ePPoP  WVp Q#P]  pH@ p` Z*` pp W * IQ  Tq`Tb@P&0 0`V `V P P  QQQhu` PG pP$pPЍ 0 0M!#K0H-@ /h P P*hU 00H-@PP T  0HDD D0 0:$!T(( (0 0;!괕ѕO-LMPP [ Y"LЍ ,< 0x [ ,< 0y YX 0AbP `[7 U PD<@`: XL[ PXi$ PU $` @Xp p;/P  Y$ @`W` S +;& 0 xKx+x;'@ 0 \+\;r 0 X:H @[T% pd`T@P$p@P@p  ;/P<0  S$p@ @PZ<P@U@p  ;/P<0  S$p@ @`Z<`@V@p  ;/P<0  S$p@ @PZ<X@ @T)p` p , ;/U$@@p`PPPÉf84!  Y$@`@W$p p;/P I P%X*Y*@HP8p D0p3/HPPQ @p@W:D4T#$@@p  X* A < Q0X H0A@TA 4$Y&*p @ ;/HPP% I < 40Q R0A< @Q: p  $<@0pQ@T0Ap<@Q:@p$@Yp:  P;/PHP,gi <`Pf i8p@( `PV `V` 0  0S  P00P@p0CX3UX4p*U, `FpG W3 X3 W1* ;/P4H8PP P 0 Y@Z*@ p 3/HPT Pዐ Yk*p D0勰  P U8* 0 3/HP P U~*D0  3/HPv P Us*D0  3/HPk P Uh*D0  3/HP` P U]*D0  3/HPU P UR*@ D ;/H @4PI<D[[8 @@p :/H P<PѫP: P Xf$  Z $p@ XP9/P  V$ @pUPp>J*:'@ 0L*:r 0DX:Hf⑶ V@0$0P@ p2/P   V$0P W0pWP@ 2/P   V$0 P @Z0PU@@ 2/P   V$0 @ pZX @0@T)Pp ( 9/ZPD$@0㆐L p8   V$@P0W$p9/P A  0,X* PU*0`@,PHD@ P2/HP Q P@U:<`p8,T $@  X*  A  Q0X H0A@TA$@Q': p p0PW R0GP W:0 pQ:@ P2/PH( 8$@ pW*@ @p2/HP, G 8 0Q R0A@ Q: P@p PW @f8 (@p PI  X  p  R ` P @P[0A3R`[*R0,` pGH0,` X3[3 X1* 9/PH8 @P@ PPr <` V+*@ 2/8H<PP` V*@ ቐ2/HP<@D@YY80@D:/H P<P`ѩP:"$@D@@TD9/HP@0HKr0DD D0 0W U(( (0 0X IFIuHHI<0H-@PP T  0HqDD D0 0g T(( (0 0h HHGXHHHH-P@P. U6 T> UF iq`P  >qP p[qP P `P  H/oP Ho 0 0w Uxx x0 0xz T\\ \0 0Wp U@@ @0 0Xf LGGF$GGWfF.G]FFG:0H-P@P U" qP P PnP 0Hn00HpDD D0 01 U(( (0 0' FsFaEEKF[Fp@-MP@P U$ nP `pP P 00 #rЍpЍpDD D0 0 U(( (0 0 EEqDDzEE< H-P@P$ U, p`P WnP pP MnP HnP HBnDD D0 0 U(( (0 0 DDaCCDDp@-@PPE TM P P`V T_ FP p `T< VE V ppp`p  p p p p 0 0IM T 0% 0B  0  08 Vp44 40 0' pB7C'CDB CCABBBCB @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q* W2 T@T!  0S  Q@Q  0PU 0UR  @LL L0 0: W00 00 0; T@A,@@@O-MM(Z`pPQ00PߍڍKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  ႙@TJ P T*0S; (I sPRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8 ||`2 0|P p P0"'00p @p P P20 9t&w00p  PVpP Q:`&6 0 ݘ P`J P^*P&P6@pI 0͘ PPOJWM & 6@pG 0Ἐ PP>JW<%5@pG 0᫘ PP-JW+%5@pG 0ᚘ PPJWl%l5@pG 0ቘ PP JW 0%05@pG 0x PPJW$4 0@Gg PPJpTpp[ `@` H4Z@$00  pHPJYI`p [f0pSa #? Ip s0,P|J P PO:x0 To M0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @ZP' @pP P PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @PJp P:p0 <`dP 0+P Qp pP0 P  0dPP p|T =W*? : O&M `=0 77VU= =mZk:<m<km=<'m;l;l};glG-1MpP@ `W U V] Tf C/l-P PQ4 @  u P < @0%P* PKV `P K8< @0= < @0P1 P0 `Z0`V ,,P `V PpW$ ,P/ P P P  P C,B xS;PP P l l+l; 0P @`\[PH8P 7,(<0 P px P `< P9Q QQ   QP0 SQPSR   @0@]P 0Vp SR 8)9B 00v0@P" ||||A< @0-0P2@T PPP<AT < J@U PP J <0V `V`g`e X,R 4Q 45P R[ `lHP @B? vRPJP DP B? dRp0@@`PrJ>H pp@W= HP U:PDpPP2 Q @@OJQ@DJ R R R<QPQ6P 2&6 0;#JB( u88 4[$ @80偢 @<z4@P P?B    ,  +!AܐY& S Y @<`,Pp00P@pU*P  RP pqʀ0P<  @PdP_p 0TQ @0 )9PxJ P7PpJ  9pf $PP PC B<<ܷ      +!A R'  T R <`,Pp@@PpU*Q 00 SQ q0sʁ@Q < R Rp 0p 0 BaP@P40pRP PP$PPBO >8 8P/22.@10@`0 ( P`V H,P Q @@HQHH,Q UC H@P>@HIi "$e$ r),,P ( آ Rs' X  @-@ bFPt  @ H-P P R  R' R R.Q* /0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-M`p@PN WH PPD PP9*P ^  OWP P PYJY'yP 0SS 0 P X QQ P PXPЍ(( (0 0}W*PV_]ܛO-\MM||0lX0p0 pp0000 0$0(0,0Đ@Xp P W Tഐ@P} *0dPPw  *0ZPPi #P =P 5P pPPW `` P P P HUPP pp  P8 840{P4`V4 p`V-  ᭪P4PUtt!t1r 0FPV `P Fp@Z!  Zh4p 0  0W] 0B 0T\ST Ἴ ,QdX Q\Ѝڍmd V5 cRVeK+Kd O-Mp W  PP @@@ 9N`PP PVZP: 8 tplhd`\XX@P3 XH 0^X@P' 00  PJ !  0fP t@P@T^X@ EP$ H 0*P 0l  PJ !  03P Ed1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@wTL^PF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7.g@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@Tg@Q507ЍU K-XM,PpP @p8pP0V\5 $R2 R1 dV.@(V%h lP QPo PPph   RpT @P > 0 0Tq 0 0 gpp p0} 0b`` `0 0| ZS2^p \{ S \{ z O-Mr`@PpV   *Ep ?p [P ,P Q p#P Q[ P ph@Pa[ @PW XRp0<    01 P8Q4:Zp Z.   P&P# pp Wpp Q  p WY P 0 pphpp Pߍ 0 0!Lly Zv dw v Pw @-@P H@@ @0,, ,0 0#EgܺvT2cK-@`PP( V0 !>?p㠑@piW   b*)P*#@pP: D NDD D0 0V(( (0 0g?O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b LlP: 8lP6 $lP2  `pP,$ pp M.`PV3opP $0<H`pTpvЍ   _lH-M`@PClP( Q PpP pp -PP U3opPpTpuЍX X p@-P@Pu`Pu` V Po`p 0R0p0Rp \ 0 /o0H-M@tP u0Q PЍ0t$0H-n!Q  Q  P@@PP P0@@PF!0     @-@@p $,X0@L   0H-P<@p ,00H0  p@-`@@Pp  0p@tp h H-M`p@P|p 0@<8 40 p< 0_ЍGЍ4   H-M`lp@PRp p8 0ЍGЍ < T / / a H-M`Tp@P p p( 0GЍЍ  l H-M`lp@Pp p8 0 Ѝ0GЍD   H-M`tp@Pp ,(p< 0rЍ GЍ ` x H-M0  0fЍ  H-<p HF   0 ;} G- MPD`tP@@, P    H0 Pp@ ЍbO-M M`| @[⨋⤻ {Pd !PU  E p$` $` `P `[   PpP `\P P .PP `FP Va V*  p [PE[[P; P.P Ul pUg.PE[`⨛VB*U@(:fa @ @嬻[ H p,,?07/K `FV P* [ 㨛)U# Ep UE  㨛 {[ * PJ@K` W *?0 06/ @pG W . P*m[ 㨻vUp   P =0 p7/ @  圻\}k PpFPqd33"3 \l\l  l'3P< 3 3&33130(l83P3+3P < @ @ 333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333.   /$; P2Z;.P P P@ `V`F[ : D0 T/  + di@ P+   P*?0 p7/ @   [ : CP ` Cp  /0+  d@pmiP P+   P*?0 p7/ @   PPW : C/0+  d2i@ P+  c P*>0 p7/ @   XCL.0+  dh@ PV+  - P*>0 p7/ @   C0 -  + dh@ P!+   P*?0 p7/ @    /$;EPJ> :P IP$ P:  P?0 p7/ ~@  p / ?PJpi +R    P?0 @4/ @V   P{ / ?bP|J0 \ >@ [( : ZB0 p.d + pg@ PW+  . P*>0 p7/ @>   :P EP JP{  P%:  P?0 p7/ @  pV  V͘P  zҖI Nd 0@/+  g@ P+   P*>0 p7/ @   .0 + dYg@ P+   P*?0 p7/ @    wA0 p/  + d!g@ P{+  R P*?0 p7/ @p  p P Y? XXᰠ+l @Y  p  L 0d f@ P.   P*pP>  05/  P* ᠠO `뿎p  @   P* 0PPJ P * P   P  P?05/P  V[: @0 X/  + d`f@ P+   P*?0 p7/ @  O  @x@  X T P/+ d 0f@ Pt+  K P*88?80 p7/ @ Z  P ̾+L[ ꒑@Z    0d ep P-   P*, `>06/ [kRɑL - E1R/0 SP PJP  P:  Pl l=l0 p7/ 8}@  p &  O:4 Nbَ\ ΍$[{ d 0,+  ]e@ P+   P*x x0 p7/ @    > >  ><.0+  dgd@ Q < / ?PJf  ꪋ! f݊` [W: >0 x-  + d3d@ P+  d P*$ $=$0 p7/ @   돎 _ /$@pk0 P]J PV   P?0 0 p7/k .@  0 + dc@ P+   P*?0 p7/ @   P *x+p kևM 6[^;+0 P [@ P*?0 p7/[ @  um /l - ]=@  V=0 +/ ((b@ PX(  / P*>0 p7/ @"   E1R/0 Sr[U(:$K  Eꬅ   /$;]P JQ*p+\  Q$P  2i $ [? P  / /0d wb` P   P* @?04/ @  Z    $Q:ꫪڂQ # !VUUUe ] 돎 o /@{$0@P~J Pw   P?0 05/ @  TF p P@  "~~ }} ~{>{{8 [: ;@  ;0/ P2`@ PP   P*LL?L0 p7/ @   / ?P J +R :   ` P?0 p7/ @   / ?P Jl +R :   P?0 p7/ @   O  0hP J4 +R t :   P?0 `6/ @  fzz` `y6yy0 x[:d 0.+  _@ P: +   P*>0 p7/ @   D.0 + d_@ P +  ` P*?0 p7/ @   P *ddᠠ+\ zxxt pw@   P *0d ^_p P    P*@?  04/ zwwt .vjvvd    /$; P J P    Pll?l0 p7/ @   U9.0+  d^@ PS +  * P*?0 p7/ @   9/0+  d^@ P +   P*\\?\0 p7/ @   8@  8P  80/ P+ d}P 2tt[: 8@  8P  80`/ P2PZ^@ P P   P*?0 p7/ @   $ /; P} Z ras P@  @ Pr P  I P*>0 p7/ @  I &rr ѽ[p*}p -;[ 0E+ d P]cP4 P P/ +   P*?0 p7/ @@  @ +P * P ,qyq x @  @  ,P *`AVV@ &04/b }]Yp pP JcX  W dh 0. j]P JcX 6pp! n!o+ P     P * @p?07/ @V  @| P )  P  @p?07/ @.X  @ 3*P$:.hq   P @?04/@ @pG W @( P*tlnmmh P6   P  @p?07/ @  @; *V@  Y  0`` .pp0R `vpWZ.p`` P     P* @p?07/ l m $` Q [: $ k5l P } PlJP P :  P?0 p7/ X@  pjUk *jiij ji P} : 0螟@  㴠 P - P0J@ P` P  7 P*?0 p7/ @p  p Q* _ o OP, :@ ⴠp$;`Pm P J  Q:Y pᰠ P&ii g @0 0PE Y qS` P   P *  @>04/ @0U   @0@PP   P*  `?06/ gUhYlpᰠ P.gg( &@0 0PE Y +` P  b P *  @>04/ @0U   @0@PeP  ; P*P  `<<>06/ VffP < I PP*%~eex @H  牐p  X P!)@   d 0Z` P     P* @?04/ |p[: c]ccQd bIc btb[:0/0+  dwZ@ P+  ᨿ P*?0 p7/ @   /0 + dEZ@ P+  u P*TT?T0 p7/ @   /0 + dZ@ Pl+  C P*LL?L0 p7/ @   PP a9b  P4:.  P44?40 p7/ @  q_%_ P -  P?0 p7/ @   3P  P   P?0 p7/ @ϟ  p`k ?=+0== `k +R PA_E` T@A@@@A@T :__@PA@@@A%C@@@@@@@P@B%B@@@P@@C@@@$A@@@P@AB@@@@@@[ ^^@PA@@@A%C@@@@@@@@B@D@PA@@@A%C@@@@@@@P@B%B@@@@@@( ]I^L @PA@@@A%C@@@@@@@P@B%B@@@P@@C@@@$A@@@@A@J[UJРKPEk[RKF:`k BE \1] P:)  P>0 p7/ @  Y}pᰠ P[9\ Z @0 0PE Y + ` P  ~ P *  @?04/ @0U   @0@PP  W P*  `>06/ Z[ Y% P`:  P>0 p7/ @  D.+ d 00~ p$~ Pp✻$ PPJ# }pᰠ $P° X!Y@0PE  $0 Pl` P  ݼ P *@?  04/ @0U   @0@PP  Ḽ P*`$$?  06/ ( XX6< "WW VVU   P>0 p7/ @   PL. @@>  @0 @{1+R= B0 00+@ PuJ@ P* =0 p7/ P@T[⨫*U:@ᰠdA `  ` P p <  07/ @@D T  P*| V*p+\   R$ M  0 UUTT$ [> P  , /0d V` P  ʻ P * @?04/ @  Z   NTTH $` kV:SSS| ;+#P [@ P*?0 p7/[ @  .RR1S ;+#P [@ P*>0 p7/[ @   QUR   /;PNJ PA*H\-1R/0 SP PPJPV P3:  P =0 p7/ }@  p1>QQ8 $P P:  P <p0 7/ @  PQ Y|pᰠ P====O@0 0PE Y D&` P  ᗺ P *  @ ;04/ @0U   @0@PP  p P*|  `h h;06/ Yz P|: Q :0 p7/A  ?L5M UW   P 90 p7/ @   P3 @)  /+@ @/+R8 B0 00+@2P J@ P*80 p7/ `@Tkp{C*V*:ᰠdA   P 0  P805/ @@D T < P*k { K L JmKJK yILJ>h :==4 ;< ~::x 8u9 7E8Ȯ N77H 5m6 << 9=:ĭ 66T AA>q? CMDк CC AMBи @ ?m@t Z??O-M(`,@ P0+P:J@ pQ pU `Pa Q p\Q Q .QQ pG0`,@Q W UQ;Q.Q  R.p Q*Tp"@p  R *00 P5/ BwЍ.Q Q Q pWpG,, ,0 0yj22d 1!2!2O-M`P@V:"pP TT2T0 00 /=0~//x  "0/(F A-PpS`@p@DTY*ppV P pW-(GA-PQ!@ 0Q$  0Q$  0Q40  p Q$ p ` Qtq(  S p` *ppG`WVVJ R p`)PJ PpG W`VVJP p`)PJ PpG W`VVJP p`)PJ PpG W`VVJ  X $ (,O- MQ)*@$pPP $P(,w(pWJW(W$P(,, W0G`P `Mp Ѝ `HX  V)p `U  P V/(VJ,(p , 0;0 0*)pPJ, `P,`% ˂ 0,0 U, Q `( ,  ,q R(, (p P(  Rp$ (,O- MQ)*@$pPP $P(,w(pWJW(W$P(,, W0G`P `p Ѝ `HX  (p `U  P V(VJ,(p , <| 0,pPJ, 0 P,0#` , 0U,  Q0`80,0   R,H( , (p P(  Rp$ (,G-Mp`W` Zh V: 0P UJP#%C01@?P0 @P"!0`FpVPD D@V'  00Vp W& 41"R@0R PVP==`  !.#``p W*w0  QЍipp p0 0ZTT T0 0DD D0 0 < $%z$$$ $$$G-@`Ps T{  P 眒 p0Q @=QM A Q  18pp T Ut* AT Ul* A!" PU*T U^* A!! PU *Pp Pp pp  ET UA* AP W7: Q3 @ Q+=Q ( 0 0{T 0 0qzQ @ T U*Qu@@ @0Z 0P\""4""k"\ !""H-MR@tpPq(`PT  ˿ <  8 p` ( 0uN'4 m!  P /L8 P//x O-M`P_ Zg 0Q xQ QYЍQ*0pP@`qP  Q8q\JPqP $   0PK` U "V PPP`|`PP PP 0`F V``3 `Q `  X:ЍDD D0 0>㛽Z(( (0 0?㑽~L l , | A-P`KpU. X Vx@0VP`. Q p`07@V0@3&b``7@` V0@3```@V@ õ 0 0gGV/<o/༱$///O-\M%8 B#@"p#2ud#"X  X:@0D#!9W &2PLpf @ Pc*&p `0 ppJ  p `  p%k  A%`Y "D` &2 0&LpPW: @&~ pG 0@ @#倡AZ @,"H &2 0 LpPW `&a pG ` `@A[ @!M &2 0KpPWa`X Q\Ѝf `&: pG ` ` @1HS XYZ[ a` P` S &2Kp @P* P&  `P`@RP  00P ppWJppp pAEE.‰%I$ųMn: % ~ }  H-p@`7PPĽ( U E  APEq 0 .S R:0pS\WR: S\R   .A-MM`P `+@P J +PJHoBPЍۍBf p@-RPPop@`PP  p@1p@-RPPNp@d`PP ^ p@0H-@PP  0Hp@-Q P@=`P prP 2 p@0H-P @PP :Q DP [00H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0u00H-P @PP  D`P @0Z0  ꔉ O-M-MP@`t@ Ჶp@`P P P P p p p |@x@:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW DP9 6 P4 4,DP. 4,DP),& #x|4jP:PP6pP pPTʛPP8P_ Y <4P |jP*RBk@x? ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4 x xYH <P\ |4 jPV@j @ N괂 4 mm m mm<P o 0 !  Q"04,DPL K f`"|  @  |x8@pPxS <P |4 jP@j @ @x|4 0 4X 4@ 1@  |xY$4 ?(oP o$P4 P9||C! ,~ A-P@pW ᰰ`P P PA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0C5DD D0 0D-00 00 0E% FO&NQ0 0 ä0H-P@P P Q080QQ R:0088 80 0e$$ $0 0f|@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Q& 0P*r-w--x  0vS-S rS  wS xS S //H-\:  P/P/ Q Q/@-@P =AQ @ R RP///o@o"/ /o@o"/H-/RR 0 0pڲH-4 /RR 0 0pDzeP/P PQ/Q /H- AR*Q *QQ 0 0p㗲H-PQN0H- P @ \P6P4P 0P,P@0p@-MP@P"  AP [``P ЍpQЍp 0 0Z^P/0H-@P QQ 8P:P1PU:+0H(H-@PP `V pP᥯P p`V 0 0O-M[# Pp@aၯP @[X  P*K! !@PK ЍH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0;] P+ Q$ (xL`( 0 3vq:& 3&!%   0ЍhT Q A a Q1 A/3` Q3 A/H-`pP V P 0P@T PT S00DD D0 0L<V(( (0 0M2_E7-00Lc O-Mp@Pp PT D P"PXЍ`HP+V  -V  `0V  p0VpTp xP0@ Qa@"Q#9*Pp`ʭ@PE" v `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍA@Q 0 0?㦰꣫Xy00$a O-M`pPP W G"P & XЍ@ἫP+T -T @0T  `0T`W` xP0@ Qa@"Q#n*`@P?U  p 0'UK[ [ @pI" ѱ!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" Sڞ! @T "Q/@X QPPPЍA@Q| 0 0?K[? rQJQ H-kZ MH-M  jЍH Ѝ/G-`PG YO m0@FQ`V ;mP,`pPVPt  ᴤP F  @TP@F    @Z 㧦DD D0 0BqY(( (0 0Cg& fp@-@P۰@ <`?U  v@ p@th\ p@-P@Pu`Pu` V P @`Vp@-@P ҥ `@B 0 06=eH-M?  ЍG-MP`0墰P @V   0 $P pᥰ 0 PᛰЍpЍ 0 0ˮ O-MM⨃p`0WXQ0 `Z Z \AP E@/r .0(PP 0 <Ppఀ Y .YQ  .Q P.PE :Y  :P:Y Y  :Y.Y Y Ⰰ  P.P$`Q(@,P `$ L!1q 0 p F 뜁Q0!QMߍXP`T t:Q0p Xk ` @CTXac:  f P# `X `@D Xa0PTM:  z` X  D V,, @(0B 0ۭ0 Y  >X V Q pQ V K-M@`p4nP P0 0@@vЍЍK- Mp`PPR HWV W /@W 1P 0S, R*PP( p@P 0D@@ 0 @Q  Ѝ@ Ѝp P`pP P 0 0LhN HN O-$MM`[   PN Pkp0" pi<~P_ pĮPY ` 0p@ȺpZ--  0`qXU P p@GP:p  rPW T QCᡮ#q`@Pp 0D<P `V *PEu0 +P   $Q$ЍۍWm @g QQ P $$ $0 0IR 8%iG-HMHPX DA `P0P$LP%  .08 P `p`U@`p Y0 RQ 1   @$T D QHЍV$$ $0 0'O EUU8UO-,MP@Ps P(p p`Px  0p& `Pd $p  0 pPT  P  =@P! 6PP ` @Q  @0 0 0 ိ`PP PP/C3M@ 0୫2N 0ফ:` P` p} {(,ЍP P PP4P% ` ` P P P Z:  P8 J `j`P  R @*P@`  B `JR:BT  ẟ  @H5T@*P@` @Fᢟ@ V Y @@ aPX:  ጟH@Z` P ke^SK-MP@PH Q `Q6 7P( p}P" P  0p`?p   0P*xX  `P`P` `Ѝa` 0 0 luO-KMMhLp`@Y( TUV H\WWP(P H`Xe X`zDppP@P \P p  0LPJ@P @1/P L RDP4 DHp0P pGLPT 0p`0*p@TPT$P R*<@@D ppP0@JD`4AooP8PLPHP<@4 P$ L@1/LP 8` P<@,HPspp@mP RLT,GoTe<@P( &,P8   '0mP|J@ 0p@'1/Pl (LPZP `V*L#0pHP<@D PWA DWmWW6P 0 %9 P @P F`L@ `厥P4@'@pGP0`P-' PTL0pHP<@( ,P8   '0`PJ@ 0p'P (P'PP@ GT'⼖PL( @LHPGP09@D`` 0% @( L0p P/W ,P,P,p 4@0pP@@$ Q*RX*,@$  o LHP@wL0pHP( J WfHP500pP  %qL( 88, G j@PEJ` {P= ,(LPW4P7  Q : `  P+ A`L ",L HP<@ZDTB8R?*0`G p @'@`@DP|Z3, L T``|P@L( 44L0pHP( WSPL FC@L4 PLL04P `$dPV:4QSDQP4 b 0Pp0pS QhAlQPT  V Q S PRQ& 4Q#P @4Q Q0` pPP @2`@pG0CPW P0 `TUP `PO@ JTJS `   @ F J@Q* DA@   `6$ 00APB@ JQ*;`(P KߍۍQP0.XX X0 0ㄧ@@ @0 0{{ h? S|< < O-MPp@P@ Wp W (`P ` `NP ` P P P ` P P`d/P @ @oᠢ@P ᅤP Q : )P  A  ` `ZMTY ` P%H`Q*  P  @`ුP ` `!P#XO#`P  R:0 BpC0R*j a ߍB@Xp` pP` R? JAP@XPpY`Z*PP EȚU@ X@JPq@`Z: ᴚJAP@[ PP88 80^ 0 `} L~K-MPP6 `PqpWP( pp@U@@ 0   Q  n@ T ЍЍ 0  0;;;p@-M@P`9,0,)0 Ѝp::@-M@&   9Ѝ\:l:H-M@Pp4P P0`L0 @:ЍЍ::0H-M@@Txp@@T dPP D  97Ѝ0Ѝ0yyyx9d9O-MP`Pa Uk \v P P Ѝ  R !1MN 0@ `LpdV7pK``pW [ p帐 pppppW @D1D!DNM0 [10 @1NM0 Ѝ 0 06 @֤Uhh h0a 0 @ɤ\@@ @0b 0 @ἤ|,ѿ1sDCqC)O-$MS@PQ  Z T# T P $ЍO&`/@@#@3 0IつZ$$#$3 0JwTY Z @``T``` :T:P} rPp` gP ^P V1@ `@T:TBV Pj `PM +` `P  <V `@T4 +Q`P- @P T- DP  A0ppB0P.T  @T4Q`P `T0` 0 QP P$ЍBNP`PP`P /`PP`P`` `0 0ãZODD D0 0㹣F0 DB6b?:>;kkX. d- <- - t- - A-MPPY Xa @ `Ѝ  00T @ xP `9T pP 0D P p@q`p` 0D P:.T Q*p@p`ЍT @ A Q  ` V3VX  0ЍDD D0 0m;X(( (0 0n17<к, O-|MV@`PQx$ V, T4 T[w V 0p& :P2P P*: }[꘤/ꕤ`S%5 0HV%5 0IT[W V`\  0t 0PD  0 P 0 PąW 0 0Pp,04 or0T @s P_oPR0pYt"W pTs@@0Y t P_o PR  @pZq00@Z 0q P_o PR  pXsPPX Ps @Oo PB  0p^u0^ u @Oo PB  PpP `\ q 0?o P2  p q/o"0P0q pWqJP. X:[C x [ [[ @ TX*[:XW W W ,P4PP 1"@J ,1P8P6P 0p! :1P% JP"*:IҝPx Y P*: Q* JAP ` J,4QPEB Q`PxP|ЍL 0 0h㕡V 0 0i㋡vxx x0 0ァ`` `0 0y* %Y;1V6дӺmô 6I>$ $ O-MpP@PP P&(Y$ `V$ V, VU᎕ + 09/p ! 0XP <X꿢6w2P`PpPpPPTPaPpwPp`PPd @Y  ꇢP P   PL U PxP  Z   09/ pu 0 0P@%0,RP <X8 0 BS0< @X0 pP  U 0 U  EPA0u0rPP @P U ULa? pp9/p 0p P @ P 7U 6 ]PP'*ᆔP bPЍ 0`9/p 0P @ P 0P! BZ@6Ptt t0 0Gdd d0 0@@ @0 0ʮ)|$ " خܮvîO-MP@pP U` {p@Z xX]p@Z[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ PZ  ԓ@pppZr@> @V[; ȑP6 p@  W)  0WPpp_oRWWUPU U@@ U@U @ U UQpP PpW @@P@ Ѝ%Ѝ 0 0h$5Yp@-`@PP T$ 0 0GFCp 0ap``@ eTPapDD D0 06㼞T(( (0 07㲞m#Ex~H-M  2/Ѝ/p@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 0qT(( (0 0gꏩҩagp@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 01T(( (0 0'ꏨagŨ0H-@PP T P P P  0 0H/0DD D0 0T(( (0 0꿧,x0H-@PP T P P P  0 0H/0DD D0 0ɝT(( (0 0㿝fǦ>Fp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0 0T,, ,0 0}zNdp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0% 0FT,, ,0& 0;SZp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0E 0T,, ,0F 0ۣl}p@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0YÜT,, ,0e 0ผעsxp@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0a゜T,, ,0 0wӡp@-M@PP T) `P P P 2/`  2/P `ЍpHH H0 0@T(( (0 0i6ˠp@-M@PP# T, `U2 P P P 2/P `` 2/P `ЍpЍpll l0 0TLL L0 0q44 40 0껟ʠroAp@-M@PP# T, `U3 P P P 2/P `` 2/P `ЍpЍppp p0 0ଛTPP P0 0࡛44 40 0㘛{IOh{q+p@-M@PP$ T- `P P PQ 2/`  2/P P`ЍpLL L0 0ZT,, ,0 0O3X,vp@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0T,, ,0  0/^2\A-`p@P1 V, W6 PPeP P# P  03/P U 0  03/P U  0 A/DD D0* 0ƚ(( (0 0#㽚mOHEK-M`@PPb Tk Vt Uz V P P PN 2/PG  2/P; p` WP5"P P P.W$ X`,P  cV Q`PL```X D ``  `Ѝ 0^ 0@T 0_ 05V 0 0&+hh h0 0"V|LL L0 0s˘}wϙS%}+*}<0H-@PP T  ;0HDLL L0 0T,, ,0 0ꋗY|_ɘHH-M`@pPP= WF TO VW U` Wh P P P) 2/P"  2/P  R Q  R 0S R 2/ЍЍ 0 0W 0 0T 0 0zV 0 0oUxx x0 0eW\\ \0  0Z}zەQT)>_1z3bG-MPPb Zj @T `TYL :`pT T T<` 2/oP 8 2/P* `P-V+@T T! T$! p@Y@P p  pTPW  ppp pЍ||zpHH H0 0/՘Z,, ,0 0ʘʔw;rw0H-@PP T /*0HlHH H0? 0૘T(( (0 0 㡘w.EwOH-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0W 0WU(( (0 0M'uƒߒH-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0{ 0U(( (0 0׏t0H-@PP T 0HLHH H0 0ߗT,, ,0 0ԗG7t 0H-@PP T 0H{LL L0 0๗T,, ,0 0஗ꯎ}s~^0H-@PP T 0HHH H0 0㔗T,, ,0 0#rˏ0H-@PP T 0H0LL L0 0nT,, ,0 0cꃍQrWo2@-M@000P.QЍ@-M@ pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /8  / p/ 0(/ $ / $ 8 ̠ 0/O-MPU `\ U*0P P*.000p@P PAS01P!0P*@P4AU# HP  @d%ZPJ P*`Z: p0P#I S%PJ X* GW`ppFRR b` 22"I S@ `P"0E:SGp10Sc*P@DTK!0E^S:0SV*͠)p cg|51'ƠEd0 l~0'v PE0uP e\pU0PP:*P R{0 b`2 I $P*J X'*` I 0$PJ P*p \` PU PR .  P*  @Ѝݖ(Ѝזe<ԭ800O-M@ 0`pW  \W .W9  [* R Q.R @[W+  P sQp P PQ ` P Ed @ F!p W`` X*p@]hP LQxQp   QP2(@ U1*@0/R# ]R* PbS````  P0R| z ^x@ T" @` Vh* Uf* 0pS P[  `P]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Qڕ(Ѝ RЍQ X* H Q@(@@꽕 h ,.-A-R8P0U9  0 PU. U'*PP`@V VAU`PQV!P`V*UPPE`Upw`VJ@@@@@`y(C p H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PQP!P0[0Z1*` !  Q*?0 0P `T@@X`V(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pqT!pp P SP@ P@(TYTpQX @QUAPT qP!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ P(`W @(p]pPP Q* H P(P}  ( u@pB XY9(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P !pPP Pލ< H-BMhp`@Pp 0'p  0!QBߍ< Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H- Q 0S AQ:Q B蓓ꐓ(G-@pTWo᠂P` P0 P1*T`P (yP@pTWc`(H-@QSP`p R yPpGP`W@A-PA@T  9QQ*0(Ap`PJPQ`@?@-Q 0S  AQ:Q @(@@ MH-M  {ЍH Ѝ/@-M@ p TЍЍH-R 0Sb 00S0 0s 00h O-M`PP @U E @"PXЍpOP+W -W p0W `0W`U` xP0@ Qa@"Q#L*@`pQZQXZPEUP@@D"sp00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRO@pX QЍA@Q 0 0?㚐r;njt+fO-MS \ Z@Y!@@`ЍpP0Q  ApU/W MP%p@ mP@Up`T@*VJV:@V@3D    @gP @`@V P 0 0@(rrH-`p@P͆ 0P?0H-|@P@ ppdPP ZP P< @0 @$ t0$$ # 0H-@Pu 0HH-`p@Qh dP W  8 0tA H Lu@ ̋H-CMs@PTp, U @ PR  `0!P0G 20" 00 @P8($ C:@P- PLP3 @" ,0 P),$P" `!P 0  3/$P QHP  @,PCލ9a`|QP [P TaP` x8U ((1 0P@P ( R $2/P ʐQ 0 0PP P0~ 0UO00 00 0E >nrnwnnFn\"X"h qp p (!!  x~  O-M@PV q1 p0R0]PD \Q\a\q\\\P`p JX0*BP :   + $   ЍO 0 0nlclOlBpm2ommmmH-@PU P P`xqpTP* X` PV:H (` dP  !0p`P0PP`p PP Q `ApP V p   0 0Rjkj@dTO-TM`R  xY X pPY P p,pxQ @T PQ$$HH$  (T$$ Q "$0 0$( = 0" PM ZR P@p@ [J VAQ@@d0\" XPQ  0400P  eP QII0S  | 3/@x Q@Z@`XtpP Dt$Q(( (kAWpTЍtt t0 0&+\\ \0a 0 X%<< <0b 0pfngvgfFg[gbfg>g y x HLy x 40w l w v O-Md\ ap D@D  420S$_+Pq QPP! ``V*AT pW W P P U {\\pppHDQPP `4p`W*V bP  R  2/P )U N @@ 媥sIQ 0 0|tlЍu x@u M. ldP@s 0\ pDs |s )0H-P@啉P00HK-MpP`ᬍ@ @`0 0pp2P `@F昍@ꔍ"Ѝ G-MpP`0再4  0@p @p P `@Fs@o"ЍO-|MP堰x $P Y| P%P,0 P%pAUW@qTTTTT\TTTTTTTTTTTTTTTTTTThXXdpTTTHTlTT  TTTTTX x TTD  T T< H 8 p $ 0 0,0o@mW `#/p~ P0(Cmp|@JpJ.PSG m̌)PG?[;5#msPQ%Q7pP%RnPpP\̌ s01S ( `쿟P 8L[Rs00 Ba /@!B BpNp T.T.nJR3/>@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:D P@! P堰gQ VQ, Hp!0   Y *P p [PE5P Y: P Y: )@P"d 0Aspg@G'v Cr r 0\ FL0 0X0 0p0c00 S8 R `V ( R# `V ȀϠ ˌ1P AU@ @A00c00S5 R `V Z30 #N Ѝq`-00rXLLLxLV q|V ,K KJdJU U T IS IHHV |KH-`@Q pP*  P P:P   P PPoPk @U?qPPTh PPP PP PQPP_ 0zSp1P{ UTC/@-hP X@P˄@@oT@x lO O @-hP X@P@@oT@ N N 0H-P X@P  P P놄@P00H-@P{P00 O-MРP) @P PZ Q(  P R "PZ0`b  0~ i 0&'b\B@ p4 P (~pP  PZP ``aP``Z```V RBa P  PR /+m FY /+ ( D D1Q0!?0!a 9!0)~`1@ &'0 0p0 P  p !P RЃp PPP .0"@0pZp SpЍ 1p pY`CL HAA-(qP@pP P ````P P @PP@ ox 0PT Pl-P `@P 괥 @I I J l1@|ȓDJ p@-P@P F`PB@``\PoW@ 0@V p(pT l>H H HI p@-`@P<k0@@ 0 P(pH /?0H-8P@P P /T(0>p@-@PPP ;P%`P ,P+`` 0 P(pP `4P  @>G .ؑ̑TG .>H-pT@P`@PP 0 P /T(,G -T=hH-P@`P` PpP X`pp 0h P t/T(,P p4P p <|F -XLď\F -<p@-PP F@PB@P` @oZx  R l0 ``}TT  0dP`T0pT D HE $E +pL;D @-@P < 00V$$  0@<LD @+:@-@Q  R 8009$$  0@D *d@:P 0H-PP 0@,   00HC \*9O-MLpW0U PP  ( 0/ @/P `(p> 0t @/`P (p/ Y.JZ' Q⢀PTB$嚟P>.P@0S0`Va`` `V 0` 0Pp@`\p0Pߍ*\Z$`m@㚟FL/  PS 0 V 0 0PX V P/P1o$PP  0 @/P/ 0 @/P  o0$Pm@㚟b/FL `Tp,`(pTp@`-00 l P K-0M.P$`lh   (P$`$DD  0  RJ0Ѝ? & 50H- X\ @LA@RPp  R/#0# r0ȢT0pC-@PP `P`@P%`PoP "X *Q ЀA B0T 0p@T_V dp脙 3> x> = H- R` 0B `Pp^p C0S@0@/_!`!PuTJ;T &p%S00S^G-H`pP 0@pP p@0P,P! Q` A ؀@`R ` AQ@p ?o$P$`vWJT`@ `X`(P)``Q`Q``R@ꤗ < 1D< ; O-MFM<0P 0` pP*aL:Pp /P{PP  v{P P% /P?/P A/ .P P `.P`.P0.PP./UV0S/SP ߍFۍ=(/R ,k` ?P˟ ==P Frp)`TVJ/P@1+ݲ,P@L1 oF nF ,p  mF  H-,$G'y08up W4mxtq`hdzt{vrw0e no04rspu|@Hfp$1pg` ipĆ ($jpTP kpp$!U2S(PT[RJ [P^NJ}^LQJJ QHRFJ RD\BJ \@@D  $"4@@ )"@p  ,@W2@IOoB $P@ >K :@ (PL Y~:HD@T T\ \^@ 0g0@ $ @L 0! P @^<  YPr `p dXP|_ `p$( XT`PxpU($p`'\|!PH pTp L Dqa V  X H @ @B @ [L0D@0HppW okp 0S [ʦ$[0 pPX`rP P p PW C0[ p0PW `P`p/+00 R\p`  Pb4  `pRH 8Q Y0p< PQ@Q T80pˏ Q@QP$( 84@ 0XDPS($P0%p PP0PP H4u ^<  0D@8 V RP  BP  LAP P ,0pq P T 0S,pS01 00P \ 0SS0PJ@e}Z Z@ QP PA QLQ@@L 1 DP L P7@H@Y.D㉡ PXH@` PxP PXPeh@TpL oH@P@TqLH@ P >>,@0p0pS0@P  Q>͠X 0Ȍ@! @p`ok@@P0S% A`P@r@V Ѐ`FpG UL  rpPo/$@$ RJP!p  R }PH`VLp @1  @`VPLP h {hȉ O-tMP@Q <Q ` R >R `0 A R+A"Q#:Q`@FpQpP ϠˌT' pQ@p!0@^p*h:@P@ P 0QX P0 p p0!p@㰑g @Q <Q< *  R >R-  p aK nPPpY @  n P 0 A R+A"Q#:Q @IQs400@Q ,Q;QepAl dR;P,P_X@PY ,QVD0PP PM  p@ld0 lğ @@L0 ,P(p dN"d@Ao R H$  /_+p+PUJ(p,P0W@000S@@00$0l@PptЍ$@ ,P(p0F0@ lll# `Q`#`3PL80/+0+PJj0Q@00 aTp @ X @D "2!!a"R2a  3Qpl"40P F-) p࠳ pRH QE 0<QmQ$08?+pP+0SJ(0Q@ ,0 PP{p,0p 1$P8_+0+0S(0 JP@,P ?; ,P40@@pR< a$800+ +QJ$pW80j 0P   @pGP š{Q)\P ף(\a@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s (z%zT@^ l @- MR JRR@@00 C Rln ̌! 0 B Rk00@C T:Rb@S 00 C RZ ! 0 B RW00@C T:RN @.RU00 C R@ ! 0 BRA00@C T:R8  P@.R?00 C R* ! 0 BR,00@C T:0 B@ R, 00 C Rn ̌! 0 B R00@C T:r  /R@/yyyT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$I O-$MR"X *0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0sƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0rp%P0 G`r."D㐲(97 @AP{p { oc 0r`.0r [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0]'@Q.0]@Pzp z Oc 0dr@.0^r@P[p{}d 0]%`Q.0] & (J/0 !# F[ BQA! A@ `p{ d 0](PA.0]wT$Ѝ{p(_d 0]PE.0]p @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųĶвH-F4cs cH-88 aP  Hȱl LO-M0,0 04 0$0 ppQ0 qR?"c@qGw@T0g003`Vg pp(p3`ȷ嘧 |gt7&s'p7v'Pl7 `%  p"1'?Xw&BnpVLw^No\ [ \ [ p@-@P Pe`ff&p 0 0;0oe@-R@ Xp@-@PQ; 0QQ 0dP p p @QcQp 00 B Pu`Q  VbQpp 0 0<nqdp@-P@`e( 0@epY O-MMȯ` @X0 [ 0Q̻pP cP 9p` \  PhAP< ~[ Bp$v v堖Odv`v\v4ohvBύƍ, D0p&6Hg 0pƍˠƍxƍp`PJg_bP`X@ h@ BlcBd8 4,(pg\0p0``0@帐D$@@DP[U%UT, p`V J dBQ :X P `P  /? 0nPg00pU KߠӠdH`@ Pt P *P@0P@0D P:$T6t @ZP*8lHPTlx$htTTlxT0<( H @*T 0D P Qd @ 0D Q:d vPr >@n0@ PytQPS\0@XP @0@ Q!P0@ Q:$P7Qpl$ p ` p `00pQ@ 6+@/@,@) @@@ʌ@! @ @ˌ@ˌ@Q `  \\P ̅0@`  ` zj@@0 A R1@0 A R:0 $QR pl$ Pl p 0R d@R `P`P P`Pd@`PPpl$ @? 0p`P / aTX0Ppppx0Q@p0T ` dp`P`Cd`pd`pDV`V`CPT `  0P'PU6 DȀ@pP 6PD1 H4d`I     P P @p  Pn `n k   7  QD `D/ d   * ~ Q: `:n`' @3P `    P `P ` dPT P `o` 5  O  K P `BtlP{ `{DP P `Ts @ELpP@ XBP|P `Q dP  _ 0gPo  PR@ Aq4Dd P \6PDX WPT`P-`0u` DNPC/`T  P @GPd@4 uTAd@ : UE+e- P jP cPQA110@000 B0 0P]B@@  _0Q`TPL pPX@H`dAUppp@\H`dP U@P U~XL\PEX@ RX\L PLm UjLXiX EQ 00d@ T Ap@LXDP, @PH`@7  P `@1  P `@+  P `Q `QQ `QP `QP `LXLXpD?P `p#oxP`ʌ Q00BB/op. p0@``LXBP@Pka@T- u{ڀUBj`00PB/`@Qz:d`PtP `PUP `P NP `XP8P `P `P `PPP(P `P q`-Pu`B_@Jj0 0`PpF PA @BO`5j0 0p0 0P `P `P `PP ```,`VD`H`dP: UP J F^T0P:tT d0 P p Q R R R0%"0.!R!U0@P@*  08@R"8@S p 0\8@@ p @TЋ8@R8@0Q \ `\P 8z T@8P@p@eWY`Pd@`@LX H`0 TQRZ <J`JT儀VP V?0P0 <:hpP Q hZP  G Wp/ P :hP gQ hZP0 u/? 0g00pz!n A0  @PTS@0Rv 0rqPp8@  0@N!@ E0 k%\ X pT 0 R@ U: 0P`pXc! F00p0d^ X0T0S X  0V0 P X@ g 0S@X@pP ``` ``gfff/? 0AgQMg0P.    Q :hQ P h ZPg0/? 0g0PgP     0 Q  :hQ_ Ph hYPb XbhVpP VpPp ;:pXN QX YPpg0P G Wph/ P :X gQ YP0 O/? 0f0p!/? 0fPg0X h/? 0yf0Qg DR^R PpPp =:pX= QG BYPg0? ,R D T@/ P :X gQ "YP0 /? 0%f0pXX/X? 0f0QgT P Q:0pX0 P#P@ dP0pU5T2P 0  S 0*@0pPED4P @H T @T VQO:hQ; PD hXP> mP 0P(00 BS0:X gNP- X0P00& F@#/0  S 0:X dPQ oX0P00 )@dP04P SA   :X gNQ MX 0P  @ 04EPFP?R0000?:X gNQ7 (X0P002 @E UP R  :X gNQ  X0 P  /? 0e000@,S:X6 P0000gT ( S :X Q W P  {/? 0d0P/? 0dP/? 0dg/? 0dtt/t? 0d./?& 0di/? 0dPg0 JRQRppPp =:hPl 0pQ: hOWPg02 D T@. P :hP gQ h0WP0 pp.p> 03d00pgPX P\P LQ@@PQ  LPXpPE\ pGXpWPp@@UpXPpLPP\p pGR :hP Q hVPg 0h WG -= 0c0Qg PP\ppHWpWR:hP Q hVP `p ` `,`< 0cQg 0\@PP | pRp s:hP= QG hnV P -g0cG Wp  R  :hP gQ hNV0 P  + ; 0Qc0kF *: 0Cc0Q g"P0pPP\TdPhP]=E(  0%B/Q0  :X! P* UP$ "\ \)\9 0cr )9 0b0 )9 0bPg0h (8 0bQ g0s'0PD4P @@T@TQ:Xs P} UPXg0u@sqcs70 GiC1CKBD T)@ R  :X gQ mU0 P % 88'87 0pb0 0wpRp:X 0pP CUPg0pg| sA;]A&6 0 P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:iPI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@㦣4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0b]gfffK-M@`V`PT p]p]Q Ѝ p]p]P ]@]@Ѝ PF\`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UppP `UG\ X G`GWP!"+G@Q '"00@0r pPu @Q P USPO /P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  K\`ܦɦ"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLNP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQk]P (@ W,p{J @v @1`t8W (@TZ T  J@DK Q(@R P 8.P @848@8m@P P Q_P 8p<0pSD0`'4p  S4@0PWP o  pPQ ` `  `PP:@ (@@` @Pj VV b(@P  @Q+P8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y P! $(P*< 8P <p_ 8P ( P#P6 Tne(`Ph@8r T@0W@ PЍЍ[[ 0PJ @8 ,pP` @P`@8p0PPDPPV   8(@`FP  {8 (P @P   k( P`W`P @! L(P 8@Pz@9LP pD4$PQ D @ @ 8P @0P< Y BoD [JR $P PPRm4P f YXPD6  P: P  8PV Z.  PZ(! 8P @ (pH@ `P`40 (P ,pP@ 8LP 8(P4/0(,pi,p@T@D0P f`,p0(`4P: Y8 'P 8(P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1D8 ,p0(PD D  X x ,  H-MP`@XpVUjPPP Q:RP PXpЍXPTPR ":S S/$/ /0H-@PP:P QP]PP@0H-P`@pR:pPpFP p@Q   R@U0 12 xO- MP QepB`  @ R T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PwP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-IA-RM(P@FVD@,  (  `㑊H  0> $` `````VV$H-롌H-p@-`@P PV P PVP⭖`P  Ip 0 0?@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!< U!0@PP4U28<Q0  P p_ P$$ 4&U @Q l0q0pS*`v 4pl8|PhUXPQ lUPljP  eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U pN  `1\0 @`\0X 0Q @0 !R8<Q=l! RH@PPH~ x 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!a< X |lPA|4pQ b.PPh X`Q pQAH ]NHV f1lP.l`X<  BQ| R`P XhPQ pQAH -NHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R Bꨅ O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ NN"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-mtK-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! @P O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝ O-MD@ =T `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  K"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp kJX h 2 @=@ ` v @ R 2K"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q zJ"P@!@ ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁN-I0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@0hH-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P  TQU  t$PU P xxPtPEQLUPP $ݞ pta a м P 0H-P @!P:0HsdPPQ TH0!S A ,0H贞 ! A0蠻 ` 0 H-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! ;!P : 7!P: Q& >0!S  2PPQ )0`!S `d! P$! @ ̹ X T $ P13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@5GZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP qqpWHPa pqpP W똡 猁PP$ fPG pT !P:Q 51 0RA *  A@[ p`WP pW3P pPP HPQP LPЍd $ h8 Ե L K-` rW WPF  V:RUPFF 1` fP@VPPR5Q:UPR:LY! !P: WlPPQ \磜P0!S 4痜$! (  p 0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-M@Pp U mE@H((!(1 0ECP3 ` @xP3JpQ Q& [zp%   P1P @`  lhP`  \00@$ 0( ,@%E"EOЍ,G^G x L y0H-@P %:@PPP:0 0 0=ZCEJm@-@P @P@ 0 0I=C>EnEp@-`PPE aP rP wP9,/ < 0e@CT0APx5 S +S4 ; pDp 0 0>B$DUDZDp@-@P; P3 9 0P QQ 7P Q 1/pPӼ 孉0P @ P 0堉0`aa9 ``p?D p 0 08B?CqCm@-@P 0QQA  0 0;xBB$C0H-@Pa P=1P HC @H0P @ P =0<PPP 80 6P%P7 PPǙG™!$P  5/PP0 @ P0 0 0JBhAAب D @-@P P@?6 0 0;A@4AH-M0 xCЍ0\ \ \P NЍ4 %eЍ Ѝ6@  //O-OM`PBC<PwpXP3 @VQ   xP &CP"CPCV 0 p x|Z zҰ pDp4,  0P8P0  BV wP P > X P 6 Q P4P PQ *Q Q4@>P3  P0!! P$00oP0 p|@P73(, 0<0 R5PX Q! V0 XA/Q v12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0>BP-;BP3Q&@P"l ! 2/@P(pSP !D 0@0!NPuu BBP@UBP Oߍ4$$彁P  p`0 P  p`0P @AP9APa  ;T0A-@PP UQ `pڄP U  &1!!UAPAPH-4!@9 P APPP @P  @!ֆP U}APQ NoppWP p uṆU dAPP/0H-@Pᧆ0@-@R * 0 0@^DAAA,H-Q p2A@-@S )A,  0@6@-@ A,  S 0@AO-M@S`p $PPJW $(XPv Z WW)(Q;$ ($($[  0`PU  P([([$g(p (X!1 0? R(Z (Q 0*P  (Q P$ $!1 0>u@,Ѝ(p pQ   0pp0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/㔔p APP`P@U 8Q 0,`jP ލ>O>,ލa1O-MP@ ! `2/,( 0<V`Q0 0b P{  尀@X_:@ `YVZ :FW wP,Z 0 p)mP!y@jmP3   0!P  `@㲀V `Y ) Q] QA0 ]m P;@ @P Og R  Ѝ e P 7g P  e P(@Y TP ( B  ($ @$=O-Mp`@ S [9p P`W  $80p` " (12/ Q, P  ` F P,  <O@T "p {p@Ѝ$p( 2q"k,<<P`< ` +P ` +P pP ; 0- {XX X0* 0:aFb1 <   ؍  ̍ \ D j)%%%̋ 0H-@Q P-P 0_<0A-M@`pQ P,PW J<PЍ P ` P r 0!P!@ ,P ,G- Q|  D Ƞ " @!D!Ƞ! #@#h#L0"8 "$ ! @ @BT 0 `* rQ~ QP P Q"40A Q0Pp` @p`P @  0@ p`@Ppp``P`p `0p P0p` P 0  0 0 @0 0   00  0 0 @  0P. P) Q"4 0A0Q `@P``0p@P`p0 0 P p ` 0 0@ p ` P 0@ 0 0b9?   G- QW @@T* rQ~ QP  QP"4 0A QP "x"4pp00`@"`@ @P p`Ppp```p `0p @0p` @ 0  0 0 P0 0   00  0 @0 P @  0P.  QP"4 0A% 0Q 0`00P@pP@`p 0 P p ` 0 0@ p ` P 0@ t h \" p!t`!h! P#Tp#x`#l0"8 "$  0P p ` 0 0b8 p@-P@Q `*`'`p" *p P q P jP ca][m`P`pp@-MP@Q `*`T 9Ѝp "    *P @ !pb1   `! k**P Ѝp  Ѝpb1@-Rq0 @8@-@ / ?!BC4 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW# Pp !;@a @V p0oW  q pYpo@`W@@T 00 0  `pW; p`W:B2|pP- +|P$ TDY ā o2   dPppYp3~Ѝ` 0ppdP0S  @!4@qWF 0 Q  ![( @p@ v Q0S0`S 0pqdP@ @  R `@@ @0 06,(( (0 067ms`OH- 0A1Π\1>-1!!K-M`qWWЍ@P }ppW R T T  0dP U P M7~}ЍЍ 00 !     /p@-`k@p PV mp p8`k7`pA-CMLaP@`,lQ$!1,P00 P P:7?-$  Mk,Pp ,lp  jkp T lp  3k 7@ ,k]k7@P,PCލp|w 3 O-DM p` @@Q P/(P XXw P0S@PP%{7X(P r7@ QDЍ5 ;p ,00 ( 040 P(p0S &p $0 8 8 <0 P `PX  U'P 1 0@p7 0cPE  @'P0 0! ⰱ BRᴰ&:QQ @P*p P :PJ   '~䱄 P[   '4  ' Pi 0XP  o']P    !   BR *0  0 ^ |P @S@P0n*pS*@ 0! A 0 q! P ( PQP"!娱P P PR  P@U8*pQ!  & X    P] 㰰o a 0 0b4 0 0 0b4 ,, ,0 0b4 v S   p ,s lr   q    O-M`PQ @&@ U U =P P p0  P  P@@T *pU*  P 00'07b 0/4P@X)*qEoR@P  P 0  p @PP@@T*   :&UXX&X6b 03<<&<6b 03  Pd  P PQq5(k5Ѝ |%P `P@U=*8EP @ % @P `QA % W%D`P 1  ApP@U*  lP  %X  P@U*   %o"%, P%Ue ZO 2! %P~ `pZ@@T*pP y%뼡Zll#l3b 023Z Y㴀 pIx !01   O% $P? `W pG =% $P- `QOu P `@QZ?  %qWD  2! $P `WP  %qW @Y㴀  #!1b 02x p$ `$P `P@U*奀Yⴀp $  J$`P 0 0b2  cPtt t0 0bw2hh h0 0bn2_ / 5  K Q  # ) SY ;A/5OUO-M(p Q R QR @P  p   p  p E `P@L @Q01`@X*   @R 0 A(@ Q R QAˁЍ ( EWT Z J  P[ @@T*p P  Pi ZK @@T*p PQ Pq#P2 @ QPP  #W㰡  갡    0P((O   0ᰡ P Ѝ(()Q /#P @ @P@U<* ?P  #(( ( ( #  0 0bF14dd d0 0b=1aXX X0 0b41l(( (0 0b+17kq#)GM[O- MPp,ATw  2! "P T`@ p@ @Y* PP. yPdP ^!1b 00 p@[  AR 0 1   ".@Z+*  0@S000B @ "P "p pPpPp Ѝ,, ,0 0b|03gmp@-P@Q ""P    "Q `"P    "ppp@-M@P  0PЍ 0 0540iO-MM`p@PV TUP WJ PJ P1? F @Y:@/"P 1hP ЍۍV @,XP>JIY*F  @;{YFG    U -dp JT$ PfpDT1P P p尀8? $P P0PpP1fP* P+1 /P HXf/P   P 1{y<< <0 0Xm/H1@oᠲjG^ &M04] @-R@QPTP#A-M`|-@(ptplhh  #@ HPT P T |PЍ$ Y$[  H-(MQ@PDfPU `P% t @p!0    PP} Q p T(Ѝ fP' `#+`0 : p  `RepGe`ቆVeP  `$`/`P D4O-M⤑$ Q"`Hp  #  #@ V8  V-൅)]`Hp  " <<<<@ V V `   PЍ$$ $$ wxX D 0 8 O-TMAPE[ B*Cp`? "TP CYL? PQ[Y*[   ~ pp"@Z*p@Z:`@dp   jVp`p@`@P:Y p  [ c"A @ @ s PPTЍ8 0 0-Y 0 0-dd d0 0f-[:HH H0 0-V  |X,U O-|M@xd+yP(`h  tplh "@ Hp W:U d U *Lx P|Ѝ$ dT ( S p@-(M|` P`$9 @T L T $P(Ѝp $ vTS t 4 O-AM  Q0p(P$0 Lp Pp 0H(H{(Hⰰ  r  z! \\\\@  2 0 {p,  P)H( " Q H (PH`b h e  I! ] Pp (PAߍ-R P A-(MⰀP@q$ p `lV | V $P(ЍDD D0 0, $  P  ` O-M P@  `,`(`$` ````` ````T PQ0F?v`QLb4HHRL`(("0 0`2r  HDP,($ p@    ,($   @   ,($ p@  , h P:ZPD   F J P  @P@evPfd`PЍ*, O 8` 8M @-@@ $ @B    H-@P~`{p$ * #q(HbO-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.g@P@@D ?T @T :0@P@@D ?TT ( H- K-@P6 `P? q<W (7W (7g)7 ( ?W (?'  8@D((P ( 2/ PhP @-0 @(@ $@/\H-\H- P @-8@ @P@DHL@/[O-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P O-P U  @A,P  5/@PX !P @ ЍDD D0 0G Y(( (0 0H nnEpnnnp@-P$ @`) PU5 P`AV ,0 3/PP`VDQ 1/`|@@lcp$PfcpP ^ ``@`p pp@-@P& PUpP`@V ,0 3/PP`VDQ p@/@pp 0 0Z ll @- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0R/q Q/ R0/@-@P5 P 0 P @0P Q0 $0 P   a 0 0< ]ii} O-Mtc@T` P 0APJ p @oᡒW  PLp(P{TPQxPM"p0 @㦙PzJPPq FA/QV PPPPP<PPPPPPPPHPPPPPPPPPPPPPPPPPPPPP<PPPPPPPPHPrKP9 ux!  GڀpYP PQPp*  6  ^PP P U C   PЍ/DD D0 0| 0DD D0 0 X -f`f  ihl , f:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /e@- 0@QP / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-pP@Q`T W   Q 0 0M4NGNs R US  R/ /p@-P`@R Q U T  Qp 0 0dMM2 S#%U#/!R  Q0///-R/p@-Md`@ Px`6666PЍp 0H-MMdd@ddPRP  @P#  @@p 5 떝LvLLH-0 G-M pPdpKXBX`@`GPA`` AB+Q8 `````R000!01U0P0 PP0  0  0 Pp$ 4 @- 40 0.OTPލa E E KJbJJPD yLD dyC 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   4`QP  Q 1/W  3N5T @-0M@ $(,D?P:\ D   1, 6PC0Ѝ8@-0M@, $(D?P:5  0 PC0Ѝ@-@A5@A5/ H-M00 00<5Ѝ蔗 MH-M 0 00ЍHЍ/P / P H-@-D@@4@@p g@訓//////> //O-4M@PqPpS@&qPi #qԡԱ!1aސ  0`Q*@T At @ T@(!(0 @PQ  0S0 0@ 0R:96,($   (4/4Ѝ$$ $0 0CQCcCDDD1DCd\T///O-M`{@Pp`Q T U v p`PUP %P T4 0ppxZP l($8LX8HXd*XS 0H Q 0H Q: P Q 0A0@ Q: 0{wytio0m i@ea`plQP0 00p`Q M I E/BX ` y  m p`w I ǟ Q`c   p'  | `t  h 0`Ɵ 0x`QR `<JpcP p@ W pW  K 0`k8Ɵ Y  M `V <@pp9p00?o#0Q -0CpEppʀ%5V 0 @z0`&  @z0` @z`0000rRQ P P- PWp  * &2&b @S0 p9p . 10a@S `9 0Q00 p Z:p0   0! J0  Gc z `: p 00apG R  p 0 p ps 0  Y+ I 0 00P` T4`FVZ ` T04 T4 00Z` T*``` RP T04 BR  BR T04 BR 0W T 4 4pWp P T4@Pʃ ~@| z`tp``v0 TKppxx x0 0UH\\ \0 0v@^TPЍ L +8c8m88;8!\=G=]@\:x A-@P PX P`ppGX`WڼP 4/P 0 0:h777 K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0bQJ`PUcc XP  =P $QЍۍH눆 O-MMTa@ PU`p Q RЍۍ/ ' 2 ' 2- qpqpQ'`0HX'  0MbPJ`PU4c1c   0 `oP`` ``p < , O-MM⤏`Pxt  R PP Pd `a || Xp0  0 U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG ̌P? p. J./̌P2JP P  Q%Q Q QQ  QX M̌P  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;YP4 X0?\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0㬢P ]P[``s @G0 / i\ 0pP,PHX`a8P ᇿ`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|y,P PuJh&0],P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 hX0Y  Le! Z-p`  ,PJ`  X0wX P 0oO+@P ~ FPD``儍h &F0 dd- 2`\T\`'LF"P ``8 F0 - .` X \L($!  X0L P`` E0 PP, ` \hYJ \\PP  P t$P``刋h E0 hh+ k`\h x " XPh 0 0Y 1  6 \LhP% hZPP4  `  XP 00ZY P  `P \`L  L v\L X0 ^ L\`P 4PY @P8PcxtX$HTPPP@2d p $|X66PPgP5J. |J| 2,PJPP PPP P(@ P x PJ m  +Pu> e*WpPQT@pt^J^ : X2d  *PPp@DhP`q *PmPA hw^ Y`@ l <  @X0hPq R:q )PPA  ,T hI q  R,#J)PڴA Xh1 `a   XP0@h0Y $Pp` C0 xx$ UP| $ $@\`p`!! QX0 `a  p X0 R { ` "\ R   w qW )P6t xl0p00 07/PU qPEP P ] $@SP $Pp` C0 # Yp @ RP笂h`X-$Pp` sC0 PP" +@Pd ` wPup` ZC0 ! !fp$b$_  0 /-m`QP X ($D@Y$@|htQP=H  RH Z \$@PLP *<'P#p$ <@U @=P`` BXX 0  ࿃`< &QߍۍÝCk s  o n  t Xr G!m Hq f wMl m x ((v && z )QP'w x ('WC(x v({ >+z *4w 'u u v lv {&4v z *%p w $|o G-8MMp`P4@, X0  ;3 hP 3+)L3 /qBPH30 5z@4P8Ѝۍ>hj =@j / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ (P P)p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp   T 0ὁ  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 , ][ P$Ѝۍ.PȐ А 0!(/<  | 0t#x s0/?r s0wpp6PPP`2`g e \e te 2e O-4MMp0`` [ R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^ʗ=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ 5ZP0P4ЍۍpPPP "Z Z<P0$ R d ` H` <` Pa O- MMAp`@ &P P Ѝۍʚ4P $ǀP `d+0r@PQ1 P@Q$ `E84P  @Q ER @ R``PK  II` `5_ V_ p_ K-AM(@0P `p  V  0V ` ` 06 P PqYP 0@.Pl  ` p`84 0 $QAލ)8^ RO-TM`刀xp A J P   0>@X YPPPPp W@/P WB WmYk `PP I0 P"XP`JPxpYz`YW|PPL A QI A0XPBJ@ XXpXX P @"` I Q'x p ppXzXXvX@PLV | PpL   @ETЍ$\ A-P`@p p@ Q)``X XpX``PiXP{X qE  A- Pp@` }` A0Rp RQ$NXKX` (P`EV:44 40= 0Gv6XE    O-MMDP  X aU  /  " `@@ lVA@lF5 p@@@/P PpBA4̟4`0 … `,(@ Wd d  PQ `` UG\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 ?~P `v+0=P , \8H` @0($$+0=P #P;P  P&  PO  Px  P  P P P,h)   P PX,p P.  P PX,p P (88888888(888888888888888888888 P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@P( 0@ P h( P  Y;Y yQJ@ @P @ ᘥ 08Px  1P,q@ l0 P0h1P P v @H$  50{ @ <0PI X PA hE_DP& 4 { PA VE _P `D Q 0 Q Q0S 0Q 8PP:4V Q Q QB4G< ,R @P (0n< R(P2e(P<DP(P'(0P x|8dd  P!|ݨ@|h"p 0rapφA"xb"|3x#%5v 0UUUP P`P v㔖Pv.P ,E4P1 `pHpPP a .PpRW :P@.PPV*GWp DQ PH@PzQP   &Qߍۍarpaip6.int$X   4KlAO M 6Q @P 8Q O segSFkK-䁙PJ]  `Q vP@PU*p H AX xp C!Tx: |p 6 1P 10H-MA V!4PTPP!Ѝ0Gp@-pM|``lQ  @-@P N/ O-QMP@P pW xP P`r)P  , P$(`#X:zP(`U#Xt* P P;Px tP PP `tP PX $ P$8  P U:$` G E Z #P P ` V:  3 F ZHPQx* Ru ,(`PE$ P$#X:ᡤ @ᙤ @_ᓤX`   0W G:1pGWB:`GPpR; `FQpPXT V(: PP FP B`Y:  IPP .Qߍ(> . @Qߍ @-@@ @0 0|(( (0 0G{-#wƵ p@-M`@P. P   LwP ` :P 9PЍp Ѝp Ѝp 0 0K O-M||x|| p@T ,X@@0(@|Ta TudDPdpHHHHD$D885T pU U X`VDQL PQ Q4' !R6 (Pn PPm pAhV@F5 T&2 /oAo"VT`F`A@DfHy V*P U*'D<P0WpE  XPE& 0585,%!~%Q t dTH@8P DR(T섟pʲt@Pp$o0S !<34010StpaVqtq X(:`P 'Pq Qူ1Ȱ@ a*P PH@A u*P ! B гR @@s娃pQ  ',Qq  Rၰ1P/ 'Pq.*Qpp1%Ȱ <*Pz DAPa`3*Pq ! B @@r@Q p@@`^p *PS @ E@ Q0 *PI ! Bp  ddqd pXA@P8P,P@-ЍP 'PqnjQ`1`Qp &P @@)P A` PpPp$ЍЍ\{4#$$77(77/.. 6Ѓ8$1///܀//56l5`5\10x0|0|0T5(\66 <5 4d0$4$443333p3T6\3 3222̀\܆4211`1d1H-MPPL \TaT`@ P@DQ 08qP% 1qP P p'qP pW:PeTpЍ  !  03Ѝdd d  0 0/ -X. a A:1 W$-- O-M Q = R  LP @ P XQ , P  , 0||p0t|p0d, PPPP|P p 8\P0  (  :R 0`B6V  `0`P``R ` ;R`ۧ0r0vP@v0@PK@ `|; D0 h+Q ` H+ @@k` 8Q (Q + 0 S ;000Q @P) ˟ ;0[P,P *   ,j`VhVPhZP(P 0  0 R0,P  `P`FP  EPPP3 R@ 'P) F` ` P  UZ#P$ `@ :p P ) @U@pH P t p @T@.XT) `  890Er@$ T@+ 4sPv P  80"r@T@ Zhs`PH@|8 T0pXP@V  @, H@@8 04XP,H@ `V@ S'  P  D 0য়  R`P @P"PP @4P\@DDLT`hpxhR RT& @UP@y* @ R P` 0AS006P |PQ `;Q`ۧq@vPv0T @ 5  R00/䤟  R& 0`AS006V ``P``Q `;Q`ۧ0q0vP@v0@PP A6P 0Q p 0 P :RSEC@\$  L4P0<^ ( `V ``B6P @R P ;RPۧr0u@u`S PsPm,2 0$ Z><AЍ753矋P) @P P p匁 p`V *PDЍЍ @BЍPI0 Ѝ\d4,8,,,++ . ++- ++t+|+x+h+l+\+ 8z +*u**H*D*0**)< )) P ! d" 0!    lu)`)T)\))<))X#0#,#`"#"",{T"D"z !!(h($(M''''\'P'$|@&(& {U$''&&{&&&|&P&p&y&&%z%%%H%\%@zP%%X$L$\$($$$!!HvH!8!y##(|-f0H-P @@ D R08P+%P  !      P0N!@P000 0 00$p(A-0`/!PD @ `)!P= P`P]p`P,PQ!0` P0P``0P0P  P( `P&p(P\4/O-MP稱q娡娑威 p P AT `Mx@hdA`T  , PQ!0 00 @P(P P$ |x  `1P0PP0Ѝtx8<8xD8H- Eo*l @-@P !R' R  00 !0!000T \hA0`  00LL @  <@xlXHH P/@-@\P PQ@  P %@%QpdLw%H-P)   0  , 0xQp  !R`!X0 P 00<< 0 T`P/@-@=  R  1S 001l000dA0\00HH @ @@/dH-PPU+ ``AT& pqP $$Vq Fl  Q X 0Pp p00< O-MpPP$ Q *QPN  R Q  ꀠQ @ `Q< P 0sPP/ pQ: Q pPf PQ: 0  RA  0PQ< V7pH | R>@p qRBApֽ 0@ 0 @T;sFᴠ 8 Q8 (4@ⳜpP ЍOHЍ 0q 0 `` `0u 0 << <0} 00Ig7LO-M4PP34 $ 0`2S D @  A2s2U$ @Z @H XZ允` PY 8P` P P @P 0, `PP@`P Y  0!Y $0?=2Qa0s `Qڻ` p`R pR  ?=2 q@"! $p @h# P$ TDp aP T R @C P+0<R !0D0 C P \ W=1 \`0/-"1p@@ ` 0tכP ` pᰠ  PᲐYH 㱀I`@ Ѝ P) `K @- %,D  1X8aZ  D B`` :`(( (0 0Dꑦy֣ݣG-MP p|Ppx@(Q `P`@P n`S <V  @< Y @ / 0aa03! Q`S!Q  `*`p9 P P O1,P `P& ` V" P!$!8!| 0p@`P  +Q  PQ"4 0@Ѝ `PPP P06 0 0 0 nݠZaz}O-MM8R`@PLp P@{pm P, 88P U Q QP   P"4"x"\ 0pP  PQ/ @QPY <Z p -@< pW  @  / 0aq03! QpS!Q  p6)qQ O QЍ؍g|@ G-` UP  JpAP  A  !㴌8qK-MPQ ,@$ p@P $p7`A8PP$ P 0,lPP /-"1pЍK  0W 0땜EMO-M`@v yڰ@p@W*Vs w V p@wIqpPpwA@ATE*p@ P `V)@ಠZ  Q R@pP p@wDp PP B  App@W * V"2y 0"2 0Pp@W*Y^ w@Y ` @ Y @ t Pp@w濹qpPpwAAX!* Zpᲀ  ,PP& Pp@W *tPYHH!H1 0,,!,1 0ЍЍp 0 0b`|| |0 0e~`` `0 0ktVtXX X0 0irHQ D՗D!̙wOaK-@P`pPV% W Q! Qp  RpQ R  P0 S`U Gp Q: P00 ,P  BABX*q PV㲀 UU 8@8(( (0 0 wO-Mp (R B@pP U `" `ተP %P$ 0P p 0 P<@@`FpP UV P ЍЍЍp@- @P0P`㶗 P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0P቗`PbQ 0PzPV 张`Ა# 0S 0p[0G ) R-$p q(9 ᲀ᱐R 0㼠SP/  Hp 0,pp% P pQ 0p0P  (P$p q$pЍO-M`p @ Q P@Q'PP@P P> [+ (P  P0P . P$ $ 0PܖP   0PP@P P  z+ Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P L @P. 0  0P% 0Px@P 0 0P P   @@ ЍO-M@P 0 `p  @<ݏp P08pP  RQ 0S R Q Q  0PTpPOY 0@00``VI0s0 `08v@ 0NY` @*@岐P:฀ ᴐ@?R4*pᴐᲠ `P pḀ<`QpЍ 0f 0 0 0hh h0} 0tHH H0 0ixHыA-MP`pQ @ㇿ@!P VY,\\,\\\/H!R*SPD  0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍB=P " @@W 0"P ! G 0P Ѝ V Vp$p   0EЍO-$M\BP@p wQ p  p  U U  P 3 k`PW @pU Up `L P  pJ   PA w`Q*  0p蝡 A`P@.`)p@W2*pV*@ (1 C 0q @ "   b`h@@ P$Ѝv  T$$ $0 0bdpjjH-4QPv d8H-<Q $Pv u H-tQ\P PP  R 4  sH꜋u XD/O-MMll10 RIN``PY 0 @0 hp, `Z):ԐĀ`p @0ppST@``![*tP P XL P <00PЍۍu뫪<--A-0S  ppp2  P@`p@`p@ R *PU U訣T@-M @~"p"V"Ѝ4@-MlP ЍXX@  @ 0 p P Ѝh8@/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/}*/z*/cw*/2t*/q*/n*/9k*/h*/e*/8b*/_*/\*/Y*/V*/ S*/P*/M*/0J*/QG*/D*/)A*/{>*/|;*/#8*/)5*/=2*//*/,*/")*/&*/#*/ */*/////^*/*/*/< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/_ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/^*/ [*/X*/U*/R*/O*/L*/p/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20260410205459Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s address%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest truncated%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist