'Vi90ΧNetBSD/earmv6hf ramdisk 089i<  9ivEct ct9i@@<@T 089i<  9ivEct ct9i@@<@TU 9ict`A9i9i9i$h 9i9i9iA9i9i9iA.9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9imDL$9i9i9i (08@HPX`hpx0$T9i9i9iPX`hpxN$ 9i9i9iK$/9i9i9i (0M$,9i9i9i8@HPX`hpxFA9i9i9iC9i9i9iA9i9i9iA9i9i9i!9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i!9i9i9i4!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i B!9i9i9i B!9i9i9i!9i9i9i"!9i9i9i"!9i9i9i"a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i!9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i?\!9i9i9i>\!9i9i9i=\!9i9i9i<\!9i9i9i;\!9i9i9i:\!9i9i9i9\!9i9i9i8\!9i9i9i?\!9i9i9i>\!9i9i9i=\!9i9i9i<\!9i9i9i;\!9i9i9i:\!9i9i9i9\!9i9i9i8\!9i9i9i:\!9i9i9i7\!9i9i9i6\!9i9i9i5\!9i9i9i4\!9i9i9i3\!9i9i9i2\!9i9i9i1\!9i9i9i0\!9i9i9i7\!9i9i9i6\!9i9i9i5\!9i9i9i4\!9i9i9i3\!9i9i9i2\!9i9i9i1\!9i9i9i0\!9i9i9i2\!9i9i9i/\!9i9i9i.\!9i9i9i-\!9i9i9i,\!9i9i9i+\!9i9i9i*\!9i9i9i)\!9i9i9i(\!9i9i9i/\!9i9i9i.\!9i9i9i-\!9i9i9i,\!9i9i9i+\!9i9i9i*\!9i9i9i)\!9i9i9i(\!9i9i9i*\!9i9i9i'\!9i9i9i&\!9i9i9i%\!9i9i9i$\!9i9i9i#\!9i9i9i"\!9i9i9i!\!9i9i9i \!9i9i9i'\!9i9i9i&\!9i9i9i%\!9i9i9i$\!9i9i9i#\!9i9i9i"\!9i9i9i!\!9i9i9i \!9i9i9i"\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i \!9i9i9i\!9i9i9i \!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i\!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i !9i9i9i!9i9i9i !9i9i9i!9i9i9i!9i9i9i$!9i9i9i4!9i9i9i!9i9i9i!9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i !9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9i!9i9i9ia9i9i9ia9i9i9i!9i9i9i!9i9i9i!9i9i9ia9i9i9i a9i9i9ia9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9i?\a9i9i9i>\a9i9i9i=\a9i9i9i<\a9i9i9i;\a9i9i9i:\a9i9i9i9\a9i9i9i8\a9i9i9i?\a9i9i9i>\a9i9i9i=\a9i9i9i<\a9i9i9i;\a9i9i9i:\a9i9i9i9\a9i9i9i8\a9i9i9i:\a9i9i9i7\a9i9i9i6\a9i9i9i5\a9i9i9i4\a9i9i9i3\a9i9i9i2\a9i9i9i1\a9i9i9i0\a9i9i9i7\a9i9i9i6\a9i9i9i5\a9i9i9i4\a9i9i9i3\a9i9i9i2\a9i9i9i1\a9i9i9i0\a9i9i9i2\a9i9i9i/\a9i9i9i.\a9i9i9i-\a9i9i9i,\a9i9i9i+\a9i9i9i*\a9i9i9i)\a9i9i9i(\a9i9i9i/\a9i9i9i.\a9i9i9i-\a9i9i9i,\a9i9i9i+\a9i9i9i*\a9i9i9i)\a9i9i9i(\a9i9i9i*\a9i9i9i'\a9i9i9i&\a9i9i9i%\a9i9i9i$\a9i9i9i#\a9i9i9i"\a9i9i9i!\a9i9i9i \a9i9i9i'\a9i9i9i&\a9i9i9i%\a9i9i9i$\a9i9i9i#\a9i9i9i"\a9i9i9i!\a9i9i9i \a9i9i9i"\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i \a9i9i9i\a9i9i9i \a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\a9i9i9i\ !9i9i9ii!9i9i9i!9i9i9i!9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9i a9i9i9ia9i9i9i a9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i!9i9i9i!9i9i9ia9i9i9ia9i9i9i!9i9i9i!9i9i9i!9i9i9i B!9i9i9i B!9i9i9i!9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9ia9i9i9i!9i9i9i!9i9i9ia9i9i9i a9i9i9ia9i9i9i a9i9i9ia9i9i9ia9i9i9i9i9i9ibpf!9i9i9i $ 9i9i9i$9i9i9i~$>9i9i9i$9i9i9i$s9i9i9i$9i9i9iA9i9i9im 9i9i9i$9i9i9i $9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9iA9i9i9i> E8cqBLW0:\Qaw)LtP2xq=*40N42=,ll Ɩn~4x _ެC1bs\`,<#P?CZymy1)\n)ssmftoUW4Z=fa*4j@rRmp*_)+J< {W4it !L|`wvʀ WTe.k9l"K1<}7k3'L&w 8Os{Z)5xlLQwibO_NJ.$SCC/=OI3kF! "XTzis8oo S]~Cir6pYGlUqp#Qei#zyenDtlT,'<xS0[%"zirBR2~L]=vYS(ѣ6uip/%or CjKLM ufZ꿼<*4Fsoɶ`ct . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4I$4 (w#w##''X LL#''Ptdw$QtdNetBSDKwGPaX NetBSDearmv6hfA-MQ t10 ㇕㟖P@@ Q  Q/R RPp`p`W*0/W:ѓ%U̓U Q`NXPX`P`U*0/U: .'l'd''t''&|'&'[p@-<@@8PPU*P`0/U:p`'<'0H-$@$P@PT*0/T:0&'A-@TpP#`/tSd \P@P\P PQ804 0 0 A/]"\ؾ(\A-|tx @lll`P7[pPPU: |P vP qU\ؾ(\"]!P@H-O-M`PKy܉I帹X b@Q            D , BP,  3 kpo`P    p taP \PDPP$PS << pPU (\P 0P(PP" p p`P` `PPp Y P  X V @`@@@P P X% DP @ X X% P3X;*z P{`pP @P` :XX^9h Pi(&s@8 P]`pP @P` XX$P`N$`pH`pP @P` !XXM ^pt `pP @P` X `XIgI `p`]MpX `pP @P` XX--pF ``@P`pPy P XX0 p+(`pP @P` XX^^np `@Y? AQ` p Qp Q X` X V@  ` `@ W  p`d\`pPUpP,^D ЍPp@LPزWpU ZP P [pPqJ ѓpj (  PsPPw}PpU] @pPpUvWpf Q`V ⧓PS ` VP ᳬQ  `  P@ p8@Y @Py@LPU p`PUqSxl`V V`h+<9!](ؾ((((((((/(ܸ((s*!^ ((^(Ae r^](]O-M`P<㴪,t,D  0僺QPd@Q) 4t444444444KPP  HP 6LP PP7 RP    XP"0Aq@-T@P V PX P pRpP0p` R p[pZp8 Q,RX`P lep  cX@P @ `>0PZP2PS]PQp`@ P0P]2pPbṪ X'P  5$ `ᨪ G`T X7Z XQ 9/P [ <`09!6^t (ܸ(/G^WW^ *""|^H-\ 0ؾ(^O-OM@Pォ4$dؤt؄ ᳼ePH@ Q'8dHpHH<oPfP* iP- lP8(pP$ rP' vP/aP#xdph@DT[8 R Q # QR QQQ 9QQV_\pDbQ +H Px V PR/U P BB RR/Q  [Pp\P!T|P TP PH ߐp  P! Tvp/UD 0 Րp    Pp `V @ P)VP:@ /R @ R@: A0`@/S `V  A9!((((_(((((((ܸ("_W_(( (H __ / (O-M` Pp].Pq @0PY 䵟ԅ Pp@P,<<<<<b  P} ZU 0` @@ P \ 0og0pPLPPZ, P/M@PWP ,0/QV/Q/P@ E0A P:`S   P Pp/Q  PPP ߏpP0 X 0`P!0#0`(%0#P Xp  P  H3:  S) Z U  PX : ZC00P%V0 UQ`     PA b?2`2P5` PSH S_p2|b Rnp[ P  P' xPS 墨  2EP   P P LP  PPpPU PP#  GPPP CP0!AQ'(PP X1  WpN/PpZP.Ѝ 06|| |0?HX| |Y X  _ (Y `_(I`#`((}`((`aa(`` `(*"A- M0 0@P ` Ѝ aO-M-MpP @ᫎ ᔍP, } P Ept @XP hPX`P P`V`U(@c +'pn  P Q4~ @ p`0 {| (  0@pp  p& ,` A`⛟xu @`P$KT4# Ȍ P `PP  A,0 $0 `    @TP P $D @PighPP $@+(@夌p|pt`{F 0(@(㌌ Zp3 A,`Scs$尀4 XZlpj P i A$D0 ,0    ~(TPPzJDPG @Pwp P(@ YPL8V p @ Q ꆍp  8P+#Y@P  oPZ Pā4@P (P d( `pU  PЍЍP TPPPP PW  P PP QPPQ8<P ``PX Q|PY@( ( (((((-aؾ(i,!( (Ab(( P\<!@  !pP0*BR P` R `Vp  `!(P 81/pSP 8(1/p0)0X118)x));eYZ!O-MLP DCDpP P g  80( @0004/ @p  PpP/ RS P`8@< \P!9# 0@#    *"; pP̑A '%$  Q` $ =  O pWPWQP p Rp0pRp r* @" " A :p  p`8 Ѝh ЍO/H,D$ $ 8)x))ud )0)dd)#"dH-MP\ p@` 8( (03/@RP RPЍ )p@-(PUp@8 03/p`81/(`pg2e@-M@(8 2/P#8  P 0( 3/P (  01/pGRP Ѝ$ 4 m8@@-M@7PЍ@蔑 wPЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-M|B p P T I0㶆<08(4,D"@@$d@Hk*L -}!,`P}$PQ@#A3(0 0S/2`r"@/@  ` |1`p!tq@`pd?K   ` ,1`,!$q@`pd+K   ` 0` p@`pdK ل /0K؃` 0!xp7 D@@ d `K ṄЍ) )HeMb-te%"{eeeO@-@LSG-MDa 6 0pWB @0Q$$8 ($0 3/PP 5 Z$ᢽ'8 ($0 3/ R!:80 B($0  @T@pGW0p@!S#( p1#7/p Ѝ$$ )x) $(eB-M`A 0P`*!s#( p1#7/p"A P`80 ($03/PP`U: 800 (0  pp3/pЍp8 x(0p 0007/p U* !P`#"P $ q8)m O-yMM`]HH0, (($0 8@HJZ  =G@-QGGOOOOG@GOGOOOOOOGOOOOOOOOOGGGOO(G GG4GOLGTG`GpGOO|GOOGL  8 (   `<P4@T nQ QoPo@o@,@pPP ,@PPげPUP @@W ,q@p@PWpP TPlP@D$D' RP4P $PEP ATp F`k:P  ԖܦpFap @  P @P@@P !dP P< 8P KP P(g$ PQ !hP T @P  P\ 0A@TUpQ Q P PCE+p=ȰF@Gp P%lP RP 0P  A뗛&  Z ,P  ApT  P@D೟pPP H@M P +:PQ PM` (pȀk{DP@DP Q HH PUT `D@4 PI(4@<0,,P< !0 8 P P$0$ 4 @ 0# @$ @P (P  ,   0$ 8@P@@P8<@ P@D HL`P `k @p[pU R$lAQ! P :pP P`U: QU R ట  U H yߍۍX1<<\9! fp) f/x)ggl)h)d)`)\)<)8)X)T)P)L)H)D)@)4)fofܸ(t) gEgI{ 'gf!fEfH-M hMؾ($jH-M@P Pp{kvIP `PU FЍdg0H-@`P Q P OIP Q$ 0p)x)O-MMpP  0P ( J  +J89P08P$0$ J @X`hp B @2: @x03 |0. @0/ W p Q GP P  P.'7g@ PP PPP = Pll' 0h0 @L7 B .@ T  ($$' `$0` C  Q&6`` ` P&PP6P  B &|f0 R0 t60S P @ P`PTT6TVLfF   @P0P,  &  0X P(@ `TRD TP.PF `pWH08[4 @`ڨqPUꌑ匡  U0,`00P4 `QD@@ 0P JP!@*J DJ 9@{J ``-lPP@))))ؾ(}j))))Ŕ"jK-p㶉P @`` Pv OCJ͗ GXP L P'p>(?P  0>;PJPpP LR /0` ``0`@@I冗 dd`=PIw (( .Ԏ)))ؾ(}jj8)L)jŔ"0H-@P@4 0  @@08)L)@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,W))$()L))H-X P 00S S P R)L9"H- ? v}@D0PPPCP P/P UpP Np tPl`P |T廵L㷵@k`D}d)) j)jjk) kjp@-@P p|P``P }`dd p8@H~0$$ 4p))ؾ(T" k))0H-@8P ^(PP }ōo))H-DD 㩪np 00 Pؾ()))@-<<Q@ @0 0AQ00))////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0EoP5PJ`PUH)7kD)@)d)p@-x@xxPx`t t0````/`Pp<p L)))))))K-Pp@Q؀ؐl  @P `QAG凕 ``X>P0)))))ؾ(Ŕ"O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPptCt" @ `P PdiCH"PP IPf H`P,P(RB  P0,00@ដPV !PPP@`Z B:x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @PCP PPPpPJhЍ PEpG堔 XpP`  0H) )))8)0)ؾ(Qkhkkk))))Ŕ"H-HL0S0 P0^)))A-P x xPl 0N^`pAT V@@pW`@V@@P@P)))A-@!PpPP <`P/Jp!PF0 @`p dPXX /L`@ qF0$, "  )ؾ(k8)T"kkO-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xPdTd 0pQ0W00 pT`R`Ѝ)L))d)8))))kkؾ(O-MBbܲP P@P6Pu U0`/pZ Z0 <3  PC $2 Q `x`F PE R R0,P0p0合P ``PQPKY  !KEՒ P00* T@Z%   00 0Q R P0@ E堒 @@8WЍ)))))ؾ(k)d)Ŕ"A-@P!P``P  9P-Jp!P 5 Dd0 Rp hP\\ |HUP DH0(, o P.R )ؾ(kT"lkO-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ))d)L)H-|p@P`T Q  @DPpNDؑ $$)ؾ(lO- MS`p@p PW%@jP Wژ吣 W0 <` EPo @L@P`} `@p Ѝ@ 6 @@PJ肟GYPG`UG P PA p[ᘂ [ ,pPm `T P`p  `0  6U4 @P, KY K@vPPZC. V@PdN MHG ` Ep[@ 8a [ P 壆 P 0QP @!hC \C xxpPED@ 9^H)))))0)ؾ(Ŕ"QkO-MQ䱟葟࡟@pP p @7Tp`@`` R R0,p006P5 pQ(A <`@ V Br *@`TЍBYh \@P0   ؾ()0)))d),)Ŕ"1l_,jP6P) P`]`Pu u+ u _6P dPP_@6PP PP01 @4 }P# 6P0 p~6P !P^ h ,Xdd o )el))ؾ(ll)/$)ܸ($ԅ()}ll )$)~ll)) 0)Qk4)8),)l()l,"H-MX @0H uP JP(%@"% P%@"%Ѝ)ht@$($(H-$Q@0 E ))H-$Q@0 z ))0H-PT@P !P 8(<P /:1P  @0 )Y mA-鰀@P`PJp 0  ;R,R ;Qp R R  Qp8)D)<)@)H)O-MO 00@ P  00@ R @p=0G=SE`LDDDDDDDpDDDDDDDDPDDDDDDDDDDDDD8D|L@P܏DDP@В$D<䏟P8  W !WWP6 PPJ` QpR nR lRg   `Qt 0l0CS  QP`PPJG@oPyJVW`GWq`PpQ nQ lQc`^`pQ nQ lQa`@Q$`pQ nQ lQN`Q`pQ nQ lQD``pQ nQ lQ5`"PP J`PpQ nQ lQf`0PPJ`PpQ nQ lQ_`/ R /P R `, R@ FPP p`PpQ nQ lQ`+ R@ %PP !PhQx`pQ nQ lQ`_Q ` pR nR lR   `, PPrJ`PpQ nQ lQ`P P` pR nR lR   `d UPP@J PpQ nQ lQ  ;PP&J~蟟`PJ P XJ0 PV X``PpQ nQ lQ`8  PPJ PpQ nQ lQ PPJ PpQ nQ lQ @ <PD$3PP p`PpQ nQ lQ`P`0 A R*=P CPx="P= ` QoQ Q gQx`pQ rQp`` {PPfJm弝p P_J P XJ P `pPpQ nQ lQL`,Q`pQ nQ lQk`Qi "  .PPJ1@P<  㻩lP<"P` 4 ` @P  P ,P  ' P PH wRPP 嘫E PFZL L PPJ( ` P 0`qW`P`Q` QP WP P Px p*PJ)P P} P, $*PyJ, 0RQ Pf PAP PT P )P W  QGpxP P:4 ,9 P P2 9 P P*8 ! PpQ nQ lQ H)( P P x80S<`P PVGGGooPPQ Plq) P000(0 P S   PP 'l 4)Hm P`PJP<) 0l0CS  PP P P FQs oPpPJ PL)LL PpQ nQ lQ`mP PfQ o%EşP0 WW HPYJPILH@ QR XQ Q4P wG Pn"8)P PTP!J PJP JP!P  &P R Pp@@PJn t$0@00;P PPP]   P<())0T[ $Py #Y P #Pj[  PJdQZ  " QpR nR lR  4m  @)PPJ`PpQ nQ lQ`P PwP t  }!P  :&o oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `D)!P  %o oR~Q| P P P %IFGP8V <3PЍ`P8)D)@)<)l`))Q"lL)b"$(lm$) .R () mm4)L9"dm\)X)T)m7k)P))/$)$(ym))ؾ($($(K-P PP`P `p@P  0PPJpPW@@L)8)L9"O-MC儳S `@ Z  @ Z A8 J6Rs0稣<\<``,9 `Pe!9"Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z`8 ᚥpP8"P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`H)(8)@)L)<)L9"lO-MY3 РаPpU W pWppW `P @tP  0  0QP pW Ѝ8)L)d)mH-4$H()mO-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` 8)4)H)0))())ؾ(H-\ R PP < <0PP( Q<)@)D)L)L9"O-MP`  P! ̰PEp @P  @RpP@ЍS)L)4)8)())A-M$R R$r QDbL  zP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J zC@ 0 S0 0pp pp 0p WP@@Ѝ PtF6億 pph;@P@ H)(lm`)l)h)))ؾ(Ŕ"K-(a@p W\yP" PQ/+ ,BW G 0\S0S0@ Q  6+ \\STP,e))))ؾ(Ŕ"O- M@`Pµ@ P1 Ă弒PP p@Q Q @ yPe T"Q@H  .)` P`@QQq Q @ \yPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*5{ 2P5l |#P T @ ЍL)))))ؾ(Ŕ"8)()H-P D, aA1S000())mO-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ JD))@)L))4)8)()H-Q:p@0 0S)  p#ʤP `t/PP ftP @᪌P/P /_/0 '0   ))L)n.R 6!H-4Q @0   w ))()O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍKD)@)8))())O-M  pJ LEpPB <`P,U P ` jwP $Q`''尔P! !Q Q %QQ Z= Z, `AwP 8$Q`+,% XY pU U ,`#wP #Q` PP \R  PLQ p5.`Q> Q ` vPl "Q`,& rQQ  R& R< `vPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00vP `Q' DA,G3р Pp63 wP @ &P!@orЍP<") )H)t))p))ؾ(Ŕ"$) m`)x)kk|)m@-@SrP 02p 'ؾ(Ŕ"@-H R <0AT B R @Q:))H-P  q\Ro MH-M (' 0 0JЍH Ѝ/)H-,! P P@?00 QQP@T5@1<@P- `PpP QxqP @@ ΀P d '0<㘖Ww@ @ `2 00(H)7kP),)))ؾ(Ŕ"nO-MP`@ P @P @\P [Pk@PR PQ  PP\`DVPP@@  V0,p00GuP PPpP2& $@P"  0ЍOB1 8PP X  ('P (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HЍH)Fn-n4))0))ؾ(Ŕ"d)H- ʌ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-pPPP` VP2@5PP- PP%P1 @R{1PP :Po1"P 4PgPPH)l8)O-MS%P R @PrTZqbr弲@Z Z 0 <@ _tP{ `"0Q@ `@`@ \Q  QQ o PP @PAP P)P P `da\  T0,P00tP PQ;; @,*@P% !0J~ rP 0<~ exPHЍ @@LsH)@)<)))4)0)ؾ(Ŕ"8)mO-M @qQ elP 0p`VaJ@V. PVJx!p@`P2 @V  `P$ T@P3"AXh 0(`PZxPl 1  VPJЍD)8)@))D))mO-Mp`PU  P  01 @` 0P D `@p[; ` V8 [䓟䣟 [< 0p rP pQ刓pP  0P3 |" @A `pW W<0  rP Q ᠒P  0 C"  0PnJ@`pQ Z Q  0Pi `@ R堡報 R,0p00RrP0 dpQTLHV  P (S$P  0Jp !Z  .z| ⢽1P ߍ.i| ``⑽X P4 d)H))D))ؾ(Ŕ"]nO-M@0Ps弳弓弃 \P0 &Pe `PD R R 0 p00qP p$$sQ VhE 0P @^1@Q20@P. bPD R R 0 p00qPl pHHrQDV1E 0P @' PT T 0 <p ^qP> pqQ UU @JPf8qT0 a   T0,P00.qP PQ**"-x{ ⠼/P -j{ ppⒼh!P@@Ѝ8)<)H))D))ؾ(Ŕ"G-ؐPp`Pd P 5{ ]#r\@q   0!P)T)L)ؾ(Ŕ"A-PAQ  1S@pT `Vr@VAQ4 40$$ 0pp 0T)L)$($(8)L)O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍ$(L)8)$(T)())L)4))xnO-M`@P/ P`e(P#qprEQmW`pmbr㔒ㄲ XePrPf@PTp88888,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  N륷@Q `P  P+  ㏷ `P  PPP `P %PPv< "nh)t)p)`)d)l)\)X)ܸ(u)#" 9!H-+ 0tYؾ(oO-uMM0P`P U&  + Q DP $P0E P*+? ?$P  2/P, 3`P   P \P g`P   P PP8P4 /P R`P+ '   PT+  puߍڍ@+'=P t#@0)`P H ×,`P`P $PVr PVD P( ^/ &P /P @@/Ppp&P D [G X Ta  @ \$c 0Pc ^PC0pP   0 ظqX;尀 ሹ@P`` @Pp P YPXP   P^_P L   0pG.NN_PeW  o.r_PT 8-<="#L H-L="#D4  xp)\)H[x[ l)"h)nnn`)d)ؾ(nnX)t)u)n\\+&\ \'&H-XX0Dd T  V H H0S \\H &H-XX0Dd T  V H H0S \ \H%H-XX0Cc T  V 8 80S \\H%H-XX0Cc T  V 8 80S \ \H%H-XX0Ee T  V X X0S \\H%H-XX0Ee T  V X X0S \ \H%p@-X X`p@tPp`t0 T  V  p\\p@s%p@-X X`p@tPp`t0 T  V  p\ \p@]%O- MP@j4$v`,P  p^PPp`z]Pf D1@GQLTdP,8D\X`hş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP <P :\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ69!)ht@$()))o)))x)))))))))))))))))))))))ܸ(.!4T(D)L)$(|)H-Y' ' ؾ(oO-Mp@"P @Py P`P ЍO%pPbnPR A娡p@PD($ t Xu1LP \.PP$ PP  \ >uP SPX  vpP&@&@&PЍ@)()))))!p p |)_*" 5S \ S \ \  S / S 8 RL R $ /` S \ ))O-MQ `VpLPL(P$8<4T HD@ @0, ` PP $s \tppV \.P PPp0PPLPP X`40@Pptp X  R0RD 40R3PP @Px0P|,pD  U  R0H pPS H * ) R,p0P( 0  p$W$tP d囗/ P `eP pp]}X}P P N}jR `pTT@TTQ P删LP~ pb8<P L,p 0B?,"s@Q  @Q$!s@D@!H0Q @4h!s@@D@P 4DP@@( P sp 0ϲ` 0ƲQڴD@PŐ1/ Q  iZЍ))) |))))_")))1 )VUUUT ;!))]H-PU h`@ p   $`@P`XXpX PUؾ(A-MPXpP  h屲@@XP( LP p<  园p>  ᖲx `B? 0`VႲ@ oP |@Q @Ѝ`P  Q Q)&p))9!F -p))=p)))))O-{({{K-Mrpb% P"P  @P   "0000 9phBl 嫨W XRPLBNP   P NBPP PlM|MP  PAn8l  00P UR pA P\     QQ  @P  & ȨP ZP p +0 H0#@( L@Ѝ$(p*X*@)*(**r<)P)D)L*$( )(s8)4) * *$(!s**&sO-MMR"~"`݅堂V `尠X V@00 T P hB\"`ͦ@0 [H"@2~ 0@""1[aQ I !砐 㮦!F"n ;@妦e hLP@0` (|!1~ 0፦"d!0p24 (,a@0P @0v@  o @0   n0_H! `"0S[ "N L\\"> Oߍڍ )(ؾ( *))M{y*$( **X{ z!z* yA-~MHP 4PP,` @~,LP~܍$(@)$(0H-Mxx @P`P 0@QJ 0:pN q5@Ѝ0)@)$(3sH-PPT4 4Q$$0 4@)0)**sSsH-@P`p KPp@DPTWH-@P`p KPp@DPTWp@-P@T0 0`K@VT0 0T @  T`t@HH@ 4( 0 4p$(@)$(4)$(ss*0)O-M−@T|`pP  %K@PpPE`UW@T80 @  @Q *tBʓ P@O4@lP4T  0Q*J P0_PZ#rP nP jP tcP _P@@YEP@@T JT @PT4T tڌQ YQ llp@ 3 L#@ 04 D4Ѝ$($(@)t)4) *tt$(dts/tO- Ml@PSTPO LP\F0P(!00 !pW* 0〰PPUQJ[PWpo ` 0 [0CQZP Pxd `   KPJ8@u3 Ѝ$() )(4)8)@)P)$(mNuutO-MPpPPP<PU8찟P@P2:@ 0`P QJP 0go V 0PP 0 S P  Pc( 3PPЍ$(@)$(P)uO-MMP`VJP@P PrUD3pV C `p~,IPp̲bᎎH/@@:KpgH/@0Kpt ~,IPr@ `~,IPp\H /``KpB`aW AWH/Kpcڼp`@UI  0$4! UC lUPa 09 q! P 0sH 0P8x`p!!`` pqʬ     2p`pߍۍH Jpʇ08 0 2$(@)$(mTvz*vqzQzzzu$(3vvuO-MMD Hpa($28 HpU#x2@PPP ЍۍcP02PP  P pWWNP 1\2422 2P0JhShchxp{@.P% P   P i P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P \Y▽X dP @U1?@@1ꨑ*vv)))**vD)$($(@)$(w\w}w7w )(w wwxBxsxxxex$(*xxy6yY y)yybyFy@-@(p )p$)(H-@mP ,( 21))o{H-Hp H "1{@-@uHp 01@{p@-MPH@p@PP NPP  P P ` Hp   P `@ЍpO-M@PpJaH0/PjJ 0/PeJ@O PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP   0@  0PP P (0/D F)ЍH k0 *)ؾ({*O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF % @P/L 4吲" I Ѝ%(%( * )(~ *<~O- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ Pp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/ * * )(}z}T})}} *O-M`P7JH0/P1J 0/P,J&P)J~@lPP \FP D&C/4P $PJ@SP (0/, `E'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P FP  FP9 dPJrPJ " 00 @/P P@  88 FP P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<8  0 @P"F  R.G  R# @0S 0@( PP $ ӟ8 *d*$)(|@*)D*`*T*|*x*X*(***4)(*G-AMp/@P P`P P 圀p 5 /P x 0p-PP /P PW( 0n-Aލ)))||O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  ɞ|NP. (0/P`!P J$(AP C@P   eC@ 0@,ЍP帰 EP   0pUP P P !PJX "PZ *{T*p*X**(*{*)s*O-M⨔p Za P.J `P+J,0/P&J00|DP "PJ(d P W 40/ `BRP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   Bp (Pp@/P dP    oTʜP  p  @PP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P    q  W J P PJ  P P J pP ,@ L  F *@*)T*|*X*(** **P*H-LP  P JPJ(H0/PJHT* *O-MMUp{`  / P `+Ѝۍ@ /PY/P /@#Cp#   P'`PJp PJ"PJP PJdv P  `A #G 0$`(+04T@dpGP ᰬaP(  /P P *BP:  PJPJ ( P  p44 BP` P  "Q + QP0P7F 7+.*PU @Q:P PF Ap 6|pnڰ pn hmf,F R G RzPtQ0P7F 7@ X!0`*nprPf Pb  @P   \OF R] G R4  $ꘑ*i|@*)`*T*|*x*X*(** *H*||*B|$|0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0*** *~%(D)****g~@-0@ PR ~ Rڬ~<  tpʫ 0H!&X4q4A4a @RP+J R #=PXx >pH L0"#  6&px /&h 0T &a 0 &Oߍl*r**%(O-M@I `Dp @Q JP>P 8 !0Z&ꘀXPZPP崀.hP`` @RP( 0 R /P R  0` BRPZz``W J R PX `` H`P 8P $ %ЍA***iO-]MPp 4 p5pE 0 @,8勀 H2E`P 8=pʣ0"%`4`D`=P L"0%P[Ӊ( $B ` Pl<P%`P0( R,$   [?44 OP  ;` PP p+@)(Y=px |0" P#`  P 0$`* 0K%` P  P0P?%`@0(Q,$ p!R P4p`]ߍl*rA*%(߀G-` @P   /R dApPRT $KQ  Gp;p9GP' Q; P0tpp.РȀpP$( .PJ 0\ppl 0$ P0D $PPLPp*J**(*O-M@//Q/pP? p` P`t<P/`pP*zp4 P   ;p T<PG 0 /7pP  -<Q  PЍ/ꌑ*H-Q#J@ pP:ph`UP 0<$P <p0$ 0$Kҁ*K-MQcJ` {@PT@:p\!0$PP $( UP$ R P  R  R::N EF ` `CSP z:pʥP 0P#;K0Ѝҁ**(*$*,)(()(*H-`p@;PP a:P (z 0#P(*v@-@ M:P $c 0@#(*H-M@` P0 `.aQPP' B;P > 0`# Q  800`Rp`B3Q  H0@!R!B3/ r:P NPP 0:p  0,#Ѝ()(,)(/MbK/H-M@( * R I.* PRP ` V  [ :p   P, " 0ЍA-MpP@:P 9P*  `.P X  0@"Q "#!"# V"Ѝ  P XdP 9pq:pXy 0D*#"l}N Q/*B0 0H-M@P Z:QJpQ B `' & C `0 &' !ЍD*LO-MM@( @0 <,P `DA($D {AD ,( 8P0$p@PLst tu(tu8tP P C9P8  P  [& K  ,|8p:  C9P8 p P p,j,j )9(88P# X XlP Z[pP +pl$,"0!P  P! 0!2؁Q P l0,P+Q $lPBhVP< 8p0PXP+DP, &< $!@7C]9pl?8$ Q?0P8 I $0k!0 @ l  @o` $@@Ѝۍ褂*qh*{***!s,)(()(ւp@-M` @9PPJP PЍp  P P F8pPV TP8p0R(P 0 !PD*(*#"O- MPR^ 0PpP4W@@@P `T V RQP 4, | | $P F  P (\J?  PqB`P  e`PpWPEP4 o< k 80 Ѝ豃****σp@-MPR ` 0@QJH 6p 4P$PC 0e PЍp *σ0H-M@PJP6TP EF. * @0 Ѝ0P*O-M MIq` V k#  6PPp@@ PP  6P`8`5@P p*$ 7pF HL  #  0``Aq 8PT0L < 0 `Ѝ ۍ4r@- 0 SR  R@|P AdP @P JHP P@C,I@h*d*,*t*0*4*P*O-MLAP L<08A04q4 P[Q P Q4`P!p PV `P qP V  `P `ЍL*H*0*@*4*ؾ(%(,*p@-P @P PwAP `{@P/Q\ e@0 S < ``p0p ``p0*<*Ƅ|Q  lQd  \QPQ  P/0Q $ J/@*L*D*l*<*H*L*H-tP dpW `T@TP`Q Pm _pWP*0*ؾ(O-LM@Q PPJPP (B4CE FI$0 `XclS, P @ PDX܂XXX  $  -PSZT  M4p X $   @ Q@0 ,+4pJ+  0T"$ 4"0F%P! Xp P8@0 Pp@8 <0 DP"P $!PX  P8`h& , #0 P 4  `Р   $00 0 P[  (@ XTPPDLЍD*L*H*P*5So*!s@*K-hMPp@P2 ( kFzITX Tnp!W0pP   `<PH  6 $p0  hЍK xt0 <@Q*XPD + NhЍX*9!օ˅#-"݅K-8M@0 400 |0p4`l<800PpP$  @ 0ZxP8Ѝ3)p@-XM@F P 08`X\D ;A XЍpp@-MP@PP Q `P0 QЍpЍp@|H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @\*H-P(@$q``Q a` S H5[`U4`-V$``````V P:VHw^|p``:PXQ! 4``,, 0'?`P*/ܸ(T*Vؾ(?/p@-`Pptt P XX@P0 P,,P\* * ؾ(:*qO-dM/PoxGP `o @P   0U0@JQ_甒t<ĒԒtLXt4@`hpX8 8 ܑ[@@PP /0 !Pl,ȓ,ؓdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0Y /PS0BJP猖Tdğğș<P|08 TL$L`h8@h BP Ȗ R   i `{ `v  `ot lRmR oR pRaR eR8h,|p``**wH-`pW \P@PP` P  pW*ؾ(H-d!PQ! 0 {@T @1`0V (10S Q Q Q ;PP0S P0SDP `P/`w @/Q @4PP/*L*<*H-@ `p  W P 0/ /PP pWxoddoP`8pP ePCSUS*8*L*K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PP<*O- MM PP `@.T.Pq |>PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K P < P  PZP/P wP Ѝۍ .P P P  @P 1 `+xVZP P 2.   +c`apW7 @/P PP  @p.WP pW @ /P P  P P   @ P.PWXP4)( *@**=pY ː C$*O-MM@` &pP+X  @'@P(P`'` [h 0MPa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  JQ \R\&R Z:Jp '@` VBp+ P ZX  T D Ѝۍ V*' Q pP P   '0  V ` P' P   +')' P <<'0    *ؾ(ۑőp@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0nH-@MP@u`X0'P8<040'0'P8<040&0'P8<040&0'P8<040&3s|ßp tpt, pP  yPjJ spP  jP[J dpP  [PLJ UpP  LP=J FpP  =P.J 5P&J /p P"JqP %pNPP p P @PA !C@ЍdAPP PE/Q o1`,V`  U    /00B B ^@PĿ$  P qbxPdPÐ(*ؾ(W**P )(#"$)(4)( j0*)4*P"H);,*_@-hh h0@`TiHP &|0P &e6}뀑*X**P*H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V R輑*/>3*đ*A-@PI `PVE qP= 3P7 #V \V `#P` =P`/P P!=/pEaV Q PA0P `P@ 4  輑*/>3A-@PI `PVE qP= t3P7 #V \V `#P` {=P`-P P!=-pEaV Q P/P `P@ 4 ? 9 */>3i6H-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`V/P W`Pe bRCR MR mR cR/pP KR#\p Q LpUP R  `` ``0  (p RP 0 44 4  ͓;sWđ*ȑ*H-0@PS# p .SnWpk0Sk`W Qp!@k`p@ QI 4llllxlPP!@k@d  P!@P!P!@ P!@!@l p0 (T*0H-@P@P  1P @0Б*͔O-MY; CJP5 \2:BZРL JaV p !  !  p`P @\.P- ` P% @  `Ѝ   + A P Q 333 Б*qvH-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T{3Hx3Б*qvK-`P p |`AT Pf3d3@U`V Б*0H-P@P G 1P ll ?`PkXp ?# D G0$ i @0ԑ*4*h"0*8)(AO-MMAQj pG P ,wAT `P  ! 7  P5  P5 @T g-P A` 0hQJ P* 0F.*p 0aP  @ x   F @ 0T <@ 2Ѝۍԑ*8)(e}ԕH-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: dЍ0H-@P@P  40P1 @0ؑ*A- A`P%  ,@PqW 2P p ,P) pyP! `sP qPP `PP !2[P ,22 Pؑ*Wr*H-lp`P @P ,[qW P p ؑ*0H-@P@P = /P @0ܑ*H-B  PM-`@pW# P!=FP Р+0* R !,P  `P@q ܑ*/>3O- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ +PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   r+P 0p p ``  ܑ*/>3*ɖ0H-@P@P = .P@0*:G-MlP =Pp aV  0 $@ Pp(` Z Ѝ*O-M`V9 @L@8<@P!=KP ! # " # " (0@ *P p P P @(q $Ѝn0ЍO:*/>3pG-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  8060*/>3/G-MpPP/P` ɢ`P$ (*P pRP @0 @ `P Ip0H 8 / ۍX**O-MP@T) 嬐嬠`pP$P u  p p~P //@TЍ**,)(()(0)(  Q /*H-l0S ^Q 000SQ**@- Q@P d  ^P L<q 0D @ox)( 0H-@P <P0 Q* P0PR PT 0ݛO-MP+ P`弐@p@PP P@PL 0<, ,00 0ЍBULz )(*O- M@Ps`PJMzI"( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝ****p@-@ Q P<`H.peRe #p@/O-EMP j@Q \dlteQ +@Q@P@dT   p9 d @Q:P P /@12 d 0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 d0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 GIpD: @Q :!P.1q0PPA@W@Q: AA0 (\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 d1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0 ;   h,'@PJPJP P@X;Θ*h*v//0H- Q @P x\ P 0X P HP8Q0  0HVo֙ **ޙO-MP@PJMInj( p |Y!R  +p/  KAQ:`|#|3kF@5`#`3  + d  |  "p EFzGj  H )n Hѝpt ,kp   (=pl  mJP1 @R0 p<  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  'PQ  !&"&p ( @ /R     <04KP4   Ѝ*****.x"X]O-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }T Y  I`/ P%   }y d 50@ Sc`2 375p@d<`1 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 ,!&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 PK d h``@|Q :!.q1`0``A@`W@`Q: A{A0 , $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0  l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0 ] x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0 = #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0  |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0  "0@ߍǙP0 <aU P  ;X)`  ;\PP}PP@@Q :!`.1q0``AP@WP@Q: AA0   }B@PJ PJPP p`3 P J @ yPJP P@*3*"[Sdusta!"h*9!*A-MMMPM `@f  P+" U UX K<0 wMލڍ V"**0H-@P P 0HꓛH-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @0q@P$J P0zqPJx @0nqP JL @0bq|O@Ѝڍ(LWemK-M-PP  lrPP "10 TP匀`pVP @ Q 0Aj`P @@U Ѝؾ( 0H-PJ|@tPP h\Q0՞<P 0  00x.R * *@*M0H-MP@ 0tPP h 1TL0P Pq r 1Ѝ0HЍ/,*X*p**ؾ(*+ M@-M@@  0P  r^Ѝ@ Ѝ/*p@-@QPH R `A 1P  @@P@@p*Mp@-MP@P0`P X y1tl0p `oq @rT:0@ cq a1Ѝp@Ѝ/,*X*p**ؾ(*+ E H-M@Ped>/\ap yBLP PPp9 P5* qP& @/P"+P+P\p Wp 0#" 0"# 㣚@PA@@X@m$39! ܸ(#"ؾ(AeH- pmؾ(O-MP@eXp.Lg\L BeP qPrP vP xP0 VPPP RP fP iP! pWP dPp p |`VdPЍTQfpPW9 P7@Q  /Q@ pPP/Q /5Pp.PP .PP P Z/QpWPT0mEDYn,PU  e0再p@{P Q 4PA P jPD f?P@ bP< M7Q . /. Q4$ R$ $ R Q  P   P  P PP  P R/PUi`3Hs P0p YWP@ P4@* SPPеcb貟p@ Q ,,t,0,,Ph X Pb VZ8Q X PP P P^ P 2$QPB pC. $ 8 PQ+ P- (P$P% P?P" Y Т . DQ.PP sPQP  M᝵pP}qPP  $_P [?P WPhIB-D0 99!8*4*0*,*(*$* *ܸ(B@*<* D* *"/H- nkؾ(b /D*G- M@P nA{@P$P"D`P2 P P- P( P$ `8P.`帛P @Pᩛp P Y@ob ЍpŔT PP WP4`43 0rn(*<*,*A"ؾ(9!ڜ̜O-OMM`@Q  p  P 8p PP Ѐ # "!Ѐ # "  Pp%P 0w pЀX` XPzp X PXP 0 `ЀX` XPzp X PXP 0:ЀX` XPzp X |PyXoPq 0giW WXj`  sPR  ᦼpWPIW?tPA 079РZ{`حV`: ZP `j PZzQpp`P TTpp#K ,,ppK4Oߍٍ@* O-MP@eaL+p@a@ Y>vPppPpP?P4 䠟Pp!P$p/`P PQ P p P/ J J` P i9!qH*ܸ( H- liؾ(K-P3rP  pR吐G';`; ;DG!0 aS P K A$*P*(*H-@Q  0Sdd`P@' @qW P `pPAP* R 0 S$A'  A/AP*p@-P@U  QX`t"r"p"PP Pp$*(*H-lP@hp`Q `'VPP H$*P*(*H-@PQ  0S``@' D @qW P pT `AP*@-@P@K- aK@:P 1S ppW1 0'PR,PP 30 Tp `_9c AQ  ^`@T K:7$*P*(*+(p@-d`P@Q  R @RP'UpP*O-M@}BQQ? `V; @P =P x !_@0P p3_b AQ ʣ] `V( ^EЍ*+(+(ٝĝ0H-`@*BP aP@00P@P g @ *A-Mc@0A P* #pt3   Gp ppD0$$#p007qQ Q, QR&]QC 0ASP4444,84T4444444444`4l00A S*@G0 G@ @9R p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     *"***3H-M@Pf9`PL-P  IRNP   pP  pEPP@@@8PPR9Ѝ****c0H-@YP )RR0*H-  `*A-P$@. `p P Q @ AQ 9T@Q@ AT  Q9P`@ Q9@8@@v@0 0Po]o9!)()( ** K-0M@pЀ,(j`TV F P :(( 0$@P0ЍS@PWV  F008@P( `0"h E^*1 G-@P넠 %Rpo`(U&P `DW@ 0W J**@-@Qs@ ,<Tlx  Y # qV PL 0^^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0ԞȞp@-MP`V_@`P T, TP@ @PPP P R P    RЍp**)("" R"K-@pPh`P<LY@5 0**K-MP@#` 0BS0P RpToo"WpP 0Ѝ**K-(MP`@p!PW$WD W_ WX 0p~'GP:$W= "WA#PukW9 WoUC ЀEVeUFaP'WP'pWAp&P fFT 0o᠂; 0/Ѐ 0(ЍK'FP{U Ѐt`'V'VT PKf n\ (Ѝ뛞*1 *O-M8ȰȀP`pG@ A  0?@ DR0 0SR* @Z 0pD`PP PЍ**X"O-MC">peP P̂@T& `V pW !P Pp5` E  E/0@0]@P~ .P.PP/P]P P[ P`p @5 p  P [Q pp*XxP X'5  PP8% Ѝ-PP`P@P@@,  ,)(6* *RF*6!u"|9p@-X`@PpHP < iPLP 35pp@ **H-p`@ p0PPP $ V t6QP \\Y @P(P sg@$*(*)( *O-MP|sUQ$CP lSPHP FP  Z Z@e4Ȳ.b@/Q PQ P@P5@UP U/P@DpWF 8R8 PQ /Q @P P+  P& @Pʥ5@/P @Pʙ5@Y\T1T   t/R@pWT p@^5p@Po5@/Ph5@P`P Pt 4x  'Zd #Z@PDP Ѝ **)()( *Y #"$**(*@P/ 0RS /S  00B /*0H-M@P P/Pl p  p 0#" 0"#oBލ0#"0H-ALP;pPP2LUi7PP0P$ @PW! !V AQ W ;W0J#(%#! *Ÿ *֟+(p@-@ \3`P 3"P Pq3`_30p@3Tp#- *H-$Q  HRY H *G-rP`V lEP X?Po`Vl P @T7 \T0@a DR02L342T3\32222222d3222l32t32|3@3\T1 0T `@ P0 BR6!Ar@q#\@` P,  AQ DV `V@ @ @ @ @ @ @` AQ &V @`@X  AQ V PV! !l+(d- D AH-P2 JU* *H-MP |l   (DP 86P4}Ѝ$*(* *)( MH-M,  0 Q t*@-000@Q#V(*$*MH-M  0 H- pt*M0H-MP@ 0Y p@-`@P PQ:Pp R& V P  VV  VT JVTJ! p|Vx@ AQ JU <00 p@UQ P~U*(8*h**(+ <*)! +(p@-@P` M@-M@  0 }@-@w M@-M@   Ѝ@ Ѝ/0H-@P 0Ht MH-M   iЍH Ѝ/ a@-0P r R P  R @ kV@",*7"  0/P*H*@*L*A-P$@0 `p P Q @ AQ p2T@Q@ AT  Qa2PPQX2@+1@(X*)()( *T*O-MP @j1 +"`Z:pP P` @U ^PZ !P d`Pp18:PP&" Q1V(ZЍ=뜠**()(@*X*O-MⴣP@`^Ug P p1댳儓Q$<\=p====H<|<<8=8==><><>P><><><><><><><><><><>>>^`P ^`PPP" ^`PPP}lP Q^`PPoP PU[P0U`aPa``]P QO /P QP Qb9hP Q0`!*(P Q P Q9USP zQ ``3o` 0 n0P 7RPTP 6 ЍQ`PR)(*X*@**(*G-MPPP !H!SSpW A ` NpWpSdUS p`aRP D@KP R R ?SP6P3 -@p I`PP  KPtP P RPR,SލR*)(**ʡ+( * X*$*(*K-@pfPP) !GRR`V Q M`VRWRQ AQ ʄR RdQW5(`Go"(P W( PP'PWPP ^H)PP KWPP 00 G*R8(RKkR)(**ʡ+(ޡ$*X*(*O-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍL*)(@*X*O-M@葟 ^P.UQ`p`pW  ZP `!00[P p paxP& XFQHQ Q AQ ʑQ =Q AQ ʂQ Q T;^PP P P [PP, @ \.Ѝ)(X*@*L*** +(K- MP5.a   p@W6 P2@PU   IP PUpW P @PxP^P@ P  @T P^pP $@@. Ѝ蜠*@*)(X*O- M@P ꀑ&pPW7 ``P p? R $'PPP VIPJ6IyVJ,`)pWP E&'` RDP ЍVJ Z$*(*X*O-iMxL$/? cb-@_ aT  aopP `;P  @T p_W _O`C;P  pW p!P ppp,tQ t 0t1 t帾>6 (R PpPt(ptAtQv dDO|QU2 D~=` @  AQ O @@᤿P @7P AQ O ``(PP @UQU dM`  AQ ʷO ` PP `U @T \`v JP@ `TL AQ ʔO OpVP[ |PK tL`Pp P$PU<<`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt $pP@Ft V$0/P t$` `Q @QC*`PP?P PPXlMPxRj$Tlx lYp&PP Tl!G%P l8JP8 lPhd^T P LxxP x d P P d=hGxx@Q *hi`P T%Px @ LPD O-MP@/p 堹P {PP 0SP U8  Pp:9`P㘰WP 08U~PP yP u P dp PPjP{&  8`pGP> ER:UU ~$ @0 x*t* H-`@PBpW >pV .Uj% L,_*h*O-MX) pR%pPPP :PW @`Q&P`U@  Z/P/Ѝ p WQ:Q:Q M@ЍO%)()(x*O-MtSp`@-b@Q'hhLhhhLhLhLhLhLhLhLhLhLhLhhhhLhhhp`@PW2 ` RU pW P  ,RBP PiiiiX [ Z V pWdpo 0P PPQ PT P PI !pW=oT pPU PjjkkX[ Z V poPQPd|Y:T@xHP 8*HP PPЍ輢*)(h*|*+(ƢK-鬀嬐@p PP `Q QQ `PP|U:P P K$*|*)((*K-M Rll$mmmp @P w`$PEUY tQI!Y%&Y$ (G$EIAT PPP GGGY {GyG"I P @ AQ ʐG *l@ AQ ʂG Ѝ0 $*(*&, h*+(0H-`@Q  0SCpa!(@r !!ApQU P" pPV `x#P P,P 4Pp|*$*(**@-LL@ 0 0 PP @*$*(*O-M/@`P0延P P`  P `xP* pP P P pP P    p P pp @P|@Yp P >PK h  po#Q 0'P P P'P /P  W YA P ,p   PPe P ~'P #P p@ pY( 0`@U0 @G7 p$p@崐`W pp@o p@RPP W    Ѝ@崀`pPp@op`P@Du"+"bP pP#, h*N)(x*O$*(*W)(\+(T"H-`P@P `pQ%V MP pP@"H-XP@P `pQ3P pP@"0H-8P @PP@P0"H-XX 0P R RQ U 0|S:)(|*K-@܀`'pPQ Q:P P:QPPPP %Pv&P`:PPp@<@qVQ`UV Cq `h*O)(A-销P`@T pPJR@p@T`|V:PP A$*|*(*p@-`@sPP PR  PpP p@p$*(*0H-MpP@l0>00  P P Ѝ0P Ѝ0H$*)((*H-0P QQwO-M@p  p` W p'ppQcl  Q   *****)( **)()($*@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp@  %  ||P`~P pF @  `P<UځE P#8p܆LL܆,xt p U :U U |=UP|{P pP  pP  AApPPp PPQP PPipP p@Pp=P ,pPy PPA @Q:pQ7P~ PutP65P ᙱP ( AAwpP; p~P7=U PpP -[p (p P" PMLt p Pp PfPPZp UPQ@Q*QQ  p;p0p(p [ P`pЍ*+()(** ** **O- M`t@P ddR f` p@Pg@DP:T @T P۰P=  [:T@ ppW T6  [2*W @W ` `pᵰP% W D 3P ` [*p P Q @[T  `  p [:P pU P UY`R p pP J p Ѝ ***+("G-PJ 0Q$a$(@ >RR4 *R[R?R p P ṹ P k 5PP zP P  RP Pp@q@T$*,*$*(*0H-P ,P@@^@@Q0$*H-t@P hPh`ppP P .P*$*(* *O-M P bAB2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ ʮ1EQ ЍQQ KP Y'DP8 EP టpZ y P p P*p P PhP]Py/PU/PmM)(*)( *6!"O-,M P( 4o = &@    P&  >P. p `( ( * `Dp6PR0C$ V7 YC0 k( P C( P `p Q( @P60AS p*P@P p R Ap$P^ R"Q P PQPTV?LP( `F0V0`,PQb䔟U  `p P P( P( PPU`F R 8<ğ0PC `倐 !o@!Q `!@PP ` `@BQ7*$Ph  0 F pXU k `Hu P ,P-( P ( PPUGBQ0̓|,,LLLL,,,,0$pP XP@2$p!Wl( pP 8( V%-( 10p0 0PApP q|!a 00 A p@@ A ( R @ 0S S@`VW   S S00SP,Ѝ   0DSʌ R #R  d \  C @ @D  0"**)(* *")( **Ȥ*O-M <#@@P0 s\( \Ÿ@`nE} [" ` 2倒p吢`<E @@PʼPoJP@P V  pP TPR p@X X@`VPPV A E@QPE` `@PP@D`T`PPP  P p P *p P@@PJ`P P |PT E v4PP,P Ѝ*$* **)(*(* *"d*O-$MXXD PHPl@e`@A4`p崠  BQW > @@ 0@S "R   @ $Ѝ*)( **1 H-pp`@R@PP Q Q (`P @P **K-$QPD  P aP p@@P P #P P`P  Qd`dp@@QP P P **$*(*G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F ㉹P`@V |P"G-Rp`P@P D  VPp  >| pAV P  TpLH0 0 댹  <* **)(*(r"O-MpBW*(CQPxbP   WP P @,<̠@ Yp `P^V`ZpW:!pEW}: `~PGZ`@P wQ  0S Q:ppW*]pEWY: ]P:GZP wQ  0S Q:pp`ET<* @PZ Q@EP`0 D` CW P@pPh`@DpR@@Ѝ贸* **)(O-PP TP Q TPTn RT`TPK50!(v**)(B0-4*0H-lP6eN\@P vP$ (0( P$ 0Hy0)(* \!A-P``QP PpPp$P@@ @` *A-@P PT@ Tp᎗P @7TX XT@R@LBLr`PE0 S`FvB AQ qA ` Q E P 3`Fv]tq`Q JP `VH @X P  1 PUR@]p@ Q` Q  R `V@ AQ f T 1pW`V PAPPU Rp)(-O)!g +(nzjA!x0H-l 1@T PHDcQ R APUP0)(-0H-@P P PP0H0A-@RP Q-Q\P9 Q-Q5U5PBQrQAP `pQ pG`WQ PMpPI GH@DX4aX< XBJX@D@ 1@hpp!PU:1S A@  0  R QB 1Q  PTP {M8*8*] *$*(*o¬@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 GE8**4<*GP 0 @-T@H<QPP $**(*@-0A Q @qP  @ *H-MPDP0 \ 0 0Ѝ *جO- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  P@@1  /!?`PP0p @ P,` ` PP Ѝ:U H  `:`$PP>*(9!;!-0H-@P 0P  PP P!P P@ @P^@P0 !*(x*(H- Hx*O-M X @ TO P @ T*` @,P( PpQeP pP -P @P qGA@T Ѝ*(Z p"O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍp*(p8H-@   *(p@-@`4P P`P `0p*(O-MQ[@ @` P     @  B/o"D`{p @  pQ  n  [Ѝ*(x*"p@-@MP@ Q ` P x "0`0` 1"2 `ӑTUJ(8 1$ 0! P*("]B*kA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !*()(ZH- 0g*(O-Mw D @ P$PP@;5P`,`,`,`,`,`,`,,`,`,`, 3 3,,- 3 3 3 3,,- 3 3 . 3D. Q    Hj P KPEP2   sP5P!| P  sc&Pj  `PP pN `PPU pP pQ P,QB HT$P Z6 P -P 08A P0` P    ` P\P PhP pQ`0     Rc   PQJ Q0P`p  4P1p QQ@p`0j P @Q* P QA P8 {  0P Q,QF f"0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  (@ Ѝ&P PܰP0`p  ` P P ptp @R*PQ  *()(Y"*(mH-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8p     F    P `&*(®@-@P@ 0/0S/00/"H-P@-@S(    @ *(O- M Q 0 ``hR@p` P'0. @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK\@A>PP9 @PP\ [PZPW#P'PTPl&U0@ETq*0Q0P@0QC0P@/ P Q@@p T"0`00a 00a!0a!pb(P_`P(V@A" @ T"0` 0a!0p 0a!AR P p@\ Rx Qx4 7P9 6TPU @DP)P @PA  0P  @QW @P@PP{P  `@{U@#P#P}P@cQ PP` T PQ PD0T000 00! 00B pᴩu)Pp! B!w @) 80R8(p!R\P`P?p@Py   0up\ ER 0p@@JUUUUJDDHUHHUUUUUUUJUUUHUHHIUH@"P $P }PQZ TV 0P@T @@9PUX r@D,Y p'@A@ TE X@P@o'UP @$@>PT` ုtf U "U `d @ 0F Q:8 !}P5P; PQ2 pAA\ QAQ A AAp0!1 eP U @ୟD@ 'U bUU`p`P] P?@<PY*?U \U\PTPn   p@P0@ QR A@Q7P@a@Q)WP@pW% m@@ TA0001x<"000a!0a! eUP8 6 P Po`PI%@p?P PpAu P P!\P 'Py P pPT/]@-+ P@p@%P%? %#@Q Q@ p B ?PP  `@` ` J)@P`P3P(0E Q)@P`P P0@ P3*( P`@PP")()()("" * )@Pʟ`p=Y Y}U (P@Pʍp# #U%U #UPPsXH:U d PP)  cP 4 P% P(@!R x*P IR'@3HY 圇P'P1P"@L T"1`Q 01 A0 @@A@AP `"Y @@%P%? %&@ R R@uJ%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Q Q p B  "U]J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??!P p: P pP 4p:-pP@P P P P@P` @pP<PT F ,@  PQp @@QPЍP P `P zpp"p WWp>U WpC &P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @|@Q qy m 0 rP*hm ahiDgLe<c0a *)()(*("""|*"x*1߯Ll*p***O-M|P  P P<j  4b4r4R$80P@@T:T D P@VWW(WWW,XWDXPX PpTt 0\T P! R0% T T  :;T" |T>|P%0p ЍOt!)&P&P ;P    Ѝ*(x*)(l*p*"p@-\Ppx@xPx`y P08 0Q 08  h\P p| p@^Zl*()(x*p@-H@8Q 8P` AQ l`8  R8 p*( *O-MM0$`(@0  0A,p P P!pFTW0A @0*~@PP u`Vu ttpPlDlt(  P L `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0$  ""P` P\P\@PP`@PP̂(p`EP @PPPtVP`CV P   }PPu PAP`q@Z   f}똁@ f0@P\P $ 81 1SP  AQ O @B AQ CTP@ @P 5@PEUMߍ 0 )x0P 0$0  *(*)($*(*)()( *x*h@-Q @@Q0H-d\Q T@PU U U <04 P00*(9!x*̟*|*)(K-MP@ 4@T7pPU ` |Ѝ`uQ X<P ```)()(**˯O-[M `p吡<ր嫈|TP@ P T@րL4`PD PD ,> @`@`P PS@ P P Q QV  d`!V 0\X1hAp@ր8T`P[ߍd *)(8**( *9!")( R/0S /<\/0S  R 0/ᐜ*A-pW |@P`pQ@U U p 0PZᖼW舜*H-p@PR T%KJ`W VU uV\Q@vʹC0( a  0*(H-p@P`Z @P`O-MP@   @ C3 U ppcppWWpP Pt ,P @T Q @P Q  R XF P Q?  "P|C PXP ׻@pI ,T @TJ ɻ@0A p ȡRP KW PU~<P QB 8P Q  R6  ㍻p3 P PP/ }@pчP ͇P n@p@ @T P|tЍ > P뭇ꪇ4 ꐜ****$***((*H*E+(*(+(( R/0S /ᔜ*0H-P @ +pQ  "p  p   p  p  P0ɲ댜**(O0H-P H@P PP0 2/P0茜*@- P@ T D޺PZT@@ Pۺ,, 0P Q10*(*(gfff*K-MS`@ T@P Dllllltktkkk pWJ0P  R 0 X`UP  R 0S T Wr!0po Pц[0|VP p\pj `ӻp{   P#@wpp FP_J`W M I  p ,0`PYJV`T  V P * Vo"0p!PP P P ЍP ЍK薱 R ᶱ븅G㎲ p᪱?@;@<6} ᙱ$***(*)(t**(°H-M@ ᥺p`pV`ჀP P k P 嶹`k尹㑅㎅㋅㈅ ㅅ I*(0p@-XPX`@PpP p@p$**(* P/ሜ*p@-@LPU T `V PJh`Pp萜*p@-P|@QQQU O 0Pp蔅`B *(6p@-`@ RR9  "PZwP sP* R  P,UPU @p***(0H-@ P P @ $0蔜*@-<@P  R  -@ꔜ*O-Mp$`@` `pR SࣟpvP sPV` pVG3  "P p+P -P  fP00XU: ᾀP  Q PQm oᠢWg aQVo  % % _p@P0P`PPk$WWcZ  01,p- P [ !+"00Q  Q PWFr *pB   R p< Y  0O`VVQP J@@ 0>T@ }ЍQx尯t᭯᪯?< X6 <ᚯ 嘯/ܸ(w/B""B" |**+(̱O-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP 0 @S[U H u<ЍOpЍ+(Q@!B"#"9!v!H!B"S p@-@Q? PAQp`R @P``D>Q <Q R <D@Q:P P r d' RHp@P-";!X p@-@PP QU,pP Q  R p `p l pU B Up< (ᠮ  ꔜ**Ypy@-@P @(P DP "0H-P @PP$P$ 0P0ڲ*;!A-@Q @P) x`xpP  ?U U @P P@U O-M@P PP3,~PP/P~PE ~PP#dtP@P TQ <PP ڭ@@T@@ U`ti~P dd~PpPU`PEU~P I:lPPEYU@U%Y cēSă@p WWp@WPT W0 T@Lp@@WroᠢYPi@YP P @㰲bR@P*pY Z P  P dDPwH D GP @PeP P W q|PlP T |8Qthah@pP P T j T@p@Wp@@WT p`@P P wE@@T@Ѝ-PPUPY"ʤ *$*(**ڲ+(E- i1"+(߲! H-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ  p Q8NQ> T<'8 :V V Vᙀp U`V D?P: 0p  aP6QHQ `6QP`ꤝ** *)(**H-@P`pP P `p W:8 Q P H$***(*K-Pp@HoሐR`P P F PP `P:XKꤝ**$*(*HQ/8 0S 00S/ <R:/ᤝ**0H-@XPT P Q& P$!PP tQ PT TTT 016P T,Pc"P0褝**)(**$*(**p@-H`@PP@Pp8Up訝*,,PQ /PQ/ᤜ**O- MqQ!1`Q@P(QAT  PာյhPl0d `P  P ҵ4P `00( @ Ѝ******X*(? R3/1!@R/*0H-8P@P0+(%@0*H- **A-JM PPP !Q $@P@a$@P `X@PLQ@TP@8$@P@ `Vf N P@ PPPPU~F?PPPPP: 0` ㄲ#ᢲf峫***X******$*+(0H-@Q P@PU PP00HG+(+(p@-@ Q!- P ,Q$`P   p  AR \PY  R,P ԩ@p$*(**@- Q @R P J Bpp Ӳ+(G-@'P]oPPP `P3 P1 @P`'#bP@Pn"``E@P_`\'PpUWG 'W @PHpV @P:@P/@P$Z`P 'P p@P`V @P'PG7ꣳ"+(0H-D@GP'nP @ U0P0"H- H*(*(A-RP`p@ P P }P  T@:pGWPH0H-T@TP P f P0P 0H觨0$**((*MH-M  0 ЍHЍ/@-M@∉P ^=Ѝ屨먳 MH-M(   ЍH Ѝ/+(Mp@-MP@ , `,0 P@PO!@Ѝp@Ѝ/@-M@ @ 8 0,@, A Ѝ***'p@-M`@P )P `& `PVH@H P@:Ѝp"*̟*HA-P``Q=QR`V X@' h @A@pW P jZP @pPpX@A*p@-鬱\P@``w`@@T%800 4T`00 p@̟*LS \!K-BMX@p`PP   p+PBߍ*0H-P0SR0S `@00SS @0P0PSS@DR D0"H-M@P =`P$ pU vp@pP AQ =U `!Ѝ bZK-BMXpX@`PpP `PBߍ*8*A-Mp @ PPTPPD `V Oq R < 2/`P   P00  !,BP!,V V P!P Ʀ :  #<0 `b`]  Ѝ ͦ)(r$*@*,*(*H- M! 0  PP -P -P0Pc|Pfl6QiFQlHQpPs,  Ѝ **h*)(*p@-``PU @5PUPpP p@Dp$*(*0H-P @PPU0K-MP@-PP7  P p `  P0` ` =Q =kP( ~ ' `c Pm P!W  =Q A _ L P P@0P Ѝ$*****()(*(*0H- @P P Q 1/P @0p@-@ R 0`PU0=U=UV =)kPp PkP ` Q 1/P l*0 R=R/="o/A- 0S p00S0W 0R:@`pPU Q Q 1/P`PpW:*H-P`@T p  岾 ᭾@ }@p@T`V:H*H-pW @^P tUHOlPl`'W W 'jP p@ ?@;@pH3ꕴ! A-@`PQp5T W =P @ AQ ʆ 00 =PX xd@ AQ l 1/P PPi +(G!O- MP@0P `̀PPpZ T    U Wp[:L0 g`W @ 0ppW Ѝ|***A-@Q)p`=iP@=i@UPP@@Pʴ`P=P@Pʧ`APR)()( *O- Mr`P@rUoP pP nPVk@`rUfT`@ aT PZ V   0O ЍPQF pWC `   P=XPP T  =X T=X P% T U R =X   pW8 _ᇣ *ִH-rP |zO/0H-P xP@MPP IP@NP xP@@4PP 0T*H-MP `P6 @  R/ pR P   媼᥼P P Ѝ$*"(*A-`@T. PW P   sj z R   02/ i b@T脠**()(H-PH P 3ŢK-p`P+ePfP vP xPP ePe@o8p`hP /o"p@P³PW BPPP"*0H-@PrPPErP0U*\\`lt00P 0(S !S p o00)S R p0KIP"rt~0H-MP@!PP `P Q (P)P .P U U Uo!PalP u P ᠫQ  @ካQ oЍ0EQ 稭,Э ,0,L\l,,,|     @  @  @  @  @  @pt q @[ @Dꠠ*H-M@P`tP2 Q/@P0h0000̰ܰ$Tб@P P@ `0pV @ P#P`'0Q(Q !Qop)QQoЪ@P ʪP@ `0pV  P#S@`'@@nᴪ@Ph ᮪Pc 0#"\ 0"#q~q@P xqOFsq@P@?@`&$oB3x@`t&$@@(m`piV@c`p_P@Y`pUP@@ N`pJV@@$ލt뤠*H-M0 -R  Q Q Q  x Q PqH P  <4 $ ,  0 Ѝ譵|"d""t"@/ 0Q@/p@-M@u cP`tP t "Rq*P P 00@RQЍpG갵(H-@PP QC C `凩VAㅩpPpt`{P @QAឹO-M`P@NT~pDP-PpkPPr -P)Pf lsP8 lP!PDZbZ<Y @P@DTD p@ P s@PPL PP P&PT僠p>ԟpDpPP [PXPZJtpPJZ]Pp @%P`P5 ᯧpv $@UU)㟧%s  jk`P RP:9sP pYDA\ \@pZi9!"+((ҵY"2Ջ #-"Pg"]C" H-M( 0  SJ+(h*k@-M @k R 1P ! PЍ ᦟH-͟%I+(0H-@M?@T P=pdP @T @0@ >|| :x@p 5뀨d0d P` ,PP, (H $@Ѝ00*x*,1;!G+(-mC \!BLq@-颟P  @t   Q  =PH@HHH H0 0P   *t*l*@***(*(+(*(+(*(0H-㖕@@"f 0@S @@Q*lPJX R@@TP,P 0HX*|*)()($**(*0H-MP @  zP   nPЍ0H-PW a@PPK нhhhxx``````` %  pW pW l  lPUPU PU  "p@-P- P`@PiĿ(ܿ  88||(( @G 6 Q  00S) ! 0 00S p "P/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /uP/rO-M-(MP l@U!%^bP EQ [p\  q%Pr%P  |*Pt |.X @*P|@@(|@X `Xp.aHPHHHHHH`P j q" tV P  `P AHPTIP $'Q"Q r A tH 1pp$$@ ` P  L q t# L p t  4+S +S t  0\ZXX hP`P j0S0 pQ Q HP8@X`a,&QQ' "Q& 'Q\Q ' P  M   Q?^n vbtfreQ^@-hgP`P pP PPP \R R PP0]S 0S MS ^R+ -R PPP^S" cS} " &PP0@pp 7TQP @P%PPPA P cl Hq+ t,  0m$5P0p 'psp dTt  +S+S K 0Gt  A PDdPTt  30 , pЮ@ T@ x }ns0p w  0 0 wg   {p p|#pP\P PE `@]P 0P" MP^P -P `^P cP'   `#@ ?P `` 0pp 7S00CQ`n 84aR 6 ){P \P ! A AQ ! 00 nP Pfpp$A AQ  ppR@!/  ך`p LPpp`E& $(ЍЍ垚%XNP pBT ` ! +(**v"ܸ(**}!!Р*****(Ġ* Ƞ*Ah*+([A-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P%`````` @O$````P``HX@@V6 "V? 'V '@8EV@4@2 @0R 6@& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRdXP@"@`EQRP(߷*ķ p@-M`@T" m ヺPpXU @@ BA ̙(PЍp谠*(p**H-`@P p R 0BR0 00p pR AQ ʐ @Ġ*+(H-Mp@T 'P"PЍHKP`@m dP`+P-PlЍD0 (BA V갠*(*7*K-`gPAU:DB<P0p@E MT@@(*Р*H-MP@ 8p[g` 8p UP d\ XAA <4 4AA $Ѝ贠**K@*p@-@P  P R A@tl tAAޘl"Pp<<DP`A"&F0 ̘ p贠**K(*A-Mp@d\Q  0 Pf`P8  0P]`P5 pW1 P<U uUi""!bci""H-PN  J 뤺p@-M`P 0@-Qo(@ -P ( R  Q4 1/ЍpTU"ԺfH-M$ 8d0 }ЍH-(Q @0h D9+̌K<8<@0 8D0< "8 < D,$@@-@ D@09+̌@K<,@8<@0D$@@-@4}0P8 MD0K,8C D/H-M$ 8d0 #Ѝ@-M@(<P    ᾟ,Ѝ`tH-@ p3PJ8, P'`Bv-OCQ8AQ<?Q@=QHPD:QEpGw5Q\3Q`,X @-@4+}8I,( 8R <  <  8< ,/@-@4}8,@-@(P \D0@ )+̌K,8<@ D8)@  @,$@@-@4|0 0&&!H-80HF H-M( -pЍ tH-!pnt H-pot 0H-@ P@0#Phh 80P TT D0P@@ <0P ,00""""@""D"|"A-P`Q @eP  @Qp@-Tp`Q PeP PQ-T`O-MP@p`V `Y: y`T s`U m`V .t PP 'TTY <%AY8Y %/Y&@Y@3Y ! % t ` &X%@ &8% `& &u` &% &`&| &\ <PP   " Y %@` &%u&Y xz! X%qY 8hY _ XYO` &%F &%= 4PP TYP<"Y ! %`YV%o%QPP Y p `%T`% &4Y %u`&  &%` &% &% tY'P pDBHpW 8bpPd 0B pWP Q5P HQpp0S) ap @Y P   y0  p W ssp 0SW ps sЍ迻л߻**#+18?GOXalt|ż˼Ҽټ %-4<C"JRZaiqz"p@-pP@`V waIP :PL << p*!H! * @-Q@&0P@ t -M0S?^S^@0@Ϲ*;!O-tM`@D]88p[- q0rPaU!"a@Pphxxx8@dp !ppʓp[pP a8@ p`=\pʄhD ႛp0(d yp $ qpGP:W W P`(  0p"4Q0J 唑p`pP%P 2PpP   aP3xPּ0ppQ0P  pʨ4P  pʄ@@ 04D9!ܸ(ظ(/ Bt @ht@t@½(ͽԺŁ"gtӽ"H-e eؾ(޽H--]O-M`@_etTo@o  0%QP ePfP hP vP9KP P HPRP dP 'LP PP# pV QQ PU`Q` `X`[ Q`@p<#AWPP -&p+ $:VpP .WP ppPP #P lp`L@ PP,48 7Pp@:PdPg qܑ`@ P200ppLXU K=P9`P$ `H ,$ P?  Pݲ00Z q XP  Xr PU P   3/P P tP pPx m9!$*(*  +(/ܸ(0*,*^1!|WV *""H-M88088 ,0P0 ^$*(*ؾ(֋ ̾@-@P #P GP ֋ 0*p@-M@`9dP #PP`-dP PЍp  0  JO-MM@P3+pk+;d+L+P{P;Dp JP$ JP `  p_P Q  z蚟캟 A@6Q ,0 hh8xp` Z a`p[ V]r N_\[ O`ptc"Pc  Hh 8xGF>< ]p8;"3 .`(_P% #_P5  `p:c"P+ 4   *c"P ` _XJ XH pP : / P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMoe<pQpXPEpUڈQWWaW&00;p pT&,P  ⬗P  PG@P* t4\`U` :pI%@5P00p PPq@UB<dU PP`U0P5 U$ Cp1PP@=P! U  pQQL  U @PTf/TT $  1@P @@S#h phtp@ O)GPp a#PPK4GPJPUi PJP 5oRUW PO Pf`C`(V PPb XT@P ^ @P Op P NP PA!XPA` d2@Pd@\J Pϔkg|DBH<` PV"ؾ( @-M" @@LP l坮d!0!@"pD0" OO@l@D"tI@Ѝ"0H-0@v P P$0H#0H-@ P QP ]P3 yP 0H *p0ȨPCP PPtP@P@  P ( P0(P*edAx*@*!\*`**+O- MP|0X@  Rdd!PP( , @0 48 (4 40 P"!u!4S n!4S g!4S `!4S Y!P0S Rd!T0S lKP= 4TqTa P1  0Pa0p 40 /0S !S1 "P   0 Z:  ЍOQؾ(" &-4;B9!KU_is|"h!BBw!O-M@(P* ,P) 0P( 4PKPD8P,08<Q4<P (ZQ D.$ & ЍP (ZQ 8 R*8` aAQQp@BP p``Br 0v0hS pRa`P R (v߬<Q v׬< QvͬP PU*v` R 0 0R*0 Q*b ᱬp pR:ppW:|޿#VCD*BoO-,MM  (P 听P pTJP@i@[& :1OP(K (( i`V ( ZP  ZP9  YPf   PP PXV  I(@`P ᾪPg @`\V:  0,P 8 pV* 8JP% H`( ᙪP  ᔪP  ᏪP  (p YXV @P T  0P 8 ӫp\ @P({h@x(dV`(d\ eYPd L `YPb < [YPj , VYPx  QYP  LYP  GYP  BYP  =YP  8YP  3YP  .YP  )YP  $YP | YP a`@VP x  eHP:($| ]@ V5 N PP 0FPFPC ?( 03P3, 0&P&8 0P0 0 P L< 0P (4  4  0P  0P  0PXs  0P e 0PPX 0PTKV*V:   0( d"( Q` (  (dVV $g(VP \@`V V P P  9P @[: P ("! @|V`(dP# <g(P  04P X #p@"T:@  4@@ @(t P(\( ( =tP P(  @(l!Q P ( y(@!Q V ( k @(!Q P ( _( Q V @ (R( Qpmp,Uo,Ѝۍ ᫩px*H"] {!.i>LY]hrD*$*"(LD7BG""bp@-MaP@H.Q)`P @9p0[P ,[PQ  &pڄP)PH8 p4/@Ѝp$$喧x*WEVP*gd\*mdͿ0+(H-$00S H Z,+(@-@Q f/M@x*V@-@ZPP PD P P00@[@X  0+(md *O-MS+4 *0ԯ R P̨8`KO놔X @+pkB I!  dfQ f/bMP{4Q ,P(P  Q "1QPpQ: P |PM 0pF\!1QA0DP= H 0_5 P  0SP1 n P! @  @< f/LPɯcP d ߍ*l**pVEW*9!}}p*WEVD* 5h*ؾ(t*T*IO-M`p@ PPP@, P4UP6? QQQ Q Q8/PP@Z Y  QhP h ḧ@ߍ8P 0P ᤧl* H-P x*H-MPV@P  1p WY"QIЍUe<*H-MP;@P  p  X***x*-H- 0,S P@*p@-Mh` R@4T[(0PЍpp4   **^H-MPRP@ p`ᐥpX""Q  "QOQ QQ @Ѝ(0H-PP @P <<P dP@P0G-M@PPQ 0/P ᖦЍ /Pt` 0/p8pP 0,`pP   x*s$*p@-M@PPQh^X` 0``P $O `ЍpL$* Q 0P #:r/ Q 0P #:r/O-M-1MPlLdኟ\h0p!X (  P p ((D `MR SP> @T1P@0@aT=:aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ gP `"V< X " @]0S  3/`@ " A@ mB*    %  p P' AP@haV :^aP @< |xP4"*  0"q "Q<!Q* J, !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! 5,,C 4P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍL"`!<"-`:"T*ؾ(4*DM0H-M@P 0厸\ P Q Q  -IQ  Ѝ0HЍ/ؾ(0H-<<<@P  PQ `0HL"`!07p@-fMMx0@+p <4< SPz D  0 P yP<<fߍۍprdAoVp@-M\@`X\ 0S  P nP yPbۍp4*!0H-@(( XP 0Hؾ(t*T*O- MMb% XuU `P!TpY P ?P @ϢP @ThP:84  @@@  0/p4 P  #  MT̄t `@(p P  P tThpt `@( p P  tP (Tt `@, p P  [P ,S堃s `@0 p P  BP 0`S<\s `@8 p P  )P q8S؂r `@4 p P  P X4Rtr `@< p P  P ?<DR@r `@$kpp P  P &Q嬁q `@$RpW P  P  QHq `@$9p> P  P 0Q䀟,q `@P  p% P  P P@倀` PpT P : {P T Ѝۍؾ(t*"(_"Eh$Fn3Wu"p@-M0@  0P  ëۍp 0 XT*ؾ(p@-Mt@xpt 0S  PC@`P 5555`ۍp8* iȜ 0H-Mh@ PP yPP 0[ Q`ۍ0O- M@P P|-X `@p`NP@pX P`P1 CH^P`H@UOTP:daP `pP @P` XXX 3Xp Ar Z*TNP@`pP @P` XX @T Ar`@P`XX  Z姘 Ѝ!p8ؾ(gH-M@p $PP7 ߖP`P_ bQJQ#KA P[ 9:::::::8::kA P 9:::::::8::D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0Mă4#p `V00p d%Ѝ/-@8*N]H-P@ R!0 0  0&DX   0DX  0DX  0D ᨡ( `, T0 H8 <4 0< $$$ $$P {T w  0Cl!R@p\`Pp `pWx 0CHE "r)՝"6AFOatCu"_!O-MpW `S 8@T,PU5a 0%@ !R! @ Q\>D?\>D?D?0>D?\>D?D?P?@ IP P=,,3: 09MGM@N"T@ 0@@8p,PnMDiMpMP"@ 0@p0@a T0@8"  8Q GM <P@PPY+ ហN@8 D MQ TTH*TTD  8@ M  @ v< P @PP+8MQ @PP* 0BЍ++**  OXf|("t9! H-`@\(P'P9 0BP p 0pW:HC@-@< 2/R f/3D0WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:pD*@-@8P wf/Cp*@ 0S3?S q R3WEVD*G-MP)ڤ 0P0 Kꈀ刐@p P pa `;`@P`XXX pGwЍ<*"!pؾ(A-MP dd0@T 0xAD DDP`H0p `F vؾ(G"4 K-M@`LpP Q Lp||`   ;b`Pp  `2/ЍK΃    G"3<*@*@* K-MPJ@P ;PC* ; PA*O  U`P8pO "Rq1*w1O  P&O"P p# 0 ` ބp ЍT  H `T0 8$0  Pyd@*<* hO- MMP@($hKP[ cKP ^KPC呄p   P} 开帀 ₄p Y Ġ (ƎP [(DC Q P XT 0`pP @ppW` 0QBBR}  7p X  p@ 0(X RX pRZ` 0㴑`A pW X9 `XP KpXP&;$3F p  0,I P [A 0> 0V`pX Ѝڍ ` &t0(, A&D!/!@*5ؾ(Xwd<*nxd D} wy! @-MP@  I:P*DD wpЍ,0( O B@*{dЀ<* p@-M ]p9   : 1P @`   '         t   \@ Ѝp< @*td@1<*H`~9!%$H-MPxx@ p P`T 0 `<Ѝm @*zd@dr<*Sp@-MP%@ ۂp , ӂpxxI@P ` 0GH L0C 0 Ѝp7  @*d@d@<*p@-MP@p`hIPP XbIPHo"@  │pЍp$0  l!@*wd<* O-$M@䑟Pq` IqP p eP]PW儑 @ @@]p аP Q P*dP> @p  Ep Q# )0 < p0R0P P`0p   `@V:Ld$Ѝ(( /ܸ(@*|d<*8WD 9!U*@-MPH@D 8p  ,Ѝb0@*d@<*| p@-MPBPP? @`HP HP HP HP)` h `h`U\iHP`HH 坁pЍp00, u .R p @*ud<* H-PM@` (KpP( }p (KV V( W ` 48 eTp` H0( DPЍ(4 6 1@*}d(@<*T"@-M@ P PPH P<<  5pЍ 0  =!@*vd<* 0H-*JTR0O-\M@PHK\e\p ߫cPQ@Q:aPl@Q W\ X\W\W\$XdP plW ER W rGoldW Pp acWoW$PdWc lW Q0 -PQWD RWD SWH@ w7  ᧀpMpWM rW @(J a7Y   [7P@ @֊P `PUpP@^@UD`@< tp(XH@ 47 ep  @ '7 Xp4pὉ@ỉXX"Pu Hu@ r4"0rPᏚUn rP@QiΊPf T H@AT `>Q吱 `     =P& @p = P (Pᕊ 㭗S@P pX  ~嵏Y*\Ѝ3X  T 4 `` /ܸ(&v}D"yaratcidؾ(  |D(iZ{DM~D?2)RH-MhJ ,$0    0>ؾ(O-$M@PIHXA  F6  vp= `ᾉP7 p  ip0 P/XpP`Y ?ZU8VT  0XY$Ѝ D!@"i I>0H-P? @P' P P P P2{ P P)៓ P0HGV(@0H؎} 00HPTX0VhP0n4 scidtcidrbmngntsyaraloobm o.",O-cMPo/00@ϟ娯00/0p☏嘟o40,00000(` PTŚH=\  R w  ?B   Pz:g`P [/Y:P pP  pI 0W[ /B:P9 `6H@~D0 UP |P6JM~p  4` V. V. *|P UP# | D`P  p ,V /9PP  p (l ߨRP!a@Qj0d0fehh$f0ahR B ?0|(p,00 4p.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rl 0 P H U,xzp  k4Mz @ T 0LP 0-P P ]Ln/9o,U  @E,| ,P P <|l\ PP,0p`0p`}0  P  P QP   1QP |/nPU P @U @**P@U@e@u8؀P otDdq8l*t* d ђP: ?@PEQeQ@+(<+(*Q  P@PP[3 [=J  L r .|**" ܸ(|2P 8C0c4llsP?  D0P PPP   0P PPP 0 PPP P  P,PJJPU@P $<Y@|P pdR8bp? p ppp @P 1!P !TʘH+(<QQQ<P`@Qb(><0@DЍXRLO*9!x*L*d!P*T**t*ud*(!*? v l*p*{h*O- Mp @ R,P1Q-t ЍOKPPX{K@PbPP 0PUP  Q P 0 T * 0 ЍOP; FKtQP5|t)`p  W  0*P Q@  0W   0*@plWP " RJQQtJdP ЍL ЍOh*T**x*Q@! Od*U\xH-M<<Ppy<,!,1, 0@L0n$!1 0@$0cЍH][J0P@ 0` p`PHJ|||p|` 0p@@ Pp8XX X ЍH0T*H+(z0 D+(****P l*p*h****GEx*l M0H-M@@PP|P P p @P Y@oЍ0H Ѝ/ ؾ( G-M@Q/ Q, pP`% P%& \ 0 p \< ) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ*x*P*O- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ P!}(K7B\S BP}(;7m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @zP4 U ,   %Q QP P댰Pꀰ!R$ @@0 Ѝ47**P*Vx**q0H-`P@T 2@ u* $@00x*O- MLp`, KPPؠ*@AP 0U $ 0 W PPPP@$ Dm6U U E㊴` '*\!` G l$!$1pn2 @f2G Y [2p@A T2p  Q@( ?D+! ?8  Ѝx**l*p*O-M p> pB1!?! goP 0:.p  R,ЍO2jKjP 0. !  PG,P) jP Ѝ<+(D+(*O-kMM%嬵u崕eEP-0 800  ecPd @R/0 hhhhhhhhhh<ḫhPP- TPoP :` p :'P @T" 2P" @H   8@$,  @   7 pcC3NPQ nR R oR|ᔂXCP   L ኂP@Cep# U A`@  ᮸pPp/C(P P"2 Ppf%PP&  ㎸Pi p\@~1P Dy1P 4t1P\  0P`:AT @PY.;㮾QpA  pjP .jp7 i^/Pa@P/"P,*<Y+i밐(!(1`kߍۍX/ 2 &xd.$.| |>!***m /9!* f*B"g **ܸ(v!~  zd@*edAZ #D#  < + xH-`@P᝹pxu  p H-4 0~ ؾ(\#A-`PV A/p>/@᜹( `0rF``{ p@-@P3 P0P 0P 0P#`V P}0P `VpP \P P`V Pg0P `V@p ***O-MM0@TP `E0P `V@@l:0Pd \ Q vT p  0$N @P8  րP0 Sp@`@ F[`P -P = q%P p   L qᭀpP @ @  a "V  T JpBP W ehp @P8 P x xV @ LZP x xЍڍ p P P!pP; ,QP 8  ˁ @ P j/P7 ?0010A4,Pp[`  # r3P [   0Sa3PP | p NPlhjh9!*U !*)!B" * !8#-"" v"  q 0/**/*/* M@-M0 @    ˁ㯾ؾ(G-p@Ԑ3QUP `Q P ῔tu`UP UP @2 $s**+ * E  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    2O-uMMرN|gp@ @, fp ppJlgP-JPJn@  P*  P oD @pP   p ؼpP' ?gPZ'%8%<5" #P P"gp   P 8D4(l uߍۍ*" *p F V 7 H-M P DD 000㫿 0 㣿Ѝ*  H-Q 1/ gP*0H-10P0 @Se@n11P0#T*@-1@Sa1^11@O-CMM@ (000 $4t0 0尀p,IP `P 4/P 8~P P0P  Ꮏ4PY  (`  06/PR $P , P ,W WPYPYs C/; 哺 p 8 Pjf`ev ᐰ +H * @  `V P  -PP `ε` ᩵0ş 1凼<0A 41,Q,! ؼo8@`PμX3!@Ppp W  AQ  P  mWNW YWyWnW Y@BߍHЍ/t*|*P x* ؾ(  !G-MP娣c  Q~o b@p P  b@PJ4W P  (P "trqPP\"QQ:\0/`c\p P:P   0`X  0p s`M PU:P s:`PkPg:`P^ `WPT: \`KD pP  @0` ;Ta 㣻aPЍP+`xpW"% %UV ( PP ` ` ` 0M`QrUa Dp*t*|*V & [  q   l x     4 \ O- M0` bP pW PXp|p1pPPLp `pW!URQ <WIr`lr, @THP OPLQ M 0 Ă1@! PX0@0 ,oPoP DpQD#r rqXYx `@@ PM( ! `o 0D p Ѝ$^$(* X+HP#,30 4080H$ 00 C ``P;L#HCPPP , (pPR #0 U($!#0Ap$ 00 < `pP30P<@/lr X X $P, ,  RTPL@'DPB QB* " ,B.0p40# 40   _PA O A  P3 X4$ P `0 R  `eV#3 %q #q "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@  /   RRaArrAa !  ' [   4    s Y H-MpP`n@P p00?# 00 " X_P0< @0!10'# 00  "_P p pЍ  O-$M`lp 0@P PRjP p* P PP7 L P p@0 @P` Rp@0@0@@@ LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:opo$Ѝ     n G-M@XpPiP  d 0!!  X ^X Q $x jor Ѝ  0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! 0 0<P  W ߩ0 P/ p5/1/0; W "O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ 0; W "> * m 9 !@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍJ 0; W " K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q ` 0 O- M`XP@ gP n'Ul L p $ P&#t 6 H0/LpPWPwPP    mPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 *!  P&[ P @@ Y:@ll@ Ѝ7  O-MPpP@P;:`@Q  Q P`V:&  e 0?@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P *6P PP:"R PVB@Ѝ40`Pl`<@K !r",; A-P W@Bhf`V` af@T@ |P p!00|kd(KHfP& (K%D8Q:PQ*" P:R R 0S% r:kkl\`8P $ 2 p p p **** % m P ,  p@- @T 0@00T@@Q p 0S @0S0S8P8@@Uk(`Rk@@p*******G-`x0X@XPpP  0   p ***O-eM@0 !P R:PpR*h XL8oTHpP$\ 4@0P<@(DdpPR \0`0C !@Q@p0 a! ,`0PF zY P@ 2 Y`0`\PL@(dp( Q Q ( @HP YF iP- L(dpp(JD"`PH@ @P< 0lPB TPD @ P* P: ```0PdphP(`0((^a@ PD``@@X 4Q$P; X 8TRpW p T1 K|$  P | Q@ P @QtQt9L@@ Q.  0 p R0 PHJ QFP B @ `O05$4X0 oS8T4 Tp 8PX TQD``P8@@p X @P< 0@@PD``pT  Z3q@ pq4Q X 8TR TX @ dPLq   0 T } ,4hlXX2 \ D`T8``pL p;TB\@< P P0pD``!T2 8|`0 @QR g(hpX;`0L@P"P8 X HTTP P   Lq  !<p q``0P Pw P    XpTd | X  D dp$ Q*T 0l@ AL``PpWP pE@P?p pEPT0U: @ T:U\PL`*  @A0`PpWPs pE P?p pEPR0U: @Rd:L`U*\P p0SPZ 0pW?p00PQ Q:M$\PPP*<  Q0 ; <D`b Vi XP v|:<u | v J!T 0PQ dPLp `EPN  `I E\PL`Q*@dpD`X _d 8XpRTp T@D`P `@IWTp@` XpThpXppw`0 @Z`q`0W:PPW*<  `pX`0bP Pp)W W% P PW!*<dW/* !T0`0P  ' ''$qp P P.  `)(GPd Q: xt`0P PpAdPD`Q*<`P B PR:``0.Q  ~P+ D``P@TP R pP GdP `0 PLp}" vpP `0RV Q `lPc  PLp"  `%Ka@P  K/78$@P  1D`aP #`0@@PD`=\PD`\P<Qm*Q1  dP PL`0p ``<`"PD`P\P`0@gPphhX!`L@(dpPDP>  L@P<@ b"  dp@p0@,P 0a;` ! e"@6UP^0<@dpPPY h\ "R:P\ R: Xp0`TAb!HB0 P<@0aX ` TR8pp:p@p P   0P@p PDP  0,@ 0! B TPY\eߍxl 0*   & 0 *Y   "   D q  K  ***    g    0 H  O-OM@ &`P ܢPC RpWd`PT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $\ ! "d  vTdPpPUP q P PUPXp`SxOxMhKh @! 0P_` d 0QP,Q 4 f  0 Lp0  4 4    P ! Dd  Sd`P 0o`Oߍ) **w **_"* h X D 3 @-@P Le*A-ppP@/`P `F @DT*dPU@?d*O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0 | ! * p SP" [* p 0e ! l P `SP T D 0BT Ѝ*  O-ML@P HP PP+ Dp $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 5!0"+"D`6oD`##@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,E0ЍTU  +0 BR!q p/G-MM`RQ:@ +  T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  (P` Vl# 5_ Pq  0AQ p ЍE LABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?'T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# l@1/p7 4P0PP R000 >@ 0@@ ` *@P .^;  Pppp ЍۍQ0Y X++8+++0++++O- M @ ` 4  R000 =p0Pp3Q  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`ܻQN ULVI  dPB0P`ǻp`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ++X+0+ +H-M 0ЍH-AM`p(@P/N  0P@AU:P: @;P T0P ?s0@p:48 S /$/Aލi P+0+!X!| r G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF ɥ@PQ u ㄥ2/P $Pd;P Q P wpЍT D ЍG8 P wppЍG0+++(+{ P+X!| P+(   "  + +O-|MMBNX ^P` P /r 6* R . c pP dP`5 L#D:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 =#03p@$ P$`4 0S R AqR AqA"tvPQ y a  0 [ Q p  P+?PI p `@  0Q t `@P:f V<S @  0?! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-x]"e 0P0p$h`S?BL? @GR q?p9?   0T- p  0ȣP{ ㉣x0+ | X!+ +9  P+P+(a  T+(+. " @  +K P+Y   l O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR B(Q 8B r4 0S @PPPPB9P  @ pdTQ p H24 P0`  O 4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `+0+X+p+(++( ++X+(O-MMZ:`P 0Z0*0V0: V* Hp@J@w`` T)`pLWpPH<0@X@0 W t0 0yWt  (`_ 0; W X a Fp 0WV@X P F@ 0TE Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   & P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE  ( 0`$  p78 p(,tP 7 `X%p 0 pR"  h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg J0 ,07PPPT JT0P q0?Ds`Dc00 Q(`  00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) P$` P 0 8@pP 1qh 1H!0` R Ph 2/$B2/$`P $R?0, h PƟ$B0, 8 ; sG)P v5P  xd ̲QP $$! ",p㫛 ~7P P $@$$ PtX$2 p PIP $  ! R  $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R PPHDD  h+4+ + +$+ +0+T x L +$+O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0%`? ^6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @\5)S A0 0   QxP v``\ p?L/ 0ẚ0 0᳚ Ѝ@+++ T    O-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰD?k#"\5 @++`#S !p0ϠB'`r! xpHF d0! T!Q0ϫQSp ee7 @|"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hp] XoPp7RPEuPp7IPEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P   T:@ 0  1<0h,Q ЍT0"h+p+x+`+++T+++++++,+ +0+++ +D G-00`P@ J< !``0P0p P`H p8W P5a<W0pT 0P `0p@ P` fYP  0d"8b"+g X++p+h++x+ ++++++ @-@P P+O-M  @p WR ]0 `B?M P``P0V8iJP]  ?t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q ppMQ d 8Ѝ ! +0+++++++ 0H-PT@ ?S@P !# " 0 0!++ p@-`@P TQ HP`@^OV*YOPVOp+++A-MP@`pBW(P q1 Q! !G`P H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝ0+#-"| X!+ +k h+ ++x++H-P 0@U :xP:@XTP HH Pp Q 0HP !  Pp P 1志PP qpⵗP 字`Pp P  l0ភP(Q 0!4H菗 P+ + +0+i u" ++   @-p @08@ T 2/`@0 &  t  D SЀЀ0+K-@@P`V D4P pP 1QT 2/ЀX:P 6oV P:pPa0+P+0H-8 B@$|0@P@00H-M@ Pd$0  P @ ؖn2 AR: Q Q Ѝ0!  - O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p '!% U R-: Q ``W`1uKP p  ! P* F00 R0uP Ma1`$\5S !0 0 t  ?[- `嘄Q P QP T  \ P PP 1 0 p! Q\.0 p؃pG pL$  Rp$4 G  $*|/lP  =*Ds  X  X  X80 p /W "pp R ;} z溯tQL 0P(r z溯H<emD Rzd (0XⰠmt!Z !? T pb;wr0 RSrQ 0 Z   0   p3P(& dⰠ5tP 1 ? T pb;wr RSrQP  0 0  ph||| 0Ѐ Q 0 $Ѝ+P+++D TX+0+,+U n ++ +h+++O-tMPs0P 弐4#@`(3\%R !0 0 S  ?,  Q P QP kPP X@X$x dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , P @ P$0`PQ d h0PpppP PK1P  R0V : 0 mpp!Q\.0P p@Lp$4 pp $   $*-`P d(P P0@0/ PtЍ(`a++TX+0+,+U   ++x++h+++O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PZP YP" 0 l? `R w Z2  R4 @a00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  p8Q( 0 Y *NQT 0 J w*  0 P  0q@P p@  0qP 7@  0dP`0 9*JZ0 0PP Ѝ +0+ + O-DMhh` pVWP ,PV@Pp0 ` W ` p   hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R l,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `6T Wp  / @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R  0  R  9 0 ,  $h T 8P `",00 08?R00 "<@ R 40$ !   ),@`(  0P  0! R   0Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P  k 0]倁, P 8 0N 4`(V5 0>`F4`P@`pDЍ@@Q 04 $Tu  0 +0++  +0H-HP@8+  0 t(@0@0+O-MP0@,8P 7!7u$4dpppp cTP!a@Q'yzLzz}z}}}}}}z{}0{8{}}}}}}@{L{d{EP FP PP$UPl XP BPzp8@Pe (;P_  0pb JX p PI x PG hc 0XP@8YQ&p m0  R *tpn  ghpaLTZpTdPKpp R`Y P  `P Q`pPUW P^P YlP ROU3@Q]ګPPXX  0/ppJk`F6T@bT@oyGJZ@P@Ѝ+Lg +\ +++++v +++/+ +++z? T+(  +   + ++ T"+   ܸ(D.?  +H-1 ؾ() p@-M@P` nQ QЍp  0O O-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0 0d@!!P 04$03 0 ̳匏cPe s$ @R 0  vPP 0 ,po0So7W'|c4@`/8P@`u/@p2'P# ` X0u'  0  GP APU B 9PU BP .PU B 'PU $"0000pRP m\b @04*W<y(0P # bP.' ,P ApQ E ,pW:E1 0 S P pVlP@P& PDIP 4DP $(P (  00($0@$@4P P)4@Ѝۍ++f p (++   + +  ? ] ~  + h+`+  P+5 @+I ^  +  ++++0+$+++ +4  "! O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@nHL$00P(Ο_^A`NP`PAUP Q pX", tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  Q P QP  hlQH@P  X pd,`4| 0` E0PPVX`Az T*d@A`0>P p(@p,ppu`:hp(\ l`pQ @TQ`P `P  (l0h T0  04%TP p` phpPW POK00!  Q :0QQ: \RVO:\P P 0l`hp< 0o\@$"P Q, ,+؋V@(0 hpPX XPS l@0 C}"PQ0 @,/-h ,` DP1  @@pwQGZ"hPBl pR4 Q% 0# x\l`dPY`:@hPQ 0 ? ? 4`_P`LPp0 B?qJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@ԋ( T`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V?  pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN<P> *l`L@h0`P`D 0>L:0ST0= P!  P z 0.* RT * P P g 0 t XR 1   P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 ++H+TPtXdpP4 `P TP0 `h@ \R 1Q Q  0 Pn ?PT@\jTPX \Q 0PP  TP0 @zP@PU  8`+h+$x+t++ؾ( TR\ 0\% 85 =LpT ? pb0 RSQT   % R ?<0t p2/X+ +@TP@ P 4ᒡp  %PP l$ R hp 0+,+DhQ 0hp 0! +  0 P?P l  `bP  PQ # R ++Q 0hP 0 &$( Q 2/Hyx-++P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,j>Pr pYXP*(D Pp/+ 8  P P$ XP$\T T0 P@T0AX`+qX@`q,@T:T pk@T0gp` @0b  P?Ѝ؍| GCkX 0( 9H  +h+U 0+ +t++ + ++++ + +L &  t ++ ] p+++++   ] #    4+O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;9PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P W`t`P d lP@PPe<`P  ЍP ゅ$ +C +] +H+k" +++ f Q `+O-lMPX堡1 0 X,QZ x@P Q  pd,` ( 0`]Q4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ+++t+j ؾ( +0+O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp Ѝ+k" +O-gMMm"AP ܣhĤ\h v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPZR , , MP "( 0|Y|I,x9  XT!DP8 78 X(p$А?@$P `pH@Qdൾ$ 0pp(P `P4`(P1E((PZ4(`  (RY Q_ ]A_  !'( R   GP f@@d(P@ET(PP& (R Q 5Q , Q '     4 84PU [ (@  0 @[- (@0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  TZ X (@ n X (@ e (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd  @   0+ ++ ]  B +++t+ ؾ(X++H R4 +"  4 8+ Y +n  00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V PJ {Q 0KQ!(, HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  (@p P   A  PP@p`Y`Q 0\yQ!L(,  (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qWpW P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0GP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h` >B&PQ `@p  pP  0 A@ 00n R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P TyHPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  ++0+P+#"  ++     Y $ < I +a! X  ! +V! +! +  :! Q/0/0+O-MpQ\`s/0 AL0 Q @K `PDd 0`LP`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXUp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍ++t+p! ؾ(+(++p+P+!  +0+ha! bO-lM@Xc,Q B Q pd,P  0P]Q p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_ 8L`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  0) ` 0`0 6 Pp@Tx:,`0@,XO:lЍD 0!+t+! ؾ(+ +0+g" [" { + " 3" +o" O-,M<(@p`P? "$P4\%R !0 0 s  ? Q P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?H0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!5,$P p@`YpUW(A*eP &P P@ P,Ѝ(@ 8P `P?62 L` e"cc`c `US&Q0++TX+0+,+U " H++`+++O-MMLLPp@$@$PdpQXP-$P'NP 1PXP N.$``*P v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pPZ2Pi L,pPP*k  P , PZ pLq P 1PpQ؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@$o PP0 XPUH%@ 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Pkh0 P|p?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h  P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ 'P G@APd$P8 2P`p(@FύT@! S0! R !X  xPh PPD,PLX PJLp P2 PAP!\$$l+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dXX)QD! !0)QHPE ++++" " ++PET d  Pp#  EP $P`\!08 818`VW$̷P1`P. \X0 p`  +0+Q $UQQPQPUp0 " " # " 0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  P0 P · A(h 0@>y\P  E*{P  <  +P 崐 ^|e|E p,pW:+U d  `P%PDQ\T P# XkP d .$P\TQD  D +H+ؾ(t+P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ 8P: PP5 0,"P\QL  !e# TX+,+# H@%^ PK  P D0<@`400 000( 0000$`,0 0w(pP 謀0 *(J|P   ߍ؍++h 0 | +++++0+'# +U H+Tt+X+0+# +8 +# +# +$ S$ +w$ +$ $ $ $ B# K-Q PPpP`w`@w@T MwP V:^"4% O-Mr!n bR@1% P#  cw*CCP 4d  ,  P P@P)  %, %*rP 3  iPf@UIT ЍЍOAP P P,++[% D% +(s% ++0++% % 0/++/+/+ M@-M0 @   _x 7ltؾ(G-p@ԐQUP v`Q Pv |Jt26`vUP cvUP @| $v0t+++ + E  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    sO-uMMرN9p@ @, p ppJ)P-JPJn@  P*  P ᐂoD jpP   p rpP' PZ'%8%<5" #qP Pp   P 8D4(l uߍۍ+" $+p F V 7 H-M 咕P DD 000hu 0 `uЍ$ +  H-Q 1/  +0H-0P0 @@+P0# +@-@@O-MPO``(ipVڤP 0  P  P `pEPK P Lu尯o         P5@ K5`X` E5p @5PT WV!<4 4 uߍpڜ|t P R `T~p 8~LR> JpA@@PV 4MPU/F+\P p)ʒP!" x  RYP9 %, %*P  P tI tQ>Y< `PvH/H0DSm4`PhX PPb8 r? L@pP= QP @ %PI  R>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ౝ[^ `4P\ X[ QY D0p8 8Ė<\S$ P -@$PA` P9  @0X# *PET : H P h @X RQ!  @ %_ P0 < %  %*  P  P:= P *0  $ P ` <dQ:( P < *  P Aq P3Lq+ QQ%ڈG R hPHP*}  P > P 0 Hq& F0 aRH dP P*M( o  P  4 Lq& , o F4 aRL 8P P*!xC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | Pp .P* P S Q,QS 0"!& 0C04eQ P P*$ P M ( (R xQ+<Q) xCx P< (%P nP P*WPy DP  H8%<5#"( u8BH0/S8<%  <PP*%G |P  @L@%D5#"G BlQL0/S@D% < P0^P2* P @ @ @ pP ++ ++ ] L0N-H@?@@_!0/@QP,%R{PPF G+++% % +P++0+++Lq4 QQ-0N R PP* P B +P& % % & Pz |.HPL0P4e00P@ XLPTs *%P  Dxl``PTp 0PpR 1@L) /Q `V*Q:QsP hPX'P y q Qt  cP PPb W [) ) @0p @p 0yP@}@@`D r F? ^@D`P T P$"Q    YSPPT"2rRBpP@mtpqtQ QLR@  m! !1`ppppp* 0 p0pWP!p01|A0 R  h!s0m`Ai"P@Pc"0UP 7k5( ++] ++++++g. + T9& ' +0++,+@+P++ +[( ( / )  ++%* E* +a* * +* +H+++++++++++LBAL, $, ] # Y, / w, , , , X++ +++ +++ ^+ ;+ + * * X& k& & & & & ' \/ 5/ / . . O- MPU to*  0@P Vp'ʈuppphh@ ?WP` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*P D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%W!\b ? D PU! lRBF,PPq Q*P _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h @P *,!\Q\UzP P @h Q p耟aP0 R DlP@pU:P@@]00|+++- P#+- ,++)- +H- +- g- - 0+- +8 T+ +0+++/ - . ++++- ||   p \Q d Q\H\PQ 0 \Q , Q/\/++8 TT 8+! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R- +H-P` < @0X@\p< p X@@0\p?φu/ ~h Hp@-P` @ H58dH5<58@<5D5@  D5 PdH0E45 PH0E45h p@蠺H-\%QR R#  R UFR R R RR  +@APo dRdP  P@08 <<TT 8T8 T+8+0+4+,+P/@-,@P xj@++ R. @-x  P  /**B R*"&0r <@3 0 @ R P qRj0++/ H-@P P jU lPQ`pM\PU4P 8(j(#j aX@PPPup W  AQ ӗ P  mWNW YWyWnW i pyQ0i+/ ] + + 0 (++0  ؾ(O- M@ @ 0`@ )Pb P @A )PV P @\TT P(@poR )obW[ X5:U V+ (DP@@ZP P p 0`(p )W [oRob8@,@  Ѝ+++X+++ 0 H-MP@T d n<0> ^S>Q`p'`&p @T@T  @  0 00P@@ЍE++<0 K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ++ +++O-MP PX `@V T p,@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ+S0 y0 9!++0+ +O-M`@@P0r!p   /P0 PS X0 @`hTB4p   |/ R+ [Q ᓠ 0%@ / ' ᅠ ?  pp 00X@@d0%hP  `Z gЍ+0 0 + '1 O- MPJp`0@Pᐢ!(  /P Ѝ 0PgT P/ P & 00g P`U ЍOg+ 51  +G-PHP<4PJ,(PP? DP ,PP  ? 0ꬓFP$ P PJ ԟ ? *thP ] }0SyYSsSp@T TQB  PF rARP TbpNP-+pU @ U`P# P"  @P$T$X$*@mP . @ PcP Zt!@@*F\hPP ׻ @PP D;0!00*'IP ḻ P @dP 0 f>(e Gb LA++ ++++++0 0 ++++0++X++0 ++  22 +2 ++1 +++0 A-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`⬿p@-`D@PP f( 0Ppc+1 ] O-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppPD"\5 S !0_ 0 pb\B  ? @@Q P QP  ' P PqPz `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`嶾P Hx P P PЍ, ++@+H+TX+0+,+U " `+++p@-@P@`@  $(P  p@茻p++0+H-XM pP`X@DP` @/XЍO-\M`"p&P@ m!Q@P*  XH$% 84 \ЍO& P' `D : @`@D - 9@K DP/  T `X H P4& ?eH+\Ѝ+aY ha`!"0H-@l P:\0P VD D1S00 0P++++(1 0H- Q$P@--.-@HP TLP @8 P 0q +X2 a1 i1 /t+O-M@\PUFP PJUM PVP V.yP P8 Lpq|Q `  ` Z pWQ  pW ׸  80H  \ ?p  `h / C΄L0P_?q`0P Pߍ+d2 ,+0+1 H-P|@paV Q PR P  `@+1 < 0 0!R  R//+O-M`PL:@PpPE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ+^F++++ @-` 0!% L#R 9.$P% "  / #"o  +^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WX#x##H-`0S4444 0 B A@o <2 2 H-`0S<5d5P5|5   B o 2 2 H-`0S565600 B1 B 2 2 H-`0Sh666600 B1 B 2 2 O-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MpR `r@Ph rr@X }P `P P  pf (`:@P 0 0R@P) d# 8@V p% ֋ 9% 1!+\4 94 0+4 F^^F4 +k  +|4 4 .  5 ++N!5 /  95 O-M@ 0P @Pu ܱ0 Tp?p 0E 0RpPX? @`p  06/  F  `ЀZ  Ű%$ @  Ự$ %`P@QPQZ ᥰ@P` @  PPP@QЍ0++5 G-P@0po 0&"0T?'!\!0pp "003`TPVS` 0pسA/>` ! `Q 0 R-JXP 03?R! 1w R o pP d7\P pPT0pp+++0++6 5 +/  +O-Mr`V1( !V   嗾P 0D0PP !V 3YXЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P P  Pp W@+9% +>% ++5 ֋ 1!RT5 +a6 5 +O-LMp@Xp`P 70 P> ,pxP p(PРP8`U Q@p '0$ H ! Q pU+* # @" p> p $` p @p #$` 0 P`,  `NP rP d P (p (p $ LЍ0+&6 +/  +0H-Q@!1 #R# @@P 53@@# # dP@L@P 08$@PW+^F5 +] 5 5 O-M(`,@P 0V` 0pP @h`0P " Z tP`pUЍA-M`p@<(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p       p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 ZY@VYJ WW: S p `y@PDp&Q:  PRPX ( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0 E  xYO@\Ѝ K;SSQ;D44 $80, (X,DS;!SR00;S%PU:A3 U0 @@<`E4Pc' &(@,TpP`0@$@ H,$ P0H`LpP,QW Q QPD@ p4a"0SQ@<8p<< ? 400P P@TpX  # " P @D@X p8P8D@P 6@[48ppWqD@@ PPPTP PTP` )T PPUW D@Pp T`V !  PPp!TP=P:D` A "0SqW*P ? ?40 0P 00#`(0 D08 R* B8 Q   D`PUYD`DH Hp'&,(&' @ t 0WO@Y@4@ @0 0b+n6 LBAW6 7 7 7 6 7 7 MBAWNBAWOBAWn8 8 8 M8 @-@,P ` T,y,&8P0@n 0 +9 7 :8 #8 @-@,PTP Y@V 07 ;7 M7 0H-0@PP 8 R B8 Q   :04PU8P0(( ,02 z 0t7 7 8 #8 O-M,P/ `p@0 QU    0"P  PPU@@4[ Ѝ 0F 47 f7 N7 O-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 0K 7 8 8 H-,P @NQ CP\ @`P'`&P @TQ$$ (0 0a 7 y7 7 N7 G-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0q 0s a7 7 7 N7 K-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0~ 07 8 8 H-M@\$P p` DD 0U$ 0`Ѝ+ +9 H-M@\$P p` DD 0U$ 0`-Ѝ++N9 H-P ,@rP NP8S\PPQT`T@p  T UP pW+~9 +9 ] +9 @-,@P ,Q +H-M0P,^Ѝ Ѝ+0H-P@ApX Qdd Q 0 D`QaQ 0! 0 +0++H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*GiP ة @!. p   0[P" OhPQ \XTA 5d#, %*47(P ᦩA @d AR *a#BP(:RQ% Q UP $@ d#a#*l`P t<@ @Ѝ!R+++: ] : ++0+6: +R: t: : O-MPt` (T P L H D @ < 8  J `; VY ,+2 80(`?"R10`@@8P? p oo4'@8P-`V* Z V, Y 8$ m0 P!8P , !$  0 !( 4P , !$   pW75 ``$@F0*p, $ 0#p% 5p X p@ X 4(< ܸ(#zd@"< = L= \ < < < }< g< P< 2< K- @PPpW ` d0`W0 Z0 0KO-M`PHr@ v#pPApOPp AP4PP fP.pWppP"~P`]P [P TP  0s@pM pI Y> @E$@@ 0@@H+  0@hP+  @IU   0   0 @ qpX DHp@(@Ѝ{= ܸ(#= = = = G-`P@tq "fP p rP@@P  p  `P  U GoP I`W $  p VP$  p Z `P$  p !(!ܸ($# > F> *> = = Q/H-$ r0Q0#1"$#8#O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-MXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BЍK-Mp($D` #P f$P 0#!  > PЍK-M@P$i' 0 !`  P`ЍZ> MH-M 0 0 cЍHЍ/O-M p@P p 'P H`t `Ѝ  Q 3 P`rQ "$  R($HP  z  0V [P PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ ` P [ a w P`| [zP@`Tv T( Z+ ፞P/ pD 0 PPT $@ 0@PP  A P P < PA P@ PZ:9Q $ 0#s'18#> > > ? ? # ? > y> M0H-MP@ 0j  0YЍ0HЍ/M@-M@P 0 (QN" NЍ@Ѝ/+ O-MPp`PO @@d`LH $<08TP0$40 ;,(ZIp P ;IIpI p@ p H  P PpW| Р !x p Р p@|y,d Pn$tРW|p s   0`p 0NVT PM+㚫 i/KCP l 0` pE 0 pq  $F   0PPp]  0PpV P? V0K p pWyxLJl@pd+Ip785갤崴 0㛹/  0p,'<& pp ; P P $ R*0p|PXXp @ЍN? d@d@? ? ? ? @ `@ @ @ @ @ D@ ? ? ? 9? O-M P4P% @ UP!? "R R$ P PP 0v ]P `  0i`P @  0GP   0U  0 @RPm P 1SS@[ prs,|` pPp| 0 pXP!D! 1S SS@H L0  0 `p* 0 P P @ \ 0`A 0 @P*`ЍE E E E E F E y> P/@-M@BBQ L 5p 8$ Ѝ@/d@@ A K-@`P p ||PL ؽ LLL< puMT $ KL K ؾ(+ z@-@P P  QP((B A A ZA K- @PT0S Pp`v 0S"&d  0XS |p `rP0S`%a"$&` p p  `8#A A H-$HA $ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 K@T(ᅷ  P㐀p0PPpp0 0KT :H`@D 04PK@TЍؾ(Y 9!B B 3B H-(4$$,0 PO-$M@PP |UP $Ѝ 0P+ $tU` H0!p *S 0 U0P`p0h pUppp R0W0 Q pPp\ 0R`_  0Pp $8PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`pa P`pV:LP PXRM 0.pF 0  0  0 P  4$$   $@ `IB B PARTEFI C B B B yB O-Mp@Q W PPB$P `  0PPkPP H< ?$ <PЍ{E \E AE p@-M|` @PRh%]p 0r   Ѝp/_C OC 3C 0H-hRLR aR bR*#iR sR tR! P 6@PfP@0D RP ( Op @$@0#/oC C H-M@PP`8ppPP  QP (P$ PЍ/OC 0H-P@Q 0,;dQ00/'E K-M`P@pЍq QPRQ sQ bQ SQ  R bQ Q BQP ]PJ $t  0 $ # $t  0  >@/9F O-M` oR r 0(Q0Qw @pPp Pl Pg P P\PY (QQU R 0#"L R " 0#B$p@0 PT + p8$ m00 p1P+ P   P@ @  9/ p'   T 9/$  }p 40 ` @PUpЍ@ r P|p#C A-`p@0PP  7/p  7/$ Ep 4 PC H- sR iR aR : pcC A-M@ P $T`p 0  0PE,(p 0` XP 04`ЍW 0b`C *D C O-M@P p儠刀P`]P `V    PP Ѝ/B"8 #^D H-0p0P@` 0XG`V8 #zD O-$M @,P`   P PU \ `F8 P$Ҥ Τ$Ѝ9!8 # D O-M`Q (,@pP 0Ѝ#P P0S* |0D0 T ) ᳖P"   ip $ 0 T0 У0  0 p ( c F#D D D D p@-M@ P$`P  0kS  R `0 iR  0bS 4R P  Ѝp/D OC H-`PP K@P 4p{P  @#/ E p@-M`lP  @[Ap8 0TFP NF FЍp9!9E E p@-MPP0($,4$9F$$(,0@s 0&P ` "r "F"#| P80hFP\F(Ѝp@@`@Ѝpܸ( #jG uG G H G G G ;!G G !H O-DM@P8` r<  rP>aB P?,P\ ᥳ눡P  FPJ  #P5 , 0E@0,Z 1s  㙨PsBP:-LR p%{r0S P  t mPZ r@ D<^DЍH H /ؾ( \ H 'E ܸ( # 8$ 4O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  p "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$P@Q QT H 0@ TX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@PsP$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O HJ #WI sI ;I H H P/@-@$P g@dO-,MX TP\0R, `Ppᠰ @P  0ᗰTPTP  0@፰ ` p 0@ჰV 0  0 $X(F P=@T9(P5$P (PR`p՛  0ΛW0 `P p  VV VX,ЍR!V0 000PyO-MS9J TPHpl (,GR2X*(q588w88s<8p 4P4i +<1Wp000S !'4X00T88PX*(v@ ?X*yX*t@iP bP@ bR@P$ {㈤4ꜳPD ,DP P(厳P P [),p (,|P(8 8@[u $X[m Ba  Q :P P@Q 0PPPX  H0ᐿPPJH36-Q J `0  3/p7 @V5 2, < ( 8 0 pP" `4P ( * ';$$3UP0  R /+$0+4!q# @ЍPQ`T Q Q0Y K /K ((?K ܸ(# ##-"AK VK -K p@-龲l@ᱮl`d \0dPP AL  0<`<@PPEu[>Y zK K ؾ(K K  #q"O-,M`P(Ls(@ pP \p&ePp AP fP sPP (@P` {P   x?,Ѝ  0$ @p   `P$Rr@s` p 㰠P1!Q P!@?10  !HRR&t 8 H0X p(` P@‰XR R R Q R  (  00 p| px $@\ 0 ?pl@ eb4 _^/L t #ܸ( #+L OL X8 L hL 5L O-M` 0P 8QQ ; 7Ѝ(庨 Z @ 0S 0 0S000S@ R@P< 0&뺨$$ 0p㿫Z  P0#S:@ @?01 B<0 3/p (8 H0 (唠$D᛬  倀PTPpW:WEVL L 0#+L L L @-@RR R R @ R R@@@L p@-0@P R CPPp pSp#S:``` @> pp pppa  0cp0#+L M K-MQ @P`P <ЍK $R 0 "0# "  ( Q   o/o"R P 0 ЍP U0ap  Q P  0P  0p ^Q 0ppf)  0pP# pfU   0 0 pp 80$#QM M N = = = M hM M-M`@Q V$ĀP ꬀P {ؠ `  P Tp T 0 D s,  jЍ~N bN GN 5N O-M`Pp? V V2k쀟䐟 BЀА Bn@0$$  埢 p H  L 0$@p L 0;8    ЍN N 5N A-8M P@8`ឮxpp4 fp p @P4 008ЍZO #ܸ( A#O-LMP`D@<840(,@s8@,0@ -bP p qP   0Ep$ (P8<P%P 8< 0S0S @p"`!p PTPLЍ,00@ D04,p p#Pp @@D,`P pF $屌P $$ 0p P pP pWtUh P Y " # # T 0 0  0 0  0@!$ + !(PP$p  >pv $ Pn]O ܸ(##O O gO D O-TM(P`HLusH@ JsP  0fpHp qP+P%HL  0P Pg@p1 T  @ D$$0nPp P  , D @0PH L0 ` < P   PTЍ0 4 P* P&  $ p,   QP hD @0,'p! P Z`p  % 哒 Y8*`pT  ㆋP  V  Rp`8倐Y:D p@0RV _(P<pVZ`,pV࠳ t  V $V @`D  00Y PQ;08 @`D <0tP(0  @`xpT  0  V0 0 P  4$$  .  h%d2p 0@D   0 Y0@  `R\ y $@0 `@P p 4P$ (0 r  #  R000 POp0$O ܸ(#pP #P P Q &Q iQ Q HQ P NP ZA :P O O O-$Mq@`P   aP bP iPTN  v TG TA  p;p NP7 lP180PP  0S0S `p"`!p P 0T \P  0  X7$ЍQ q" #ܸ(O-oMM^@p`8@@@@<@8@ = VPa@Q#(((($((<(((D((((L(T`@AP HP'`@@WPp o@ @ pz@L@ Z@pm@ P(< P  ?O;  <Q ,PD PP Z    @ @P8Pl 28<PP 8< 0S`V Р 0" p!03 P@`V P pP pWH ]oߍۍp u[+ 9 p+~9h Էd @ XW, 4  k偐D$ 0 (4P _9  0Y9`pP @P` XX X :`pPO_ @P` XX X x:Q L 29 D`@P`BXX ?@ P9  /0P# $ OP P p D)P  P003BP X) L2P8`@P`XX X : ( 0`(P 0x᪦P 㫖  Pᨘ0 8P x(8 `ἰ ]l 08 T `ἰ 08$(0 J( 0 g8 8$4PT## ,P3PJ8T$4UW ##s80PO @NP Db8`(@P`XX X 9GP8$ m0  0G8  C8# D咶"X w9O_@Q* <&80 P  D0   &D% 08pWb W^ E P `@P`XXPX =9pWG `>V>`#  |P~ Px@D` P LP` P B PPU?>VP_ P L7$$`0`f`$$0@ ^L$OO0T4$`0MP O O<@ 7#077G@8$ m0 77# D(  @`V`Ƶ`P?U?P# s"P0^7U"P4PW7孵ZP p4RD0 ` +P 0>7  P 437`pP @P` XX`X e8`pP @P` XX`X V8Q <74 7`pP @P` XX`X ?8`pP @P` XX`X 08  `@P`XX X 8pW&P" 8pP  `C 6 ```@P`XXX 7PUP+R #.!ؾ(ht@4#ܸ(#T 0R (!? RT =R 6R DR ;!"JR 9!YR T+jR yR i R !x!R R R MT R S S pG S oR R R S T 2R T H-BMMP`@v6 s6 p6P j6PGaP0 \6!p0 0M6&P pD6`!P0P 436#  *6P. @"6'6 @@/` AQ` X X X G7@P @ @80,5BߍۍR R R R R ؾ(;!oR ^R OR R R S R K-M`PAP,D\$4x<ЍK5 pi 5@f` d5\5 ̌rPpXPpP% p'PA `@V 5C 5@h !80pP?KЍK55@ Q  Q `$ m0=D|5@PP@(t5**!!p`0'q1  W a5@)@\5@W#!  p`  0H5@p p`0`=5@pV V 'Ѝ`P`= S S ;!R :S /S yS S 9!d!kS ]S NS 9S ?S = (S S O-DMP$$hp0 e(` Hlphp`0"@ P4P~hpz "0 T 4phUp lp`p@@!g_  @YU /0ᕌh!`! 0[ T< R 0" R  $ d4p:Pl P+*@p$@UT@ _ T+* kh@ppPp lQ 0/PxJlp,P PqDЍPl9!S =E S =R 6R 0H-xMQ P$ m0@@t vT txЍ0S K-XM|xP`@ P @ 0  0)pP$ h p#p2/p8 0+4P %4 3XЍ9! T E O-LM P@ 8`4$8 p4  kPLBP PT 8rp sBP!*T  kppLЍrT P8 㩃P PPD 80!lR`p#T T ` @#q"ܸ(h 㩘G- Mq@`P  aP bP iPT  ` T T  p^ ЍlP&p PP  0S0S `p"`!p P0T 8P 0 HU q"T#ܸ(O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P P *Z48 p+lP`p<@P P p*W48 pJ`FG `(`H0Ip4 4800KP`,`$P `2LЍh#U G-8MP' PP# (L 00 `@Q0  ppT P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`叠P p*W1 00(pbRp`P0 IU h#O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @$2 :/p*WlЍh#U H-0p0P@` 0`2`*Vh# U A-t A `pP@ `Pp @PP@TR 0 Ah#A-MPP )p `p @ pG PH WJ:pW@p`0< 0?p`9p0$904$0p`0S00:8t00N , 8 8$ :  0p` P p0 P`XcD]00X~Ѝ耜Sؼ׀X X W W W O-TMP+ P@8`բq @L  U@P  p'P LR  pTЍOZrxPl  0P P H  0f ATЍnX {X 0#/ܸ(,@-@R  R 0 E  h+@-@R  8x+O-AMfvP@ %oPpgPc`P $$rt@Py &P7 p @@P-@x@Pa 0 <P -PX ePp@pPPa xP/  NP' !P! ! P !P !P !4P  !lP !XP !DP  , P r P   P s P WpP lP @@T Wp @PP` t9P d  P P #80 FP P rڼ=P  sP P $PW @P X  PP "`0 Py "@ 0 Pl  0Pe  x0P^  `0PW @$ m0P ( PH /PC $ H@ T: P4 @ ԡ`P@ pWP9 pK4 ᷝP#  0P& PXU N]AߍO/\ H @`' @`# 8Xe` 4AߍX HH H0ڟ4h h0՟ ` `0ПX /ܸ(,#X gZ X X T ;!"Y (!sz! !Y X Y Y Y Y Y H; X U"ǵ Y Y *Y 9Y BY MY ZY hY wY Y Y X = .R ؾ(\ O-AMp` \L CiPp FP P$$(,0せPP`@p6P  AߍO(o   P  @ (P PB P $$0 P:   P   P, s/ P& (P'U , 0!  $$ $P $P @PV 8 0( $D`t | $P |[P8 | P |$PP$ xP  rP @ lP , | P | $  ,2P !R$@ P$D0 倖!  0$  z P$8 4@!1#j!  $ f P$ 0 < 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`8X \4$$0`&! Y $$ #$PR,<`(4`8 \$4#S#! : $$ $P3ppAߍ| h<p| t0Z /ܸ(@# Z QM Z X LZ X Y nZ H; Y Y Z X Y "#(!sz!Z [ = U"X T ǵ Y Y *Y 9Y BY MY ZY hY wY Y ![ EFI PART[ z[ \[ @[ '[ [ Z Z +Z @ ,(O-$MMP @ȬP Y R`#ڙP QQ| 0o   P H ʼn< +` PpgW ἐ$0P @o { `+P#  # + `  0 媐P T ሉP +v` PpgW #{$1+P`  0 P  ] w+ p&m+V   ,+Ya㎭$Ѝۍ@@ Q<N<Sl ++9![ [ \ \ !\ N\ [ [ A-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0X4@1 3Rߍi@ip\ d\ X\ p@-M `@P Q!  ܏p < p Ѝp ;;'i\ |\ \ O-M@`pnp PLP pᩈ ᥈DyP P, qPP PhP aP  -P PhQ @ ppb P ohZ 0 S 1_ pp P P P![ $ Q 1  [gU  ,0(S 1;0P Y  4Q 1  Y l3;HQ 40L S 1#PZ @ hKP 01P l 4P 0 S 1 @ `4p@ `-p p R 2/p 8 Xp Ѝ|p`` LDd <\ : :g!E e \ .\ \ ] ] \ \ [ |\ K-P! P 2P phP `@ P P.XUK-M@ PP ` D`p p gPPUЍ 㳚  8 p !0 `7\ Z iH-M BPЍZ @-M@p ( 2QЍZ H-@PP p0PV?S` `. 1DdH-@PP pP *` DN-*?`H-M, P Ѝt"K-8M, PPA $P      oP H`[V q 0p@0 RP PP )@<D8Ѝ 0'] 0] ] !] i0H-Mx@tP PP P 㖍H Sp Ѝ0 0V9] 0] ] ] i] @-,@,@@+<,(+\A-(MMA^@㜙 #p P(Ѝۍ @7`CP Pc(ϔ@P$P @CP 0PN(Ẕ@Pi] ^ 2^ @-M\ @2P P p8Ѝ 0hIe _ De !iPe @-M\ @P P p8Ѝ 0Ge _ e !ie p@-M@`P P uPaP PaP p 9P Ѝp88 8088( 8e _ e !e e e d @-@8zP , @ 0/e e _ e |"0H-M @Pp  \YP H @Ѝ000 00ї( 8z8\ _ e |"\ \ p@-M@8P R`AV*P P 0*p l `PPT_Ѝp4(D8 I8 a i`a 2f f f H-MP `UppP @ pCpx8QQPPp`W &'p`W &$xi d d d O-4MR @T @`P0⨧p lpa`7 `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P ?8P lp p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0喨$ PP@ɏPP @`d@`$D7 +%#$+ɚ;6eʚ;c 1("Sl p@-M`P@P  p 07\#ma 0H-Pl@t@P qPJP 0$$ $0U 7g!d _ d |"0H-M @PNp `P H0HN@Ѝ0,, ,0/  6/e e E _ *e |"\ p@- M@P `=P P 0p l ``P`pp ` Ѝp(6 6Vc iSa e e p@-(M@ P᜿P- VPp# $ p0   `q0 ``Q$` P P` @PD(Ѝp 0f㱕_ _ Ud !lb 0H-M @[P P p qڸ !0p@0 pЍ0 0C〕_ _ 9e !i0H-MX P*P  @p((&@Ѝ0_ d p@-M`PP @ Yp 6"ma ////00 /d1(00 /l1(00 /t1(00 /|1(0 0/1(0H-@|ῇPP ȖP00D PaD"P# *@P+?Q: ADPP*@01(H- p P+0@ Q:a@QW@ A@Q=@H-钖H/O-M(  墕ppW df@  R 8 Q P 劕t ,04pW px  p\e p<F5@T u @TYout%ttxU`@0000  pVP BWCW NWD aG QsGP&0//100//0CAW8 d1//0///p0///|0wrWWX!   ċ$$Q :p 0lW`W;CWI LW@ vW9mW; sWVV`clt!   ㇋<#Q hifaW lWHcawW zW]V`XcV@`RbNQ   x20S0520S1420S$20S*(" R@" R  $Q  10 $ $00 I(0 c PP !24{tx $4$ @(` p$PP PP ;PP4?`p` pPxP V  R 2/- x |0*&1(+0(L1(41(d1(h,(+++0(1(/$+T"+ +++++++O_ ܸ(+_ 5!_ ` _ [ |\ {_ `_ -(-(-(9d !d c K-M⟔P;P 3`@mៅpL㛅`尀W00 P   R#|pW 1/pmPP`  0PPP PP;# 1(Of ؾ(f f 9!|1(g `_ If ( R/0S  /1(0H-M P@~ EP pP 5 pp 5@ p,Ѝ0 0}fe g!iqe _ ^e |"0H- M|@P P P  P L p Ѝ0 0iV 3lb _ Rd _d ui d H-aa 0H- M P@, p Ѝ02iSa H-M,   PЍ2i`a H- ΄P1(O-MM@Q QO[P)2\`wP,`Y  ^<0884@0H,P(X$` hpxpPXP TT oPDpZ fP: 0  ]P4 pP- P&P P pㄒ p p P `P U !TPpY L`p 8Q P HH p \P P ` &pM ! pq +p Q t !l ^H gpQ 0  XPD@@ \ pa PV * %:wХP p  FpP<%:`P p 0pPL\pW  2/pW pf@X@ xP  r P  p P Xd 䤍p Hx  hp@@D@P a^㊑   $&p R^ \ HP 0\  3/^_   PXV눃p 8ppc`S X"- $ @   ," 4  "   "  00\ p" 4  ",  "(  " `V_  1/`\P`V 0  3/`VLPTP a \`ġߍۍP 0| Ru0Sl iZ +++++ؾ(1(a 4b iRb Ab ]b sb b c t1(c i^c Fc ,c +0#lc +c c 4"9! + c c c c c l1(|c h eb qa |\ }a a H- MP@`P !\ p NNNN $@ ~PE Ѝlb vi 0H-MP P @P ph A  Ѝ0P"448@P,0PPPЍ0?c c 9! c 0H-M P@8 pAooЍ0ip@-M@PP P||P lll P0 ``ҏD `X p Ѝp$/V!ni h ^j (+,+0+7ih H-M@P P lP XPXp ` @P Q tЍ h v!B"h K-M@P P>Pp p`(x 뜂 hp8 PV  P @ Yp <:4Q 1) P? `$ 0SR+ R+ P0 pZ @TJ xP QRR T@ Pp6P 2! m7P# p PP`! RQ + `V UP:ЍxPD.TT .8i(i A"!hj #"v!9!i 5i >i i Ah i@#{h rj h h |\ [ @-mP$@$@.Ii 4+dI 0H㚀ؾ(j @-M@L iPHH0 Ѝ 0㣍i wi i !,+H-(MP`P& @ P  p(g pAP\ ܶP D(ЍD .8$.   . i ,+8i(i i j j [ H-@P `@pP8P @Pp,   02V!,+/j wi &j 0"0H-M@P 0P-7j p@-M@~P @P7P d`@ _PLPu, Ѝp 0ni ,+(+ͺwi Oj 0"p@-M@J^P @Pt7P \`@ +PDPu$ 녎Ѝph ,+0+ͺA-@0P @pRPDp7P @Pp `P,, ,02㒌 a^j ,+z? wi [j 0"H-`P A@Pp 0p A @H-M`P P p@  0P P  0p @A ЍH- P Q   Q 1/pK-M`(P ( pR@Pp:؍"Q P ύЍ TP"P , 0 gp Aꭍ O-MQU$& Q UP Q N@PtH ⃵@PHp姌Tp@W Wf Wh W {@ЍW W6P  ĄP@Q  /P@@(@ n0($0  ,pcP `P$@( [ )P (QM VK( ( 0E`P$QD @@``P`1Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i@ @ `V   Q Q@P:ƌ@" TW T4=@ 0a<P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ ^$PP q`\V  0@p PP @P `@?T  PU @D8 0@1+( ++t"B""j e j e j A-@T `PpᎆP:᛼P  0p A  O-$Mp@P @UK H`pP#  0@`4/P( P+P Q<P D pH`V 0{  PPUZ Z Yꭋ P 롋$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q P 0P -P6P 1P `VOLЍ @(@Q QQ Q R-0([ZZZZ[ g;P P0 0  0p 4  )k p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP p`$@ | #H-`P@puP pP @B #0H-@P P  R$ Q  0H/00Q /  Q /K-p@P`P QpjU P `PUP QpNA-p@(`P P@ @p 2P #A-MpP,`P T @$ $0(0 0Pp@Ѝ #O- M0Y$ P 8pP J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  ꥉ@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6/y P@T p@-@`PP P V  P PT  +P pG-FM@PU`P` D@&P R  pF`  pp P{ppPƘ {@ @p(}Fߍ '%k k Xk Jik Hk Nk 0H-D@D4@4,P,0H<+2(D+hdL+eG-NMMP@Fp`)u(qԇ [V pp/ ) +4 `P*(k) 0p{ 1JO 0p{0P,0Q,* 1U(() *0}Nߍۍ+KiSp k  07yؾ(k H- 1p]'Ii9k 0H-hP@P p T p @T@ 7p@@03(T+O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW yP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@P$ @Ѝ("l (l k p@-P@QU 0PxQ  000  @UP ` XUQ p@,U `PUp((/  .3l A- M `Pp@㣆W W# `@`Up@JV:U` ㈆  R@P P`  Fz[P ЍH-p@Pp `P   HW3&[ \ H-M pP`@N @ЍO-MMMPc Pp` `Kϕp] @F2 r`,\qXpYE @߂P9 P5 pp y $ p !@ !P 0 o" 000 3 ;yP 3P t3 ``[Y,Mߍۍ<0$ %"ul i+4 ^l :l Ol |\ [ H-M`@Bp pP㽅  pp |yt ᧻p Aꊆ@+P H|%낆@1P }/PtЍ  i~l su"H- RHg+l A-Q P`p@6P PP`V@- M  @p l 3P T q4'%- Ѝ %l 9il l l @- M  @kp&  ۯP   qP p P T q8$ Ѝ $l l 9il |\ l 0H-D@D4@4,P,0HX+`3(`+@ph+p@-M@ p  QR 0R@ Ѝm m  0#vؾ(!m H-`@Pń$P ` pnPLU,$ Rpl (:il @-M\@ ᢭P L  pЍ0h$ 0N㪃om gp q !iq @-MP @GP  1pЍ(I$ 0M㌃A)"gp eq !nq @-MT @*P IpЍ,,$ 0Anr gp q !q 0H-(M P@!@T  0p < p(Ѝ0$ #"i$q q q 0H- M| @P tP p  p Ѝ04# 0q%r gp r !ip p K-M <pn \XH` 1P P~P> | iP XPT :Q00@\p@P`0  `XP0 @P TP #0 @DP AAq X \!PdH qHb#hݍ(( P#zm q q (B"q i8Wp q q @-0M| 0@ p 4P L! p0Ѝ(2#$$  ##hm im Qq 3q Fq p@-t@tlP!P@PHPH@`@#p@'p+3(3(+dw+`|+d|G-BMPP(` pp `  t8 8 `! p !R*cW%  zp P P  gp P l\P X  T)p |p Q$P I >p QP `8㡂r 'pP = pZ oPQ piOHf!PPPP pm `V !RAqpP!0   :R P &hP2pta@T ,EqS"o@DP0 $8P p$ $ p @ `P\P  Q  Q BߍXkx!8i(iXr i_r +ir rr |r r r r r i8r (q r R2 ir r A!ii%#r r r .r / 0sؾ(r 0H-M P@Ӂ$ ZpЍ0!im 0H-8M@ P 㻁$ Bp8Ѝ0!i8Wp O-UMMd8 @2p*   " hp$P QPJ+PJnP PiP +PZ    Ppo|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `((Y:!0(!    004g2P8 P@T: 0% P PO 4^ |f @DpP `dPN  PEp U ADQ) Pxp4 `@``v\T DP 0  @T >k4euP )P  0@@TPUUP  @0P@TP>ZP Q P=@QGЅttttttttttttttt$,4<DLT\dlT:%PP[ P WP  PP  @Q $瀈txHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S""" PE@ U$K @{Px PA 4 딲嘢@R 0 p   `'b 0 pp` @T> aLrth\ P D8, P  K[ v ,I'Y.0<Q  20fp3p 7p .p %p p p p p o o o o o o Rp n m m A- M `pP;~< @@AQap@ Ѝin O-MY ppS   A^Q0S  j` VЍOWyd j`W JP:PJ<@`  `V*EU@P/  ...H-`@P 0y`< opfWpfU W `EDP oV `FpWP-l >Hi    0 ` P/`!%# 0 ` P /S`!%#@-M< @P  LЍ 0|p gp p !@-M< @P  5Ѝ 0|sr gp p !0H- M@ Pp t ҥP  qD Ѝ0$$ $0m|"ip gp p !p p O-dMQpʼpʬp㔲P gcp P < AKpy <Q |T〲Ph"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps ><@|  㓲 㑲s !s s u u !\u u u u ,5(ȕ,+A-hM8P(P /P @ D@(@ 0p( d @@Q|@( } }bp4 @P^ 0r0bP QJp PP5 P2)㧰}Q#P Q Q" ( | |D $JP( | |hЍ$PQ P PX@d`\XB@PAPX dP`P\PXP/\ TX  P_+H@/<v%Oı+8u jt s s w\s !Ft ,5(t t t Mp@-M,,Q P`@Ao ``` `_|QЍp@ Ѝ/H- 0R0+@-@.N|s /,5(/ MH-M@Q P`pA?Q:>|P!0QЍH Ѝ/ MH-M   ЍH Ѝ/@-Mh@P  0p @Ѝ+u @-@ȯL㒯㌯p p$  &#u nu MH-M    zЍH Ѝ/ MH-M    zjGNЍH Ѝ/O-MpfV尦@ fPl@ Q! 紘ȞȞȞȞ@ȞȞę-P gFP RPP?PZ ` gPV#Q  ?P nP&  #Q  )P D1P  P &  P p[0 PN tD尔娴PU`P vP q  q   P `XP PpGPG U*"@ Q @pP cP bP  XUp*Y GP*U5pz    PzP UZ'@[XvP X Pp ZpP P !d  6/ R{  @Y @P堮W  0ɮIp3nzPUPR fP `( `W HL` !(   AV  0ឮ Q P Dp%ڸ qr 6pЍ.x d ll@ <(tꔠu /-v |^v v ܸ(++ w w Cv (v v v cv 0H-y@<< P, 0 k ؾ(v w w H-M 0 P 9 \R  D 0P ,Ѝ05( ++A@-P@  t0< 4 S 0 p00S$0000Z&#0&#E&#H-M( 0  sPЍ85(h\uP Qp0q#4 S $$0 Q 0! 00/Z&#E&#0&#@-P P$   #Q\:0|\! 0  sS Q :00@0 \! S! Z&#>x Rx 0&#E&#H-P pS Q $$0 Q0 00Z&#E&#0&#P  S\:$0$\! /Z&#E&#0&#@-P@ q 0$SQ:$ Z&#0&#E&#P H  #Q\:(0(\! /Z&#E&#0&#P H  #Q\:(0(\! /Z&#E&#0&#O-qMMpW嘇` 0@  cPd@Pd̥ĥ% 0AP aP" 0@@@@ 0P B[| 0pu<<&GP 60Sv0C000PU Pd P^Y P P*u앟쥟`tP  tP  sP  P P PP*PsPP(8   P 0 0000 000P` P `[xTdP h['o/P=U ;`P`P 1`P`P psP sP sPpsP U AP(<P( {P `U /`P()`P( Ȁ{P P UsP p P`  SP    A  z(P @P`Pk( P(-P@T`bުpp$AwPm'P+c/iPPqP qQ r'P㹪pp( xQp 0P \( (ᾪPy vqPaP:a@P !PQᨪPPU 4 0 0`qߍۍdA t < ` (#ix +vx /+ܸ(+y + zd@+edA(# x  x x !x  0H-MP0@U , ᕻ#Ѝ0{ H-M~v 0 J/{ ؾ(G-P@pnQoQ PppP \@nQ`oQ ``)P @PTB"K-MP Pp@Ȑ`K)rP $rP p`VЍO-AMM `p@-P ,$ (IQ $uTzTM $gPfPP/P$ yPO 0 PL @. P( PPB FȰ p` qȀZ qPY  qP PU  `Tc+,$ @P P   0`p $ $ $ $UZN 8pᨠ@HP (  WqP $L8P0%(%B 0'B$L4BT2 ` H P, ȤȄP@@pゾGT)p`P -P =Q@fPU @Q PP@@@`4 `oS嬃`0` S0!P t CV`ppV @PdZ (∩pHVZpL @Py $ P ZP- , 8y嚨 {tP\Zn( `PG oP(PE` fPUP(  ZPZtXs Ap P P!p@T @$ P 嘹7@Aߍۍ ,QP@Z@PPP 7p h  t ]P㞩  Q ( $", p0@Pp[n B WtP  0SLtPB 0gy "!y ++(y @y  =!!(#"Py Uy \ B" +]y !cy vy x&#-"" y 9 ؾ( y q y O-,MMPkp 0㨀 P`pOHT2 p$(PhhbhRhr Q Q X@T f P:T 0D! XP0(P$P !XòP !PqPF HAH`'X P: X, @X``hP @@ @@P0, 0  @ 0JP ,P , tdP, zt,Ѝۍd dX8,ЍۍOly &#+v! !y 9!y ;!y y z y 7z x! 0H-Q  Q @P)oP Q  0+p@-@P6 nQoQ  ^P# P ,R RP @P, dPP ``,dPP(@p+A"0H-P@0H-MM @  P0 "x(03pX  0 @ , |@!g:]L*#e| O-Mp`P@q 2P R帒|‰  TPe@ Q$8444Ƚ44ؽ444GP MP3xUPgt d 0PI p FQ< `V  X X  V`p!}ZYppp Y4tZ8xV  V Ѝ (  ܸ(/K| /(#Z| ,!H-q ؾ(| 0H-MP @ RQ pЍ0  0} @-@ٮP@֋ @-@ႰP@1!@-M @Q QpЍ  } 0H-P@L)P /P0$ؿ0HԿ K} d} 6} 0H-P@0H-M @ P0 ' 0ץp qP P  L L,qq (  0YI!x} } } } O-Mp,P( 尰尀`@ 9oP 0P pDEQ A O'/ܸ(X /*#Z| H- q ؾ(} 0H-P@(P /P0$?0H; K} d} 6} 0H-P@0H-M PAN0 & 0@p pP P  H H}(pd A>!x} } } } O-Mp,P( 尰尀`@ oP 0P pDEQ A O/ܸ(X / ,#Z| H-up C(ؾ(} 0H-P@(P /P0$᩾0H襾 kK} d} 6} H-0H-M@AP" 04 0㰤p PT]~ O-M,(帠帰`@pP 1oP 0P phDQ @ A + \ЍO X /.#Z| ܸ(H- 030aؾ(~ 0H-P@'P /P0$20H. K} d} 6} 0H-P@A-M@ PA> )$00pt 0@ D `L,<\PP^]P0#b~ e| O-MPp @0nbx LPg@Q!P(t9P GP8||||MP' UPw| ||| 0Pc || ppPQD0Z  S S  Z`PY[` p' [<pY@tZ (Z PPY$||Ѝ   P~ //#Z| ܸ(,!H-n ؾ(~ 0H-MP @ RQ pЍ0  0 } @-@ƫP@֋ @-@oP@1!@-M @vQ QpЍ  } 0H-P@9&P /P0$ż0H K} d} 6} 0H-P@u0G-JMM 4P@00 0 0H¢pa4@PpfnKPVP S QP0 P Y0 0夢p 2@E P!ʎq8P 0<p 00 ; p3aP +e]<0 &h@D L0\`dpl`pPt@TX P$@`p QJލڍ0 0  <+X3#  e| p@-@ %P PP p@߲(P`m`p +"O- Mp`H@0lH `뀶嘆否 @P@A@7PPD (8\plp|2P/ 3P6PI$D]@ IT( RG a58 yltp l,gP[4P a@]Y 0P P    @B P  P  @           "   $      p $ L <  ( 8   @   , 0 @rd$ tW, wK xB0P }pGQQ0`+ X4R 7 ЍT( -5( 6(/6(0#4+8+<+'"@+", 2 ; E O Z ` Z| ܸ(H- h 0H-M@ PQPЍ0  0  @-MkH@ <0 @  00@@뿀 ـ ؾ(? v  0H-P@~#P /P0$ 0H K} d} 6} H- RR 뤁 A-M`PPJl 垠pPJ@@ RR0 j IP 0pЍ~ 뤁 p@-M`P@ Q 0ЍpO- Mp@PFp8 p0`pF<8~j$ $  04O79 2/< &   4@K<0 p P 1Q 2/R 4432kH Ѝ @0+X с H-BMjo^# 0142/10 >p0p @0 0 P k吸 ,,jH<Ͽ Bߍ ځ A-MP@` p$j XPh 2/R1QP5_U @4Oj@j 0 Ѝ0+  (0P0/O-Mp WjP `@ p{P`DH @0@3/p@jP;p@6WP ` p@y)0 @ 3/ qZ㋐r P P YR*$$0b`j<Ѝ + O-M@[ 4V@A[P p:\Po pP0`P [i d,@8  0RaP +a < \$Bt`p PT P p  P 0  p8 +ixd@ P @!0x \ D  0zp PQ 1 UP ,P iQ @P+Tt Pyqp` hD U 000  Pߍ+ a D+@+<+4 O-M-M`p(PhT 0 ؚ݊@C 00000   Zg@Ql8,,,,,P4,,,X,h p  0Py @@ eP , eP | ph  @ eB 0SPb@ ] @ WB 0SPZ@ SI P  p GQ$A+T@  ߝp, 0(<S00 p@ Ppp 0ЍЍ)` dXL 4 H /ܸ( / B e ? 4#Z| Ђ H-h X=ؾ(F 0H-8MMA.NP$ 0 (0ݜp. @' P@ } z(rP r((x0m,嗥P ` e,(L0`0@]8Ѝۍ0, Nm] +  I 9 W 0H-P@50H--MX 0@BP       Ѝ뿃 ̃ 0H-MP @ RQ pЍ0  0} @-@P@֋ @-@ᰦP@1!@-M @Q QpЍ  } 0H-P@zP /P0$0H K} d} 6} O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4qI"X3\cs2/3?6o7"X3\csIII ??j I p I p I, p I$ 0p I( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,erI@ 8p kI< Hp dID`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@PII DI!?I!:I0A-P %I  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 H!H"H"D`6oD`H#@`6o@`H#H`6oH`HL`L2/3?6oLX8<\L01`\XM`Mpp` RY}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p BHD!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,L0ЍTU  +0 BR!q p/G-MM`RQ:@ +pX T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_G ЍۍLABLK-M,(pQ@Ppp  P_`Ud Vl# 5_ P[ kG 0AQ p ЍE LABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@xd9P PP `PpGPPlllo ,8 Q`40,( B@4Q `LLL`lL LLLLLLLTLLLLLLLLLLL 8LLL@HtLL@[`Pc V`P @#P+ 2 10  0#DlO "8P `D` 10   0 <-@Q  $$/0PP  v 10   0 80  *0l4 TL 80   0 c00  0 @_P _P q#[ @Q ܠP T 10   0  10   0 0>@T@ Ἇ@_P@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:TTPX/OTPSPf PJ<Py/10 1@@(.  T u, s_P'  _Pe !  !  0 T X L u( F`  Ap8 @x P P D %#pP[otQaxB AG@P T@P UHH,H<T @   x00[?p+X zaap& P\P T+| KP pp W,&p`T @ pt z ]Pz? jJ p$ z[p(pxPt @#@z *P;PJzpYpm*l j ?y\P@@[ot   zp P:pTf) ?]\|)@Pt@x$ P )P*   0Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$p $@$p CZ0$Pl, ;p$ D[LP ᴯPt p`H `q!'P  0P$@V U   `Vp V ^po+ QʌPtfP  RL+ㅯP  Q(*|fP'PP[oQ,P VP &0]Q 0Q 3,80(  @w W ”y ᾔP B^FP @p1叭 + + ؄ %0Bd 㝔㛔㙔f%0 Tp txB@ [?&pP`n,%B d0t@{ȀB_<`  #p- \PZ ~\P P)  -p! P< pP &p0B/pPPI@4B/X}/  x +X + 6(+ ,+{ @d  =>PT*[`Y p, K-\PrG @  .\Pm  )\Ph [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4++h!$"0QSQ% @PP+   P7(1!֋ + + =P  0QQ[oXQ <$!@1H!0[ot [oPu  0 0+m X7(ؾ( +ѹ!$++ +/+ +( (΍ 8+ ԅ ++Z| d{!-"#-" + 4+P7(0+ T7(+,+++K+ي (+G L7( ++ܸ( @+~ @++ 5#yffs:S < `5#(   φ  w  / L "D+a S qy i  ׇ o T A-P@T_ T0xht @0pwPXX`P`P pPW+ؾ( ؎   5#O-$Mp8_``  㓬 P@p0S$ P| PaSKC P0 ` kC P0 ` P PBS GSPbS gS x0(P` \  ` b R40rbpSjQ72VP^ZƟQVQ"P) ()% @P W P%  p@H0L S P  p`0$Ѝ\ 0@ 0<p@0p`0  0ލ +A q O-M-]MMԠԠ1f P@ P< TU DA`@0: P`P P`EpC 0p: P P`Ep JF0 D: Epp# Wp"  TkP @Q] JP H] +P Px0 <0o (5,%(,D D R$, $ P @P  P @Z B0 4  P @4A  P @4D QX P @0 Q*, P @0Ql( P @04 Q@ P ,`@TD ! / P*0\PB\C0\@PXP#U XQ}`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D17P9 `4  (08Pp8 he#pφW @ T 威 dQЀY48R T?QYQQP0Xd@Q4!U:8 P `4@4#8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?pV 0A0E HP? V !"p@!G0Ep/(50$u 噚z"@0S @!1R\{Pu DP x@8P@W8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0V? A@pQ`1A P PPP*!1eVPP! !Q :AdWPܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0aA1QpP!a!! 0`~APpWp#Xp1G 0U!0B@1UDᡞ@/X0^ 0ZAa@/.!PV`0PT3_>QQ10Q0U@A!`? Up 0(A0a@ V㸀!` 1ؑT/ a!R, + +8+(+D+L+P+X+L7(T++T7(X7(% +L ++ ؑa Q )@Pp$ x帀@8d<`P0aV GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  B_Бp 4Y?@ so H44p0o0 /LP0@%X\V Qph? ~  P\% R\%R`d~ ꨏ ԏ  - X +UUUU3333++ ~0: P`P P` Ap@J P  0P P`@p XPDPl`F r0TP R&0 댏`H pJPE@T`VA P !1L%H +0`'꫐ T >@ 딇Q L+0 P LgX +0j@PV.#LP f@ PJ EXBP%xzeP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0_ ,Pz/ #QPP\  P0R0CP0R1,@,@"TTl @`XA4Kp@8<$Ϡᔆ P0QP\PZ! @Va dJ\j 4+4 `@, Z !/@ ZJjd Pf pzWE h [$Q`0pP tx R !x 0+ PJ,@P |TX\`/$%R0Q@h$l` R/dP|dT P  Pk P P P` <$P plQ>d:S4-QTT! !-QPeXPeV d! ! !S@pS!!G SS$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4U0P  UZ YI4P   0x 0S0# !T P`\up%Wl` +^Fi t+p+P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82fQPC@ 0p@_ A尜DL`%%lP`PD !LlZ?#\Q @0`d0 80 0h93H -Q XaAQ 0SApTP尫Aa[x+d唫AP@ aPT@TK.DT@@Cޑ 6#a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0@P`+PaP ,  PP 7@`,V:T - PQ ~T  R P _E EP: _I` :+8 _A E]0 l dR 07E\@!U04@0vPLj @D5Lp0? dLT ؾ(ht@0@`ALˉ_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  ꂓ U \0- AF0q Q0 ,Pp@X  6` @ PTP` ]GX  2/X 64  d 0 XPq#P|QXp  6`@ UOFKgS\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / <و dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !p 坈 @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.uFVDVRP PP\(` PJ R ?M 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daD+4&(KЍn %0z_&%( L+L7('P+  ++(+D+L+P+L7(+T\+`+d+l+h+ +t+p+x++A"9! W \7(l9($+8   p@-M@P`P    :tPt!"$! ۧPЍpR7, 0$C ++(+D+X+ؒ M-MMԠԠ@`PSTQ LpW@@! 04#'p( P P;T P*06 q`V 7Q  QW@_l2N\ F0KMq*0hK +|+L+p+(+8+x+6#H-M@`P P DQ!p_'"$" BP R垟T 0 "(( !N9Ѝ+ +(+D+T+ `0S ? ? ? @ 0/PP B1 B/0 //ؾ(/ p@-`t[@P\PTPC/EBp+L7(O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQRA A B B `@1 .Ha@aV&`aV Qd\8 _Y0<LH]P Ѝ S`R B B C 0C  0H!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQ K QTT! B! QPuXPuW&d  R  b9 Q?SJ먠   0 H? ᄡJ !?JA0 P9 4{@80 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_L+P++U ! ؾ(j \+L7(M ѓ O- M\T`0dP p e7@ PUSQDP sP Q Z\P Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0P @ث 0`x5?ᐛ#"2++\%R !`0Ϡ|' r! xHJ0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0p:5SQE `z(1!2/pG w( X q13?A qX0/x 0 @5TQ% @p`p 1!p`Z`p@x1!p@W   B@l,B88@P0 0 ЍO; L+P++U ! +\+ Tx+p@-t`P@P A@P 0PppL7(+G- MpR `@Ph @X uP `P P  ؃pf (`SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#PKfKKX f ,pP T pW p"'D P& ;:fPJp @ &p8 Pe zp_ P P,@ u 0 FP@@th l @D 0E@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@F`PVFVeP64} # Zp, {R  h0`P!E@LPPL RFFVB( YpL| ׷zHP0 )P`UlkMȰ  P{FPrJ pFP FP I @YTbfA0HE  / ~z Z ~4pᵍP< @ b%dP  0pV W  J~`V_pᾏ.8aT?  ppL(!PpP (P @D EV$ P i(P  0| 0+8 /+ + + ;(t +h!+{ +Kي +G ;(+;(U ܸ(+~ I!7#iS < 6#(   φ i  ׇ o O-MVJ`` 㱗 @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0bQ gQ0`pP p`J"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0$$  ލ q A @-I 44@( 0:hvؾ(  87#O-iMPP@~ϟpo  G"1  "" ? @P",R*?`0F|?0V:@'T  W W O@尐TY R0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WPӾD< W $R,f f2! `VS&Q W01@( D@d X XD$PY D`D0,0PDP U:T P QR !bPQR` ( @P, *$fD$bD`,`($ @P@UD/M0C0 (ࢂ0 0`fR `$`8< dPN\ fbX(@DPHL \` $(0,04<pp}}  T@<%<PGh@3PU .CPB*x 4LY\`\ P0' G0@PV Kp` Y  d V:VK  0Q RS 1c!QRSTK\ 0 0 0 P30, VPE0V A0p 0`0V1 Lp㸟O pPh(d_`P!:!&{0;qa P8+ 0 (@0"*" $O0 : R/PUP )G0@P rRp.0 n Pp GR pW  P@9TP ,.   ^ ,P4 | QPP PR00CP0xR0$B$TmT. X@Pp((,P :LPd +㺵 oRp}: &#0t:   0+'B,l6%A0sv F@ P  P+" AR*1p71 @ wFp 'P`P:P `PX:P U:k 00 4(p TFVE KF[  P0   0 9F(P P$P pᗐ$*$pdW:0 & 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.EUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  PP(` P!  T P [:[ P Q R !b P Q R$ PP[@U GPLP \ E{P ){V %"e%aq' 'd  `l(4minEP\ gFvᨅP$ 0@墅P  VGU $QE<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*A E, 0v < (PGU0<*!!U:LD&^+3333UUUU + +++ @5q0 ;003S ;B0+V@A%P %P@0@~,AU1P\ ;(;( +++ 0p'U*$AD ᆊ$P  0~  0ALP ``PFpD 㰦 `z V `#P p l h dz&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV1JD  8  0 ᴰX pⴰfH;(QS+` 0?0*DLpP`JPA\V!z @`Pd`plhy |GPPr &X2@` 0 Eob@U+7&0#7@0%A0yiߍ+!    ; 8 0  0z 8p   gԐܐ p^+Δ + + ݕ  ++G _ + ֖ &+&++:# T ؾ(ht@&+ A"9!W " V 1 ɗ >(H x @(;( q  w  x N ! @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\   +H-MP`PTp`H%G!  PЍ ++ +י G-M@LPN TL8QpW,appP?`V5P P+02 q`V 7Q  QWL?\ D0ۍG>+0ۍ+&, ++++&+9#H-MPLp`@%G!  ᝘PЍ c+ +$ C G-`p |BW @ ` pP @  76PUB@D`Rq@ #6  +&+G-x`0FQR vWO:ኂPK P 0@  T 0Q0 pW S Q @p0 pW`! 70fF&0؇0 A0 @ `   ++ ]"O-MlpV*P} ` W%:( >@0Qx  0+u06&000A@`(`WO*@WP 0O(p&!&T $&0f?C(#0(  h0" XQ S 0$&?,(LP5Q0ᒀ$ E5 P ((j&d 0DЍO7hT PH .D4  00&   + g ;(l C G- MpR `*@Ph @X iP `P P  wpf (`JP Q7G@ Qg@ P1$ l l l 4 D l l l l T $ l l l 4 D l l l l T 'a 'k 'fkЍ 0m H-@`pPr? P  V  0S H-E? XX@L 0q0 f 'g #g g gPl, g\ g`P L`Y< 4 sp6  sp3 =sp( 0( PU *⨠U  0 >P D0 r*PP . * ݍ8 2 d@`3 3 q3 3 3 3 3 edAzd@3 3 K-M@ ;PpP`p @0 P3p#rW `2! ݍO-MM010`PD0?;p4;t0F0`p\`h0S0&a'0000x01'udTPpo`oorbpb4P`oobpP`@`oobp00>~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT E8 P*V [aAi/K  paqp 0PP05  1qP 0AP$5 Iqp rP0 p[@e(QP @ 젍i9P QZ rPPV ` R9Pp pFoQ9Pv L9Pq  P@TPV젝q0(Q  @oow A 0  040($sU @#9P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /o/P@0S  000A B0SR @A@T`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>ap d(G,w0gP nqp `/ [PT5 T@7*<?W?p#PWy < P @ \ :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< <QuPsPqC   TpKp I @ eP P `+Q Q@pIT'*  p@IWXX"*V, H  0 p `pIYkV D@V:PHU  PL  P  PV&`!nI` T: pP`@P`XXpX  XPEI U P,ŻMI X:`@P`XXPX  :HI X PV 奻HD PV `@P` XXP6((X ̼X U`P0P 2 * @M P Rx% A  B* 0 (``%T+ 0+8B 4EMX @E0  / RU $``W_ ,& H  0 p p BP (PT`Dl 0,9` 64 ,-p|p~d|XzLx@v4t(rpnlj(-@',ؾ((-',(-D <ֺ`U4P_Eq@T("  p Eqp0忺TUPQ @*P ,埞 H 0 p 0`pPQHlDLL EDY P8 "pU pDPpUp PV,j H 0 p !0D Gc`@pT hX`UD@ PlCXT(-(-',(-',)-)-(-)-',&,(-t(,p(,= +   ٫ p X R = ʪ  ( 1- f L 3 "  ˩ a D #  x x(-)-x)-()-)-)-A()-1-(-1- A( h(,l(,x(,D H!4% e H)-P)- z o K F T A-@+aP!Qp0p.p `p Q0AQ`0X X pX.Pp!pP0pp C `p Q0AQ`0X X PXqT @P ` AQ` X X X ֺ@4@X$$+,)-0)-4)-ؾ((-8)-@-@+CP@()-K--@@`pw묐$ 0(P]X YVp   ` (+SIp  X4Ky@@', Χ ԧ ܧ ؾ(A--0M@>T )|B|%tRt!lbQ `P PH @ w(+   +S ˸Qh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S KӸ6 (  0PwpWBAi$b l  3P xX0 (V! P HX0 88 0M J  P hP X0  04Hz $3-j Z 3-3-,3-/A(  3- 3-A(3-ɰ A(3-e- 3- 2-2-(3-r ܸ( ؾ(03-6 A(3-  H 83- #" g α  = 0H-%@XX PWH S< O0 K$ G,ؾ( F O O-MM/?@@`,, l`ll|<M∯\x``T@PP P LL塲 @@  P ,P NQ/P5=ꈰ%븎n~P  @   _s  Q P@P<@P Q Q @̌Q-  ` -͎@0⥲ @@ 0ᰯp%P,0➳u u u h D` L < < 0  PP  ,@  P La@Q?⌌,  l  d D p @ Z Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP 0 Pf[P} F@,  PV(& P] @  P@}PN Pt P,w  P H @@ P * :$(,048<t th,墲@S PV P: P P @1, d PP% @ P P @ `P cP Pp `P$ @Y(0GP PK o ``\PXPLPt @1 0PP DPQP 0LP PX^0\ P   +  >`Pj P@@  PBPD  @ 0@ P* P PVP% |0 *@@vD P @k (Pe  ⬱0 z` 2 |0 sM 8`5 @PP& @80 iP` 됕xV[ 4  V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  p 4g 0@pQQT@l@h|PyppdhPn 㘷  @們Q p ΰ d |P AQ  QD PB   @P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰP@ThX  qp[x弱夀P @ P:@D \p f`=  p` P @`)Ѝۍ蹶 "T/ , p . 7-3-8-8-ؾ(! 7-:-6Z!"' D 0 ="U 3- ~ K3-[ m d! X #_"7- !p!#"Y  E! 5 N  D  ̵ ^ . ȴ j `?!L "߳ "3-A( K-P_ P" `p匐@QQ Q  0B01F P 0p0  pc3-3-7-8-0H-P @P hQ\ 0 B 1 <QP @ P03-7-3-G-`PP  P /P../ =p:PP* x Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SAHxPp`FQ `@P@ET@EPP/Q@@-x@ Q   0##"ؾ(߶ Y H-<iP0P$Y"P3-8- 7-A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS R R R  \RpQ  " 03ؾ( e A-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ Rt    t           q P / = #44i @%3-(3-7-ؾ(ܷ KH-MpP B` 0 d@P P P0QLX9>8< X0p7V`Ѝ7-A(3- ؾ(  K-pMll`@B 0 &P8iP0PA $吐P! d`PY  0n .P*  X$! P p P  0 P  0 PYIT@pЍA(7-3-3-A(' 3-ؾ( @-\\0 B@0 1 D P  R T@7-A(O-MQP  X0 P# @P pt X0dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  NPW  `$`VP@U:Ѝ3-ؾ(- J 7-7-7-3-\ >-O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  XP@0  P P PU    p p  L   H  H p H  $HP$H 0ẬW ] QDP nK `V  啬ZdU  TpP $PX $C(ppp" X pP B 0"  z!d"X W> L  0< @ZpPu BP/ 0 pf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0ᳫ Ѝ7-h 3-ؾ( e >-B |NIL"( >- ׸ |INOFND 0H-@P E|0x   <`0\   3D 0+( 0H>-|NIL|ONTAPE|INOFND""O-MP  X0 뀑P0:dpp@PXp}PQP@U: E 1 `V P P  -9 `@T" `圀堐XP pW PP  P    p$@TЍ3-ؾ( 7-7-3- >-չ H-P  X0 N P@T `p P $p$J `@TV4@T (P$@T3-ؾ( >- O-M  RRP  X0"  P  X0  W D븁就P` R]*唑唡lp1P` U *@P  0G  x %0&  @P *  " 0KPP 40 R:Ѝ3-3-ؾ(J 3-' 7-@3-_ o O-MP  X0 Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  P帩U@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝ3-ؾ(պ @3-7-3-h o G-MMP @8P ,, X0  @TP  X0  ȠP':P ^P `pV  r@T@ `PU:Ѝۍ3-ؾ( 7-A-P  X0^ 딀P8`@PP p RFP pWP@U:3-ؾ( 7-! H-P`pZP @o"@/o"PPoR T 0RP P ,t  ⥨PQ f ؾ(7 O-cM@P  X0 t$0``zc rP啨 S0#ip =딓P T @0x#0V rPTDr @C0@#Fp P s AP/ $  PuJ(8 Т0\`PI@/0)`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQL PF! 0P [eP : P2@ PH  P P6Pf ⱧP wP PcߍcߍOHX`XT$ H0 ҷ3-ؾ( 7-$3-A( 3-.R >-E( >- @3-! ?- C-$ & t ?-?-?-?-A I(R O-CM@(PP& UP`p㰐Y AP y o py@T:]U[ ptXp `P 0<PP P `X:P*P  0s  P  0i  0SP lP f [:P Cߍ2-Xf-`-3-ؾ(  4 H-$ 0S  8 P/>-E(p@-P@`  P ll l0 a  P  ``4@`p?- ?->-?-A(H-M<vP,0 $0 $厦s럿 ÿ $3- ؾ( @-H@aKp `  'WP p@`kKЀA(@-$@   P@3-O- MM`@P/0c [ !  0 01/ Ѝۍ0 01/P ! @0'댁P epP dFP TT pW 06P  rp` 0W @`尠0 P   +0 0} D`p 0@`WC-!?-#"ؾ(q Y ¼ p@-M@P 0`q@P `Fv\\ ⭥P ?\  +vJЍpؾ(\ O-MP `4,㰠Q +]JP+Q!R 0KS p@TP T:P |  _pP T U pP 8 0pЍ"7-3-ؾ( ߼ O- MM@-nD/Q 8cpPC @P? `P/0젟 !EP. # "  GPqP pU P cpP  PbP @(0/Pp Ѝۍ"MbC-?-H-P /0`@HqW !  p@@@ C-@-@I@ZO-Mp P  X0& rP#@0#0蒣#P 0)妤먓P `I0 P` @`@( p`@  xPU T TZxP UP@`@0T d@  ḣ@ $txPiPZO P@G $ TP@Z 0P4p lP hIh hIx0ST ! 0 $02   $ !P h0t x nt @I0` U@v 彁$ 0 @TZЍb @ˣ ǣ) 0ЍO$|\嘁tXD咁P P 0< 03-ؾ(> 3-7-$3-E(  >-ʽ   ( E 3-3-y 3-!X { e K-MMP@`/0pP # "  0Pp ,MHp(tA H@PTD` Tp{ /Hp# P Hp) KT>H  P  2( #P!: ?P " $ PPh @ \09 @ ZЍV-03- 7-R-R- A-/@/3P PpPP `P PP4 O-MPt  딀 q`P Q@Phc  BT0aP@U ЍOjf V-03-p H-`@p V: 09| ?hh`1Q$0A$@T @P! $@T7-K R-R-3-e p@-@P P P  P ` PPU U PUP` R P{Pb 400 P@$ p  5 F V-V- R /R  R/Tt @-@<  @V-p@-@P`P>V  ` @//`P XP ` ux o pU V-O-tM@4PP $$ X0PtЍPLP x_ *L@P` @`GP p 0 @qp@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(2pWX@ T *P@,` Pq ``D@ 0QD `V `@ 0p@@ pp @0 08p@ Y^ (T L tЍOE3-ؾ( 3-.R 7-R-R-(3-7-83- G-MPdP XX X0U[  8D`p ʛ%^ MoEp ʋ^ =_x0@ # H-@!0S Kaq:pP P@2P .g PVP ] P03tGP lP\Hgj\44 02-(3-X-7-ؾ(X-x !X-X-p@-dP@`@QpP`P :TNP @p$$ 0&XٚI((3-\-ؾ( G-M P  X0 EDP  yp\0\#P  S刓嘣 00+|P0 `%`V Q %wB P "% P X⋝B PbŸ"0Pp0CA00G0LP 0& P d"pk0 <`rR pp1  R8"BP$tP } R ` Cp4ڈ  B? P B2 P2AP P t!( X'JaP"A|PЍ A3S[ 00!p0?[ L dd00{p0 Gș3-ؾ( X-X-X-I(3-(3-2-X-\- hf- n 3-2-\-\- \-TI3-83-7-#"I(D W 3-y 7-7-`-1 T"H-MP" QQ @P ЍHtt Bp f[ <L⎜Ѝ$$ 0)k3-A(X-ؾ( X-I(m O-@Ѝ<3-ؾ(w a l R 3-v O-$MM"R匂P|Bb吒尠$p P *P #3"#AP+\ \ ] (\ ] ]  P eP Q [P #3"#t p 0H d L,4P04T< X 0 \ `p$ "0尲hPP(pDP@ H L0  ``@ H,P R@ $Ѝۍ@3- 3-T? .  7-tf-ؾ( 7-W t O- MQ@̱( P ! Q  딡PP Ixx` UM 0`  PP pP Q:pCAW k Q*QW P 8PP  0@!0 $ dP DvP0 Ѝ3-@3- T `-`-) ; 7-V O-,MMP t0x&00PPP D H`PP (P<<@(P rP`VY PP H% 0epP  0P: *p0 \ 0-, *pP U #X(%5( 0u  0p W ( Q PNPP`\VF > |* 0Nll$ bW ,< P. ( P t`P@P  c  <p#ᶗDP PR 㔔,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $厶 p@t冶 nP $", Xc 0LX@B` #0 0Q a0 XA(P%tPPW (P  PP(@PEUʐ[Ps x `U! V0pG V@Q  1T0Ѱ T`G(@n`FVʴP``(@a`FVʧX- `-`-3-\-3-@3-ؾ( /"*  < ^ | 7- $ O X- X-I((3-X- 7-83- 3-\- % 9! 3-`-F y x P/AQ y ;I(X-H-h``PP QLLP @ @0@P@P0 z@3-`- 7- `-O- M3p R cģCȓPXQ0 U0SWluP 5 P +;P [Xڗ# R [ P 0 [P[} Pl  pGWt"P{Bx px0{pP P P\ DHP  ,, $ 0_P5 Pj  TP B P ZU? pK [(lP 0 4P-lqPP<0p RPA P 5 ᳕+ +< 0  Ѝ  t%+#_Tl ሕmhf-X-\-(3-X-I(X-3-ؾ( 3- @3-#  3- U \-3-< \-\-O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0D:pP A  Py`@\n m ,o Do ,o m ,o o ,o tq ,o |r (P d X+P9PP Y; Z?:pK  ]:]:ZI @   0 @x>PP D X<P(P $;:p:  +:+:ZU P@   0@ PDH 0'P LP  ,P   X⬔P :P-}9pԴP@P 1/T  `9 p9 D@$rZ 0P 8[  (2/P pDXP`)0 XpW`P @SP |98y9P @ 0@C |8x# PP @P Z:@ `PU ;88  6969Z 0{Pr p 00P $ XL `PP  Xܓ ЍOE`P=  X͓7R0|& P څ8ׅdPD tt Up@8{R0<tR0 ᛓ `Ѝ888 vU ᝅ8ᚅpP tp@ 08@3-3-ؾ(D ,3-3-e- 3-e-e-x { H 3-*! t ~ %"jd" e-a-,{ | "U A(*    4@3-t pC-M`@ P *P gICPhUP @PP L PPH؀P 040  PЍp`f-\f-df-l @3- ؾ(O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  h*Q Q  EPRPA P P< P P 0PP!PPy P P`gQ8j@P!0嶃P ,Ѝۍ3- T `-`-I(3-. ؾ(\-@3-I } H-MT  P< ЍH[, 0(0P 峑㘎e-a-@3-: ؾ(H-L`@HPpW0p$ +p\f-`f- df-H-0P ⋑p@3-e ؾ(O-EMس@P P  XwT 8c@XpP PPp 0 RP @0@!4SX X' X 0B  B  0 6"$ 0B  B  0 6" 0B  B  0 6<"p 8P , P  P  P P  0X Y:XX X# X[ D!!X% X- XL DL!+  6D!  MD pP   D   4D ptP 0| Y ᖐP X PEߍ@3-ؾ( .I(G | k \ 3- . < 9!/p@-MP@P  0|3/xPl 5p ЍpL@P`(O< 4 0`M2 3-e-e-3-e-@3- ؾ(p@-M@P  03/P x 0p ЍpL@P`hN< 4 0` 3-e-e-3-e-@3- ؾ(H-4P4`4@pPP p3-@3-t MH-M(   ÐЍH Ѝ/ؾ(;rnyy;sq{{Yz0H-MQ  13?  Q 1 Q <R 040,@P0轏Ѝ0Xf-I@3- ؾ(K-M/@/P Pp/P Pp/`P\ 0`PЍ0H-PP NN@P5p `P TT X0Hn0@:N0  0H`' 3-3-ؾ(L ; 0H-M@  h  P=Xb,ۍ0 xf-0H-@  P. ( "P   P  P   $P p 0d\` S  L<<0Hؾ(    % : N g u n% w xj- p@-MP@ P`P ``PPP8,@, ,0 `嵍Ѝp xf- 0H-MP@P3p \P PP X0Ѝ0H衎qM$ ( 0ᗎЍ03-3-ؾ( @-@P Q P K G@tP 4p XP LL X@i8M0 $ @^Z q 3-3-ؾ( ; @-@P  @pP{4p TP HH X@6{M0  @+ 3-3-ؾ( ; H-M`@PR P$3p[L"VP,3pڐpP x0x| V X0P@ 7L,, 0 pЍ& 3- ؾ(3-? V _ MH-Md   壎HP<P ЍH Ѝ/ Pq㢊ؾ(3-`" 0H-PP 0@H3p T@P DD X⟍nL0  ╍03-3-ؾ( d @-@P O K@pP2p TP HH X@m 0   p  gP a.Xo   P`qE@-P*   7 P @PH @P\ \\- XIP2 @P$ 00-H`FP@:Pa0@3S) `@BK, ̪ ̪ 8 ̪ D ̪ t ̪   ̠ ̪ ̪   ̪ ̪ , 4 h t ̪ С ̪ ̪ ̪ ̪ ̪ ܡ ̪ ̪ `R 0A@@ S3t t t t t t t  t ( 8 t H t X  @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   PF!X  aQ QP 7o/oP" Wt`Q pp@p aT gT cT\'  p(P ` p  (@AP @R p pQx `xp@@P@ P PD  @ P@@  P P( @ P@@  (P P(t , @ P@@  P P, 4 @ P@@  \P LP4  0 @ P@@  sP P0T`K`Q PP $`@P`XX X @hp@P_ h+p7P `P 7P P  P`L\\dETF3PP 9p@PP2p@P- <P R' $0 0` `QV1AV0v QV  ` ?#n-n-p@gPD P@P2P " 0|P  vV3$DP TU 7U Un-n-$Qi[ L H n-n-n-n-n-n-ܸ(n-D4G 7<$5<(3<,1<0/<4-<8+<x!+n-b`^n-n-n-n-n-n-n-n-A0"n-9!n-"] y "0 H n-n-8o-n-n-n-n-K(@o-q-< I W e v ؾ(  9"! E 6  su"0H-0P@P PPP0J(O-4Mp`P@P,P*!,0 $"00 (P PPPPCp0P 6P P00 Cp0<P 0P 垄0pPp UX*` P, R  PyPP `V::x  )pm7P ,Q>8  PP M P0@P  B/;;P 7P P|CtYDp4ЍLX n-n- An- n-n-n-? !  O-\MM@`P QH 0@<$\ЍۍO@P}4 4 4 4 4 ı 4 ı ı ı ı ı ı ı ı P б ı ı x ı 0˃#\P~tX`rd弃(\s ~e8寃  ~Y x5 8垃!p4,0,#W W\P oH~X?  ᅃQ, Q-)"z"\P~0X"\ЍۍedAP @ H P X h SWPTM D @ Q\ЍۍO8j@Q:g@P189 :0T;p<`=Pp`P!%8;=E4@APBpC`D9 :0<>?($ `pPP4jP8 @0 \ЍۍO軂\ P n-I 8,t ?#+ z ?#ؾ( ~?# b $  @# A#|?# 9!\@#O-DMMQ `XPL"@P}4rXg`@P`XX   5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hX qQT4\f0 .pA~hXw pP;  .0&O 0 . B ZP@`@P`XX X qXDЍۍ UA#ؾ(q- n-!O-Mp@`V` ` GP ` W W` ``P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P 稸 | x x "Pp p P@ P:0WW``- [a( Y /P1 W/`P p!`Wx 0`Zp @`Ѝ^p 0  zЍOC/`WP WP ߤp1P YKP   Fe`P9`W  ?( n-K(n-n- p@-@`P R!P2U e1 E op n- n- H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0n-0H-P@U U d D` 0ቀ0  ႀX0H ؾ(O-dM 4"p(0P$8,$<0 0p " J"v" H- |yؾ(1 pC-@PЀKx4ЀP P`@ @X`@T @ 0DP MIUPKp Ps`y- B#`s0H-@"Ptqnkm/j!PJd" @@!X喛  :!D 6!8P, /!0Hh!0R _ y-_! u-K-MM`P Q A !1@D{xntP l1@Ph pT0T! >|Y V @K< 3| ^80 ;3<V "v< & 0*0| Y ! 0u R 0mmP P!u@Ѝۍ,y-0y- .R (y- 9!' I   y- y- u-4z- p@-XMlbP `B `PLQ DB@@BP@8<"40  :㋿]PpWsP m/ PJ Pd  Q!Q0zP;!Ea3PHQ xx1(!PlA,a@`Q`P ` 50P!P1 QQ QQQR0  ! A P 8:PY%u-| t-t-H " (y-i u-} t-t- 4{- u- v u- u- t- t-d- E- t-ʤ R H-P M!wt-R H-l4z-H-~: O-DM@P b r$ -Lh@ Q D D D  D D D D p HPVtEPGA` P LQL!@1 @yPp3@$ P B řp$ pP   pX ɎP@ Gd ῊPD8(㶊 /K(K(ܸ(~ {-v!yt  Ct '  Ł" H- `zEwؾ(< O-DM@PndcldlsdT K`P a@P L L L L L L L L 0 L L L L L L @ AP# MP& "Lpw4PPp pQh!1 E ` XVppP X + |*PL PW " 0@:V& XyP: H!0@IP apP  / 0IpPc X X ap@ pGWʌ@T@DЍt㾉,` 㹉 {-{-{-{-{-{-/{-0L(G!{-{-{-ܸ((L(ؾ({-{- {-{- @-(M \\@LX880$@D@,   @ @Jy/v < ؾ(\ } O-TMMPL<00 8|P,DceHU(@`L P[ 싟K쫟`Lp]V0 0 `[0`x8V4K 4X 8PK+Dx;UH0ppD+@;UL0 8 P V] P V' KP<Q XQ8  PX XP : P | xXQ8 `<P Ddj4X>| @<PT(<@Q3 P18E> 6p PP%  P| w PP xwPpWP 80 T TH<00 07/P<AQ   ` 8   8pW P 48 @<(P @P<  @0g6p|.  P@(@PP`00(yw<@P @    44 hwD#`wB Rw@NwPHppp$p \G GP,,GpppP hW,`,LGp  ,W,(,Gp  V,,Fp  V,,Fp  V,,hFp  PV,h,\0Fp  V,8,,Ep  U,,{Ep  U,q,mEp  pU,c,_PEp 8U,Ux,QlEpW \%@P 0@vt,A,=$$$vHQ v(~v Bv[I8@ E> @@@J5pt @ 0G8 @@PE>  PPP75pM P4 Pj8P@ E> @@@$5pN d@ 0!'8PH @E>  5p; P$0H8@ E> @@@5p+ @ 0@_0vPXT^ 8Pp 0`L  PPm'P @E>  4p i7"v18<@@[@T' ,$4Y3,4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $&0 PP  h0 PX4 R-5 s{-~-/"#"9!K(v!,L({-{-+ " n% Sp |- B" a (1"* ) 3 {-{- (L( {-n S < O-MMp=P @TT?QD@oP.PQQT o P 弿 (c$,,$ `( 0 p+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD yP; =PP4H=PppP `P`d00@D,dD`DDD,@pxP _@ = @fP  tDP W ,TPz @@ 4P p@  ,PI  'P^  "Pb  P  P  PT @Pt hBQ0 0 8 @ X H ( P aRm p p QrT 2P PP@{ @pQv U@TPY  @PW PV PU PR PO T 2 @Qo PlP8 gRi3T 2PP P@PUTdP @ P @ Z 7PL@ =PPF=P@P 0P0tc` X>FtM.hp ``X` `p0 `d0`F> ` 2p D`@P;!9Ut (`0wd P` =PP[ =P  =P  P9 =`0@P`0c <BM.  p  FnX 0 A``P`d40 `1p hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP, ( , \ , ,(P  PTTTP >P`ppd w"Ps1 (P P7 P% ( { @PUPL(,P@pW`,P* X @1 L Ll  Pb Q vQ Q Q \PTtR:"#PT ``F> 0p H`4 G 0@ 1  =UO qJ(qB &&PW  @Q s0{ppP pp<y pP.` 堠4 P   PJ 0pPI c 7M. 0-  q 5 q'  @P LQWP wP b(  F0 ̔0pT@` A$ M> P&0p @@_@PT!L;0  G @Q  {-PP   `PP ,L(`PP PP  R%  {-K({- ФZ PZPZQ)Z&PxtL 44@P{- , ( 60PP P {-a M `0 /p P P, PC 0VM.0(Z P |C 0= 0? 4C0 0,F.0% # D X дp[ [*  3<" "? "P ;d`Q P@P= \P] 6 /PP P  6,3@!POUJTH TP@PU*%o , `d @ PP, @ PPl "F @Psm뜱"-\/ tH |@ H" {-{-{-{-T" b {-{-~-%   Sp E#M 1  c -  <" D &  ] K p < M0H-M0@P00$o 0P P AAЍ0HЍ/K-GMP AN` XpF` 0 @1.p`PV`v  4XQ:6&X`Gލ Q( Q `O-$MPP/P tPt@` /pF   9Pⰰ`P$ЍO9,L({-l}-O-\M@ `lQqX: O/P 0:P P  # " P@*Xp\Ѝ` @0D4` @0D 0l}-! B#  Mp@-Mx`@Pd coX R LL0Zo  *p,Ѝp@ Ѝ/(L(+ {-{-N {-@-@P @Q 0 %  y. pp@P PP i- 80T(Pk{-{-W {-T"{-A-M`P @1P(p 0 WЍRWP& XW mЍA X0ЍAC`P P# PE  X3 DW W n! n X   m# X  0m    0|m  l\\mWPЍAm ЍAm{-{-{-+ 0L(v!{- T | \ ;!_"pؾ(K-`pPP``1@ p 0 WRW P9 4PW emKd X0KP mU`PEP mQ P xmU PE@W hKmmW W0gm K)m  _m{-{-{-+ 0L(v!{- .pؾ(A-PLP <PXe``8 0`&p VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝ{-O/ {-{-{-H-0 l 0@  @ @ \R $0@BR(O-MĀ弐`Pp @` 0 T  0 p C@`VTDw@P Ѝ 7x   9!* O-dM`PP HZ8 p@ ^|]J 0f  0  f 0  .[0<VP @Z P J dЍOf  ( 0H-P @P08PU 4P 48`PU:XP0PQ4P8P:XP00,Q$/  {-{-4L( {-O-MMP` @P @u앟 F쥟 8TP0U@%P% ' ' ' ' ' ' ' ' ' ' ' & ' H& & ' & & t& ' ' @& & & & 4' & (& ' @' ' ' ' ' ' ' & PAP DPYPwPr@Pi PaP[PS PMPG 8P1PspP#jppW  FP P:   L8W`V LP,P 2X WWP P PWGP;p( d) * ) * * * ) |PgFWڀWI  WV  WpBpR'pPj `P P8 ev W; @Wr!0 0  0=Wd A  p[ A bZP) qv\P'ZIH D!00 0  0f8 '  p  C0P&b r ?e*㛙@9eT 0 !$!6q0p*eb |--/!--------ܸ( 2!   -  K-P@(a(q( 6tPP>aPp'D Q Q`Q@@eP! @P:{bQ@T tP dP@HH P{e8 we\b H -/ܸ( -ؾ(G d 0H-@ Pae ]e| Yep Ued QeX MeL Ie@ Ee4 Ae&bؾ(r  J X  H-MM@P  WYP* c P%J $ $`pPP 7P ``P   `q p4B`Ѝۍaz --- 0H-M@  YP DPP 4  L pBPۍ0茀-- O-oMM 0@@@墰Pj 0@啰P.P PpB ;_p $  . pI @(,P $P* P: @$h  . p0P' P!1  `_cP p,danXaP  c,аX:(P.  . P(P% @P 0a P `'cX `7|`P P fc@T:  (w-PPkJoߍۍE#A"|d>v!~ -D p edA|P"O-MMmP``d D t P P P  XP PY  A  aPY T XP 5p4p0 MP `P Pa ,P P ~`,  p*8  ` @ozPBp1 ~`V P Y p"p2@`nb-P D ")8"$H EA "2Tb@pPU xoqo `A`qm`PTEY @Pe U ` 0wb<PW U  jb  0c@p V L  0cl@lpP 8-P t"PP __8&s 2! - - #-" 9"  p ؾ(8 `  @-@pP dP   6p , b@茀- O-M-Mh `d @Pp7WH"PJHP  pP X: J.PV V V| t(   P< 4( 0 ((P (P4 toU\,@D0 Pp@ ` pG@oY1W4P t0@H @L3 ?D) @ R 4) @ R $)@R @t0S0t@  )yiY@ @@H  P`@pQaHXL@\0Dߋ0@` lp8hP dP tl0 P @lpo/\p P0T`PX@` \J ;G$ `@`\p ;$`\p H0' @`#}[ pp E;$x@`[8p t0$ `ZL } 06 ? t0 `H0@!!@ ! 0< E 0` 0L@Z L@<0 Q   `\` X@T`DP0HJXP,0P# ;4p$P h @P0y[p? ;$ p0n[p4 \ i`'Y@P~ pP4pP @` ;$ `BPPL[p ;$APA[p H@0 P! l0#D!}1[p `@ X$;`!x![p vpPv A{EL}x t0#   @_ 0; 0 p3 l(0p @`0lUᮻ4厔P; P` `pA 0Zp ;$p`Zp `X$; xpZpy  x0ktiV(4P^$ 0  0 0( 0 BH @`@!l0_`! 0p V 0l uhdu Ahd$+ A 0 ) ` 0lt0p L ` @_ 0PЍЍx.pY@DC h h h pG 9!{ Tɚ; i  iA K -p ! z h   Ap@-P R @pP`lVp@BppO-MM@Ppb 0fPpp RPqPk !Rc P`p SP\ @@ ]P AP  a@P@ 3  P  P O@@ FP# < A^PtP =Q?pl= R< Ѝۍ $ `o> -ܸ(A [  e H-C _[ؾ(p O-M@@PZ ,qvgP! `P ǀ`H~A@U U @B P P `FpV<`ЍP@P `@`P(B.RP n먀---  H-P P P||| ^tC4hh h0LPd@dp`^0 SD H ꌬ- b>.<6.E#A" /"v!s 0H-@PP PQ o^x0 RP\4&H0&P0< ・00 0E# /"-H <6. b>.>.>.H-P@P@T`p|T Q\ enTDP 80 %,%P@p0->.-E# >. H-P H3  <6.H-P H3  /"<6.H-P Hr3  <6.H-P$$$ ]3茬- >.<6.H-P$$$ ]q3茬- >.<6.H-P$$$ ]_3茬-3 >.<6.H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0%!T Tp =@P P H 2@P PP 2AލY d <6.(6.86.46.u z p O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $G@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXP + lЍ((Q6.@6.b6.b:.-[ O-DMMP<@l P$ <>Pc @@:xuMP <<\ PT <@ AP 0 P3 <P. < 00< B@0Qo0TA0#PP <!@P@PQyY,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< 5Y@PQY 9DЍۍ <6.PG.\X --ح-06.46.86.-z (6.u -- H-8<P 0 ,,P ):L눬-- -A-XQPQ DPD`p@ Pp@PG.---O- MMP@P\ |PXx`Vpqdp` 01ZݽL0+?PJ0?P 0Z 0Z忽 +0?PZ0$@@0ZoPaP nP@pP qPt t@l8 @@ YH0  Ѝۍ-- -w ؾ(( PG.! @- 0$ 0 @6. G-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0M@WT  P0 W2p@pCT Th!L<P P @!A<P PP /@3   0/@+P@ r( @ R @Q  VTt 0D)P@@@gKލ(7@d Y <6.06.86.46.$?.F 6.- @- 0$ 0 @J6. .R O-MMP P";P 2B  00$P P Q7PxJP t\r P>Pt P6-0Ѝۍdh 0/㯺 <6. 6.PG.$?.\X --ح-H?.46.06.86.F - .R -- K-AMP-@BXP) `P M+0Ѐ``=p pPJP  0`E+0=p̈́ -8 4W Aލ<6. "6. .R -  P/zjA!H-P ,,, ,0Wy-茬-3 C N <6.p@-P@P Po`t P `P X-pU , `P$00 WpzjA!-W H- 0 -_ <6.H-P 0P $$H*-0--i <6.H- 0 謬- <6.H-P P!,$!A?o2Q@0!`@PhP pbP @P( 00 ,@P BWh@P \h 9W\1PL  D  )WzjA! 6.P--  4-<6.H- 0H 0- <6.H- 0> Ĭ- <6.@-(@(0 3  R4- <6. 6.H- 0# -) <6.p@-MP P P h/o"Q ) @a/|,F@PP aP}<P@,@@T P x` h0P t0@  T0VLDL 06(0Ѝp-zjA!--8--q : <6.H- 0 - <6.H- 0 ,- <6.H-P PP@PiP dP ?0pʨ SV+xo200pP`TT @S@p L`@``0`6VQ 蜬-zjA!- -<6.H-MP) P'P  8P P}Q xP ll\P PPP 000+Ѝ 0 <6.0-- / HC.HG.?.0H-P P  P<P @p ;ll0P \T U 0Hc+0<3($ 0H <6.̬--H?.H a 7 H-MP PPL  q8P 4mP$6+Ѝd ?.<6.O- MPS PX!P8PK HaHPP34BGP  P ;P0 @pP P P &PPP pPpP ];pP3P* Ѝ <6.PG.\X - ?.--H-MP$ P  7P P|  7P PTP@P4P * Ѝ ?.<6.G-Mp`pJoR@P WC P㌑P' W4 lW&T{:p`pZH0P( PP0Q$V/ ;`P cP%) 0,ЍGW`p7*PE@ :|` ᯱd0  $V ЍG Ѝ:! 45 $?.  <6. ].R - O-$MP P" *7P{ P! !7Pr  @@ iP |P %;P^ PY @TxqxPP2@`EP  @P3 /@PK%,,PC%B--ح-$6.-K-MP P!3P +P p\`&S&&HH!p P 8uBP(/@% P P%.ЍP-P `0@  P ᛭P @2/LP$.w <6.- -~ ح-" -$6. H- 0~ 06.2 <6.H- 0t -? <6.0H-P PP U@  +p%`0L @HH000 0G,U0 0H=46.<6.@6.Q6.-Y 0H-MP< P @  3P,  2P( P%ʴP !@P  P  @@d+ P L+P i%Ѝ0茬-86.f <6.q 6.-b6.b:.p@-P P!0PoobQP``@'`@ P P P  P 6%|| hP  \\ @HHP 88 0{O pzjA!!(-$--x <6.H-,0, (0\ 0 0-d- <6.l-H-,0, (0\ 0 0-h- <6.p-H-d`P` `0@P0lHpPD D0``P0_$`0-d- <6.h- l-p-H- 0O (6. <6.H- 0E ,6. <6.O-MPPR@Pڣ$Ѝp` P  P p P`U j8PJ`U c8PF-B- U`T P 0 0p S pN U`T pP x0dl `p0h`P S `N - -&!"/]"X-T-0- -A!zj`-\-$ H- w<6.H-P |PPt}Q hP \\mTAPHHH 000$ ` <6.0--e HC.HG.?.@-MP P@ Q P QJ R  ;N#Ѝp| 0/Ѝ@萰L DD@0  0 Ѝ@N Ѝ@$?.6.- <6.0H-P ,@,PP0#00- <6.K-MP0 8RQ4LtP%" 0P! PP ܑ P !p p W'P e#Jq p||AjPzpF p P  W2  WR3 pV@ AQ z P p AQ z P\lthЍpG$ܭ-2 --= TG.H.ؾ( y  <6.0H-MP  PP| 0P W4@Pp @ 80;Mt"Ѝ0d - <6.0H-MP # P!P /P 4p `@ P:5L0 Mq"Ѝ0d - <6.H-P P"(HH <6. @-00 @P 0 @L.R - H-MP PP  /P 3P @(P PPPP"P^`[`2 pȩP ᔩ ᐩ,ЍY ]A"<6.O-MP  PP  G/P (P PPP "$P`p2|@ ᆩ lPll Ѐ`pDD0Xp`|Ѝd ]6.0- 6. <6.0H-P)@P5 P 0 P + PPPP5p 0PT0H004 4 L! 0 ="" ---# <6.A-M─  RPx0S lpl@lP` QK0`SЍA|! Ѝ<6.S(-N 9!H-@`p&P PP w10@0PT,, HK HK0--m W p@-|`@PT&P PP < 8Kpp@-! p@K<6.- W 0H-P \P H@LPGP0!80   0,0H̭0-$?. - <6.0H- @R: 0`  R L@ PP @ 88 0,0H詭P00-$?. - <6.0H- R R l@0 PP ` @0@@ 0,0H~ P00-<6.$?.6 . - O-$MMpPQ %P $ -P XCP` P P@XPU  J$Ѝٍt)`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)Ƨ NP@P@0 0@ @ AQ`@)ᡧ)P]%z%P Pp  P P M T@pP Ha8= @P   J` Y` 2/PP )E%| @P  P JY& Z2 2 ܭ-TG.-(|-- <6. ح-" 0---!O- MPl@;P LP P9( 6(P Pp  ЍаАЀ:`P P `P"pW pῶP|P PP `Ԭ-ح-W W --@-p@-MP @ᯟP  㩟P P ` 㝟PU PP 0PЍpd%PPЍp@ 4 P F0yY!!!!!!G- M p` [p. ۴ P/P:P" 5p P RP N ЍPP `A`pD@cP'`PX᯴p 0p/     /p娬P p. P :㜬P p`./ PPp ,@cPP .P!/]"<6.!"O-wMMp`qq|qxq`T```tq```````|`hpx`l`h`gppd``0`` ``S:P p &p  &|p |&xp x&P; 5= x@0  p x.|d .h.Px(UlpP'PQVPQUu UyQu - _PG Ptp t PP 1/dQP Px d   P AP :P 3P ,wߍۍP &/㪫P--P P  PPPo؀PppPPP\PXP PP/?04P 4 P@ ~\ X 4 pQq3dP XO TG  @G80P `QpQ P %x%^ R Q OP Q P Qa-/|@p |%|#P@P' PO }5P xv 7%peV k"P WJ@n Q;Q  @n qQ Q)PxW p@nPP j # R ? 0  R (` U/? (`͟(` R 0m S썢 Ρ0 <4P  P 0( 0 `p Wp  Xp ߷#PP   LX`̌ PP ̟P ,P P P&@,P  X̟ R 0E nS3 nH0ppT0(p:@P0 `#p @P  P  p  R `@F#p0 P0`+ P@ @@=R$ Gj/5ue0SG/ rP@H` 3j/5euS FPP T&@p3Po P``@@P y #4PS PRVU PQ`@P > 48_x,QPUQPM PNJDAIJP |P$ $`=P H4 0 %0&   P 0 '0* 5@`0P&@#P `P0P  0 ʧ<#! hRp Pl PxP(!P RL *pn'P9 $p Ln_: P  P j AQ Q(P ͰZ:  AGP PPL$pXPW 5QP PP  P d*P!x0P x`%P  ! jo 0 VpD PPP3j5ć-R 0 (0) "'* $DP l+X6PL۵@? "Fg" P~P":!|AP) lP% P ! P @P  P: #t @P   Dx1P !"@- -X\0S  ! jO`]aX\ 0!3/`p@X1*, Dl@ pP" pD Z  @ 0R;&!0!D-6.6.qW P P0( )n `Lx|Peeee>TUPv?  Pe-P Pi f6. !0--!! -A D -ؕUYP^ HhOP b[jo ^  00 0P  ῠ ỠP P  0C p0Po2  .pm[.k?g#p~ ]- 9!Y ꚫ0x `,P-H-IT- `P UPU ᣳP rUU ᕳP dP mtatp1ڠ!^|Q<s!th0T2j!P<f!P < CPP P@ x0  .x `pB6x| I /x//}Q m@!/ R:m MH  To/ DB c/d P =,QT/ PߚP  K/ 6.4-,<C/똀P` h|YpQ`U P  Bt */ PLV P H nBP8 /UP | [ //p {ȰP^( `j?   mP pn q6 Q! (+ @  0p P `@ 0 J[0   P `?@'DPz <`n?9PP6 0   P$ P P Q'P Q'H P! u !!!PP n& 00`4  H @ <Pn? P 0 p P ` 0  P!u!!9!8K@P  4p PWP#)㡝d b!8Q6 Q; W   00H Q <   00PY!8 1R#P 4 >@ x4P0 P  00,@P @`#@f!P hL4 @4Px  00H=~`  004P: p  00`"  0pY P  P 00H 0C 0pCx-M 0  `!B0  04P@`pH@ P0 DV U P `W+ W! Wx| x  p  04P@`{ P P p!:6.6.0--9! -ܭ-TG. -!|--!W! - C!!!!!!!-!'!&!;!-b!u!!!!C N !!!! ITS(( !!*!S!b!l! !!!!!!-!y!Y!.! !!!!R!*!O-LMM@  P0P(P,PPPRPcP  $@P]P  40 ,0$P:OP $P (0Pp ,P P PP*lUP( LЍۍ`P@V= P@P8 /㞢 PQ# P* P#PQ ;㌢P PP P P  '4P ՛ `PQ  @`P P `P`U P IPTP ?`P`` `cs@@P J@坯8 +㕛 P8@<( @D\Cp8 pP P,0 ^!P X `X8; 0"S K8!`U. [,B尲8p `P /^P`` P P +>@.>.--<6.A  u !\ ب ؾ(6..R z p ! !#-" ?.--- 6. ! !\-<-A-MXt` PrP p   $P  pW  pPpQpCP P8 P7 P P{&P1 P&P|yt@@)`cP Q PPQ h 0SPY YV Mr   0P3 P-x:   D0P0 P(B`m i   0`4C   =P< o P P6 oP h P pHT4P,@)'PP Ѝ (P  !PPP C ,6.u z >.D?.@?.>. !->!ح-!-- 6. !#-"- ----<6.\.!!t!@-hM@x0 @@rP sPxl@d 4`d  PP0%(.D-6.-PG.!!!--!O-MM̨P 崘@  똈p>ڌ 0 P]TP2 HP.<x p00P `` p%SP|xt4$q p1$P!~00p! P P4 `_ 000G~`pRpQ_` Qa Qb Q F@[@Ѝۍ <  @0p@P>Pd"|x$t4q px0$P!~0p0$--؊-<--d-l--0- !ح--X.<6. ! !(- ! !- ! !Ȋ- ! !O ! ! ! ! !( ! !Ĭ- ! ! !h !I ! !O-LMTLQ LЍOM] @jpD P cp= (P(, С mP<=iP(,  00( S00@BSCC /Xp P #P ,P @*LЍ  <!P@p< pfP b#P   p P Pp =P0  \@ <-$--Mb ! !؊-!!O-LM`Ptpp̣ǿ[ǿS@0PW 0@P}@   ppP #P  pPJW~ PP  Y@pP ܡ#Pe J@PJpGPWppP  <# R (  0PQr" @P  P P ء ?$  R# P0p#@Wx p0 08 (P4$p0SE/ppP r_ P=@AJprPP'  P #!P0  @P  P # @P   0@0孓oBBPwLЍ#{00H--O-CM-`/@P,M\<|LЬ0 P  @o" 4Q P0P&| PP3h   PP4 t!PP@" \P @WPY-P !/[  / $  Y >ph PG PB8刜P< |P7/!pᠠP  PkW @W /*PpSڈzP | P{pP p P LzP < Q  ( 0 p0 P, Q P   PJ  LIPc d P P Ro 8  p G `p  @ dIPJHXPP 1/P [P`CߍP [P lw T0sP@ lP0 P Y㰗 .P (壛P |P  &P? 'p@ dt&XP\P@p H  P gP Q @VP tQ P Q?P P  R @@Q(*P  Lv `P! R &0p \UP PA P  $UP @pEPT#p PI P pHRY"  @T @P  P pn   0-=.,  0  P`P  ,p @ V v V  ,p #tSYi @ TT @P  PI #E0 pP000qK,t\ 0 ?P!JPp`Pc P pP p`U  0pI M#- @P   -Q@ @Z@X P 0  @ AJ"@ b P 1/YP $A ,߼0 S R P_ P QP >0 !0  <8 @`p,`(p0P"pLAP8M0 ,P- ,-H-6.!4-6.0--~ !!----<6.A ,6. !"#" !>.>.6. !#-"  u\ .R ب ؾ(--- 6. ! !!T- !6 !` ! <-G-/P/p8P @T2`pU)`v+ܠ+ ၉ . V%@1dp1PpW u`9P PP0P PJu0QT.Q@DP 8  !"#"--! !0H-hM@\s LPd < 8Pn-+!--A-MLQ@PC `lP    0}FP  +厏 %PP uʴ P4T P+PPyP`Ps qۍ@(0P(ۍA\.+!D!\.-<6. !@-,@ ۜ@--G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,㖈Q00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRQR MAYP\ F Bl@ l!+8+4@W+/W++ k P  G/- - --ح-.->.,6.06.46.@6.Q6.86.b6.b:.0H-tP2 `P T P,P 88 80(@PP --- --PG.-p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q ttw`H@ PJP (E@\.!<6.-M!Vꌬ-M!O-4MM0,@ A,잟~^.>@0@}^~n.Q ^n~^@^pp@[|>Pn~ @@n.@@\>@0\@@lΟPp>x~Pt.Xn@@@@@@?P @ +$ PD*(.(0 .P  )P& @P P P P H<xP d ۖP4 0P R Q P  ׁP 帖P@@lP\P,X P|P T P``0 `0,P 4p@DW, @ 0 T' $ T' T' T' % T' T' T' T' % T' 0 T' T' T' T' T' T' D T' T' T' T' T' \ T'  T'  T' d T'  T' T' T' T' T' T' T' T' T' T'   T'     T' T' T' T' T' $ 0 p     T' 8z( P?( 0P 7z +# 0 P:5   0 t 4  0 o L)0 eH<y4 @wq pwcjp 댉pip$$P\ Qc pWS @,y( XP ( 0P! 7=,(奕 0P& tx( w|P( 0P <xp 0 8p $}  08(4Ѝۍpq`@ 0;I'7w0UA0,@@,  yxd7 nPZ@W@w@@@?PQ 0뤕P @PR2@P P PQ PQ +@ Ttx+Ʉ P:?P X<@Q@w P , @  ᮄ&PP uP  uP  uP  uP  tp%pP \X%XP D@%P  ($P  DD0Po[,:}RP ,WPd |Pld ,@pe@P `p00 ?Q  0'`+4,tp帓r帣 DV@@04 V P R P 04@ &jP [0,p.8 5    ?@0 6? 0 6 Pz0, f@LP Pᾗ|#Վp0 69!W!-- -!-!m! --H-e!-$-(-X-,-0-4-8-D-<-@-P-T-\-y-x-d-p-`-h-l-t-s!|- -j!,!*""R !!!!!-!"!ؾ(---!/!!!/--!-1!B"!-!-o! ---TS(Z!-.!ܸ(---Ĭ-Ȭ-!Ь-̬-6!'!/!"! y =!!!!!!I! ]O!M!Y!_!!j!!A g 0g Ԭ-W W ح-ܭ-y!!O- M((B44R4bP  P  %姉 )0 p  Q PSP pp W| P lPdʵT! $  2/PP P  @P  P (&   ЍP  @P  v &s눬----i ؾ(-!-|- ح-" --`/ W W p@-xPPlP `@`jP PH5F(@( P gp-S(M!-Y!!p@-@P 0`PP EP @pS(p@-xPPlP `@`0P PH[5F(@( P -p-S(!-9!!p@-d`dl0`` 0HP\@ @T p-|--5.--5.H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUWdL(O-Mp@`ؑV, PPV( V)JtQ@\p1pdd!W $X!P  `Q R L 8`PG ЍOuЍO#V,ⴰp`P p| 0U 0\ d$HX ` ㄁ `2/ЍIf -I!-!N -!%!ȊdL(0H- $R!R!0S S1!Q0t100 R R R@!084!0S S0100@ P@\U "UPU "U P@PU& P@P!UU U UT 00 0S S 4 0( 0-5.5.6.ZS(XS(0H-P T@P PP PP  30 3S(!c!@-D@p0P8@o\S(-O-M-Mp$  $p P+(<8@ (P㠓N/h(P(╓N/]<@8 P  jP u 0S l%("P@T3  8 A8  A%( (  _dUdPj0!`Q-@AP @D T$tdPp?DA( j! j X`@ pP:j)0$  uK!uPP:S0:UP$j( !P(10A,qS @Dw8 -T=IBJ P@   APЀX0 7 A  QzV@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0I! PR,@@X!@R : P\" R8`p 8 AkG   H 0 JT!e!P$P!e!Px ,(P ލЍ P*p!e  Y@LL!@Q5?e ,AQ%.v w,BD@b"(r02r 7"cA qd P | (@0`  `P%3,.A\.6.\.\.H--!-Ԭ-4-T< 6. 6.!6.Q!(F#9!G#!!ų!?"!!! @- M @ @  Ѝ0H-0MP@ ḒPC0Ѝ0@-Œ@@O-M-JMPP- F`F?pPQ @C57 -T=IBJ   Ah@T0@`p 7 A  Q47`pX p $ # 0  F=P9[ڼ#!HP1 e0  PK xP?@K P*8#ePvw @#` pp7cDepV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0`Z pX@"f ZPVJߍЍ.A Y ! P@PPPP^6@PY6 AKE4 H 0  Q%ᡏ,!p@Pf^@ U: d0T@vw @ ` pp7cGdpCqQ`  W 0Pp Q0pSh f/`4-0-\.H-!6.9! E.(!ų!2!G#=!6.6.Q!Y!\.c! -@-e\@ RHP < 8,P N@H--- O-kMPpPN `@ xP/ :pӫ.뀥p4P| ZP  P PQ P p  HP P  @PhC C $D D :P p P| ԌP  !P ȌP PPJ?P p P(EPPJ?P p P.Qs AQ  {L Q  Q Q q R sP PQ \Lp @ U Ph | hrP PP P H @ Zq AQ  !L Q q[ܡ Q  LpK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P P  p ~Kp娮vKpkߍXhLdd`T\8y- \.9!. /">.>.>.<!>.>.̼">.>.*!>.>." -?.K-MpP`݈뼐@? T*  ` ?,` B0pdd Q`Ѝ@J $ 0D--5!ؾ(|--!;!!O-dMPp@`QP PPP `W P 4P V  U ~  0ppW ̳̃ԓP `0S    P 0jpPVpP \P JPGP py y |yP pK`P: Q $@P@$ ͌ 5 P@ÌTQ d$@P@᱌P4 $P@ᤌ`@T&QPP!@PvpWEQa;P3 PpW:T@ xt1 p@P : PU ᯇ] P , PU ᡇOP dЍ)y PoEP|| ꔬ-!!-Ь-!!ؾ(8- y P X c k u !LG.-ح-ܭ-TG. -!|--H?.HG.HC.!Y <6.A-ā`PqPKV q@Bq P:.P Btt0Xd @qP L qP 888!P V  jPd pP 0RP @@xV  R@ ᯋpP  1s0b Br`蜬-0- X.F!-K!h!x -D?.@?.m!x!b>. >. $?.t-U 0H-@Q @QPP  >qP tP dP TP0 0(!$?. $!P"0!@-@P G x0 t@Rdh0HT P <Q,\.D?.-ح-@?.p-l-LG.<--ܭ-H-P @P 4 0,P [l --- Ԭ-H-@ۋPaP pP P㒿KGpPJ㈿nP |pP Pr+G@qTP *ح-\.<-$6.!H-P 4P*t*!!H-P`p @P @ R* T 0pRpp`FPt` AQ G PpT,`T ؾ(!!!@-@P (*^!@-@~CPH?.O-MMP`QQ P RP F@@P \@ R B<P{  {P@@{Q`@T``rp+vP/P +vp+vXpUڄ!1TpppUp Xo R 818a8pw 0R @dP:TU o P   ^} RT F@@p@Ѝۍح--PG.0a.4a.-"E!0-4- 6.-.R <6.X. 0].x!S!p@-0MPP `,s 0@P Lx 0Ѝp@P @ 0Ѝp- A-MXaPPLAPpP 0P, {@P;  z R/ 00 @ @,@U(  0(!{!P}Pp@U PlPl夨P @ "pЍ蜬-0-$?.!<6.-X.(!O-,M(rPbP@PB IPGq `zP.zPP` sgP a X2t0   P` ,㲈P<@ .P6  !0  * @3U.  0(z'P}PpU PPP  < 8L ,Ѝ<6.0--$?.!-X.!!:!M!Z!!H-0 2P  (8a.r!!H-`Ph@\ ~.pP D w.pP, p.pȊ!!!A-P  ЀQp`@P yPQp`"QQ l@0L"Q "R  Q S0:  @HG.<6.0--HC.X.H-MM P@+t*`ᎄPP G@P /P`p oPP o/@oP%PЍۍ#"!O-M@T `PpPPpWPP`ὃU@D` 嵃VR:PAPp  P@ * aV Q#*ẂP*` @P  P `V: vQ* XP  ]00S 0Ѝ6.-@-M P@ ,<P ( QPpP@Ѝ茬-ht@6.H-P P#Q  P p\Q H QA@P ,P@&X-T-`-\-*!@-M @!  { R Q Rd fQgQ mQ kQ Q bQO OЍ((0H-M@PP *0Jpd\P LP *07p Ѝ0Ѝ0H갬-T!-q!O-pW% Q" S AP\ ` @GT ^ *p\W ^p2P`pW ^U1:O- MCPpA`A%[ [ V* `Pb[.KP :%[ M[c n[ m[^ c[P QDP8c[.[0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^0BQ- 4 BV*.0.[NV|* R07 2R10v*`.a!QPP V  m[.P| R_ `PtꀡlAEVS*% iLPHPb V  RA `PVV8*% RL:2V-*/   R)*<00 QR937 2R1*+0R*00 R*`>Q V  R `Q   Ѝح-LG.!(j.j.A-MP P ۍ@*@Q:ۍAËP ,p H 0 `P 0  ۍAN $!m.|b.,!8!!!@- R R0R0C PR R RS@@R `S RH-  Dm.b.K-MpP@a? Ny E! @DPt|  Ph`h@pQWYXF0Q s0 W pЍK?S( S(7!$ !0H-M , PB^P ,ލ0*dp@P# , PvU r ] M~| < j E~PPP"TA! ; U!!!܊ U(! !0H-M@8/LQ q( 0P00?Ѝ0U(7{~@m.@-` 0BR`0p0R P X 0X0X ppP P\X+ P L@ L[P 0@L @ؾ(!Lm. U(i.e!O-M`P 㬱#}#, 庱U P PpP``[/ R  㥱P ``psO@P 9Pjzh ZPPzZ Z Z PP  Pz Z" P  P P PPK PP p  p OP  [QqAP w  +<  QPc P ىZ  Y sP > QP Pp6P ` P8|OP s? p0t V0lW8`8 İP ЍO!+j.f@m.t Xj.j.m.U(i.:!Hm.l.!>!w!j.(j.O-M`@ @1 [P) P  㴰P ||p   [    㘰PЍi.U(Hm.!xb.A-MP  P ۍ@@P:ۍA;Qt` P P`[0 @PP P z < ,ۍA !m.|b. U(!!!e!!H-J| 茔 Hm.H-BM` 0BR`0p0R2 P0 X 0X0,PGxx %|"|T!@`*DD ap`P. @PpKPPX ĈPOP p P0C ϯ .*{{Bߍdǰ{{@,< ؾ(U!j.fXj.j.m.i.! !U(!j.(j.H-BM` 0BR`0p0R2 P0 X 0X0,BPG 兯{{`!@)PP 哯Xap`P. @PpPPX- APOP p P0 L )e{b{Bߍp@DAbT{Q{@$, Tؾ(U!j.fXj.j.m.i.! !U(!j.(j.0H-M4{1{`p @P PgTC{{Ѝ0 0lt{ {X/LAmP <   0l\ !ؾ(I!U(!$ !p@-M ʮ`GP @P tPu ṮTT 崮H ͮnP,Ѝp@2 Ѝpj. "U(j. j.!@-PMX @P MP @P 4\Aᘯp  iPЍ!j.U(!& !@-@8壮T S j.2!) !0H-D|ATP(PVu YfMU(i.p@-M< ,PH A !00 ?e GQY c? 0S$ {/x    ?0 0,S/܍p@!U(j.o A!zjHn.0H-0MP@GppWvP \D0@ ?( ;(0Ѝ0i.zj(j.p@-0MH`@Pp4/v P  "(0Ѝpi.zj0H-,P,@ WL 0HPi.zt @-@YTM̭@0H-@PP EPP 00O-$MP]P@ԥp%5p ppp %~`tQ; pOP0@ Q,* 0@$%$5`v pa@Q4P ( @ ( X h ( p ( ( ( ( P ( ( ̡ $ EPw FP- uPz   uPx  uP PP`PuPe @{uPe 0vu죟`P PPFlP`/gjP. `:P} B  `` =o0 0P \psP*V  ᆅIT`D~U QiQxA`tP @!00$BxxxxA0! pA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dP!!pT(m.n.h.g. n.i.i.:"!Hn./"!!!"i.KE"V!!_  !!!!g.ܸ(Y"!!г g.~"!"!"!ؾ(lG#U("!"!H- 0@iؾ("!H- 0 iؾ(#!O-4MPw`oP7 pppqt`@``P- P  #4 Pګp Q Q :@P`@wpP@4ЍmX P %4@ wꜧ g.i.g.i.i. t H- g.g.K-M܅@P @GT^@PV ^P /Q%꯯ -P,JppUp` PPQDP4U0 ᩳp  U ᡳp UP(J: ӯP"dPP /P@P 4td@0$S \TQ DdP RP (P : 㘯tP RQ P 0so#@: {P: sP: l|kPh: `cPH: D[P(: (SP: , KP: <CP: <;P: 3P: +Ph: @#PH: `PX: HP 4Q,(Q Q  Q Q  Q A ᫲pA ᣲpA ᛲp @@T ,gP |@Ѝ<0 u4ru u u h.h.%!%!U(%!xG#G#A"h. K m!n. n.&!m.n.i.l i.Hn.n."U(" O8*"!%?!!"!;{i. 4n.U((n.U($n.h!,n. 8n."0n.!C&!,k$$ @ @ ß #trp|ul#0S7[pQ PRU(C wPJ pp<xkPdbhr`嬒 vP 0@ Q :p   0@EQQ@U+  o P : y,~=@a,`aP  @RXX!0@` DQttttp PDX`D\ P  i@P PPP P@P  | h h.h.h.h.]c&!h.h.ܸ((h.i.&!&!г "!"!ؾ(&!i.U(i.U(&!&!o&!O&!h.i.i.&!i.Xj.(j.j.j.j. &! &!j.!0H-t@(( P ؾ(O'!t'!H- P  j.tA-,aPATP qP @pP! ``ppP pPP pP pP  ᰀ^ gXPpTT 00#000`VU(0m.l.V!KE"ؾ(4'! U(l.p@-0M`@PBj<M 0P  R l/ R R   ,B  c/r P("0Ѝpi.i.U( "(j.O-MQGP Flallp@w l Z  &0p/oS"0 0Q Q Q P  P f oRQp\P R R P  L P U(h.i.9! (( !i.O-M@0$!\sp Ws ` !HP@PPu/p p PUh  m!'s$s(P  @oЍ| j.i. j.ؾ((j.@-@ s@ j. j.H-Mlpp=0 R `p@r R VQ  `RpPwP  Nw P:P \ pPP@ ? ^  4,PP61/ЍU(S(h.l. i.H-PQ (.p  Q *ؾ(l. P:P 4(@ P? ^  /l.@-d00S R P0@^@@@aprP @w l.l."&'! Q0S S /H-PU( 0\^?@` pW p`WU@PPPPU `BlV U@`P  k.'!O-MP9 @` p^P WP)l P:P @P?P v W P:P @P? W0* P _ QЍ'!S(h.U(l.'!'!@-((@  @إj.m.j.G-BM` ͥ XPp@ 㾥 Q UP:@`G 0 SP - XPP yn$ xBߍj.U(4m. j.o /U(O-MMPqq`B|qyqHH"LBX `pP  gP#  ZPBP SP WPQ , Eo hJ +7PP=4`HP   Q: GP0S* P* U%P @q_Q:|P  0BR00R P 00P U:u `qP @4 sb H4P j.i.m.U(j.j.l.4m.H-$GPP ,U(4m.G-MMP @PT %XP @P \1@P" @ NP p刐`PlP  cP 5Pz,uuЍۍU('! h.'!G-plPU 唁 `=aP @?P4 P@lP@?aP %P @ :i!QP &@ P pVp@Pd|H@P   @ P &!!'!U(Ln. A-apG!PQp @p`pP @P` XX@X p#PpPj @PI ` ` ` ` ` A P6 g$P-` p0RBR` X X !   P p@j TX!I0#QAU|Ln.ؾ( '! 0H-0SS@6@sP\U  ^U%0S! @0C@#0 0RP00C 0R1P00C 0R!00B@ n@t@S @ T^0@0@00SS S@ 0'!p@-@`P P @kPpU@p!p@-P`P@P hkP P akP @pU(H-@P # p@P5 D X l `V >kP& PNP    iP \H{!P P P Q '!'!p@-0M@PN OP 'XaaPd   l ㆢdQP }, =R RPhi k@ f@P- 1P T@P @P0EP 4 < P X ` h | x XL@D,0ЍpU((!ؾ(i.(! (!(!)!)! )! #)!:"0)!Pn.O-Mట@Pp ` A  ᯣ R (R( "0~_POy_P Kt_P   㓣 ㏣pW$s`Ѝxt i.)!f@To.)!O- M@mp `PP,.  (  hP  XPP mmp Ѝ Pn.Tn.U(i.0H-MP@ ;@ 5mP @ メ0P3P tp@` T p}@e 塡Ѝ0i.xt O)!U)!X)!o)!f@)!H- UHi. H- z(!Pn.Tn.O-{MMPm4`iP $iP iPfv䆟䦟薟@  1@ Q*0@cP @dP lP nP @@@p VP hPPap U@p-PP2 @gP" pYP hmPgPŬPY  C` J p Pt   P  PhP,,P)ΠpPZJUDPi ܠQHQE  P@ P P@㲠pGPV H㤠p7 `PPTL$0 P %%P -㋠PpZ U.P#PpᗠP%' P P ygwrs}{ppYᶡeX`+P,X  PPPgPP@hPS PP  /P p5k2P#(@/ 0cP(P -PoP!qP P 0@Y I`VT 0`PPtV PD % " P`P şp p;P PA 0 !P   5ᷟ>H 7]]]o.|o.)!o.W(ܸ(.gzc,!Ao.v!,!-!ؾ(,! ,!,!,!,!J-!o-!%-!-!y*!r,!,!,!o.H- sؾ( H#@-0(, @k }bؾ( H#-!A-MPΠpڐ`pV`  PpP6 P  0O&0"vpq#@ &p P pW@p0Fs SP H4 hЍo.)!*!)!A MH-M  QЍH Ѝ/o. MH-M  K-MAP`Pw 0@b  @p  ÞP p H   0LL@p 00P`T 0 RJT`f0d `@Vp@p:H0  }.;f@\ `0H 0P<.pp@0@X (Ѝo.-! *!:*!I*!P*!ؾ(1" MH-M  lQЍH Ѝ/o.O-dM$@pP hP P(0i8`4f (p p,@PLH,/o[ "QP X ( Q$(h(P P pA,@,X* Z P  D x D P  0 XXY (Q'H(,  |(QQ.H,(q(QH,(g(H (,  P (H,( @ P u (H ,( C( ($H , P _(H,( @ +  P (H ,R    C (H  ,R ( P 2(H,( @ '( 80aP  (1bp48P@ Y 9( 0 Q(X,  Y ^( 0 Qm(H,P ZePD L T \ 8p ` %  y P^a  X( k84YZ lf c Z:(jPdЍTCtptthhx.`'\4Ld*!+!,!+!+!V+!@+!.+!+!n+!+!+!+!*!*!*!o.*!y*!V*!H-rpq#@W P` Ep P pWP3hO-lM $$!YPL[0p88Pg  CHH0 @ <0 0@ PpP @PpD ,T,0`P@p(@P $ (P#P@<4P ,(ppP' ( /4p@ pp(0uP:P@p, = ;XPlЍ0h @`uP*@<  p@$ Up P PT@`<0gpP pP @ @(`$$4$,t@&x @p&Ds& w t v0P$   p,P @P @Z W(H#+!,!"(,!7,!I,!Z,!V*!G-@cS $$PgcP`]l?G#1R# k:Q[.0cP0`vX$$ R$P N`DTp P-P+PPQPr p tc`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhhcP1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN,.!o.o.]o.o.ܫ.H!7.!Y"<.!o..>C.!o.L.!o.[.!.o.r.!.~(.@.o.o.4...!.!@-pʈ@@x@t%,P nRTPDP <5R%#IfIo.o.o..m(@-@a^P @GH-WPH- T  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t P\p!\ŸQP PKPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@e 0Ѝo.p..4p.p./@p./!O/!|.o..Y/!j/!|."|.| |.o."|.!|._!I&!|.m/!ә!|.|.|.A""|.|.=!!|.|.Ҏ"|.|.%}.Pf!}.~".p/!}. " X(Dp. }.}.!}.؇.@-@PP P0PQ@$Ct|.H- Pp@`P P,$P!9!G-@PQ P lph` B pBW@P$@@Dp.$}. o. Dp.|.O-\MPXC @p`XP9  ƫP0 P@?U- UU FBX  XnO X *P ? bPN(NX>;SpPX B\Ѝ/!7 Dp.|.0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[o..@.Dp.|.|.|. }.o.D.|.x.|..}.}.G }.B}.@-@PPP|P pp ,dPLT #HP(8 }..o.x.Dp.|.D.|.@.|.P/o.}.}. Dp.}./H- BH|.,P/ Q /.}.Dp.P|M. Dp.|.|.@- P p@T ``` P @9000 P @d. }.}.}.|.|.|.@-|@ p X @ (|!}.|.|.|.|.0H-P P!`@ l \ LP < P;@0tZ(|.|.|..|.}.H-MPP+ pP' +P@p%`%[-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 x ( L L L 0 L L L P L 8 /QPB@ Q* l L L L T L L L \ L d /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 @MPJQ00 `/tZ(0H- P:P @+PP+P00H00H|@-M@P [P!  +P PPJpP JX Q8U[QJ(~ЍЍ@w!/!/!/!/!@-@@@   p P@tZ(}.< 0  !1``@o/tZ( P LX(t/!}.H-@M@P `PU g[P P PYXp 5P 8 P@0dp@ЍX( }."y/!   /$}.p@- M<` P @P0@ ЍpX(P/ H#K-`Rp@N r P TPq Pp PpEUT T|KM t8/p pPw p PWpG8/p,PTP K-/!/! 4 0!/!/!0H-$Pp@p L@0X(0!0H-@P!J R| 809 0  r \ MLPp  z,P嶣0X((}.,}.10!p.o.0H-lP@P Dp 0 )0 (<R   0 @ 0,}.O-MP3JԠ 0p`/)0S0"&᐀IP`pQ !0# "  WcLp ޑP`U ЍX(,}.C0!O-M<@pW% `PKVJ r P@ ɀ Р +0*  ( EPЍ , "0 S !  0 U Z4pZp  Q,}.p.` R L00S/ 8 //,}.0}.T#0H-|P@P   $ 809 r 0Ht$Pp  @0,}.p.@-\  0 S @ 0FI&0@P@@@T0 ^@E@,}.C-@=P \( ) R 0aЁ@`V p 0T!@@Ѓ,}.4P/( &)/,}.O-M4Z% ( PЀ P !) ( Q*) b@pF T  ! 5 @@ T  ! 0 hP  HPJ Q P @ 0  @@@ @Q*@ Ѐ   p@ @Pv)fp0!p 0S V PY)&   0CT !   `q    *b0GPp H8`DPpUpwpJE P PJW    0W )u 8 `Q XPOl!J02CH@P 8P)#P6$P5P  00  @ B  @ @0 PP:( Ѐ7 ?4JDЍ,}.. .X(s0!X(H#~0!o.X(0}. `..p.@-Q# (  R B@ PRPPY RP0<020Q @p@$p'p 㰀$,}.PJ Q/X(0H-M@P) P 8 PP R 0PP So" 09@@0@(@ @@ @S!  Ѝ0Ѝ0HI,}.c0!H-M 0SPЍ0H-48 0s 0@@Q@0,}.K-M @PD&`P3@ p p(p,p P  0 P00  0R!     & q@ЍKao.,}.A-P@T5 p "  `VP       P  @py 絎@V A%,}.o.P//,}.H-PPp`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP nKPPPP4}.O-MEZ댣 ZZsZXPT hch@P uP+P G-Q   uQ+P  GP TH :P KHbPP .P bP wP pP cP P@ Z Z,PP"ŸBp`Pp`aq0!001qQPp0P  A1 PP1 PЍd@PD 3㮦P8@P (@P@P 3P.P )P$P yP 0p`P 0p` V9!5!~.~.~.~.j5!5!~.~.~.~.=5!I5!U5!\5!e5!"S 0!3!3!(@}. 5!8}.tZ(5!!5!<}./5! Q p/4}.@}.0H-p@PP\PPHP 8PP(PPP0~.~.e(.hj( p/@}.H-p0S :Q   h \  S@D4S@#   04}.@}.@~.95!ESC8}.@-MP&@PP tTQ @0$44    0 Ѝ@}.8}.`~.95!<}.ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?4}. R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:& ' ' H' |' ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```4}.0H-p@PP\PPHP 8PP ( PPP0~.~.e(.hj(H-^Q R RA 10S* Q1S@-,@QP~.i(4 1S10S/ R/L#H-@P/ `P+ PQ p SP pQ`tQ pSP  pQU <@EV@P@Y( X(5!O-MWP D T: DP.P bP cP$T*@z UЍ@}.5!5!0H-LL444 40<@PPPPPP0pj(.܆.؆.~.І.Ԇ.(( (0/pj(Ԇ...O-M@QPP- 帠帰p  `@pT*BP P PPPЍ4}.Ԇ..p@-ML@@PPP ` iPPЍp~.K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍІ.Ԇ.Hp.G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( Ѝ.Ԇ.І.~.؆.p@-M`P@6P   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZY~.І..Ԇ.؆.Hp. 0P/..K-P3 `P p PU @QP@ PpUp W PP ps ppt.0H-8@P(P0 PP0j(.~.O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb7 7 7 8 $8 |8 8 8 8 8 (9 9 5 5 5 \6 5 5 9 9 4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` /PPvVp@P0FP e[ ^eP .NEp  Q  p PY  P PY PXeU `E`HuPP Ir A;  @ QpP ``pPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* OP T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iI4}....܆..j(...І.~.tj(uj(...`!)6!"pj(؆.9!p@-`P@M ,Q:Epd P:00@T0Q: Fp~.І.pj(O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$Ѝ~.5! Q/..~.P /.  0 A O-MM@PzP(8Po pPjJ  Pf`V^  9PV p /PO ,PI PpQ Q Q   /P  /P  /P mP "PX Z P@⨠℀ ⤠|   4/ P'  4/Ѝۍo. 6!76!xj(?6!j(#6!Q  FR/2G-MPcQaPP2 fPX K K Q PQQ<Z  @ 6P? @ T@ pPJ  PHJP dPdP% dpPp Q@`@ Pxx p  0 T 22   Ѝo..j(xj(.R 6!6!C #6!p@-Px @(P U p@lPL`P <LP p@T\`P pF6!!p@-P@Q `P Pz`V V U  p@Up\P XD ~8Y4P ,$ sp@Mp76!xj(j(?6!6!H-M@pRGPK`pP`P T`P`ЍP 0 !P `P`~.p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍpІ.Ԇ.Hp.G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@Ѝ؆..Hp.~.І.p@-xPx@`V ?F RH 8 @o/o"ppІ.~.pj(.@-PP D@@88 @ ~.؆.І.pj(.H-P ;HІ.p@-MPJ@PP ` @PPPЍpA-@  `pP t P  PpnW<r  pP A6!S6!b6!k6!x6!H-` R V`:zLpT" PHao@DTB o..H-P`P p@pTPP P P7P @WN@T @g@..@-@9  .@-@.( @ R  .@-P @P@-u@ .O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ [ D[ X[ tU U U [ U V [ [ 0\ D\ ,V \ \ $] ] H^ d^ [ ^ ^ [ HZ R D_ x_ _ _ ` 4` P` dT dT \V l` [ ` ` a (a 8a a a 0W [ [ ,b Tb xb b b dW xc c c c [ [ c HZ [ [ d d [ R [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ (M P[oY`py艟j#P; W W PE #@Q+:IPP\PX p pPS `@<9P  `BP @P(34IP0 WMGQ  PU hX S S S 8Z XT S 8Z W S S S xX W S S S LX plihP PP P6P aGP30@P6P 6`/E!W @W *WPmh'7Q  b  ,& wn P `Ćg\ T, |rˡE Pm%H P P P Q.``. Q`+P`%`m z堅EaE{5P 0T EH 50 @QV @*WVW !WQU0EP(. g/(@#0881@Q* @p P   P 7Q /! Q aOwȏoeQ OP PP P_W-W +WQ3D1P FP$  a@P3$ 5P  $Q .{Q @2 `QRfP$$@"pTNP {uUel Pe Pe Pe  Pe  Pe ?Y+1FIo?Epˡ>J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p Dp.o. ..(.. lpp0>K6D0..p.o.8.? 9P@ Pe $ Pe  Pe  Pe  Pe >6*o.\..pe=6:{k ˟ 0` 0`<;X.et=A6=),pˡ=26QM PEHpˡw=66@.p=6$$ ( P 7 P44 P@@ pˡ Pe$ DA"p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qaco.Ie`pPk ^Pj  Yj(Q" pˡiHP Iꌬ.pj( pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p !  X( "$7!8p.>0=xPe= \Pe7 @Pe1  Pe-  Pe) (p.e;.(T(bo. .p.8.o..\.T.X.P : 0AS R 2@P ^P  P *Pp Q:Y@ P >P ᯑp /@P  JI Z P Y:HUq P@TA$Ѝ4}.H-, $ Hh.l.p.t.O-MP9 `pJP,@ PP PI?PPP@P PPW@ppP@ W:PЍ?9!@-~2FP @ᔉlll 0OP \\\ 0H<PP 0CP ,<< 0@;j(l(r8!xy 8!8!@w 8!8!8!8!8!8!0H-Q P@ 3P $  00 0HZ2h.8!0H-Q P@ P $  00 0HC2l.9!A-@`PQ ?PT pP 5/@(*PQp$PQ  pP4  pW'9!6!79!K-MP@QAwP=J` pp4@㶆P.  0];p"  yww$ 'WPMP+P PQ P@P M@᷈tw@ЍᯈGP`@VEPVnPVdPUppPuP cP ePPU*6vP#PU*PU* @xP@o.t.p.p@-``P@PC C  0C 04 Upx.t.p. h.K-PG @`pAQ"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi l.@-M@d P)PQ( QЍp.t.Po//p@-R @P `ᕅP pp@0A9!H-M 0Ѝ G-Mp|`PhPЍT`P D@`PQ hp p>iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`p.8p.;!Zluj(H- P>;!ZlO-MPPt7pWD ! P`P@W WV `P`p`\`@-  pRP@PWU P [:;7@/ P0 k(@`@V 唐唰Pp @W pP pp-P L@U`PV Ѝ>;!Zltj(Ї.uj(;!`V5 5l`cV PP WSo.>;!ZlX;!a;!Ї.;!  0@2p6 `,nP/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލ4}.(.H-M`@P ЍHP P`5`]5`PpLD 0! @ЍI 9"7{G-@dd3P EHP & `k '5Pp@Ppzpw W 0H-@@z6PP ,t6P o6oR0[.!~9!p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PD46PI De  %R R   0%S sS4P-+@ 4`4` 0p!`pV3 U @ T@ mP`p(p4@^P pWp[ :P <@@Np~Ѝo.X.6!;!~9!A-MP8P Ѝ`P @ %R R   0%S sSPЍA'P!4p4`4p 0`PO~~@~T ЍAo.;!;!H-M np   @o Ѝ0H-MP@P lnp&PP%  P! 3*Pt UnPJ  P3P$Np$PЍ0,.m(m(@-M@UnPJx| 00ЍpC-M@P `nP h  #D Ѐ # "q p RЍpo..ȇ./7{@-@n3Pp/Q@0H-$4 @0!P 00 00S 0Hs0H..p@-l@P pp `t(@P!$ %$oB@0}.@-@P ](P@3Q/~.O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍ蜬..Dp.Hp.D.x|.@-@ ,Q' @蜬.O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍO.Dp..̬.T..0}..m( X(   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ0D.O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 P̬.T...p.<.D..H-@p PP~p P P @P@PD@0`kp@P@TPX(W(p@-/P p@ `@P@!! p@Q! 0s B @!! pp@p@/S<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`Qt娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dS P pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP p*P pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. $$Ѝۍ8!.n(p(...~(ؾ( ?!?!#env?!?!]@!9!@!@!@!V@!?!A-MM@Phhh `0  Q ` 0(Ѝۍ..H@!.H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0` x x x x x x Q- `0TS8bCPE  $ D D $ $ L T $ $ \ $ $ $ $ $ d $ l t $ $ | NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 (P``.p(V@!~@!9!q" ~"0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40@!.lu @!.@!.....؊.P3//.p@-  | 0 0  0 R @ `P``@@ @@P@ pppp0@@P@ @@@@@@,h,dP, @$TPp.... ..............؊.K-M p`PP/ PA5 g P 0s  W  R !Q |q!P|0p a@0|@(p |P 0pa@|@0(p|PP7    @ 0&AQ 0p|`QQ@`|@0(pP 0<|pPPa@p|@P(0P|0!|0 ((0|Ѝ..T.W(X(.....000 00 SR/T....p@-\P` VH@!R', `V`| `p...H-pP0O H_&`XPPVv@)@PFyPAeaP@@ P P 4@P' P Pxx |pt0 @@ @@ ,P *@P@@4}..|.|.|.|.H-f@@0/88 0 |.|.|.|. 0 /.. .. 0 /. ...Q/H-KPH/.0H-@P P4=P 7@P@0..p@-@P` KP*P p@-@Q T3 Q \T,QJ  R  R DoQQ P T  P@!.Q/H- JH/oA-$b@PP  Td p  P\p TPAP   P C P<taP, TqP! Q@QH!@ Q(("P8 A_ A4  P @  0*0 S P P P L P$.Ȭ...0.8.(.4}.<.O-MXLfLF pRP P -P' P$   PP= P^ @Pd @P[Pw(*PW|PK TQPF 0 0S S CQ= e Pd b @P"nT@w@)d=*)Q@tTttQd8*@PqDP w?P P4#@3#Q pp P  QPA)vn@@ PQ_W  P_p_W PpP_PP W$P& QP! 2 |q`0RFNQL Bp1Q0BR @EXPW]i _p CpW p!0 2lPQ> PoSk 5ܑPp P^@ )`  0PPAJt!A@&Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPEP..(...4}.Ĭ..p(..p(A"..D....؊..VUUU.A-\PPL`@p/2 0PpW@8.<.@-(@P.0.G-`B`PH8PY( VP(BRr R! } @R a   @R |`aQdqQ88!   A Q 0 0S  v  QPP YPQ PX  S   KxX@ PPP.0..(.l.Hp......p...x|.||.(..0H-PmP lP@ p@TDP08P@ p @T0(../!.A!A-`xpp@ PP ʟP`88 0QT$0 pp.....@-< 0RA ^01 0 R. (/.H- R  R P @ P X |0S1(00 P  B! ~ ..H. /..G- p`r) P%\p" `p堠@P@UP@PF@t T}`pYXPo`Ppp...G-餐pPi@i`TV V kPT kH !kkPPP..O-M Pp` >PQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`p..p.G-M`VQ &p@  lPP  㵿  @P@@@ 7k 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P`D...G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  VHp.Dp..p@-@PPJ`G  PP  P v}Ppp(P, '/ 2S/Q/2S Pl"R PH"R P$"R P/ᐬ.p(H-PCp(A-M@P`pP P p P@"PPЍp@-L 0 S < <0<@ P` F P p(...Hp.O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍ....H. .؊.VUUU..D.......p.0H-MP P@QP@p2 0QЍ0(.H-l cR:TH0P Dc 0>:0   `.d.`.h.K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0h.`.d.O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  Ѝ.h...p.4p/(P    ꐤ... A!@-X@PJdP 0  0P萤..!A!O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B Ѝh.p.O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍDp.K-@P뀀倐`PpP 0 0@p`.P ^P@PPPP [P @PoP (ePIP @pt@TPD@ HP 00P e@0蠤.`.o./  <P S$P Ѝ0l.E!n p.@Q*P/o.E!P/P Qx.@-P@Pp|.@-MP ,@P  eЍ脬.E!@-MP ,@P  QЍ般.F!H-P0P(PBpHNꔬ.o.H-MP P P D^R Q  Ѝr(DF!0H-0MP, P P+@P,P0,, AQ  @0᫧d@X, *Q @0Ѝ0,,P Ꜭ.. !F!\ ^F!vF!@-MP Pb P0QSSEC ^:  !p!p!p!p!!p!p! !dSeC ^/  !p!p!p!p!!p!p! !C ^&  !p!p!p!p!!p!p! ! #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0Ѝ谬.F!F!<<< 0 PQR0/ᠬ.8..$ 0AP/ᜬ.Dp.0.@-鱿@ ʆ舫.H!O-MP H@P Q Q 2/P d@@P EQ h&X$X$X$h&X$X$X$X$X$X$|&X$&X$X$P$P$P$P$P$P$P$P$P$P$zP@ T  pPaGQ3Q Q =QU QQ D ^aEP3P@U @PA\%p%<&%<&<&<&% o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T 4]QS?@+پ4  0P. @+PP ]|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @ꬫ..ܫ...H!o.F!>G!G!H-M0S8< 0*ЍH脥 *}Ѝ谫.#H!H!H-M`P@6p-W0A Q:UT h pU-W` U T  @ЍIH!bH!A-M`P) @pPQ$ pP \Q`P \$Q T i`P `Q,  [``Ѝh..H!A-MP @pP`@W @ h ЍA9W  Yhh -QQW W!  @PN*<+,|+,,,+W4 W/ W>oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ X갫.G!|G!G!G!H!.mG!P/So/Q  /`!H-oPA! P/ᬫ.H-M  cЍ謫...H!H-MPp`կ 0B PW# &`0a@ S``3S0D0@B` T:V S     b RWV  `&ЍbH!  RQ/.ܫ.@-h8P\TQ @P T 2/$@P~H!ܫ. r(@ 0S/ S  C Q $0/ r(O-M`Q0S@ ` pW) OP@AAQ:-P X T T 4Do᠂P p  p$PZ  RQ   Q P   Ѝ r(H-P E(PZ!d~(/O-M4\`@pPP`pP/  pp@P Q@  Q P H ?PJ |QpQ Q? C  HPP 0!U QZu (P $#P UQ      H\P P 8ЍԬ.ج..p..`.X.d~(ح.r(.0}.Ь.H-ج.H-M }H-M@abP@`=`0 0pPqЍ 0H-@UbPPP t0٭.Z!O-M(,P 0`pj@ !W 0!u(  &[*9#Wu(":#%"0p  0j`VPP3UЍK-P@p:`%"Wd$!y (0,$5# 4!0 W0 0dp W2O-M@p 0P` = @$ U!'  % 0$7#z4#j& D@0[pTpp3WЍH-MDQA#| "B -=)/ GЍMbH-M |pP `@P&VI `@PЍp...0H-@XQ 冲@P@P: $ @0.h~(..@-4 4@P ( ,GPh~(.l~(.@-@@l~(Q/O.@-P @PG-M h!O`P 0  Gp  E y-P!kЍZ!G-M h!O`P 0  Gp  E y-PjЍZ!K-Mh@Y p`piB PPGpEy-PjЍZ!O-$M¿P`p@0@ Ya@QW@A@Q7@2YJY 0@  0@G@P PPT$ЍO-M¿P`p0@ Ya@QW@A@Q7@2YJY @?@ @o @@? PPPXЍO-MŸ@`Pp@0@ Xa@QW@A@Q7@2XJX 0@ @9 p 0 @pPPPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `ypP%rP `ipP 0P `[P p@pЍ@-M@ P @@P ЍH- @Q 0% pH2H-P@mP' PDְ며 `n@|P PdPdp@`댰Q<HR H.d.|.:A!Hp.|..H-M0 0ЍZ!9!H-@P`pᗰj 㼰1P PPPP @PP @Pv.0H-M@P P 8,00( (0 0Ѝ0r(Z!Z!Z!9!0H-@P߯P !^@֯P 8P0՟ ~QT㊪0Hp..K-M@jPPPV  p㧪 0PppV"㛪`o"Q _pP VX TP  V`WpU VЍ.o.h. [!@-@P Uo/O-|Mⰰ夀堐P@ ;/Q00PP 0  0`joP  #` 0V pB `CR JS0@  S pwp`pppp@@P0S 2<`" U,0 [Q0 02@Q0R0s0Z0PU p[W 2@WRp0pqQ 0S @PE T:000    @0+t`` '`# (; 1q0WQ|Ѝ./+"p p p@@0@@/Dp..N-DD p0SC P Q 堎.Dp.K-pDD0 Q 1PC010CSPʁ蠋.Dp.H- P  *Dp..O-MpP1PQ Р +0* 0 P Р@+0`* ` BTH@@P@ *+@ЍDp...A- R*AQA 1 0# "  l0`0AP 0$ p%0 @1a^ @ p%` $ @P@Dp..0H-\ @0\0H0^00N @@\@ 0^0.Dp.0H-HQ 0 @0P0s0: Q00.Dp. @- R <0A01$ P r :0Q . P@PP@/Dp.@-|嗨xx@x 0tS፨`ቨTᅨH Hဨ< <{0 #ܫ. .A#|#Ʉ#X#p~(#t~(#x~(O-M`P V p9P:P ?P \P@P  `%P6 .P P  @T `OTgaDQ} 8NTN\N|LhNMMNNNN|LpNNNNNNMNNNNNQ O@T k`bDQ (MO ONPOXONxONNOONNONNM PNNNLPBDQ, MNdPPPNNNNNPNNN$Qs !0  0BT DTLTLPH a! @p= :TT? P80qPT5)2 K P .P#\ P Po!  'p PmPP`H P $#0 #P RRwP0 X@@%R P  ^_w PIp)P@!%pWo P0ja  c"2Pu@ Qp@PjP/ v꺯 Z  r' P6 p !!1P 0  ?FtWꚯ 0 R : p P1 eP ᅯ 0 R : p0  /  pPQPG#  | 0v= Q Ѝ..9!o.`!l *!o..Dp.D.o..0H-@b AR0P;PQ0P iRjR tR mR BR bR04. 0>S:S Q\S 0SS/.SQ?S/p~(p@-@@@P@`@oPBa p.ܫ. .t~(o.x~(H-@F@pP<` Q P  c..p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮Dp./ .H-@P dPT`VxP lpP@" r &n@@T렪@`.4.|.Dp.O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍODW(X(|..Dp.@-@PLT !P 0o@a@ .8.4.[!@-@P P@8.p@-P@U `PPPV,,     pP.H.X.p@-@`ҰP , 0 P PVPpX.H- P BR Q9 bR4Q& ^ R N Q P@pR @pR Q Q PPPP P0H-P@u < 0P !T @0X.0H-P@]P 0P  0T00 @R P@P0X.K-$P Y@pP0`#( P%`$ % `U0"0^Q  %0$  ! R (QYD 00 R 0 PRX(W(T.8.̬.4.H-$  PH8.̬.4.0H-M @ Pp q 0+Ѝ0@-,@ P @ ..h.0H-Pd@^|P D 0@APJ0P P @0j( .4.̬.O-,MQP@P@@P:   3 TP Q SPP ) 1 PJcs lljQ Po HP P8bP `p[0`p!&TFP'P PP P@'  P"P@`ppP`p&')`p!& PU`p 0`p ! ȑPU`p!&P & ' `$ps[! P 00  0P" AoPPZ/  P P  ,Ѝ0  !   $ 0  !  T 0P P  .T.̬.4.8.:[!.Dp.4.Y[![!H-, loP .G-M`Q `P@pP f]UPQ:PP  P PQ00P00 0PJP NpVp ㄢ`pЍ.h.O-M`4P84@p`yP  0 P Po? 0 0pD I4@Р08ؐ`@+(oP LH$` &@P p D, (0HL !y  W` HTLY  ` HPLY YIV  0@@ [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,KKP @< rHp.Dp.4...p...h...Ȭ.(.l.H.P.X. .̬.8.D..O- 0 7 0|E W ) @(pWQ p< 000  00B P4PЍ .O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝ8.H-0w,$ Q  Hwp.Ԭ.H-P c P[lXUXHQNKHEHAxo.,ywtyH-@<74P Hxp.Ԭ.H-0",$ Q  H,yp.Ԭ.㬜A-@T<  P뤡87(@P xxpP`uQP P00PAjp.,y.Dp.Hp.o.\.0H-TP@T   HHH 00000~(x.t.|.0H-P@P" P P tP dP 6P J6@@@@@0~(k[!q[!x[!~[!O-MM@P `pP T |VN|||  QP  HP (P @ Q^f Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ P 0<40   iPPkX ညP  `PGU lz` APPv p!P  P  0PPd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 PA ppp!7p;0yPᗾP5`FpV1cpWp`ɚ 0`poW KF0EFXP  p00pGPd2Ѝۍ0pX ᎉ|.[!0#[! ~(|~(ؾ(p.(~(x.t.@#O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 0E`E 0X , Ѝt.p..(.[!@-P\\\ 0S @T 0@0000 BRt.~(x.@-P\\\ 0S @T 0@0C000 BRt.~(x./|./x.P/卿t.H-P p`˙@ř XPaU 㷙WG-t`P@p QQ  QQ  t.H-ԁP 3p3PCxH-耺.//H-MXp@G p P`p-VUPPЍ耺./@-@P D/p@-P@P`Q/ ! R:3+`Q  D`@pH-M 0*PЍp@-R@P`@TpQ/ A/p@-@PU`PUp/@-@ R Q Q! R * Q QS@SJ@0K-M,`(S@Žx0V"@^QpP` 0000040 00P0ЍO-MMMP <Z ,⠰P P @ @;PP#P 㳃  {P 㤃 `ZN 0R p``@F  R00Q P/p`{ R  `R S RQ @!Qp R0Ќ@xȍ 0 E,R @Q @<.0P Qi @ Q^Q @ P 8.P Pg P0PL pp@;P }PaJ\PP# $  EPI P@P PU[N D @Jpp˂@`@`P pI p\P T P  P"T   0@ Q*\00ASp 0S:Q5\P&P\@PPPP B@I @P p @pA P喂``[P SPBY`\PP   IP @ PP Q @QK 0Hp @IJ 0Hpw P P9 PP (08PP, P @k P  @@QfPPd   P @Z S O@tHP@ TQ  iHp*P  aHp*@UT H ف!q !Q p $@((;P }PJP P  A 奁 ⠰PI_@ `T R t` @ R``1 A R*P {I@"P tڄ@`@@@hQ HQIQ gQPiQ pQ*Q Q;QvP <&PP=  @ P3;P1P=-wQT  R 0 @ JA PR R Q JV `@ j Q  ,/pF$ PQ @@ Q @  `0pW P P`0@\W0S5 00@ 0@Q @ @Qq @@Q @P?P P> @0"@S6 f`  @TPQ P@Z  \R R  0S S  @P7 E PPi`  -P),@`qW P\Pl p "@ D  ,/p;x11.ꌺ..PN``LBQU pPd3@PW`VP Mߍۍ(,t*'%(L"t\PU  $ \!\ H< ڙ댺..(l#\!4]!.^!.^!^!. N_!^!*_!a_!t]!.^!(]!!]!]!\! ]!_!`!D(]!_!_!\!\!v\!i\!7\!\![!N`!$.(.L.P.O-MPC ,P@qP{P tP rP 2aP bP.`V P p0"pS ppX PTP  b?@TЍl.9`!$.A-MM@0 A R * +GPЍۍ.Q$Q +Q$/Q \Q `<P P IQPR IAo`AP)']!]!p@-@lP  P @ 0S SR (*P~ `Np(]!O-M[a [c \[c p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00ЍK^!#^!-nO-M`(~Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" @P ]Q [QY[[Y][Y   P R  P R[   @R`  GP4 R5Ѝ`#.y^!L.H-M@`PpmPn@ P2t     ģ aP dP fP       P pЍO-M@Pp`$ V ?P [P PE@ Z *?P  pP P@Ѝ00@?6SC ȥȥȥȥȥȥإإإإإإ?Q7@?QW@Q?0|/O- M`PF{LD@@sXL4X 2XHPa@Q%Ц0 ħEP GPX IPvHP\!Xz|@Os  |"@ P 0㰧P vd 0㣧P \id @w|\!@~p%<0APU _| @PyPU O|p00 0p.`@p@| pP PUlPT%D{9!.``!ؾ(`!.s`!/..~(..ܸ(~(.Ae.H-T 0!ؾ(8a!O-M袟rಟ`P P P5 EPgβ&Pr PQ Qx P X H P" >#TΟXnP>P:.AoRy Ο$n>PsPQn\͟m=PV;hP >0  M=m͟P PzPQKQPPEPPA Pn (>0  M = m͟PP, PTP(p PU =P0PP P M `8 pP0V 0P 0=@P@tp:pp@p P W Q:0  $^A [APV>Q >P Q:0D  Pp0  P<P =p   P p Q:0  P G P`P:0t  vPpllP  PU ` PPp`Vpz KP✻P:0  T$@ @@N PZpWW L PWp+ P:" Z 0  0 z@TQ*W  0pʟj: JPt 0  `p  ??  쉟IP G :PP  E    v@P !   uv@P P9ɟH@p `P pPPP (p0( pp p [KP 8htȟP `h@LȟT T4Q0  p"p!`$0` 0 @!P"P R 00 p[JXPQ P `P   JP Pz{V`P  0@&A`T  W: PP @THhV 0@,` ($ 8V0` @pW 0 `?p?0   ``堅Eeş..ؾ(.,.$.(..@T5 L0 p !"P' p[JpPW p`T.`P ppPpp` ^J4dğP xpDP.tDd0 @0 KP\ 0# 0 8d  p??  弃P 0! T P  >\Cp PP  3cDßRRq   ,#p   #P p~#Ÿ c3P1 PQ0 %` pP$[UU$B pp\2`bŸ L2PbŸpA02= 8A Q  PqP i 0!  P  \> \1`aPЍ ぎ~$  0! @ P  5>c{@uQ p<0 Zt d H.d cD Rk ..,.T.P.y^!a!.D(p.0.9! H.L.X.a!$. .(..~(.!ht@U!Ȇ#b!b!b!. H-P`@ pRsW h  G-MM<P2 000q@P!R R"0}P `*0}P 0*0 } Pd@T:l@hЍڍD@Q S< 0 ᳍ .(. .. H.DP  R {RP 0pꈺ.0.9!p@-P! P@`{P wP sPp D"P` p 7"P`@Tp  p O-Mءԑ` @P 0p&W \W1p2 `/W-0G`2p#  pp'  p@ Q :s2  W `p0\W&W``\pQ :rlppQ :rЍX.(P.K-P"V-Y`P||!|@0p@Sp` @P`QP" P@p@@: AR 0\| 3!Q , p0:P! PBQ`pPP Tp  X P K2 z..b!b!Ap@-@PU, `P SP PU P( PP PPP@p./A-M @ PJP `+  P p0-RۍA  # 8b!L 0Q0p0Qp \ 0 /T|ؾ(@-,AP \0^R S0QQ 0QQP|P P# Dp?   @蜚. @-00\ 0S 0^ @T P PP Q QP RR  P \ 0S?o\0/.@-|t  0  L@Q  @ TQ Q  .0/K-8Q <P  Q0AQѸ0ڰ = {!< Q P嬁q@`\P P    @T( Q0AQѸ0ڰ  M{P  (P  ,P  4PP Q X@P @PѸ ڰ  {=KW0/ؾ(..H-M@P@P om@P /P9PP~P@-@?PP+@ p`pPQ Q 9 @p ЍPz""Hb!eb!O-M젟@`/pԐTPP`T   !z 0 9P  JPPQP@T Ѝ  9vؾ(b!b!.O-MP pt& ğ 3Bp/P  @7PpW% xxğxQ `p-QW-Q0eCQ Q  `eS kS iS` ``Wc೟@p  JPPa@Q%(T@DPEP IPH-P<@QP5 SP <p^WP p?Pp^ZP ?P^YP ?P<{ pEQ`T"AQ聟 (  iQPPQ ! T-P  oP, P P  xP  L H D P P Po@P00 wu../(?".~(~(~(b!/b!b!b!ܸ(0/..ht@gtؾ(b!b!c!c!Ie!)c!c!@c!:c!|"b!H- xguؾ(c!p@-@0PPUp00 `ixP UP UU@ %t0p@QxUT D p@Gx,  0p@..Wc!FE"ؾ(Pc!0/^c!c!c!sc!jc!O-TMPRPbpP  \IuPP}p GP gPwPPUl@X (P p^ Z u@pY P@ dQP`@5P Q WA ap ap !p W [pZ pX 6pP  @P@0デd Q H,ڇ Շc!/ܸ( d!B"c!#" d!d!* Id!!H- wmtؾ(Ed!@-M@%P   p Ѝ ᨇ2d!0H-M@P P P Ѝ0"Pp H-P@P Q `UCP <P` P CCP rQ <`V@-@P w P  嗚 唫呚H-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0CP( p@- `!R 0@T 0RpQt@tQ  tt 0Rp BpP(@-Q@L@@-R@L@@-S@L@H- 0C^sؾ(d!0H-@Q0uP0 ˍ띏띾P ľ }Pͣ ̣ tl@@Q*XP L  B<*r000./....P(O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$嗐P , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  P` @`Y pPhP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP P8P XPU PPN(0 ,sQ  Q0@@0R A (0內P7 s[P {ә (0 m ʫ Q 彨$ @p|PlPPfvQ/P!AQ2SP RPF@Q ,x,,p,p,,,,,=P P. <Pg>P) ?Pt ; 4ppa 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0Sxp"P0A@0 B0!ARP !@ B/!+u $pW eP¡ 0㟦P P(P epPU$pP X PQ XtH5 㾚 0Ṛ fx PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  3xP EPPAqP(PᏒIFt cpp|r0S! B  3 3Dcp| xPQ zPaPxP@a@(P(@P  ~3t z3bmQCt P U4Rpf  R  2/p[ P!PU   M t `P  Ɩ `ħ`aA7 s P ئ尧P [)Q P`P N) P`qV4 R  2/厖 PPP  P,Ѝ蘍 0 ꎍ (0  ꃍD 1`P p roU..E ../(ؾ(/g!(Dg!g!f!O-M@QspR'P- `P@Ug 0.UP` p` P@U 0UQ  1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PV !VPrU V!   P ( 0q> `PqUP T0 Ἐ r!A ЍO]g! /.Q/A R /..O-MPp*@0 T` Y&P3 `  D늠`P   @<%P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@Ѝ..d!@-PJ@Q 4A P <..Q/Q//0H-@LLP@U U,U0>/1//bx H-l0 cH=e!@- Q/@,L`p|P` / ,* C( #  +x P `,L L0SP   @ 7/:%/2/ftp<8/9&/\'/H-M  f8=Ѝ.tgzQ/ H  8 ( C  <8/9&/\'/<#/8/g Q/  D(L 8 $ Q   7/:%/0#/1/H-M  h=Ѝ.tgzQ/ 8 $   C~<8/9&/\'/1/H-M  o<Ѝ.tgzQ/ Xdp|X  H  8 ( CW  P<8/9&/\'/;$/d8/1/H-M  p<Ѝ.tgzQ/ 8(8 $  + C(<8/9&/\'/;$// Q @-Q$@ 4Qa ) ,$ M"+| h L, 8 <0SP  @\)/f!ftp[(/O  @-Q@$XpQa ,+ | 0SP  P @4 P  9/ 7/:%/ftp//X܃Q Q Q/,  i{ w?/<#/8/0H-Q@@dtQa 0r ,P\ PP,+  ; 0H=!?/s h Q Q Q/,  r+ '?/d8/1/aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-9d!H-YH-9d!H-7H-8.H-̄1/H-HH-8d!H-X:H-R:H-L:H-F:////H-,!BW>/H-,!8W>/H-,!@-W>/H-, #W>///@-@0@-@@-@@-@@-@N@-@/@-@1@-@1///H-.H-.H-.H-.1H-MH P`0 0   0 Ѝ2/H-M@     0 Ѝ2/H-M4 C 0 Ѝ\'/H-M8    0n Ѝ9&/H-M8    0[ Ѝ<8/0H-MD@   0PPF SЍ02/H-Mll"R \, 07   d 0% Ѝ2/ftp9!0H-M|P  K  0@ P < N0 J,7*7Ѝ02/!!H-M8    0 Ѝ:%/H-m5 7/H-#8./p@-P@`0  p@i e!H-M8    0 Ѝ8/H-M8    0 Ѝ<#/H-M4 C 0 Ѝ\'/H-M8    0{ Ѝ9&/H-M8    0h Ѝ<8/H-8./////// /0#/] /0#/!H-M4 e 0# Ѝ1/H-M8    0 Ѝ:%/H-4 7//H-M4 e 0Ѝ1/H-M4 C 0Ѝ\'/H-M8    0Ѝ9&/H-M8    0Ѝ<8///H-M4 e 0Ѝ1/H-M4 q 0Ѝd8/H-M8    0{Ѝ;$/H-M4 C 0iЍ\'/H-M8    0VЍ9&/H-M8    0CЍ<8//H-M8<    0,Ѝ;$/H-M4< C 0Ѝ\'/H-M8<    0Ѝ9&/H-M8<    0Ѝ<8////////!/e!/e!/f!/f!/f!H-ML 00 Qa  0Ѝ\)/H-M@     0Ѝ\)/H-M4 M 0Ѝ[(/0H-MD@   0PPjSЍ0\)/H-Mll"R \, 0[   d 0IЍ\)/ftp9!0H-M|P  K  0@3P < r0 nP4N4Ѝ0\)/!!H-M0 00  0Ѝf!H-P8.$$ " A/\)//H-ML 00 Qa  0Ѝ9/H-M4  0Ѝ//0H-MD@   0PPSЍ09/H-Mll"R \, 0   d 0Ѝ9/ftp9!0H-M|P  K  0@~P < 㽉0 㹉33Ѝ09/!!H-M8    0YЍ:%/H-1 7/$$ " A/9// /\8/! /\8/e! /\8/e!///////H-N@-M} @P  z]ЍH-よ0H-P{p @} }00H-@lp P}%{0H- |z>/@-$@~P tz>/H-=~H-7~0H-,P@ |!~ Yz0>/p@-X`P)Q N,@  @|ADz 0}p>/p@-h`P)Q N,@  @|A*z 0} n}p>/p@-``P)Q N+@  @|A z 0}|p>/H- ~>/0H-HP@ |! y)Q !~ 0k}0>//////-f!/5f!/=f!/Ff!/Sf!/]f!/gf!/yf!/f!/f!/f!/f!//᥵!/K /Y /!/f!////////H-M8    0Ѝ8/H-M8    0~Ѝ<#/H-M8 k   0kЍ?//H-M 00 Qa   0OЍH-M8 r   0=Ѝ?/0H-M@   0PP(SЍ0@-M@d ,P H 0  d 0 Ѝ!9!0H-MP  K  0@P 8 3, /11Ѝ0!!/H-M4 e 0Ѝ1/H-M4 q 0Ѝd8/H-M8 r   0Ѝ?//K-@`!PpR "  "r  Q0rk0lQ P9cx Q Ua rwQb ( dr (cY `80S  3/PKRA"g!g!?"A-PU@" P`xpPU.PWP:@p`P P`$$  .....A-M`Pp  @U@,  p3 p& P 0눀 0p pPǾ5 Pu LZP q @@-@Ѝ8( .!$.0H-@u T\PuTPA04P: P P*@$.8( .d(H- f  ...匑 .夑 .@-@4f,, @ ... MH-M    $ЍH Ѝ/M0H-MP`@ 0fLL % Ѝ0HЍ/ ...O-M@S0 dT @P ܢbRܒܲ 0@ @@ 0@0S 0p0@ @ P P0PlP ՒP ={P 7{WP弒P ${ !{   BQ<QY `D pᦒW 塒HPZ za Y`p zpGW fT Ȱ!@pP32PnP|@_P zX=T@ 88 ЍO3..(,. ...(.VUUU @H-H M@-M@ 0"$ Ѝ@Ѝ/H-M Ѝ9!H-Mpd`@P|ePP , |(#  0`Ѝ ...O-4MXop"oP`/뼤@b\ U`W,@p P  d巊崊L届, 4 `娊,@ P嶑(巑`đ$` D@@ 0`0Ps1I P@I [@I[PP P tP@QP@@sKQ,$`(@0 ᜊ哑U 3 ᮊ @Z@ `juP~PZZ@ Z`~뭚kAZ1Z7 AZYYIb`Z ZP\Y  AR0 B00@PPPAP @ @ P, `K  W` Z  Z#`w Y&, K AAPIK`l[Y [P ,P OP`Y Z [  #` P G,P K  P`=0P $( 0 @|hy  P QP ,    ,4ЍO .V!r)!#(ؾ(..p@-M(0@,4PP `pЍp9!O-MH@p`ᨐ塐H<8PW @ WPQ!&L@w"0 a<p QPDp W  p  DP3Kyu 'PP  !PPUPH/V` R` 0@@P7 ᐔP wizinq c E G0P`i`i`SVrc  0@ _PL iH!D 0 < T QcX *ЍD P^p X ./..'!H-M Ѝ9!p@-M`$@P , !  0@ЍpH-M Ѝ9!H-Mpd`@PcPP , (!  0`Ѝ ...9!M@-M@ 0m! cЍ@Ѝ/0H-Pd@i0 .O-OMp0(7ǟ W@ '@b@00 @bKFPP P  kPP&V6@EE E P |Ff分8P,  2ePoP pPP rP lCPN DP_DfPU@aPM  !P@ g@ OPE<p  ᖰP @T`V pJ=Q @Tp=<p ኾ$0Q 40pDdmP ,p]HU8~P@  PP/P @PhP  PPU:yu00 PT刎@剎 D@ 0eCP <P cx,hS_C?.@@@D@P8@U<K p`PH M{,P 8FD@T 8@D@T8:D@ZT+P& `8"1P2T    0p P<e`8`<Tp P@T ZP @k p K"G在P_X P `v'tT<Oߍ8@)8 %@ D`{']< 0,]p 0(7/0#/] 7/`8/1/X'/І#1/"07/\)/9/2/!1//! H!!ؾ(|//!!j!mC /0/|BxCC#/#"!E\5!,7///0.!Y!H- 0E^\ؾ(+!0H-M =.F$#zP@T + _娌tP@T +` _}嘌<P00 0%Ѝ06!4#/q!1/!0.ؾ(!H-(PP Hu\1/$7/H-\H-X߷P eP @a+F? !PqH6!"O-MM @zPO `ᵴPI 4P/ p  ㆮP; P ^(ᰰ(P)8p{P!  [P  P ppy  y / kPႩЍۍ!H-A-M D/*P~ zQ upI Ph Y] 0%Pa 1GP\I% @I`')G^PPRJ_68SP!"p"P7 FP. @`\Fp $a FP!""Pu_| X)P )P P  P |FP! d,Ѝ pP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p`FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0pp`W:U `pEP pPUUpR}1/>/|// @- Mu(P: @1  P1JA$*!P RQ 1/P $1/$+R @LFP JPAP=P + Ѝ)Pb  Ѝ@!FP @ 厪^ {P Z_ 0$PEPHF#&1/>/!!//A-(MM@(P+㰺+|(`+㧺+sDPP (|DP l 0 @@@@ @@@@@ P((B(Ѝۍ!l" 0H-MK+uP+A P+l0+8FDP Bۍ0!l"@- MC;(P @O PJ*Q $Q *(P * Ѝ P ` 0#P#e%1/>/O-MQ   0P  P P X @Padq P: P Rp pQ %R R!"  @G  hR%R; dR `W p!01p+Qp(iR* sRH" 0 ``@`Q \Q`V Q 0p1p%Q^p  R P P Q Qx@QcP aP<0  3/P3 BP$PPHp ` NPX Q Q   1 CPP$PPP`V: @T2  Q:Ѝ(0H-M 9P@T ' [嗿岈[P @ '| [僿 d@0T HH [Ѝ044 [X4#/q!! ,!0/v! B!ؾ(@!0H-M 9@P v' P%QlPtt[P d% `'T %<]00 0[Ѝ01/!!.R !!v!!@-(M 0  00 0@ @np@.(Ѝ@@@ 0㹽00S  㱽2X<(S`P6 Z PD @p0p4 pEZ :[2U0*Pt@P,  p/pp,P‱[P `[ PP  0Z  pW iTꒇX4P 0( 0ZjߍOЍ/ 4#/e!|!!$MO-M H"/0PL2< #0@T 'P P  @'ͼpPCp  P Q G0P P * %R@RA* `'P`V*PKP/)P pV/PpX5 ,ᆯP& G(, @ .P  UP sP U P7 4( 0 U Wp芟@u wT4p l PQP @ 04IP Ǧ> IZx/0x  0p>p Hɟ< @ $YP   PP P ^P YJp PP( ~OP 0 缨   "" $ ,P~v\p\\\ 0hh `l`p`>P @pW (@PWP4(v  0N  p) P[` ,@P @ ||`Wr0D7-@ $o @Q ˼(P4( P (pW[@ [@P" 0P  P P" ,QPTi1@P 6@[ % Xp7!뜵2\P utu (P P! `n P    ,QPt- X@`Y V044X* P,DX \ ~Y P@pQZ ,~&c(p PC{u `HX\ 5`~υ료V u! X ᲅ@ ` `Z tf~c~뉌@P 4F `jU xAuX {[  XvJd0LP @GPBY  ߍOЍ/ T``E WX 1h0@P @W@h h nr BvI0P , WA傄P  Wy P  P @< @ @   <  E<P A<P @0h_54< DW5ht@/>!bt1/\(~"f@4#/1/!]!"l!:%/o!!O!$7/_E"!I"ؾ( .! !!A"!H-MLaP@%Xㄈv뜋' p}˂j} }uS\}S各P 0ApmP @USTP ^]|{ bЍ$$ 0+iS/ _!ؾ(!O-oM M Q8 /p⊯P`D<PB @U<*Oၬ vxTPPDx@ PpW<⊯< iѳY3⊯Y iD   Y 8P  P `.`@ 0lPp0Y u   u 0,@qԽԍ4p80@tp8@(V@ps `D\ @ @ vPa  ]P P@0 8-@ @0*U ( +0 pP0- [aP  @  (0p !@sP }]lP 4 A|\8 MP$<@P T/ 4H40`뀜 O ,x 0ww 0r P L V<` 0PP VUt`wv (P K! p   PP J0 =P J0 PN UP @:    | tL* P{ \  yy0 V z 4c a|*QpP:?Q` \P y4*{0}  0 | 099yɟ Pp9 QR @V iY 0pt)S0` 0Wp pV tL9p@ip 0 S0 0W   8p㠘=P p h `  ẁPH 6P  P~  0{ P5   P/  P)   ڣP#   ԣP   ΣP P P  0P p' 0yP < 4 ,/!?.!>..=.y.!!![.$ " !!.R !!1!N!Y!4#/ؾ(m!@".X"A"!!!!!,7/!!H-MHA0 PDP 5 㻯0 PDP 5 㭯 p. P@( 㞯 PeUDx ㎯DP `X@\pP` R NDPPЍ!i=.y.<.8i(.>i B"0H-BMlPP .PQnP @0 PV  OBߍ0>.?.H-@ҽpPν` ,=P EPQ.P@ P 4@P0\  H>.?..#"P/9!h#K-!MP<|PPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ P!ލ!%!,!9!h#4!G-PB@U% 堀嘠`pW Y /W P EQ 0kP@  ᧳P p`T:(!H-M(Q DD6<8 4 0/S 09PЍ88/`}:%/0/" v9/p@-M@P1  @ Q ||| E 5pPt@0h` /QP50</Q PPOЍp8.2/88/\~:%/87/"|./@-@ @22/p@-MFP Q   @P dd d0!PXX@L40  O<<0 O@ލp\'/nfsA!8/<#/87/`8/t!|./9&/H-BMP P RxPhhdP X5TrP H5D"D2 @O4N6@P$ 95 0 bP !"5 0P !1`  l?!1{hxxx6P, P4d mXaiLfc8aP ,$![  WP  O K|FPPcP ^H[T |㹳Bߍ8.<.u#"}!.>/!.!!<..R !+ .!h!!=.y.!!%!! !G!!?.!!i >.!!@./1/9!4#/!(Q 0/ ,Q//BO-CMMf  *Q Cߍۍ)Q5 %AO0J P f Pc A/  4E0p%A_0J\ 1P <5@A/\5p ׫P4 4`A/p4@00Wp`X:@P ;xPB 5/P  /P  xP;B 5/A/;xP 5/< PRp B<@R0d4A|plp<@RRi R|00S #JxA \pkR` 0<RdAp[00S "I(0S "pI<,0S "pI1$x"P Pth A0lXr@Pp)(P,Q !IA Up$PAHxphtA?lp\0)pR00 A ^hA? Y  2$P A/A/@T pEh/A I0A/P A/\0>/4!!>!""r!$=!%!I!P! !!!!!!!]!!!V!!{!!!mC ! ѹ!!l!W!]!#-"1/K-MMpQ4 @`P   P* P b#PHP" HVP0jp RW V` ) 0`D@PpЍڍ p p *d YldP UFPPJl@Q0 0'  0"#!!T=!Q!1!;!H-PP 0 S,0S ,\ SHն S:8 80S:^3O-}MM0FP`*P.  X/E. pW <. 0IY=  D)QB ^ P FodP`t  yP 쩝䙝Z @}P ,uPJm@U r@`PF^=  T:U0S d 㞫{ P TLPP@T: (P P P$TT 0^ x`   H 0 0 ;6/`PV<u `QppP P ģ弓 @ \ 3P+3D YP  P sZDPO8pXP <p8PH - < ݵ 0P@`TpD8p rŸ@㨒B@ b`RP"  < P( H h, 8 @0$`@PLPp[N: r0D ^h Z蹍䉍Iy/ P`V XD^.먁P FD@|ttqlnP X@!gLPFP 0``1q(Q4s 0 !P R---P - -Btƫ}ߍۍ>/Y! .R ^!4#/w!!!>!]!9!W,!!!x!O!1!5!V!"Sp !!!!!!!!!1/Ѕ !%!?!X!!z!!!!!!h!!O-$MMP $ЍۍXXD`p P!&P`pGw$ @&P`@P `s@p#bCSģ@p Pb# 4@8 $(PbDPP@<@`TXcP p &P P & a4 @ & a4@ $(8PEuB P n&~P  P e&ab ` @Y&pa4` $(@8\p KAP}?+P. D@<.P 41.P $"B-p@@/-  02 \@Y@pW T? LU 5)Q x! @0E^#P1 @P+P@pPT:  ' ,T*d0`48 xP 0 ;`5/P b LL L0F#!!~ !!+!!0#!!%!ħm۶9!!!#/>/"Y! 0w0u0H-P0 @\P0. 0H,! 9!@-@  p8@.0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ PPPЍ0.0H-$@P  PP0.O-MP PX@JPK  PFJ@ TC  q` JIJP%  /P  )P   P @DPPP  lpPJ J @T Ѝ(`~ @-M@ #Q Q P 0 ЍD0H-*JTR0G-MM@08T<4,[ QP0 `$P P0A`T4`0 P{ ,Ph ,T8Tr 00<Ÿ`A@T   0pC8 R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TB?P0< `Y RP K?  9P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:03 ߍڍ`_(7/t(,lH-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z `Pp Pk (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H   0```Rp <`8`$`4P4`8P  P 8 <0p!0$` b`PtЍ (O-MpPPE `  Q7 pp @p  L0 3/P! ppt`0 wP 0p! #d"P P ֠ `ѠpY:  `Ѝ1/u!0H-@P P 0H0p@-Po@`Q0  p@ @ A-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0{oBЍۍ!G-M`L@HpP OP PNy 9! Q Qm sP! a\'Pbp$`Q a$qU(1,!04# H` UP P%`0@PC P?Q; H=P7 P 2 p^ `p$P  H\$H0bPTU?H\. P5 .P2H4P- (P) .P$ K?t # Fop<q' G0PPA@# 0`SAHYt\ Ỳn㷲H  Q圑oP P1 JJP㢲Hp T㞲S`q L0 P H  hPd`UMP P K?tb # `W<\"pru{AP1 p/67NPEQ* FPXQ&o !0.p A0y 0sK?a # F_`!<! p; ,70H` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p F_p; ` 0@PPPNލ#!`(l(ffs!&v}D!"9!(!.QQ` !!H-S P`V VVPU  0B `SV VV U E0\0@P`pw` V :w\VQ Q `&c``a0````0``Q `0RO-dMMpQ:P P dЍۍ 9`P 3P  _8V7 +|/+(P \R R 0S   @PU2 $P  R 2/phQUc++/⸝Pp`@PaUj:5aPf+⧝$$P  R 2/p pP0 _R5rP[ᩭP K? b4P ` R 2/p1/4rN_[p$aV| /x;@@ /(7/-t B"  2!p_!   /O-M aPL03/PB t R 2/ p0@P 2 0+0  >P @ 㐜 ዜX `@ ㄜ 〜P8 P( ;Ѝ1/d!A")!... o/G-Mla0T!TqTS@q@!0`PW0C's`0Pppp0$@ PࠟԐ`P`@pPP@pݪPP@pתPphPѪ`0P PP>DЍGQ&.l#r#]#6#...... !9!.H-M 8!oЍ@-M@ +!oЍH-M !oЍ@-Md@  0   !Ѝ.0H-LPh4P@## p0H_!u !M0H-M@ P$0  R 40@ Ѝ0HЍ/  NK!*!0H-MLQ PP(#L@0@DP Pa=#0, PZ=Ѝ088/87/":%/|./O-$MttxQxqaXa @`"P 4 V 0n  P7 0㝰P"@`pP P " 0Pp` @ _뜰P!yP! a! @$Ѝg!9!`8/!v!0#/K!1/i!<8/:%/8'/\p@-MMd @?rP  8 Q  RЍۍp":]udfH-MM roЍۍ"G-M(@`T`PLL$0 PP$P``pXP`  PmP <4 Ś00 P|P aaagP `k@ \PeJPcqWW `gP1iz|;h! 0@ 0 t@TP" l 0 PPPPPPPp* `mUT Tt㐁!,3PW @P ynjQUU oRP܍$$ $0'㗬\'/87/|./9&/.!!!<$1/`8/!p@-M@P"  EP`t@tP  0;d\ 0;!oBЍp1/!87/"`8/c!\'/|./9&//@- @P `8/!@-@P @q0/p@-M u @P || |0Px| h@hP\h`00  0`;PH 0`y;@Ѝpk!d8/1/87/!c!`8/;$/\'/|./9&/0H-M>Q H@HPH8 0V;4, 0O;Ѝ087/!;$/\'/|./9&/( r/0A B0 /.$ P/ @/.( 0Q00A B r  /.   /.H-M6(@/ガx 0` \\0 060I0P``` @Vߍ0(.`K-@؀ؐ` 0U Pp`1VW pG0VpPPE P P P/U1US 0p``0 p.A-q 0R"@0 `pP0U 1US 0CP 0pT@T @ @pGD0Hp <0p@Pf 40A7 @.....". !p@-MP@Q PP<`Z 00`2P` 0Ѝp!"!O-kM4@`P = PpDP1!000P2:dPQ 1/pPdбjP  P [ p@_RPH[8 Y PUX  0N I`/V [  #8opP|P p &`[p  (kߍ88/:%/<8/!8'/?/!!! 0/ 7/!.@-4@ۧP 1 Q袲!0/|./87/H- P<8/8'/O-,M@Mp$@͜P @`$(P (``@ `$VQQ P*0( p@@A$㭜@P@PE pp$᠜P@* `$PA( (```h$VPP Z*`H x p@ `7 (p@$uPPpP %@D@P,Ѝ 0B㤩!!!P 0/S/<S0S 00S/0 /S/0(.@-M4  0@@ԅ POЍ!O-MM(00 0QQQ 00 0㯅PPP b堒 p0@%  POD&TRa @b  bgRP u} 08CP ~R`ĉQ  Y9m VPJ P,f Pa4} P  00?Q8Q5Q3 !}~PU P P  P Pd  00 PPPd@TsЍۍ!!%!_!!0/#!#"3!O-WM$@ N0S  h무 f/ZXꈄ 0S   R /R/Z@Xk 4D@DtDTQ` Q]` PE `jcW`mP `0 0a V`XP P P+ P `00S 1S /S$Q AP` `$PX @D`   @/Z$T P p pW~3|P0T` `*X,lX$ AP PK]P P + t)d  nv|`Ph(ZP( ,0"# 4\0 P $YuQP@P M(( 0@@҃X  Qo P T1 $Wߍ@c!1/N!?/0(.//`8/!b!88/i!0/v!!!!.!"G!L!k!u!!!3!H-M Ѝ M0H-MtP@dmP PXD  fd Ѝ0H Ѝ/! !h!p@-PU |@ `P ]P  PUQpppģ( 0H-MhFP ㊔P@ 2PJ< /㌙܍0>!0.M!Q!?/H-M#A gh`QXqXQX!0 6@ $WS0<DK   H0 0   0 ` @ P`0P!JP@Z"K٧0 *@5)P & KߍZ!/.0.?/4.8.v! o!D(!>!A-M`BO e$P @  P`00U0($ @ލ4.?/`!, H-c<HJO-M☒@T@tP`9TP Hr@TP@@T u` -PU J!00 Va 囋PX @epeTK .PH  | p@ PPP UP: " ᣦP/ 0 ! ᗦ  P  Pp   pPPlpCPY4pL0  0ЍD.h(H.@./.0.H"P@-M@P   6P 6Ѝ1/MH-M  0 ЍHЍ/O-MM@  NPJ FPzJtd >pr upvڡ@5Pp up| PjaPz p P`P _`> ᛢP `=P  ` P ;b9bV% P @wP!+P  oPP i3 2,PP} {y wuP p P l`3  f(T{iPЍڍ a a! !! .R 0/H-M ھЍ M0H-MtP@dP PD  a Ѝ0H Ѝ/! !h!@p8 <`PU 8Qn4P@ PP0 3/q8r L0 3/, p@D0@ 0| x@T0 XpH, \ \<@T!a8 RK B!a"p/(PT!B"&A@x8pQ9 p7d 0@ 3/P2 T `Q4P- 0 pW2  0S$ d@0p 7/P ,PA P p バ@!(pSߍ@ `P <  `Q APpRpW,@    e0 0h 0M 0¹PJ`Ⴕ (Ѝ踋#MK|NH-P0 @ `0  pV0p0PpSp`K-@MP L0 3/P 0@P p`@ Q J !pRpR@Ѝ( (/HP!P/HP!P/H-(MH`@ Pk  0pp`` PP P 0@0p0P`PWU`V HHPP(ЍX4P H/V /H +HP(p@- M` D0P@  `)!  0P `HDd Ѝp_"b*8nH-<0@SH`4P[V9T9VV0;:!HGp@- y@y@y@y@HPp Վp//K-MP1@Cp (0AS*d`0 6/ 0( ,0 pp 7/Qh0 3/ލO-M@P[4`崁崑帱Pp P RF V P P> d!PQ9 P P;P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍ(,<G-`MFPpW 匕P 儕PŁ h{Pł HrPk,jPGbPHZPI|RPJtJPŃ kAPac9PŅ Z`0P$ R p`(H  p`P$ V:pp0  Y4Qq$ Q $Q$QzY Td48PQ Ql$ Q\ `$Qj X$Q P$Q H$Q @$Q P 0 %HL %HL %HL }%HL v%HL o%HL  h%HL@ |a%HLR d`ЍGX%PB 0 0^2)( @P 3"Q 2 `ЍG<%H\"@PP!t@0 <2P@0 314b 0P(b# H!@PPt 0 %`ЍH \ CH ` 0 Hd0S? ! l' Q 0P 0DP$HQ,  P`pdp``I 7/(,0  !Pp 0\@P 8H 0\ H/L/P/T/X/l/\/`/d/h/p/t/x/,<!9!1///!!h(%!,!3! P\1/0 ` 1`0F?o2SP) p aP+ 1 `P! pbH"Pq h P 1  C0"@AC(O-$M@\1/Pp`Q `V` YIP( pW D3 0P  $0Y0 01q0<0  08 1V0 010<0  B 0u ŸPCP\P Epl`rPC" ppJ0`LŸL\(P0ppp,f< 0 @ᱰ0Pc (`pPV pPP Yp`Vp 8I PpuY  PW`PW:ioup0 pP 8P {pP R 2/pW,0U0Pp(p(p p(,(ʹWp,$Ѝ(( (08 X.(*|*0!I!^!.03"K-@Pap `P6 pp Q h`"p~hp㥖 P bI"p~`  p(p崁Te`8 A-M@P `03/P !  0P ` 2/ލO-EM@($B3PP B@@Lg`pPr WT.E @ P2P @ P*0 簀GCp0@P\ @ pPT00@D00 $0 PX 00Pp PñWUȀUuuuuA ⸴  u  0 吳Rٳ P J 8PP P Lp,TH1/PD `'@@LL X4P0PPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DPh k Hh 4pl0 0p0<80`  0T@4PsVD@hpL<8 PU:@PD`KPd Tp!@ a@(@!<PU  AL " L}iPB U Efa"@} /30/O-M@Q(  `00 ppS pb*0 `0R!# p! # z  (P U( P (P  `p@Z P(A 00?B޽Aa0  "Cӽ0  "-ʽ0ɐ   "D 㼽p ᒏPPPP勏܀@Ux`- .PxP T- #@ x0P".P`叽\\ 00P `p@",Ѝ9!// |//X.m!.!_!O-MC`P(pQfAf00  8q VJQ8q L0 3/P tQ2*0 %$(؆ 0P Yp@P3, 0P 2R吠0`, Ḏ8<  0㱎04 , 0ৎP,z234@`WP  P aPjѼ@@`  Ǽ0   㽼PpW @  B8O0 7/ ჎ P@PPP ,  0  4 p0aQ$p,pt@`p0p `p4p  p08 <0Ѝ`$pVp/1/!./|//9!!!0H-P L@ᨏP /FP PQP/<P0"O-Mpw @D`ԂQVHBkT  r * PS  P B)P4R PqPY Z P  EqPc P5 \P UFP PP 'PP ! PP0# # o "!op㡲ᬲ@[԰PDP[ a᥍P  pP $ Q, /Q D0Q R@FP@RQSSG@QDQ4Ѝ@԰QDQ09!#H.m !TT 8T8 T#/"O-AMMP p0@` 4P`Tp`P% 0`H1/(7 pD0`P` pW   0D  06/ @``T:&T&v0S Z8LP(,` :a@h&t@$pt0> Z $&v@t03 $@@$ pZ<tpH@J Е(P@H蠍 @ (e0 夌p 0  0㘌됰 0  0㎌h` 0 $X ``\Xpd<Xp +}+}`p#&W@UP:\`RX峺X 5L P S㩺X +p@8`P T㟺X !@@U㗺X WPTW P@! 04vDphY $hP@p@ <D0 0#tTP4    F0P Q ᅍP iP h aR:,pRLL0aB 3/VQb <  `쀍`#HR@%P!Y*:p L@1/ 0xQCJ`쀝`쀍`TPL1/ & !pB@!?ᒋTT P04@ R  [ P T P0[ R PTP0  8` T8p Ĺ@ ZVH(B`쀍`D ( AߍۍT !H 00 01/---!!!g!T //!!!!O-M@QR p  `0PU,(PbQLQCQ GQ (lQ cQ gQ$1MQ SQ mQ sQ#    0PQ +Q 0Q PPP ЍO-M` PX  |$T  P  L  1/1A$ V`0`&P p0 7 ( *H ᯊP` 0㧊X P0P 4 T L0@P 0 H 0R  0㒊0%pX `X0 $SPP AHP$QZT`P  Q`P @PL 8@<:%P%q0`p\dO㬸\ . P P㣸\ %ppQ㛸\ `W t` 0` 0<8p@ P@,  (  @P` 㘠D PL#HwVP0 D F0" "P ᇋP P! PaP:<qPh L0a@ 3/XT P@P5 h l@㜀@ (;p ` 1/ 0y@ 嘠圀T X*@ @㜀嘠@ yXT P@Q  QcO 1/`*@P!!0!P  uU FPO 0$i@UP4`0 V0p0T000Q,p(0P@WT^@8pPV9 `@P&  T RЍ1/T ---!!//!!O-,M@%PS (@h\ b ]4`P, VV V`%U:V   P  P :$U   00 M% 0ppO(PJ`ᖫu,Ѝ 0㻌NЋ#!!!P@-@,PQ 0 4  a808  qAQ l0 0 80480 3/P,41/,H048 TX ,踋#4 R80Q0Q(1R Q//ḋ#@-@|0S4 c$S 40,8 0P0803/P,41/,H048 TX ,pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W (1 3R$1A2R"1A2R!1/A2A@ (㮌PW P0@ 0. @尠V@Pp*,  (0@ @*PJ(Pq@UߍR 0 0R RH <\H @`/O-LMMHQ h!0Q *1S$QLU )P ILЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0PP  ;x`  6/P pW:HL>///p@-8M@`040 0PPPPJᦈPTJJ4 0 0P UP@PoQRQP8Ѝp0H-P H@჈PP 4}P $xoRP0"!8!H-H P9!#/@-M0P /P P@/P@ 4,@0 P /P Ѝ/v!"p@-@`PPPp@#/9!@-@ ( (P @P9!#/!K-M@qPP@p5@ؐP  ~`P  ~TЍPpp㦴 (@LL P 0 9!#/4#/!1/!ؾ(0H-@P, ,Pa0 0H9!#/A!@-@P@H-M@Pt`tpPCP w}P`7@ w 0᾿܍9!#/O!G-MP`cp@P` wUPp xwpX  0㎿܍9!#/X!0H-@P5 P0HD9!#/A-M`pمPP @ J~` P`0X0 0]P PC P$P@Ѝ9!d!#//0H-T@P P 0800P0  P7P0P0/{!9!#/K-鰀@T& p`P P@T `PPP0PPL  0 PTP /9!!#/H-P`@P 4Dp` v v`H//A-MM@ ;PJ`P v ҿiЍۍ{dЀG-騀Pp@T 删P`YP   0ᢾ@THP@T }//9!!#//p@-@P`3, ,P0 p@9!#/ 0H-@P@ @P@" P 8o09!#/!   H- oH- oH- o P//H-MP ` 0ppp @ 0ppDgP0aPЍ\#!!/H-HH-Ma@(P<)P9$p EP6 P1 $1/$P  0@+P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@>//@-Q @T R Q p0S@@P@3 @@P@3sa/H-M(P@U `w 0n1/P >@Ѝ/H-hMP; a!1P@pPP P  P P P 0PPp 0 0@dpP d .pPhЍ 㤡P88/"!!,!/&!N![!#/i!B!/H- H!!///p@-`Q  0@RPU @T00Q0SR ps㬱p@x0H-0M@l    ,($RP P  Pi 0Ѝ0///H-R p`@PTPQ ჄP `Vp@8$ PR PXP&!/0H-PR00@Ƃ@Q" % %!$# 01///H-@@P`GP $( pGt H/H- P W8.0H-@P0?/0H-P@Ġ0 =P V0!0H-P@P ('V ,PN/ 0!O-GM  -ƿP @젟P`쀟p兠P$ P   Pp |P h M ; O Gߍ\)/#!D/[(/K!\!!!!G-MR@pLOo2  P PP PPU ;`l` Ѝ袲!!G-!M`P@90:pa!P<|ᨁpQpLP/ p P d Pف` 6P=P%  P B XPP2  0y+@F0[ 09ᧁ @0 BX@P L y4 3!ލ !u!!4#/! !!v!H-P@Apph P9:0X`̌<` 0P0 < Zy,, T#!4#/-!E!X!k!0H-M @c  0հP YTP@PT@ T8 @0ʺ$ ƺ܍0\8/e!!!!H-~H-0d!H-v H諺!O-aMp@P㻅U cP b,PY Y Y$G=P d" P m1P0 H"1P0 P:9 )`!0X ,`ǀ0 ,`῀p@WN#=3 3La!0̹8Y```!p`P P P pppp @`+I@ Pa!IK F0 0 & 0'p 0ppPPĢ,@ᆞ aߍ45 ㉮rPJPS1/l(!!4#/!!/!!?/D/\)/[(///ppJ 㤮p@-@Pf`@b 0p@9!H-M8Q@pW(P `W1`V G bA8 ( 0v SANP 0 0P\#zdPP 0` 9w@L IPhoЍE!.R !!!4#/}!_!U!o!!"/E/0H-PP@PI !T0,"D Q0(4  (0/E/F/@-@$P/ DQ @/ #Z0H-@P@o0@-M@ Q T ]㯭ЍЍ@8@-@P x/!/K-P`P P 0Ap QPP R 0 RR8p@DQ0  0PIW# (  Q$0X, @!$ % Q /(K-0M`@ PrPЀ P0X0$ 0S!*    PPP P QP P  R 2S  PP0ЍF/K-M⺛Y80,(P`BpW@T V `VPY P\apHPW :X X *p^PqH^0,q 0 Ѝ!!3!.!@-0M@   @ @00( P, 0ЍO-MpP P ! voP0APP S @0SSP`RЍȰU  P0p 0  I((Q $,PQQX  o  PP Q 0e/8!!!O-TM@p$<0 4 `e8 @ `Pg $p@pD` 0 R ,@XXiH L08 @R @@@pT \  0@RP WPWtrQ` P P(P8  @B,Ġ⺛Y# <0` Q BTPPQQS S S p 8S:pQpp2T2 0`Y8P P  *WY  㬫T$@`TP { 㣫Kr/ @(E}(HTL W0 H  @DL 8P @ R<_( (Q $/~  @ 0QP  v n 4p s(p R0Q0  TЍF/G-A\[@U$ `p R2SRRW W W 0 EW:0R00?S? p`U`\ p"( (Q $}`X {  QPv H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝ>/O-M@P )`Qc(P`TP%5yPUR Qn (ᜅP RPF0Pn|ş|R0 ``pp``2p &0PHpTPPP@H@Q>@ LPLPJ=P `P TPQ `" R pQ 2 !0PpW:T`V:P Q :TP :@PP2T@PT:P季(婣$妣壣c&3pP"0 @@.`!0$(0 f`$Ф$}$wH`@PPy0S @8 3/P PTH`H , lŸp2R0 :HP ,u `AH  0` `````]p^ PL,᠗PR P`NxKP t ᑗpLob@P P  P+ pPH` L03/P PU:X\P P`=V `P hP R 2/@`Ѝ `.T0S H2 Ek>/1/9!_!̥F/ܥ$t /p /4#/s!!J![!O-LM@ PpPD@ P Bs ``@`z8s` `s ᵽ/s P?*0,OP<   0jp V@*XP*@W DP䈽pWo ~D|<z@xt ᓕ Wߍ$$ $0vF/ F/9!!!!!/////G-P\1/ pW P W  Z A0`0 @V*PV`:0W r , 0Y0  01q0<0 @` A|0|pbu`PH0 lpP1`\rP,p 0`B Q$$ $0y=v,!/ĵ!!!O-Mp@僠@P` p P v|  0P\r0 rLLB"_!O-MP\2\`  @ P/ L03/P HP  LPAPj㝟 0 1 *^0 PpW  7/\!@D0@8R< p"q  0q 0PPpQ, PT@  04/PP  !p W P:U qU E u  e b$ ߍC"9!2R !/1/ K-M0@ Hu@!ql(00@hpPPP ` P L03/$1 ( 0p6@0p- 0@pގeDpP 0h Q* ,0p 7/P, qP lP0@-||0  PoPЍԪ(p /O-MH`@PH8uHҸP \(P 4Ÿ,@H1/p`00PT uz@@TP41/d 0 `WQT8p pp3/PJ 8P0`H<p,p @ 6   0mp) H@P,᳒ᒺP H4 03/p4|PH@偺.(0H  PPnPЍ萎#@#>/1/p /O-CMH@pP g`P  P `"  `8 @ot pȐW4 P @X,P@   Ru # A0     0pp姍. PZ,PH 1/D@P`p L0 3/ PA Pp`V:pL@᭷8P 8s DP4@T@0X hP<Ha L0 3/ h0` 6/P> <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0nVp@PL[:`@uB ",  PH⃿`Cߍp //O-MPQ `$@@`(P `"p6gU $Q 8 Q "'g@p@Ѝ@#lH-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*8G-M,PPVCd:nP\2nP S)nP K!nPŁ BnPł 9hnPk1LnP$ R p`( m p`P$ V:< 0 RZf 簹Dh!|qQ0 pq|R8`pdp``J 7/ $@P(0  9@0 m @0 {m ` 0 P0nm xpP0` pPL `p 0Q $0ppAލl!/h!/p!/t!/x!/|!/!/!/!1///!K-MP1< @Cp(0AS*d`80 6/ 0( M80 pp 7/Qh08 3/ލp@-(M@,0/`サPV    Rx 0  0k`p *AᯏᎷ(ЍphK-0M8q L0 3/P  @ p|1/ P@ p` U0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  ^ 0P``PP 凝P p@ 2/Pw 0``PP mP`@-@Q 0 A2/@P 0 @ x @ @-M@8q 0 3/P:  Ѝ@/O-MMX Pg[P ⤦P] OP ☦p ʘ8@+{]ᖦPd*`0 㑥D@ bz$@+Y]tP 0 o@+B] bP"0[P tBP`+&]L r0 A,+]0 2 +Pf !P\@+\T0 PJ( @+\0Po P,g PP.묰 +\Uܠ@唐`p  0CP  0ФPE u P + Ѝۍ& "" "2"&"<""F"O"!Y" "e""q""Z!"""("O- Mp`QK@T: PY Y4PTP, pQ:  TlP  0|p| iTPP Y Y 40lUmI Ѝ"""O-MM@p/PP PpX`P` P "0@+\ PS*A@/bPP `P FQ Q/R ◤P8JP P) P Xh  ᕣP&J/Pi!0@+[`+[ PhP J P+[ P:o?o`@ᇤᆣo@PЍۍ (P /PP) @P`P *jP'j PT x+c[ P*+][ P*VpSPo>o@@P#""v!"H-* ,p@-M P|@PJ  @PJ P `% V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD ҇DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`9ip5d%XupX@&T  R q p5@`TP7 K50 `0-` R4@$ X,`v0P4$@,p0@Tw  00`Xh`P(D00L`,!<HHAC ` sjP4<xP@cjP;8Z CVjP p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#ٖX 0 0h@@P尙 X `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`-hU`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(89! "1/#//v!>/!"(0H-0MP   !0LSd @/P6U7C @ @$P UYb0Ѝ01/T //"/H-(MP@o0(P(p,p10 (0R0< 0F0P0 000```Ppp, 0,H('0bP`((`(Ѝ/"/!/G-0M@(@ ;lP(p U d1`0 p  0`Qp@810 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P2,p(EAp(E@0Ѝ#p@-M)@P7 P 0`000S0P`pP %+,@,) P0:  ,+ P aX|^* dW-0TT Z@F.44 40 0 Ѝp" _!// !/"#G-pMQJ@PPe : 0 ` V " 2p 0wf": r`T Pv#㽔x"p` X0 ]fH":0 w8"J& ,Pg 㟔p0 "(H0  R P5 ` p=TXp!0 Q 4 t R8qS TX`  P  k/1/9!_!HXF/hx$"P"c""tO-4ḾWp@ `| P/ 0`} /P PW  QP/ [  PdP pPZ _`冑 PYܭP (`P, pap P# (phR ! p"p  gXT,4  `8`ⴁ4Ѝ`1/O-tMPp$h⤱pP @ ]P Y$P$  Rp 0dp`p(uuuuA`  u  0 pp1(TTz Y`PBJ(P P; $0P!aP(PpP- ``@`r@@"Odhb"pOp Tg 0 P8P唧Ph h@lP_ 4 h0 hl,`$o ptЍ>//////O-lMP8`@ gPp 0W 00V0 $00@ `` 0@ pVp`pQp pㅪP *.Z뛷  P:R ,0ST0 S Qp xlЍO 00 8 Pp $,`X4( ,$P `Q Q 803/P ,(Q  RR(  (  ,Q 7P @ B p,P P(4Q4"@`G'cP "cP GpP,,(($`P P p X:(4,$($P Q `8p L03/P LPTP P (` V:(8 0 P- 88`p L03/P HLP 08 < P    R pW:H1/` [*k8q p Ѐpx@p@ X0T0@ 0 !k , P  0 2p@P@0@ X* S0pP Ah`W $0@ [ 51 07 5$P X*1h2(0 S&*1c20@0WP0@,  QP@p`A R80s@0p 0p@X0pP0@WPZu$4p W!*!P: 0` j`g [0p@Q`@`V 0@Q@$0@P [#* 0P` E`Y 0x/0p0S P  2p@@0@0XP0` PN0 @ Dp @P@0@ ? P<0( @,Q :R*Abp^ q P rPU  P$0 00Q* 0^qa @PP_T  lЍ#>/"!1/,7/O-CMPp@U\0`dR `80 R0P pQ0s  BYO p*PJ ؠHppPV p EXhP0 dpp`pPW:!8phP @T pPp )Xh L0 l@3/h @T:Pd@E oq/AQPHp0ڧPT 8HpH1/PPD @RL `T` < #"PLPP{0  + @p8q ``( L0 3/d0@TpTDXP@P L0p @_X PPdp0`Y:[4*d 8 pዑk< @ pR P D L0P@P `^Pp "0P0$P``P `PPU4 P H@\ Pt`Y@( \ [ H 1/d 0Up`P (``R$` cX' <T dH@0h@84`,`pgZc PHp85 P \ 04 p0 Xh < \ 3/PE ,hl$R8P0  p p p0/(7/0H-@$P xQ R1/0H苡剡$ Q:Px灡$P U:H-0M@$P L0 3/P' U  0S0A`0  BRh( pWpA`p'`&p  BR @! 0! 0ЍF/H-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H-xM@P@8F[xp$ᖷ `<=[A ᔸ$jP a  |xЍ>/p@-0M`@8PP P c0P 1/$ 0 x`   06/U U 4 ( ,0ڏ 0Ѝp!"X !H-0MPUJ@$0p x`   06/@ ᷏P x睠x P@!0Ѝ"0H-LP@ jWP 0 dWP  ^WP)  XWP*  ቏P0}  ဏPP @  uPP 4!00Bl eP 0P @ 0ZP00V ]"C"." """O-UMM,pZZZDP{l4SP PBsSP PRP H՝P/(7/O-aMwQ`|@ T P$P |Q1/$Q}P}QAT㯚 `Pv |fN Jp!Qe  j + RW > :0 0S O +&0PU  UP QU}QU/e  +PPQTQXQ\Q})<, E "E P a/Qb&bXdZ [ `tP }AQ  Q  Qa/@T[V  0@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8 @  PU: p| @ TP xtlhp| h0 xXT\| T0 @d@`@ P  D .@  0 ,, , P H4| @0 L@<@8@P ($ | 0 | ,p"   pp}o(0db   QARQaߍ"/(7/"C/V/"X'/xD?/@V/ V/|V/V/?/\V/XHH,!Q/Ѵ!/"/O-Maa8@P%&'X''`(()P   PxpW   R/07/P- L03/xP P ~Q ŀ`48O00PS L%`_ $ 0R 8Rt;$ _`p " P"  PIPDP`,Iph!P RP,1U A C C0UP @P 40$<IP@D$ L0/3/PT"0 P  I| `(RP @P  FPIPHRHQP #I 0@L @pRoP  HC DCP8p@T*0x 0SU C"T3_$"IR/P0"I`0;$ r _@pV 56 @[|! R0" ߍOpU Ro B B B$ /H-8MP8P= 8@_QT5 P1 $q?$Q P V`P``V Q  P Ꮽ  q P 9 ጮ 54|8Ѝ 0m APn"""/G-Mp8Q 8Q`Y rP $A1/Q  01/P P1/P$QPH1/`@0PW* 803/P <0S  3/0X `````3/PppX000  3/pb h L03/ @  pܸ PA @` L03/P |Qzp `V:W$:P" `p㘀 L03/P  |Q h l0"#v` pW:v ` ``@  ]T|Ѝ$$ $0m 0 cOn"""#"/p@-@`PQ  D@ <Tpp@<lP PXpp"/O-$M\)ĀĠ@`p\  0 PU PPU 0P 0`PU LP Q` V$ЍO`$Ѝ/"(7/H-M!bAP8 @Q`V P {typJP_ q`P x Q@PPQTELELEdEEEF0F iAxhh!h1lq`Pa Pp paWP@ 0 P`L& 0p`Pa PppP`a 0 Pp \`XPp@88 80 `P&PЍ"/4#/>/"LX[(]l]|V/ TUWWV/d `  d@V/MPHSS V/`HJLM\V/O-M@P 0`a q08 0000 pQ7` RQ`V, P&" R Q "t  p 0P g&"Q!! S 8  `ЍxD pK-MQN@H,IIIJJ/y!@-@Q pGP p$$ PUX V/@-@CLP < $1(!,048<G-M^ P`au 8VHtTTTU+A @s`d;? @s \0 +`0S @ h0S @Bl0S @C p0Sp @sP 0 E @st`Qs0 SBߍ "-I!;!"*""K-MP Pk@ I`lXpp[[[[[\0\H\X\h\t\\\] FP P 0,!< G 0@0Po0:4Po448P P 0@v'dPod!J`l\p K`l`pohpM`llp0 b 0P  vc]PWލpP PptPotPP P;!>/@-@ QDQH-@ P`ppp pI@`g$Q"d  @H&Q4"p@-@MP@PJDP R ,@! p``P T X0*6P @Ѝp"/"/O-MM|?thX0(P pW pW rebq(@@BP   ,0RuU   0  0``fp pzbghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ"/$O-$D >P 4 vP1x@pW W   kP"  cP vP 8 R |8R8d08 vP PJD[0`V: <@P1 DP 8 1880p W P p8 Pp8 p\v@    `;`V0   ႹPGߍۍd@H "O "` "y " " "ī!$ " " " "O-_MMPP xP #v@P _ߍۍPH'`Z0u@PHƄP GDh(PpPd T 0,`@f$<YOp84PpHLP\e`mPG P [ [( [TP*T  ;`/\  2P \%eXePP  R-  N-PX  P d! 0   `T`p  eP DP  >P  8P \P}Pd\ 4 @ $8H@W$,L 0HPp><eP X\HLP8 Y P0D` T0-T0`PP0XԐ84\<P <T0<P< Rp0< 0( Pd'HLPp <@84,0DP<h 40p8@<8@օ0`v?E( D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W PЬP0ᐅ@,0a[/ 0pluP<tPpql0 [/ `u`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R =,`xp W:E tD@5$$ $0 D0>" " "?/ ""/ " A"]S kS NS ?#|d "G-8M@( [`P HP P``\P|8`X&&qC8Z`0  $08Ѝ 0A>" ""#/ /H-0`@V PpD;P ;P `pV@p@-P 0P@U  ߴ„`忄PV庄p@跄 0>" " "@- @s@# "A-PP`@pW P嚄嘄/o!O- M0 >,0LQHA04q8ag5W X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝ>/UO-\M RW  dLA p0P  P0=gM`@>PQ @0P  P0+gMp@P@P?HL P PU@P 4 04/%$X P@10`d5/p`\Ѝ;!>/@-@P0 #/0H-|P@Q& Q0XT D 0"!Q@ PRUR0 0#/V/H-@P*p- 02 HA  0E8# "& "0H-P@P |T T TEU P *P0T T 00 0 0#/V/#0H-MP@P  PPT  bP @"QQ Ѝ0QЍ0H #/V/Q /^ V//0  S :H-M 0 ЍH /H-M @0 Ѝ 0 0H-0MB"0T00    000&P0Ѝ0H-M0 0 Ѝ@-M, $@0 0 @ ЍH-M0 0 ЍH-M 0 ЍO-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0G0P QD∠ 娰X\`@dPp[8 !0@0 ;@@@cPJP PR R@> 0 pTЍV/ " ". " "f "O-tM8^P] 40@ SD0AQ0R^E0` p@S[ PPTTT  rp 0`:T X0W0-0Q0*0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^ Q @ P`P ``P`  T3^ [ :^ q0p<|pp2 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QmB`0Dp  ~W T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ zP  85 `pu$0p LQ Q= `V@  @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP^  P $040wP 00U "K "A-8R4`U @y@TyR @?32"0H-(M`Pp @/3 0 @p-PP  "0P p0`0p`007/TT (Ѝ "G-`MP@`U0P0pWk40  A P UEq0` pl`P1/P0= (@K1/pUK  2 0Q000S 00     p`H p P/ 0p0 0`D p  P 0P8P<`U`0 40p @P1/P0 p2"p7/0p`ЍpV/h#O-MMRU ` =/pZ %P'+ 0- @ S 0/;z@PJ| -Shp UX,p4p@`<  0P`@ @@2,B&T(@P P $p qWP< <P@ ,`@L. P1@őC.PH)0U84 13.@( PG *. 8@`E?4A@?@[(P 0D{ 兔rU Z, ׇP,Z1 r@PT8*  PŇp P @, x%  P岇pǏuw '@`$prWV8 &f8@oߍۍ@H L0 ,4 400 00d@ ""v"c""O- pldD`dhr VQ? " `>,0`Ģn,4`@C18 ;VPJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@ @B R R R (0"r" " 09 0YR0pW ,@$`PBStP T `p W,4,㨆ppP" @0g 4嗆 pP,| I$Pv `0 W UPD (p4P OP,0Ra+ V0  "P 0τm@8Ѝ 09. "" "#O-TM $H0$P L0nPHJ0H 4LP`P0 4<($D @0WP.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0"P'"X$! `VQZu  吵" ?*@Lp?`HL Q pWp  o* 0l*%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍ>//p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0!8Ѝp>/UUUU3333O-M4@pPo? FFPP Z QPکPW   pP p?+P JzPP PBPTW Ѝ"G- 4pq<pW PT \ '0 ?@`RU U UU R, @"0R YW P  GP:YW ᜉP?6"R 22  G>/4/O-MMPP TQ4pAn 县 @P w  ; pp -  c@XpZw gb0P 1/ BT _`s`VsOPsPUs sЍۍ 0k ,{dЀ "" "H-MM@0P 1/ ;㲷p `P3qP p a\sbzЍۍO-M@吰px| Q94`0`H pG0w@0P@PЍx#V/_"#/#/Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @#/V/K-M─ Q @4` 0᪻s Vh p0(@堻DD0  p"!@@@@ЍV/_"&!#/#/K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`o`Vo4W  4 ^@@PXRU PPO`o`Vo"O-M⾀@p_`EfPP V QPکP"0@QKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0s( """p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P㤕Eu  ωpPePfP lP zP6bP eP  0$ 0ppW @T  =]p / Z8 X6T4 <F 5,gPl ^P$   P #`@p wPI $ x#῱p]pQnZ' I]pʔPp|KP(] ]$\(\#0P 5$ ]$\(\ bŸ2 pRp@ Xpf@ p PF/3^pt!P  xhPt pI]pT`p<$[ Aw]$\(\U \ ( x\p@P P( P\p(Q P 0@T (P 8$(o\@^Y ቩ`   R0q0 P0R0v 1(P V V A Y &(mP@*밚//"/": ܸ(" ":{"ht@ؾ(̚/Ț//К/""""""s"i"E"&" @-MO(@"0   "ؾ(9!H- 'q] H[@-D@p4\0P~@o耫(̚/O-M-RMp |V]x&hd ^ ]L~@Ɵ`@ R0`RWF`&W@A X *``eP7 p P. 408 0\ P '.'` P &.'480 \P zP t 0S $ k@T2  AB  A$ @ ( _dUdPh0M`XQ-pAP "pGW$$$$d$TP`?G!h1j Z` P @p:j)0$  u[!EPp:S0:Wp#hP@  p  1(A$QS @D -T=IBJp   A@T0 A  Q@*P :0 %k!%Pp :S0: ` p2&1p|pd`"g P" `'uh 0廴 P R,pX!@ R :P! R`@~ AkD `  H 0 JT!e∴PPp!e‴P` , P =ZRߍЍ P* eg Y@ @Q5?e[AQ%.v w,BD@b"(r02r 7"cAt qdCP.A/ؚ////Ț// /!К/Q!T#9!<#!!ų!?"!!! ̚/0H-0MP@% V&PC0Ѝ0@-c&@%_&@@- M @ @ Z ЍG-RS PP@&7 `QLp@: `T0 ڳ@`P: "A-M`@@P1 pP@P P:PUPP$-P  U    TP V  㻒`@P%@Ѝ(H-`@yYPp  plYPYU%P7p@-P @`Yp  `6Y@oYpp@-M@ Zp D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM hp !Ѝۍ"p/H-M`P@R   `PZ pT1Ѝ0H-@ B XP  PU P R jjP  R iiPU0HiO-MMRO @ PT k p`PH`Vp@U+   0p &$P $#P* PT" <P U p PF@P R@XL $D <0$( (700Ѝۍo{"j"X""p@-@$P`cP 1 Z Pppp@-M>P`@*p! 0 @pll0< p D0 @pЍpL"i"\O-lM K @oP `2p- @ p +Y Xp 5Xp XP JYX" (Xp Xp  [ ! 4 W Y lЍ} - 0 |0 x0H-@P q  W}PpPPq W! p000H-P#@@Xp#@P@0p@-pM`0 @p P) eWp @bWpЍpO- M@ `p j"p tl0Tlp0pPZX0TPZPT@ @Ph0P0 ЍW!""9!#""4!G-MMQs#7QPp@ ` VGPZp` VЍۍH-MR @PpP `V  R: `QP 6#5e`P.`P  QQ*JfP  P  pp `pH0   P`@ggЍA-MM@ P|| M P1`    DVp* P ` `P  0 @;pl ,@VP pp" P "9P H<V bЍۍ"""$"9""p@-xMP`@S  j  +Vp/  `Vp$  Vp  Vp  Vp  P ! P0 p 8, U xЍp"""p@- % P ( DZj$$ UPV  QpP$%%pH-8qP :&PP P P U e0A-(MpP@`v7LP$pP  s=oP. Vi P " U PP tPQ` OV7tP *P P hGE PA | R@ xA P9 P6PXP%7P  ]tM((ЍAU- PO-EP $P  Fp P tbU(ЍH!QV L'-(ЍA%A (ЍA""""""""'" )!@-M@tQ0$e2p    ,Ѝ""H-MP@p"P= + 0 + );P  0i `xQ Q RQ 0 0 R\  PUP DJЍ ЍH<"T""@-M@pP Q Y pP t 0!Ѝ"@-M@ P Ѝ| \ xHQ  P Ѝ@#@-@:df,PP PILP P@N,I"" )!p@-@`LPp P$  P<: !$P gp,FA p >p@Q"G-M@q + =p` 0 pPB PPG x PE p P  > $> >$Q **XxP P P  @ , CP  pOLLx!vpEp8 Q   x  Rx s| R xH!Q pV   P,Q   6P6c  Ѝ""w"`"j"O-MM` *0Rp <<r0},@P+Q` !p@ZKv7P  PP@ `Z 8\!`1 pPU PxP `@P T`V0 @Px  0Px` xQ@ | R xH!Q 0 ` `VbxMxP Qx}vЍۍ"""Mb"D|@-@ x`P $ L@j@-@1@RA-@Mp@PR `VP V :f07  @ЍAP"R P 0wr>pWU# * P P `* <0 \ p] <0 8TX>P * @Ѝ 2"F"v""O-$MP@PJ PI pP tPD T PEj`Tp Pdp`VU\PB `T9V   PT- `` pD  PX` 0A0 $ЍOj\`PPPppEaU `p p  0`&yjPMP 4P 6PoP kP nPNP UPqpP xPpzp _   ZP x`V  PB P Z %P T 2X0  0 Q  R R R0 PK  P0 PA0`PV_ Pp88x PPU!  P Z ` @P @W @Z (p2 PU  JOP$xPU P Z ` @P @W @Z  w(p P88P88P$Ѝ Z$Px@T s@@ 0< <,PPP Pq 0`P xMPM Z """""ܸ()"#j""G-8@0P@ `0R`0+ j`0`V" pȐ̠ P   : X  @`Vj"@-@ P  oP@<p@-M@ 0P* `HD1 8!@ 08P0@00ȌP 080  P 090 00 Ѝp@ЍpO- MxpWY 0@ PY ` PP PXP X U@ PZ9 `' !  0x?U   |_X|P< |x6XQpW Ѝ""O-M`PP,`(` @BP =P, 0p)z/{ `\bMpRMpKMp &KFA&KNo弯弿($ 0v?PMPpY 4P, 6PN@Qf@ Q%0 l | L `\   $ @xP! $K$$p^dp@F($ pEPk pw 0xE tQA  0@`P9 0 0LP5$Q`d %P0p  0@BP 0 0.W%P7sH % 0 6- %@ .Pd %Q{ p @Q P;  P7 %zLpP & LpP \& 0P p$x00 l   @0P T 0S 8p P p&T0 -6p 0p +  \(KKp @P t p[  A\!K\45 p$ Ph ppD$ 4 030@> pX +6(p 4 @pd{ !1R0,- P7 @$@P4t4 P P e !@T$@@T  0S7 QPK [0%:86Kp p \3 Rp TN $!@T p P  pp@T!0@,P ]  p,p@0PU p P M PpPU/0  Q PUK" ( W!1 R  1@\ "("|0y0 bPU HA P  0P@PUp$ @bK넫(#)"(""""""/ܸ(^"q"w"9!#"4!W!""5!X#0""2"="5"<7`7N"b"""""""9 3/"""$"ov"Q"w"|"""",4"""B" _""""e""s""""+ o"""ؾ("#"0H-@HIp PaJp$0HI0H !"RpC-M@`8!QQQ*Q8 Qq PYЍpC,pQP  0pJxxFQ" Q/ QQXtt!0 Q< QF,,,!@\p-ЍpC  ! 0P kD!\H1B  P0 P Ѝp@LL {x@T -@DЍpC""" "" """"C6""""""("@-M@q $0d @*ЍЍ@[2@-@ p ?`@K]"0H-M@ n, HP pT<,,H,Ѝ0R |l0P`XLЍ0H<PЍ0HU"""""@-@Q  pp*}.p 7P  P@VPP @"#"O-M@`PP Р,(po R ` `0IP    !  H@k9 P P  @ P@Ѝ5""0H-@LP PPNYLPLPHYPTP PX=YTPTX7YXdP Ph,YdPdh&YhtRU xP  x,PPxtRYt\RU `P  `,PP`\RY\0@-@j@9u"@-M@Q  \b Gp PQ `0 @kpЍH<Ѝ@4 /Ѝ@ ""(8"p@-M@Q  *] WGp `PPJ|XSP| h0 ! @.pЍp@4Ѝp@7``Ѝp@""9"p@-M@Q  44_? BGPP p GGЍp@!Q| A0S|l `XPP `@P` XX  P ᒢ80 @p Ѝp Ѝp@""ؾ((8"p@-@>P PR <`0p`> * >@p耼H-M@pP tq^$"P)P pPpPP QbRPJ@!TU8 >pQ: `l!R pP 0K P 00.(p$$lP >P p *P> >'WptqЍ x`V >P`lP x>P p *`> z>p@ a"u" """""/O-MqP tE@pT `P `V`V P@Q`P T @`ⴱp`(  P [ Q    ``q崑Ѝ@-M1@T T @@@ @ @@0 S 0CÃ0 0   S  T `0EpЍ0H-Mq P@U P PЍ0"   0     P @ 0@ 000P`0LEp qAH-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^n 0Ѝʚ;O-M,(@0p`W P P p bPp< 8pW P<PpP ,P4 Gp @0 `P Q   Q4PPp4p PppVPЍH-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-0^ @PQ`V`V ^R`V`^`4``<`PP#AA-M P`@p   t APp !wv PP 0ApPЍi$  L r /Q/ !/p@-XM>PU U 7 V)@T @`Q T TPUA @>@P@ <0 8 i> "P> *@AXЍp$"@-@T `C@A-M`V @P P  nP Q  0R p kC`VЍ SQ/L@-@T 6C@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`F  @GKPp P!pl XZj  NRpR P$ PP dP ZP@T P @X @P @X@Tx  T@PY( PX HP TP UT\X @` 7P \@T\X,LP P "P L[LDo,  U( Q P[PPPp"P P$R$RPLPH (MP @` ,P PU$, 0 @  pp 0  @D)@pA@ 0@S/,PCP !5SO S1 >,PTP5TdP @h 礥P d@T!P( P,PSʇCP#:SS S (UP|P U P(@X TT@,PP 帒*> @RU p @ !H }!pHP}H PR! P 00L ` _ PD@ZOPaߍ Pv"i"""J"Sl A- MP `P @ /P P (P:B ` Ѝ:,P `  p8W % p8  P  !00:P PPA`p ``0`P iQ.Q  ` ``Q4(0H-M P@    0>pЍ0~iH-@MP @P`R gp `V pT P P `V `@Ѝ xQ/$ /H- M@0 P:`V 0 PpP P R: R #d0`P`VxP Q g  Ѝ=p@-@ ON PP ` `,PV:P@N($P`P` ` (`,PV:$P/N$(pO- ( 6@0  00 ( @W8    p < 4= _X+ P[,@Ks PPA  @lh<@(P0:d@80 P`8@P4E 8`0p4HU4@ Q P A P PP 4 ,(   0kP4P4PP  P P 0 s\P 4P S  ` P`Atp` @xR `,@V:@;M @ pP ``,@V:@)MA `0 \2`0<@  8p0 @` R ,P00 oP (,8@p80QP4 L4T4`Q P @A P P2@P@4@@[ U  *BP P0 P; PA $PN WL|P [G 4#P  P P  @r\P 4@ R @PT Q2  QPPT eP $PT $ZPPw Ps[o, (0@Jc` dhⅶP @4hA凰dhP dI$P W LBpP0! R *B <Ѝ؍脡#/"" #٥ "!" ""#"G- P@p`P `mV?@ QZ 0  GGZꤚ##"Q/K-PBxP Q @K@QKP Q @K@QKxP@TF | KKK,(VP X,,PP,(VK40VP J4,PP40VK<8VP <<,PP<8VKD@VP .D,PPD@VzK xK KuK` mP T PT@dPH- D0\ CϠ%AˌDq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 bp 0 P @@0pU   `p` Ѝܸ(#)"("/O-4M1CPP<    x ``\@Xrrrrrr\ssthtttttttttu,vvvpwwwXxdxxxx,y8yyy|zzzz8{p{$||}0}} ~|~~~~ 0<HT`q r r$0<L\htĀЀ܀r(r@4rL@rdqq$\ \~ T\q 0P"   @ `0 R [+/A \M , `P @@,P pyDP[ /0PẒC IQ \  @P PZ P P pHP ptl\[  @P P{ PK P PM\B  0p;>; 85\ ?GX\xrtB 0PP `P0  0P P  0P \ ?X\FxrtR0 0 `P 0PP\v =@ `=P Q P Q QQ,0 @ PP/#P<0@ NP <, @!0 <,0 @ PPb/P408 1P 4, 8!0 4 \% XU X\ LP @H 0@ `p PP PS ]P8\6 ,`P@@TP" P PD PDH ✱P D, T!DHP  P PP @\ L @MGᇫPLS\y ?X&\6txp`@p @vP BP3 P  E  @ TS  \4  \) :` ]~PP x\  P ($z\ gqxx{wt"p li f\ @>P X]\ ?ROL\ ?HX\FtRxrp 0 `P 0P 0 0P" f\ SP$ 0!`#"'"`VP P P0FP!  p @\0P{ di$("%"PUP P PE : @*P p0!p  pp p[`0P "$"\=  0Mp 4@ "$"Z \( 0P"   @[0 R \ 0P"   @[0 R d;%T6괡" w$"$"$"Q 0 Q QnQ   "PQV Q QPP@QO  Q QjQG=P p``0    @_[0 R0  0PJP* ' P  "1#" 444 0A; 4 /P `I@P /CP@ T P/P PP2-XPPvKp.Ph Pꄫ(q#"d#" " g"#"`p @HLP` 4LP `PLP LP LP3 LPx ``LP LP LP LPP LPP LP pLP `LP P{LP @vLP 0qLP lLP gLP bLP ]LP XLP SL\UP LLP~ GLP{ BLPx =LPu x8LPr h3LPr X Um Pj P P#"Ub P_ P PP1P@ P+VP G A  @P@ e bVP 2  0jp 4#" "@L PC 8 PN $ Pm  PF  P@  P:  P4  P  PPh  Pb  P oB"0$"Y@ Q@ IPPXY $Y P.PV4 P1 P P3X,p4 PY:7d$"Y  PPP[ lPUPX P P@@EQ  Q QQ`` P PP(V8 P5 P P$Pd P P\Pl @8P X3P H.P `C%"`CU@  P PQ@l-B -@P&4 )A0Zp P 4*d_` P PtP`P P P`I%"YP&4, 0 '7p`4PF(@P P PF\@@,0 Hp$ ( Ap E P ,P 0 8(  4@P B  E@PYPTPPF P_ P PFP P P HRY( 0D P "   AX0,Q  Y&"Y8 , Pp P @0P0% " 8,  P B  P P P M 5S4*BjP%y&"P"P P@PX U  U [ \ W W\\=("W("o("V@ Q Pp8 P   <+8@ W "P PQ  Q QQPP@j&"Q Q Q@{IP P|P4ЍB PP$P  PQ `0S0S  ,PQRU, ,P㯫P % $( $"iA2#"W  @ P:@@` Fdy `\0@P  PPP$"~#"1""(" ("!"("'")&"&"F&"_!K/"&"&"T gV/"&"/"'"? 4/"c /"."."."."."."ǵ '/" /"3!/",/"."#&"9/"B/"ͺ'"#'"@'"['"W d#"'"'"v'"&"&"&"%"$"$"$"%" %"%"$"3%"<%"F%"Z%"g%"K%"%"  !K-P.APp`^p`UV K;P Uq@ P*q@`FpUV $$ $0 @"""#"O- MP`p(@"Py"PP p U [}VQ UP X` ~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  h.U!   0RP P  gU P U U P X: PpPPU [7 Ѝ(O-MP`"P6 =@P5 VU ``V p=@W P! `V? P @ P5  A ЍЍO  'P ۣP p? qp =P     z ЍOx?("("H-M@PR `P /jP p   HQ &UT `` pU GP W /G`T i-PT`U z-`Ѝ("("G-M`P\P FP PP p @P @ q FPPP<[ 0X T>>Ѝ ("K-@M @P  `   p  .P t t"@ЍG-p` V1`@P5P X FGZ : J 0pQ00@T*H Q3/K-T`V0 TpW1 @LL Q Pbqp ||PPPP HHPQPQP3P]PPPWY $0 0(")"*" *"@-@co g@kꤡ##@-@P @H-Q# @PP gP  *P ` #TpPl`W9P  0>\("")"0)"H-P TP gH}H= 0oF(")"*"p@-P @ P`P T P`p@p@-P @c g@ 0Y!("E)")"0H- @P P= PP00H-P g_ P @8@P 0 @ 0uP)"(")"H-P QT$$ $0c 0("X)"*"*"@-P @PT@ 0("a)"*"@-@P Vn@H-T R H 0("h)"u)"H-P @ c_>P ` 7pTP&`Wp@- MQ @T R R" PcoFP Pep ` 0̅  Ѝp<< D0zS(( ,0 0H)"(")")"u)"*"O-MQJ pRL P@ < 8P< {ZPTt`P ` PP LP U U t U  pp  `  0#ЍHH L044 40G*"f*"N*"*"9!*"*"*"*"("3*"*";*"O-4MP8@ % $dp P \\$`a+P $ lbZP ̠$`  pOT Q a P P T8pPPN9PPJVPETcN|X P)|TTQ88pP4  P& WP P #P TT R ?lP HG[8 8:YP XX3PxxQ tpVP #c_ P< Ȱ` p`PP+9PP' PT P    $p P P vV xP p@`P z`\ `pP$he4Ѝ蔡##)")")")"F+"O+"a0Q03Q/A-Q TPp Q 8P @PdQ`PC TTQtt PuPttkP88fPC XXW t  t  @p'P M p P BW @k pP .@V T$xxQ8 @(( (0;+"u"+"(+"+"7+"("*"*"H-P Q/ 0;Y+"+"+"H-P Q/ 0QY+"+"+"H-P Q Qo~/ 0}Y+"+"+"@-P @Q QoBc/ 0Y+"+"+"@-P @Q Q@@oBG/ 0Y+"+"+"H- MP6 @PP 0@_oP!PU ` eP "`/PpP `1VP ` Ѝ(( ,0< 0'6/Y+"+"+"+"K-PP*~@.`DTǁ `YiT d\`QP/ 0n/Y+",","H-P Q  ^  N/o"1\ 01 CR #^ HgN$$ (0 0iY+"K,"^,"R,"H-@PpEUa @WgxUȀep@-Q( PR+ `@P P pQ  0p@ 0 p@$OH 0Pp(( ,0{} 0_x Y+"8,"C,"Wk"H-P Q!. $$ $0ve 0_Y+"j,"{t"+"0H-  @PQ0ġ#٥ u,"O-TM @PP@zpR P P0zp@@@@zPU A`@?P: @PUPU @`@?P: @PU pz  0P'PNzU PP TЍt#X#|#x#M0H-M  P0 ,p @RBp@@Ѝ0HЍ/G-R'P@U`  R R* R/ `PPPpV# P* ㎢P a ZpP dd d0YE R  @T:q 0},",",","H-Rp`@PWU L0 p P `p``P QH RU p`Ȫ" )!"0H-P@p 0H0H-@Q pPWP @QH` PP=QPU:XC,"ؾ(A-M@`PPPT  up' p P$ !R* | 0 p PP ` p1P , $#ЍA QU p` !2qPUЍ P PP!p0S < ,Q ?0$ -"-" ."."."."q)-","O-M`Q @U !AuvRSP P;@@0<<'P p N'  p Y  |p p P% P P P P P P tPY H Dp 0!,<p x;@ . PP 0S , p @ p DP R kps @Yu   Pok@%@54  p` L0  e%S S pS H pM P pG $ pA  p9 PP tQ0$p t p'  P Pp ;@0 !kx`V# P P   P`@Ѝ`Cp D `Rp|p  P `  V 44#p T p  `P?p xP4 HP+ 8P& (P! |P P Pn !P PP_ P[  !px   pr r%P  ph %P x`V ^%P`V <pP J@ pH PP 0S  ep4 @ 0p-LH w`-"h-"-"-"-"I" )!""Ȫ"-""-"#-"-"o."-"g!"$"-"-"-"." ."."#." A"0."9."D."T."b."m""t."A-R 0S P`@8p p 0S."H-@PpP$  `P.P! P P x P HE .P`_`P @ &!."H-@'Qʘb(PA p`pP @P` XXpX P:HR`pP @P` XX X ~ } } }  }!!!! !@!! !!! !!!! ! !! |40,($   e}  `}  [} V} Q} L}`@P`XX X ~XHؾ(.""&"T g."."."."."."/"'"Ƶ /"2!/"/"&/"+/"> 3/"8/"A/"^!J/"U/"? A;0S /A+ R 0S,0`Q \2 R Q,0 /H-QM`@Pop 0| |` *Q pPE E *Q:ǖ`G$$ 0|Qލf/"""`/"O-4M$\(P P< 00a;Px `B0`,p@PPd   {P  uPU@ P PY@T,P pP.   WI,P P(@$PT= WP   >I,P P @T,P%Y" `P#PX  0X  0\@P:P 43 03=4Ѝ (35 u/"|/"0H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \ \0O-MSXP` @ Z8*@p` `V3 P@PH V :QG TE?YP>@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N V"`Q V`FЍ7O-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ @\Y!V< WW\pG`5V/ WLH! pG)" `( P /Y YV W50 )\0!00 0000pG` V W! pG``0@ U:@`V W  P P@7@Ѝ (A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P pXp H"p(H-M`P @P pRW PP t-Q0# M<8 W 0 zZЍ/"/"O-,MP0 @ \pP(P  0p P P( `p P   0 p0P"L`  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'$!p 0!pth 0,ЍOL@W 0( u0,Ѝ/"."0"/"/",0"/"O-KMMPT@` p, pBNpZ  zpQ T  zpI =:pD W  P   * Q+DV42 0<p' P 9p!  t OP  x    @  0ppB N KߍۍxzWhRh@ p W 9p 46<@ H@KN x  DR   .0EP  yp P PX%|yp p.   pyp p"p  p `yp p  2/ 2/\ Lyp pW:Wm@`PpTP0P 1P!2y 2 -9pa PEu7lY mC ;!_"A @- @  Q UT  0D03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p 10 BSA-M `P+p@ Pۍ@@P `Y)P @///p@-MP A)`P: @"3 p1 0)``p0@ `ptl 0" wp@ `p Ѝp#=0"K0"]0"p0"0H-QU @p >}.h0Hx.0G-FM@>P+ pF`   V" P `Rhp F?y`> *D F?lR`Fߍi0H-@M@Q@8 @PoQ Q@Ѝ0ur #H-Q  RRP` 0[0"0"0"$ /Lo/0H-@QP  P t 0H-(M `Pp!@\ 0cPP pT !W:7 P(ЍiH-M `P@(  p  Q(`!Pp ( ``PЍ8i(iH-M P@` p |$ (PPqЍ:iA-M P`p@ b @ЍO-OMMQ PT@P Z @@Btp8T CPLHp`P+PL  P TLXP3LU ,V|0 px Hp{HpPpt`(xPLT`>p `GW@pxP X " `% P p ` @pFV`PL ` FVL`P  ( `L P  X @PPEq 3pOߍۍ88 @0$$ (0 00"0")"u)"*"G-MP"᠀@`P P 0PPe4p Q *P p 0PPT4p x` P d,4`,0@`P'@xPԑP   "P\P  P7 P .@T:A/,TЍ)"A-(M P @`Q &Pp(Ѝ0'x Bp 6pWtN   QD    RQ|@|  8  Q& X0Qx x: pPTPP8xPT 00"1"1"!A-@Mp @`P@   !U4 P$! U @0@Ѝi@iA-p@0G0lhp"PWP`R*)P lpbh `EpZV llp@-Ml`Q H 99p lh2" Ѝp&#G-vMM@ p+Pp U U``U`QQR ARj*Py(Q?`Zv $` r xqPm   Em? pc SP$  RR}RppuQ  RQ  RRn@ P !.  4uph Q s AR:Q*wP$0`P$R p7 P " ( RQ QP P) P  &P`vߍۍxP @@,PPP` V`P` `RP RNd% &5 qP m1P P*,E/F?0  0GpR^m  -0 ^p : $L 4ii@1".1"H-M 02Ѝp@- @0 Q*P`E``U`@ Tp pp@-MQ @P P R xЍp@Q4PPP' @)/$PU ` x@PU x@T `>P* P @T@ЍpQ/@-P@@@V@-P@@@VP/  [@#O-Mp(@@$@P>'P] @xP PpTpp`  0rp`pP :pP  lp- Q'P$ (`  ) Zp ) Rp  7/P$ Gp $#P 8p )@ЍK1"T1"fB@lB_1"O-M`P    Q4:  0Qp@T W pPP P    00 R :   q Ѝ@#H-M0 ЍgB@- M^ *@ @  0 Ѝ@-@J (@(@-@p  p p~B G-ZMP  x VY   ^ D   d`!.dZߍH#X#gB#ج#K-Pp@`:qQx™\ tr崀`T 0R ,0TQ q2x™`,p V:T 4` q#,P@T#5"1"1"O-MRpЍ@PU.* U 1p `p!W*P%W Q  PPT  0qpp T  }qpx1ppp"*"!G-MMRp @`0GP P Pp  pPPЍۍ PzTt P:&oTx R RQ TQ  p >P:  p@5"@-@A@U wp@-`V @@PpPX 0'$P 8L p@Tp5"@K-MP@p `$PH` " 0 `` 0  0  *@0`PHvH V  `0`8PG PK:j @   *@$O`(0p  d$O T LH0:HP[P hI 00RNHЍK$48{O  j@   4P 8P  @  * @  PdQ Phq $KO 00 xP<PPfH0p 4 1@28 1@,0 1@&4 80 348@P\i`  "0.p(ah`H/# OP hdP ЍKNЍWN 00D 8@??_2"~2"2"2"2"2"2"+3"l3"2"-"7"3"3"3"D3"3"3"g"A-MR @`  0Q 8p0 0S  R-  . 0P Q :  PN  0P Q:3 P 0 P:P 0 P;P 0 P  60P Q:Ѝ}  0xV4"6"6"H-@ P`p08 l A.\ 0/080L<c u`H])6"M6"@\A0H-@P P `Hi$ 8hhL0HIf6"6""H-MP@`p:P PP dp` D0 @Cp Ѝ,ЍH6 ЍH`B"6"K-P`p @Q$   P":A  P 3 @  P  0   P d &P  0$ ` KL :4 HKy K/4"V4"4"4"3"&4"p@-P`K@P D 0Q 0 pKpcSc sQ0S/080 dQ Q/ "A-M`@VP  0 ЍA褹0 8 H1 PЍ i >P P<P  0ЍA.t$L X a  00 @<&#4",O-YM`Р@R L@P@QP1P}PLPh @P  [p/$P  [8/!,/$/$ R 0 S  R 0 S zT0@  f T0apP8op (P   R?w s4,PIK8P`Pb dP KQ* [( RQ cR R SRcQh (> BP* 8P4(`  P [[ nF S ((!Q [[ (`8P4T00pS 5$ AR$) DQ&[ [d0S h`(`0R 2$$Q D  RKo<P[$ @PB8 `{48P4[   `DPx[ $ @P:24 zD[ 8P[,Q $ AQ:30$ @Pz:  7` xQ[ t40p0P + ` ,`  ` "4 `",` `P`  `[ :R $` VB `40pP4 `x,0P:$$ AP.+ P 40ps$ @P:8P6<40pDP40plP N h6`U  PppU R: 0pp,P P P P!  0p4P P",PP 4[P:P $P4 plP 4P0p `,0V:4 P,W$@P:9? 0ppP`DP ,Y $APM J0p 8P8P(P $ APx8P= `( /(40p[    ,W`DP $ APU<  40p P :, Z $ @P6:40pP[Q   L , < `4CP Y Y6 $ P@ S`P4P p`   $ ARQY 4P`C   40pP (` ,^ $ @P:(`0pt(`[   DPL)JP FK KhPZ p p8P_ (` Z C p PE %w@ }\P 0p7w/` ?0p(`2@P' S:" 07DdP $` k PPU P(` e0p(`.<(`P:!.C$P!+C$H! Nr / @<R8HND\XTPL@<< TD@ah p+ 0p yV $ AP 4(0pX  0@YߍP `0p(`%( 1Y2"g7"#7"6"cSc"7"27"Z7"C"C7"7"7"A-`@pPP P H PPP PxhPdP o   $AdA7"K-M`pP@P P 0ЍKpG ៽W:@Q Q ЍqW:<Q:Pp R:pP P p pXP H P   `    a: ov5P0q!A @4"4"4"H-` P@R :Tp `G0 HFpPd@ 0H7"H- pP9P @T `dPG0 H#HHQ \Q0 H0 H5"5"O-M@p xPU% `;U PQPUT P> R* WP(  0Ѝ::"p@-@PkU ``ca _(][`@xP P QQ|q n| |p ;p0H-M@H PX P  Rm (>P: ' P 0+' P P0    }ΥPZL @  +S00 @Ѝ0Ѝ0HzDA5"3O-M M @(P8|p< pH PUP P`i`H 0ȀpPp-@ ((q. `DQ& P(  1p| 6 @p3 pЍ ۍO  N>@tP([ @(((> *O (P >Q 0*< 0<   QpF  @L@4 @@ S! ` iP'   60 ;  (taP( (((1pt!c4 Ѝ ۍO] +PPp U$ WPP   >;@  50CP   $'P PP    cQ0S0SS 0 PcQP 0$P @Qi cQQSQcQ0p i P Py cQQtSQcPo l@TP LP P * `EP PP cQQ}SQcPx$OE L }  0<^@Qf k2c "\( P `PP  h dPh{0cSceSPcPhe    q.dd@? r 0 `0 P0R  $@ @@480 BAC0 48\ $D  4Ѝ ۍl0 X %R"]:"I"m:":":":":"ؾ(;":" w:"<";"*;"SDRi:"0H-@0 0PUhP00H3O-MP@pWQЍP PdPd  0Pd  P@Q P;8< h $Qhhd@ P  T Q $'<HHsP P P2D B`h0 |`{P P  0 Q 00S A AR:   `};"~2"e5""K-M@`p P P$PQ6C Di@P-  %PP y 0UP H<8(! H0 @Ѝ hh;""  @0H-M@0P Q  RU 1Ѝ0 \Ap@-M`P@\P Ѝp @P\ 0 Pphh`P TT@  @ pB"6" (6" 4G-AMM`@Q\P   p p 0 `V\PU  P $ eAލڍ"6" G-hM M TX pPP0`0@P  XV@p XX JU `kp T*hЍ ۍ"6"RQ:0AQQp,| Rp/O-M@P P x0P ЍT1P> R *dP   0ЍOLPQ Pf0 Q U 0S: @oB hDQ Hf0 Q UY 0S:  50P Q  Q P r P P  K a$P` Lp 0  0P_PI`VP6@G   60MPP<`4 @B ЍOO`0 0   01PP6V`VP l 0KPD P P= P @  02p 0   9P P  P P :iP 5@妾PP < <Q 1P PP  0,%`#JPK?0>] 0 QPP 0 C  P `  aQ ]iV 0o L4TP PPN  P `"PQ Q@ QUPL`@`$QDL   60_PC Q@:P<>h 0 P hh` 02 @ZP(   P0%PQY QP<`:   P0 P  :( 0 6 0  Q* !P A  :>!0ἽPO ( R x1@叽h!  RP*} P   k 0@㊽Pa p` H `哽\PPP8"98"]8"8"8"8"8"8"9"29"8"E9"" \9"9"9"9"w9"=9"-"RR9"8"8"8"O-IM \pP HLaP p` X! @QwP IߍOn P @at Pj ,0 60$@@/$ oR003p 40@!'P $ R ", R QP ,@$`%0S P?Z   `W @@ ` P?Z x@dX A P@0  IߍIߍO8"9" ^!9"9"9"H-M0080PP@UЍ`P  P  pd@0H-0M@: 0{P P ,,P    ,I? l wL 0P 0M90Ѝ0 :"0H-@, Pt !L 0H:" rR H-p@`PQ ^P P P( P H "HH3"&4"0H-@0 PvhLh0HBD;"0@Pop/A-`@ P:P qP@P fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-TMxPUp ࠠ P @Th$ ࠠPUY@ִ 㫶P P. $P* 8 P% 㖶` @oV V  P P < 0  # P  P@T  pP$p <`5#Sh0O P ptt1P`P+8P&dxQ XSh06 Y 2P `}@ V@ P `@@j `P5  < X5  < MdP  d P oP `d|@p |@d @ 9z εP$  ǵP" `8EPPe  pᲽ# | W ૵`P rpK $  P@ @p`@pmd8idXe ++p  }P ` ȴ|xp |h|dXHP [  \`PTЍ 0*딡#;"<"<"<"<"p@-PE P$ V@pH1P DP @P <P  ↼`V  R 0S `Vp0QP    U dPdh 0J;" ;";"{t"@-Q @b P  F<"G-M`@pP# PPPU4< P P p  PQnU`@MT  R PP ;00@ Po @JW$  `p㠠p;  0ᕻp  PP@ }P 88ɻ@ cЍ*"/<"m\ N<""<"K-M`pVo @P d$P R3( ,0 aP  h d J<PFPPU Ⓕ=hP dPHK0Q RQ PU( Q,Qh  XQhdP`PHpЍ`<"<"PP    Q/G-MPPU @ `xq 00  0 PTЍO- M0@< Rx!R ሼP PP p`PP"Y Y V' P PA 1 ЍV P PP1T= 0S; Q4P5 ` P` ` R:00@ Po V[P: `Y ЍO. `` ЍO膺*"<"@-P@TQ    P@ p@-P= `${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P p p//( /p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V w4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  `ử ᷭ8[ L= K4@P\@K X@! ,P  = (0,P $ HA[ i P ) 6 ` Z `<Ѝۍ , @P   ,P 8//("/ᘯ(H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P i((( 0000p@$/ /(/,/@-8@P R  0000$/ /(/,/O-MM``CP P R4|T Pq sP 0SA  "0S`P   AQ 2 000@:R#RP\@o"t `P @O  Pq 7TPq P Q ` QjPPpQ\Q PQA:Q @ὀ T\ `@: P90 ᤀ+  R :R|R   0v`P P ` d`PЍۍ00S\S000(/$/=! //(,/K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `,uluuuupqP%mRb0BS`,uluuuu:NR RR TR nR rR tR     @Ed P P EP P V  ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP   dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  P0/4/@-<@< P RP0/H/=" O-M8P R`$$r UZ  PK oA쑟` 〴P( p)[ ^PP  KP J Q   P Q  @P% PpPZЍp0 p+P ,P S 00P P P S0RS0H/0/I/&4/L/H-pS 8@ P ll@p@-@8P  PG@DP8`8PP p~TppD/0/H/4/0H- @ PPP [~P00/H/p@-@ P  P@DP8`8PP A~TppD/0/H/4/H-PD/@-@P@D/O- M`p[ pPP[@ @P! X P YP P[ X Q UP0@0``P }`P ЍD/0/H///////@-MPPP <4@ 0PЍp/x//@-<@< P PPp//=" O-M`Q<@8p PC[ V``P 8bo P8 0pZ ýP(P  PJ Q@oP iP  PJ Q  @P}} PpP) AP ;P 6P 1P +P %P$ :pPPЍ謦/p/&H-MP`@`pP0P  0p`=PPoPЍp/H-M(( 00;PЍx//K-M`p@PP  0p(`pPPooP@@pP |U@@Ѝ訦/p//0H- @ PPP |P0p//H-M(( 00;PЍx//K-M`p@PP  0p(`pPPooP@@pP Z|U@@Ѝ訦/p//H-P訦/@-@P@訦/H-@P`p "    H0H-M@6PT PP P Ѝ0 P@;T@P @@P rP (@Q$ 04/ӿ밦///A(1="9!O-,MM@P ,ЍۍRlE0,((  pΥ  %$5@ 8E,e$U/oP b(  P P P+p X( P P (((H@2Q6 <T|TTTTTT؈T8T@TTTTTTTTTTTTHTTTTTPXTTl(TtT0OAPL PN p娿3 7/B\?P;88AP2AP+(&!P@P@x P@XH`q(PIr(  Qj 2pR R0Pb0P@@`ņ`1 0`apAp 1`p`q1@qP"'>"Ԧ////((Ӧ/(Ҧ/Ѧ/Ц/<ئ////////ܦ///// /A/# /$/(/,/"` @-@4P*@=P @0 //O-M@`PMPV":<<F !,u  5 P*T@P+@fpW *P ` PP  `PWP:WP~ `V `PP Ѝ@$ 00p0 0W:S W 1BY `Zb W p劐1W X  P `|7JA J`F02[ ! [ :C:00:S B! 00P "% Y8 0 11R 1  P0#!gw F[02  ケ [ I1 01S ! 00P "P` PO:!p@P@pP  p@W I P `J J / `Y pI" `P' P᝼ ` @2@W@R 04/Լ@P`p& tUUUU3333/Ħ/ //Ȧ/̦//Ҧ/Ԧ// RNT C , Ѝ/̦/////O-M4P Ѝ $Cp 07/   #p07/ # 3c@ P2Rr"T` 2U06/"2b@ 0bPS2Rr"T` 2U06/rRbR PB1/! @6 1 A葟ءL 0"9!>" >"J"Ѧ/Ҧ/Ц/ " Q" !>"Ԧ//// „"\ "!>"/gfff!!>">"/>"ئ/>"/>"( ?" ?"G-Mpp W@@]P`AV`0TP pPW  @0: ߠp TP @00PP(PЍ$///D/@/Ȧ/H/0H-DPD? ?@ QQ00D/H/O-M " 0P! @o,@PQ$ ̑0`p@ ^qP@(`T:@|!t04/pPM dG@T* aDpG(1D(AP@T:T *倀Dp`G& D(8 P @T:ЍN///#Ħ/#/ئ/(O?"9!Ц// A/O- M`PA0@pq EWzO0pp@@ppPE@01 ES U0U0 S=0S:p $ ЍĦ/ /0SA/A/K-`P*?`P P PሷtPA    ((o!`X3%,P*A     # 388 0op8W` "2 08@ @0Q  R 0!pW- `G`oo `fTPD@2v'&p{4p P PH@HP( P @PP'  01pP:P`"pW*1 P0U `E`ooT0 `fD@F% 0@2&p@``C`; L 0 c03"  P R 0B0?o 0cD`T@p#"00& P0 R* pW 0G0?oD`T@ 0c'01& `VA` 㦶ܦ//ئ//(/(/Ȧ/Ҧ/Ԧ/A-P@T- `V p`@P@P`@V P p| p@ƠlP `P P` ^^/#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X  PUP P P,H Aq PV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R ```ЍTUUhL/A-M@``>Q$A QA X,,,4  ,, * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ $]?P^ {P=`0P*0,Q < (0VP 0 DQ* }R X g. `A $  $ zPh 0 @-0  @&0@  @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP  8 P  }RP P P* *0BS p`v P D {R P*$ЍL/(K-M @\Y  P:PH```JY0JIPAp DP/y`qPLP  O$  F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0Q @0 F @Q*\S{Q $YЍR`0Q* 0,R<Q*X :0VP  V RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n L/(@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A ЍL/O-4MP@Q * 3P2  -P/ @  {ZP  S00@i <P* ^R 8 P*]Q -Q- P &  ] d0  $ 4 Q }*x0]Sy  R*-S]P$i-S! [S'R%* =R9 :R Q:P ]R-RPP KjpPA*0-S=Q;* ]R8 -Q/-`.Q:P]P-PP=p PJ*Q* =R]Q P'`W Qw:\P_:WP WW w  ppQ PW YP 0!p`PxuQ*x50 `@V:P  #p p P> p WP PIF!  p`ŃPP !  p峃P !  `婃Py ?yQ:fP`6/P  u ,PuQQ`P XP 0  P\*P* :R]P  PP s P g r0p00B^NP  - Q|*]PwP{8 P 8< Q  P  0`0`&$PxiU `P P ] PS `P`` P PV`pP x P`{P'wP' w? (p P@;@@P  APt4Ѝ,PP  E@#4ЍOPP(p@" @"L/(0#D(((p@-(M@     pdrP(Ѝp@r`] N`(Ѝp(((p@-PPp@`Xa!EA(0S0"(0%P0S0"P0% q 0 !app@- S* @`PPP Q PP@ 0A U R  Q R    p(L/K-P@ S@SpP@ WW`P   PpGP P@xxxxxHxxxxxxPF 0v @ P!A># " P>   oPp  hPpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ Kf L/H-q`@PPQ  ,( VP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  D(L/((@-@ P*Q* [R .R. Q 2R1:QPP00.S ]RL/A-@X 2R1 :P`q0pSWp]W `00S:llpP PzP pPWVPL/#@"A-@TPPQ 801 ,P !(0# RR: -'R:0p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  c,0  X:  ` > R,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$ቃ,0P pKZ-p`P0 ,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$P,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:!,0P $PKP#RR>p&A Q       d   R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp                 Ll     \2 Q@  0p@ @P> @ X:} P7D  x  x>S 0ph `Rd\cA^^ p @ }|0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(D(((B"O-,MP`TQX PX p00'$@  D | @(@p-+R0H(@P`t    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q """"" "@!`!!R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp$p#p#$\%d%%%&p#p#p#p#p#p#p#p#p#('H''''p#p#p#p#p#8)2 Q@  0p@ @P> @ X:} P7 $)T)h))))T**>S 0ph `Rd\cA^^ p @ v0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(D(((B"O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0 -X-,------0.0.0.0.0.0.0.0.0.-- . .D.,,,.,,,,,M> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ D(((O-DM,(`0 4$    Dh  0lP\P  很 8P P X8l@Q$ ! ̌X <<(l@P  p usP@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ nrP@Q) (@[%P | w<@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍ(O-M8@S*P`  >#RR>p&A Q 6\9\966\9\96\9p7\9848T8R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp;D:D:;0<8<X<x<=D:D:D:D:D:D:D:D:D:=>X>>>D:D:D:D:D: @2 Q@  0p@ @P> @ X:} P7:@(@<@@@@(AA>S 0ph `Rd\cA^^ p @ p0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(D(((B"O-,MP`TQX PX p00'$@  D | @(@p-+R0CHDCDDDDDDtFtFtFtFtFtFtFtFtFDEE$E0ECCCECCCCC    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,ЍD(((///H- // //0H-HQT yD y , y y  y y  y y  xy sy  ly| gy d `yT [y 6Ѝ貃 # G  a ނ c hs 3 w  O-MPQ`@T &P p P P nPoPoPa@PThhhhhhhhhhhhhhLh  "P  PZ U PZ T PZ Uhp PZj UZ< PE ( ވP?  ؈P  ҈P  ̈PhZV U4 ྈP'  จP!  ಈP | ଈP h ঈPBZ6 UZ UZ UT13TTTT TTU  Ѝa A q Q   ^ b  : *  ~ p@-`M`@048<@D F?P@@@@:Z2 0P ɿp$ 0H 0p !p  㹿@p@@@3PH -P+P  㤿%P`ЍpO-DMMp@|"0B @ @!y8PB  " 0! <R5:0V/ `㶁t`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp HTE@P3/H%P  BP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻhOoO-MT2PXPPV@P" p PP. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@ P9P P 0P @PPP`PpPPP P# dstdayminsec̞,9 ~G x z |s 0}d L $ e e  G 5 – Y ~ g U ޗ 5Z ȿ \}0H-PzX @[p 㻳㸳㵳U:00at T0T0 P <  Q/0P  Q/ /%. %0H-|0|0 @ R@ P  0P @PU UPP@T0 0% H-H  P 0S !  P$p@-t0h0Q L F P0Q P`VP  p+H-PP @p PP `QeP`H-d`@`P p `P PQIPP<#H-d`@`P p `P PQ,PPX#O-M`'P6 PtP5 @p`P  P QP{  `RpPY W x ve`P Y```Ѝ跴 )/ H-P@Q p`P `Q,Q  FLdIK-MP@Q p`P `QQ4 Ѝ FQU& } pPp```}Yp!"PpW |Ql 07/Ѝ4Q$ HW 8 @-@ @O- M`pPP PPQPX @&PP 6P F H `PC `nPoPo@o`=NnP PPQ  P Q0  HQP S hN`P@P @ Ѝ  E O-MMpP@}` aP:mPq  aP /P P ㍰p [wPPk 1<0 ppppe =P| p0 pT `P{ `尒  `Pn  xP 0p  ṱpv N vxP$Z shE 0]p#  1h2||` Yh!s|`p Phk|P/ns Bh]|`X|` 5hp@@ >K|`Ѝۍ 0wp `P    0 `'|X  0  `ίzd@ Nk CB  E 6 Dk k j gE r o Ϸ H-M   0pЍH-M>   0pЍH-M?   0 p ЍH-M8  0RV pЍ- P  / d`H-E0H-@gPP :{? $  0(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(408 0@S4 0@P4*# 44P*``404 R*>(4 8 0BpS4  @P4*# 4 4 R*p4 @ P@p(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(04p8`@Q4 @P4*# 44P*4 Q@<84pA 4  4  P0R:X @4 Pj R*>0 9w04 R*#004  4 (P4 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  R4 $P: #  @P:  R*004  R4 P: #  @P   @4 QBLЍ%#jo%juH-M00^ЍH-MPЍsO-MR @ `pPJP/ >>>V \K V 帻P VVK ajY 塻P BB`qV 勻P >>>>||||AW vP nnnnT aT `P  AV JP T B T 3P hh p?@ hȠHČ pp`p P@ P @0( 0 000h 0 00P00

Pp\0` f`V2 Q1 p P @T,@\0  V 封LP:4P0psP   pW   Pp\0 H`P!!rAD |  ?p , @QPJD$A,pP @pCPA!X!F P ADX   P P峲U`,   X Aq P:P`P  `V    H`  HY `P R 0'ACH``PAD | !  K?p ,H PE U @D⼀d$[@\$D忹pWpC幹PCL岹PpUPC嬹@`H ᧹PCT@C H UT4``0`W`@ PP\ph4`pV,APF`D |  >p3 ,H PU@a @L`8PA PP VP`p Vd,PFA`D |  >p  d,H P U@a Q  `Q`800P \0P `䰝p,`KY \`B AXZA`@,pd @ T5   P P嘱U`,p  T డXP: PP  X    T0 `VEg\pW QD<   P @ST`,` W\[:P @㱫P^  @T  48qL` TAX@0ZG`,@di Y: d q PP @T`,@d YdడXP:TP@bP d [    8P0P `V4H`,ZI \`开 q, @HXJ@T6 Q  P `尰V`H`, Z X:\PX P  [   ,LPJ `唰p,`K U8UdgLpW5 dQ$   P @_T`,`d WdL[:P @㻪Ph d @T   0HYZh `l q, @K\X TT0TSdH`I@TA dQ(   P ` V`,d YdH`[: P\cP d Z     X@kߍ`@xS$SKtKp@-M ,,`(p@0p 0SЍpLC`Q/p RD D  <0($0 0S ?@H/ CA4BP/q RD @  80($0 0S ?AH/AADBP/p@-q RD  XT P 0P 0?#B0SP \H 0 Q ^,@PA@@`0D```PUh``@9pAd>p@-`T@PUPpPUf@pP>p@-PP`@PpյP=N@pH-Q$ H ?30000S 00840 SX0  | D0R 0R0 0S =<X<H-P$ H ?30000S |00840 SX0  | D0R  0R0 0S<; /`O-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`pl mTpn`PPD\ 8pЂT X0 0p`lmn Q s(   MЍ<:;;<;T;x;l;:;,<;:9(:::;d::::`:9:;9:\:A-MpPPFOPP J`P @ T  ``> /`*p㉧`zPY } pU ipP pQhPG  0PPPPP(P:  0PPP(P/ p+ $p'  0(P  'QGPP =P  P ^PpW Wp壬ᡬ@Ѝ2 $7p@-@ PP z^(`V (V`!@僬\偬Qp@x6A-MDQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0Ep!!QЍD3 p 11Q/G-M`pP+``(P Up㻳bPಳ3㺳࿳뀕P ^ >B<?^<v98#6:30'0#- #(H##p--_|o pbrvy/z{M|}9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0uD'0'>C 0( Pp Ѝ 2 g @-H-0' 0 ( Q訽(      /p-O-HZ p`Q "P !?>`APQ0H P P p @`v @@ KQ t p  `!>0@!Q QJ q" R R !0`Qq  0׮Q`Q 0 ɮpxAT `Ta  0 ᶮ`pdQa @ K. A7Z Q "P  P P p9 @D`vX @V@ KQ p(  `` ?>0 B!0 dp;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!S]Q)\('%T%#$HT #$H#O-M@0f  P`R`P vYp|0 R 6L Z 0 R )LPm E( $ x!R  Dlh<p$(OIP  KTCIP  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj S\HPd P``p$V <P>RPV3\(P P`@`p$V <P>R@PV @ ᖦ ᔦT [  r]PEQ i]P E W `]P~? @ pA `pP _P \[ P TP#  ZЍ\[  3]PP@Y+]PPPV "]PQ ]PP @Y ]PP P PV ]P(   R R ,!!p 0H-L@\PJ 8\PD q[Q08 QP@Q8 P  \P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@00P, M dM @-"TXl@000  |@' ,0d@@0XX00H<0 0@W$l(Q/  X/@p@-@P`` V PJpQ PPJPUDp@AO-MM@PP㪟PT M,P AqDD!D1 0prppp P 0 "pPU) aV Z W ,K wZpPHX`  0"`VpЍۍ ||<<<HI O-M@PQ PsPp8$Q  BQ   BQQ9&0 P "P  0 P 0`0Q 0`0(2`N  ojQ @8YLЍ Q  A AP ̡P o8<Q q Q Q) q-(p  P@ x!@@; C_P7P3 L'xp  <PJp LP  XYX X PO@`1{04@- (@:p @ @-@z:p @H-M0< R    ЍO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# Xp@P@DT P` 0"`Vp 0 "K-P`p Pp W PJpAP P QO-M`$P@ `QPLU VQ"V Pp ppp@ ^PhP LD8|  @[ }p] w  !>qP( PU hpD yp P wd U Xp8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ \]PPojPP xp|`Ѝ|| 0 UNQ|( ,  dTԱ8T ܲԲ,$> 8dHp@-P@p p@@ ]PLPojPP 0(Lp  @ H-PPQ oj@ S pP 00A  BD @@ H-PPQ oj@ S p֟P 00A  BC @x H-M@ R  0 Ѝ (Q/  T/\ p A-`q@P qpp借PB 㱛PG      papUqP U㑛P , Aq@ll0L 440 !M9 9 : 9  O-MXK ,  1!q1saqQ P `ƠV EP j W*  0sp Ws: W`D0H |-p ap W 0@ .ЍЍ@- (@'7p @X@-@7p @0H-(M$ P@ b(Ѝ00H-(M P@ U(Ѝ0p@-(MP D@6p `~ @(Ѝp(Ѝpp@-(MP@6p `j ,(Ѝp(ЍpH-M   ЍH-MT P ,00  ЍЍH-M P ,0 1 00 0 ЍЍ0H-MP h@6p T  ,0 P Ѝ0Ѝ00H-MP@k6p T  ,0 P Ѝ0Ѝ0(Q/6 ±@-D@@p lm$  PO-M   @LP RPP  PHPP Ѝ6*0lm0hF p 0  P, PЍ48@-@= @P l 0 \  /*4 ` 01SPPd@-@= @ P  l?:X01S6 ` PP8@-@= @ P o t Q 0OS*` PPXA-,A=~z@ P D _ZQ8 ``: P - P  08 PaQ 6 0po8PQ*P8` HPh@-@= @P  R  "+ 8 P"P$p@-@@PP%`= ` P   P  0oS*` PP p(P8<@8pTA-P=njPQ z@Q$  "+ 8 PP Q v@Q  ,-  @-`@=@Q [Q  ,-  A-P=njPQ ?z@Q$ @BK@8 PmP Q !@Q  ,-  T@-L@=@Q Q 0 .pG-`=P`Q @ Q+  @0p,@-PP@P@8 0pPP Q  @Q  ,-  H-4=P TH-4=P  H-@= @P  R):d@ `H  P t PpLpp pppPA-@= @P U R dP0@ȀplPdp<L 0pLl 4p0pP0sP@-P' @=@Q Q,@0A,@A1@0L 4P@@L0H-P5 P=@ PP  R0 T,  0P!, ! !0P!, ! ! @P0PL P0P00@-P' @=@Q Q,@0A,@A1@0L 4P@@H-M@ PUImQ DQZ QP1DQ?PP@DQ 0p  tP P05 0 }5:  < 0 0p5PqЍ,=P/ H-չH-L R ,PKLPH-P  Q PBP|( Rs3 / ( Ru3 /8 0S s3/,/* Ru3/l/*/4p@- M  P@ ` ```哉 `` `剉㧉 ぉ ЍpA- MRPQ =nj R Ѝ Ѝ PKA@PrUP Up! Q` ULDA@P p$ 0  BpR( qp|P  5P: 8  ~5@@ v5 Xp5G 0@P @*PTP Ѝ<(0ؒXA-Mb=`Pg A@PTP!   .Up`| PMp QP5PH@@PQQ  lQQ  a PJ  P0TЍp00 R/* P@@H0S 0PPht@(, dܐ̐0l@-4@@P$_TЎ@-(@@PLT褎0H-MP@ P,P ỉp PQ \  TLPP  Ѝ01/Ѝ0ht@<XH-M\P ЍHH    VTЍ輍|lH-M\P BT<  Q, 7TЍ@H-L= R ,PIPH-8  PP(H-4 , PIP@-P xQ |@Px@P @  34/*@PF@D/0H-P PQ @ Q Q00tQt0QL0Q 00  3F0|@-@ @P P P tPl P L  d3@E$ PPH-P" p8 v8P, (@0`P0``` 0CV@`V0PpW0H-P ^, 0( P@PPP 0UPAU^0P/0 S/,/p@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V P  B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pQ  R/, B0BR P/0H-^, 0( P@PPP 0UPAU^000H-^, 0( P@PPP 0UPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-QQ,0 (@0`P ``` V@`PF`VPQpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^, 0( P@PPP 0UPAU^0P/  9wP/0H-PX@tQT X0,P /*P / ,P ?:P A/,P /*P /p ,P ?:P 0/0,P /*P / 0P ?:P 0+/@-tP MpP @pQ 6@0tP a"t@*p0P /*P ,/@ R Q/*0S/ 0/,P P ./`P P #/H-<P P p H>H-@T& mpP @tQ C6Hk0tP |Q pPpp|PUw tH0 O- MPE ZCz P=S;p0R@P @pQ  KJ`p 0᎛PJTP  `FPG\P  J0  Ѝ @,P P /O-MPpW!  K`  0᫛* ႏP  0`埛p   0zPP ЍHp@- ]P >|P @`|`0@Vߔpx& @P@|0㝒P Q @XPPpD X|$pp@pApdpHpdp@-@ P P P`皔`0PVp@蒔G-P @?zPP  X `@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`npP `VO-M  Bp T P  [I`p 0KPBJ} [`Fp P bP P P(@ PJ JP Q P@U  NJ@W  A J@Z   M @ЍO-TM +p R TЍ]p!R @ 0 t0J4TЍOq.tATW |! BR8   P,`I 0TЍ € 1,` `VS@4p  xpʀY`t 0@ 00 0Sp pٚ t1 Q 0 0J+p ǚ YpG-` PPp ᾚ@AAP@Y ZXT  P@P ᩚQ4K-P pP2@_P+`P:yP$JupP $,M`V(%MV QX !`@pNpPV GpPV @pPHH-?Lp0 S @ 1  0  <PL 0H-@P  R"4坒P PUX P R 0P R 0 0R00|0z,x`Q Q QP ca0H/D  R/P@0?30Q/@ 0<( /P/0Q@?R/@0</Q/ R/Q/ >R/9R/p@-@@P?`-pS/p@-P?`@pH-h  0S QX @4  @8 R ($@ H-P RX0-@ 40 @ 80S 84@ Q O0H-@PU XTP@? @<8P@@'00H-@PP XTP@? @88P@@0p@-Px @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP \  X0m@ 0$`0 @ 80S@pp0H-PP @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@  !   08Q@ @00 P@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQ0H-@ PE 0H"h0H-@PR J 0 P  S mE 0H0H-P@aE 0H0H-@PQP J P  Q IE 0H0H-@ 8P`&p 6E 0H0<0H-@PP&p P J Q  P0E 0H0H-@P5&p  E 0H0p@-@ l`P &p V J P  V pD p@<O-MP`V7 p@IT( `㔀uI 0 ᜠ堀+ @D PT ` 0jpڔX ЍO-MP 0: @p`P@IU) 㔀5I 0 ᠀ PE `U  0'pڔX ЍO-MP9 p`P@HT( `㔀H 0 ᜠ堀 @D PT ` 0pڔX ЍH-M 0 0Ѝ蠾O-M@P0%p4 U2 p`HV)  㔀H 0 ᠀X `F @V 0ᗔpڔX ЍO-MP09 p@`PnHU(@ 㜐aH 0 ᤀ娐 PE `U @ 0VpڜY ЍO-4MP @,X0\ PaqQ @Q@ \ XHXPI @X0P{uPX @X`  TPT8`F  V P p `VTT8   =&P @X0 T P8  $X0p qX@T PPz 0 @T (0 pQ 0 Q  0|\Z Ua, D0|@0縀<p+ H L@ PE`FU`(0`   X0Q婔[CA[TQ8 X@Q h (0  `0S0 RPD|p HLPpP ( 0Ap Q0@ TP,X@p (0 P P X@ @ hdH0S #P0ᰱ`P:X`@@ PPu @`V@ @X0[P`F `F?PV P X0 Q/Q^  pW,PapD|P@pJ HL p!`W(0G Q R0T R 8 + $P ( 0@ pP0@ 1TP,0( 0A  4ЍQ`V4, , q LO-MP @pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,PEBp@㤰E 0ⰰ~ pG @W ڤ 0 `ὑpڤ[xj @Q _ T P 8 O Ѝ, X? @`忒xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q H|KLP/88!R!RQ@@/,P/48!R!RQ@@/P<Q/(!R@ ,@ /ᄯP/$!R@ ,@ /ᴯLP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/XP@/A-PP8@ `@Q Pp !fp 4P P@@般P40S \/A R QPT/8\ Q/A0SRPT /$  RP00T/ĬPP00T/0Q Q//0Q Q//ĬO-M@T Q lP\PHX P\T \ ARA `PhVTV[Z IQpI W @ Z+ Y  0@IYʔ ` 0!!7G W`Fp,0!PPPPPPP,!PJ ZQ`p,D |    SpM p`WQI P pIV 0!!L7`V,0 !PSPPPPP!,Z!p WPP`,D | 尡  p `PVЍP U 0@!PYP ЍH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A/P/P/P/P /P/P/(O-MPF @P H?A,0DP   p@Y*  Xaq | Pcp pW:0@   ЍЍ@-T0 0SQR,,r@  @ AIlIlI( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ ЍHTHL HGA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`U(`VpH-H  R <0Q0 RFFG-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $Ԡ4, O- M@(ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, PPl j,0 Pe ,Q4PY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`Ҍ| `[p 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/|p@-`@/P`*P0T0p$ R Q P8Uo%Pp<LG-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@舜Ě0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P aPU   VPUP0 P EP/8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(Pȗ0H-M @0P@0Ѝ0p@-MP @lP```Foo0 b` P `PЍpPlO-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP oDQ HHP `P$p(PPX`@p MpW ,[D 0`@P"0S  PPؔxH-M  @ 0Ѝ(P Q/H-M$000kЍԓO- MQ@R ЍP~P @~P, `jP0w 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp89P4D p}P= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R} !Ry$Rv RdQ8p# !@f8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0pW(`p@-X ]80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8pP:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMP@PQDЍl`hS`F@RN@^A@VL@`t0 L`SC 0 0RPPppP oRPB 0Ap0 pSPVPP( x b 1p 0 V` ,  [P P [Z x@  $P  0!P 0  Q:ꬌԋP/H-Mp@pQo :  tx 0P`a%PC9 D 0` FA/   Ѝ8(H-M 0  ЍO-TMP X0pW8  Q$0 I 0|  S S pJ0J$pp`S0p@Q Qx00CJ$00pQ@  $80@0808@8$80<808p080:0 {0r R  p$z WpPPtPPPp A R :X,@PPu@Xp p`,0p`G1```0pp 0`,p00C1@@@000 |0Q(PpPz WP,,p(P1uP8800 ,p`(0!p@@Q8@@@8 /8@8hP P _Pv P QTO`@   `0vS0U0U 0pW00 R9 ,0, qQP ,   P00D|H  p2 pLHpPvP",  A, 0000f  , ` 0XJX\0 PVJ AR , OP@P!, Q0 `  AX0$0 L R( & P$P P  `a P? `aJZ `$L(,௟X ,` 0PUUp OPR( @ R `p Q44 lP ڃq p0 @`, VT  0 0,X@0` P(P1 $V.(P)X P@ P   /`Af$(@3T P  QOX @ PQ P8 0p q @RQ,X/V$P . i P^ ,XW PR !QqQ`Q  Q@XV`@(, 0 ``V /  R@X,0DV     A,X0 ? :X  \ g8 8@  0W0G00 Q PPPWZ !R0СZT,  ZPPdPH @F  0|  0"p , 0F m 0P| Z P X/ L P <X @($ (/   @@TD, Q o ` d p QU @T" 0Pu X@pP1, D0GUV pp p A B O@ & 0P\ @u,P  Pn d@Q / PP($Kb @T ]@TlPP PdP 4/ Pn / bQH @pP`,WT   0Y @Q?@@tQ8, Q P3, p0q0ppspP'Q!E괂9P]p`@J,UW   0@ / R5/"@Q0ڸQ<,Hp0X01!0 `p,pqPV$@T P`P @T`Pp,!00 b$HPy0 Y4, ~D00 IY) @!0 `@p,p qPV@T `pP @Tp`l, !0 ~ @0R,C0IX,p0!1 0`00&03 ,01p@`GP0qV& 0 !"t}03  @nh@(@p@<Ѝ~ 0 /, @BQB!00PpT}p `P0@, @Q 0!@!F@V`V ~0$`0V'0@P(p}(!P@ U&TX @,,`pP Xp`p 0$`0@P UW  S0(p00 Q 0吭0 p|| Pl! @!,Q0D p P DP EP& |p Pp` ` VpP L D0|0p̈ pPx U $z{zzdy U :qxpD! $P= 0Q@P L@T.p R! ,0 0 SR ` R  ,0 0 S,,!,1] 0 071mLomHlm,mll8k,jk|8 Dkip iXh|ihh(iff kkhi`dHdbabaeb`,ee_xcdPCAT m j44@@$TAWgP ` lP PG@T*lP  PZP  PCAtPJPP  [-FVf@P`  [PJKxPP PCAEU@PP  @   TPZDP> 8up4@P9$e`  v @pPUG/@TPP ^PCA| 8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P   P PCA 4Wf D@# D @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp1$8I G Fl xtd|FTGtFPXD8  |dP@8D4$0 tLhX8BpBp\<0||H$P@@xlDX<4,hH-LP @ 88 PC B: x8 RDQ/lP h%R!R/!Rt%RQ/< P/H<G- 80SDpWlUUhUUQU  xğx@ S `< P\lT`1ppp0v4DP@\0``` $  P # ' 0 p@0@lP h0P0P0P   0 00'ΠTʌ Pʝp ,T,(PHJr |\ R```ǡP?R``o`ǡP8Ro``aǡP1Ro&`bǡP+Rg2``cǡP$Rg>`ocǡPRogJ``dPR/'V /% P   pppp` R R /*P`p`P0p W1/+P0#'1qa0( x1p`Z0 0 PP! TqH  Z% PP H 1\0 H @,PP U !T``` `  R00QUtUUUU 5S t0Q%<;:::996D8<A-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1oj'NJ Pr`"qpWpr`V  0d6 66O-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pWx535@-^:J00`0S4'>:00?:0S0C^@1,0 0(0AS@1,0 0(3p@-M@P)J\ R ڌP v`P!lP0ok Pr`l R -P 0 0 @ LЍp220@-\JP\@ T،r@L@@v 2H-  0S h0/+0 #''.*8P , 10|L<H-8!?: 0S%0@S 14 (400AS 14 (40 0 00S `0/+0#''> :8P , 0p///G-" R t" @  " \R@P P hP9 P{'r"QJpP p! g @1@q Pᴖ ql! P  QEZ8'QJr0"<p(P p! / @1@qPᴆ q   r"Q ]=  q l  ` f@0@-D/. -\-8.--@,|,X- ,+x+0H-xP@PPPTP <  0@@0,,++/,0H-h@ Q pP QpP U  P)0+0H-@ Q pP QpP U  P00H-$@GpP0+0H-@>pP0@-  0 S QPSZ\^@, T@@@!\@@@@ 4*@-0P RQSZ\^@,0T@@@1\ @@@@0p@-P0SpP ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA````(O-Mxx#p X  Y cpPCZ @P@P0DUEp ЍO` F@P pppTT8  =,!!g1Rv`@ @Z}0 @00(@P0S0jP@`p' U!` P @hT D|_pN HPEU KPE[*Pp?P P尡 : @`@bP+ P `VP Z 0p`!pp 0p B Q( 0A pQ 0@;pЍpp | '0H-@ ,Pp 0H 0$0H-@Pp 0H0 4$  $O-TMP" `Qo pWoPC[ RbP @P G PPR0@[gTЍP$0 A pR? 0` L  $op WpCI 吇(+$P @ P TU8  P PP P P PXppH$pnPCK $nPC P  Q$`$P@$V`FnPCYIKP3 @Q! ||h n@H$pPuT@CEt!)+ $$`nPC  APQ J $ ,(pQ1@P0W1Pu p@W1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PP P( A Q PQ p}fTЍ X#!0H-@ 0P p  0Hn00H-@Pp  0H`0p@-P 4@`p  p@Mpd0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>P [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr P P@7/@DT PH`DpP PPЍP qpP@7/@DT 00`B/P[^  Q H-M0 R!R Q L ЍH/ $ R p\xH-M<<000 0ЍH-M0@@ (Ѝ0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0<D(XA-M@Q,@PA P0 @z1 2"!1K`p@pA% a!a @ paYP `V $Pp`Vp fPFP@ @Ѝ赁N04 A-M @ R  $ P? P0 "1 2" 0C`p@pA ?> @paP `V $Pp`Vp nPPOЍkL \ A-MPQA@PPX `_0 0H!2" @ pA0p$4|q@Ap " a@qP* aV$ @T $P pp@T WsP P`V X PU Qv`PЍ-?L*Sp 0 O-DM4lP]Pw $4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1  806084U<%%!1KP@%A % a!a@pQ `P = P P4pq`o1 80/84T<%% @ 0A0P$\4@$A #" a@QP8  P01 R  80/8PS<%% 0CP@<#A ?>@pQ `P g ` P2   PP.  ~P*  xP& | rP" h lP T fP @ `P , ZP P   ! Y P P P`P=T ,@ t @Y  t@V ,b@ ,=pG w P`Q6@tP@t@DЍV aDЍ-?L*SkLN h - : A p0 ; @ @ @ Y O- M` T\P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` 0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ PL`Y @ $<p zr/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*  0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0,O-Mp@`PDpQ$ %QpPp1@ Q:PsPplP T TX  @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ Y<[ 00@4@PpYP, 0pp$P\ PJ PQ$ %QpPP1@ Q:'sPPlP Z Z 0@Z @8PH* T p@T` Q Rc ,Pd  4 @ `@%T TP`%V `40 P:,P]PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @   pP&FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo;@ Z4 0 pP*,P W,`S[P 4,0` 0ȥpp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP &PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 p6Ppp2@or.Ppp*PWpp$pp!p W _ppP}P}PA+~V OQ  p OPq  P %A@Q" OQ}a ARI/A AR @40 P*,P _,`ZPY 4,0`T @4 @ APT:%Q Q    ;R ?R eRP P @Z ,pYP 4,0p  0Hp444,  ,ppsߍH MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//HK-Mp`PQ`G`P# P Wp PpYP  @TpT Q# X+kX)X! T tXX P XE X9 X6 Ѝ  KpP Q  (P P  㢂p(P  㖂pXЍ<4ఴ, ᫴ht@ # # # " (" # ?" l @-M0S H@P - ЍA-P`P p N@~ZT  DpWXP RP LP FP @P |:P 0AU! j *! ! ! O- MM *pP /P  0 ЍۍOP= Q/Q9 IP6 @`ZV.=`P& @YT  Pp  0`YM V Wg@? P$ @P`t@:PUppGTP:PW g U g  0PF]P P9 P 0 ZP 0FP% @P@`t@:PppGTP:PW g U gq  0PF"P P Ѝۍ蜛\  1 #   \ ) O-MR `@P pP %~%WP P  m!WP  cP a VP  GP ^WP   rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P  $P`P PR X$POX$ lVP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ e`ЍG-MtPp!` 0 PN4#@PCpP+ Qu#@P   0~$p pR$Ѝ P 0<$P  0pP  Pp p ܓH-@`P! V Z PP`P |P p@U oQW8 U oO-$MP@  PP,PRP  ``WPF p|P  刣P  Pt @@P,P `QP  P`^  ZoP p@UPg  FMW p[GW P pPPWP PX P `(, (, PpW< 岰P`VZ`VJ $ X @TP LUP $PyQP ( $@X㰰( ( `P~@IVC$~PV@L@@PDPTHPLP3 Pp`sV nV fV    P &  0qP @T pV $Ѝ,v3   A-@P P|``P,P PPP  pPt pa M A-@p P`UP TPPPP !Vpఀ  O-M` 8P. LpW @@fP@pW P Pr @sP nP P@@ PZ  0|y pW: 0Po4sY nY fY  P H DPUP @TP'@P#APP H @DP pH@HH@sY H  nY fY,H (@0H0%P' ,Q0@H <P00@H 0ఀH @ H  HH @HHLPLЍt )  0H-@ PUP S0OP!0@- \ s\ 0@T sR nR fR 0S00WA- pW `@`pW P `P sP nP fP` P`/`M0H-M@P 0" ^Ѝ0HЍ/K-P p@P x @P s `( `8 H0]OP*  `pQ`   p@Q  p岐Q   pP @p @,@P ,(` @ `<@P <8`0@ `L@P L@HP@ yPA@-0@@@@ @@0 @DS  @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B dA-@p `PVP mRP!PNP A pP   H-@`PpWP 8RPPfNP `  P  O-DMp @ P  ,P ^P00\P00 PII|AP|@P@! P\P:  DЍZ  P:  0 T  P: 0cPPIQP `< P`P,PMPH  P]<`TP#Z4 @ P@ ` ,P= ^P00\P00 P`F2``P,PMP  P#<`P aP S<@SSS@SS S0SSq `FYP S8Zd Pc #0P< P @ppp Z <8,P < R  0 S P @ czP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @L80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p! <0PP Yz0R < @O Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p <0PP84 PUR <0O @pPePPЍ0kL 0!S/7 0H-M@~0  2" @ PA0P$4\lP@APH " aP@0PPЍ0-?L*S { 0H-0M@PRP 0Ѝ0`P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,6P | p` `Q  (W|`pQ  P|37`2`F``hpTppo@-P @NN N N$ N,NN(Qnn/nQ/n Q R/$ R R 0S/0 0S 0ˀS0000 M <@$0pPT/Q R/$ R R 0S/0 0S 0ˀS0000 M,04 <@$0pPT/K-@P P P $ RpWPHP`q&0V`v`fVP8Q(P(` (2/8 (` P $PP QQ @R 0 ) /+ 0 M,@0@4@ @@@@<@@@$@@0pPTH-`R @1P8S T, 0PS(00 0$.*P$(3/P `p8`@ jP P$ (2/`谸H-PQ @1P8R T+ 0S(00 0$.*P$(3/P P`8P@ +P p$ (2/P贷H-^ 0S$0S\ 0Sd00SQ q Q@0 ^<@<<@O-lM@Tph P $P[hPlЍ-P T/ R R \ /+ @ / M/+(  A?04 \ ?< /P0p$ t , X <@` p 8D   P\pDppH < 00LTtX`P R!\|,<L0d< H dp $L@ <  Pf `PV*U 0EV*S  `PEV *`PU X EV*R `PE`PV`PV `P! V*`0S]  CV*R  CVR  CVR 0C`0`9V`PU4  EV*Ry  EVRp  EV P`V*`PU 0EV(*S  PE#`l`P Q?:P`$`0Q`P A p w:lX(, Pp PAW P <L Q? XTp`PP`lPL` PD V*0` PV p`F0pS:L `^ XN\ U Qu V`0S 0CV*S  `0V 0CS  `0V 0C~S  ``@`w  `PX`P VL7`Py !P28B`?P`P C? PXU ` U PUPU`   P` p`T AP`@PJL\pv `PYQ? LP`F? lP<dh\ Uy*XP 0V* `` V `F 10P:``QP@9lPPLQ Q) P*V `F P:99@ઑ@( P*V `F P:90@U !0CP0 P*V `F P:99@ઓ @P 0Sd,00PQlP``LP`U:P X(p,Pp P`$`0 ` `PP <` >H? 9`0P  Pp8"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PEꐵP$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  H0Tp?? `PHp  \kT\`0pV aHp  \[T\`0Vd V)dHPed `pHTp P00C\ Q  LTTp HP)ed d `p'Tp`ꮻ H` TpL` ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P E Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@` ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1Q `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#`T M P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PNʲ X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `p|Tp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q  % " Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍC R,2 0S0S@@T:S@?LRl/@ <@010<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPThQ R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 v.*qMP  R@ :o=RTp B0pG 0P T0p YBp ( 8 R8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 F 4 O-  0@   ,QP @0Y 0  pWpW  h 0  LQP. IpY  G, QP @0 0 IPH  P- , R P0 @0  0pWpW   0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0vpWpW   0  LQQ0 p $0 00Q ,P Pg,P7   R!4pWpW   0  LQPI0 00 0  00 > 0q pWpW  N 0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ7$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z`b 800 00 1pp t l Bt lQ\ 0R8UP @Ch l\ pWpW~  ; 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\n pWpW   0  LQQQ P<V Vd  0p V LD  ptP\l$ pWpW  s 0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (Ѝx]Ѝ  <pp0  000  4pp0 00` pWpW   0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\^ pWpW   0  LQPQ(Ѝ\PQ;@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  - 0  LQW 8\ W p \`F P,\  C0V   0  B0s@ `R' , V&*<l@P 80Al0 lPP8 0 C, l@V`l l 08C,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l l P,R@ T@T 8  %, l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  5 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8  0(/+3/PP p/+p 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ ~L DD y !t 0 b $ 0 BP`kp@-P@P@T `@ QP P 0 0 "0pO-MKP tP tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCzl`\pWpW!  M 0 PAU PЍlP#Q.\ 0R8UP @CDplP\`V`V   0 @ATPPPQ/ \ 0PR8UP @C`l@\pWpW   0  LQPPP<<O- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC`l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\LpWpW   0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CiplP\`V`V  < 0 @ATPPPQ/ \ 0PR8UP @C6`l@\pWpW   0  LQPPvPt5 6O- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ /DB Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. A = G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" $Q G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" LP H-P! 0  @^   @`AQp#pP` pE  xO H-P! 0  @^   @`AQp#pP` pE  N @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/, U/ Q `2/ !!'XX X080b$0 ;0,+  ,   H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   \H- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p V4B F G O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@Pdp   H-P`p% P @`P$ T `h$@{$$o\ 8HTԉ? p@-P @Q pp PP `pP'\\D% P @@` Pp4pP- $nH-@P PQ  pP `pP&\\% P @@n`@`Y PmQ/ 0 S /Q/8 0 S //Q/di H-^ L0 SQ 00S P {& Q  0 S//᜿p@-@P PTQ p P ` PP&@p`Y Q $ 0 S/Q/ K-M@P, P`Q%V# Q   P ` p0TP S0\@ Pp LЍ蜾 e K-M@P' P`Q V!   p P x0x p0 P0`[@ Pp Ѝ(( (0; 0\뼽 Ҩ  j } P 0(  SQ 0S /%ԼH- R 00 S Ro舼 H- R 00 S Ro4M P 0L  SQ 0S  @/  PQ P ,00R  @/ Rꄻ A-M(@P PP  P:`P6 0 P- p P( P0 P  RQ"QD 0P PЍoK H-$"e H-P Q H88 80 0fz$$ $0 0gr2  *   2 H-P H 0 0t]  " @-@lY"P XS"HE<J"P 0H-@ P ` P  P P 00H00HAl8H-P 0 S 4  PQo" H-M  Ѝp@-P$$"!ཱུP `!p!( P @NN!P `!mpppP\!pLL L0M 0c ~~\~H~~~}}}m   H-M  ЍH-M   ЍH-M  Ѝ@-@T  R舵 /Q 0 S / !@ ! Q/ q3/@S"# Qr3/DP ,0 S0! 0/ሴP ,0 S0! 0/HP ,0 S0! 0/P ,0 S0! 0/ȳ0H- R x0P0U0A  t 30t00 0 T    t :@0耳p@- R! 0P0UpA 0t'P0``R  0T0   '('R@p0H- R |0P0U0A ! R 30t000!T   ! R :@0@0H- R |0P0U0A ! R 30t000!T   ! R :@0褱0H- R 40P0U 0A  U0H@00H- R |0P0U0A ! R 30t000!T   ! R :@0贰0H- R x0P0U0A  t 30t00 0 T    t :@0p@- R! 0P0UpA 0t'P0``R  0T0   '('R@p0H- R |0P0U0A ! R 30t000!T   ! R :@0خ0H- R 40P0U 0A  U0H@0<0H- R l0P0U0A   t  30t000UJ   t :@00H- R x0P0U0A $0t%(000R U J  $((%(R@0\0H- R d0P0U0A  U  0t000UJ  U@0Ĭ0H- R d0P0U0A  U  0t000UJ  U@0@0H- R 40P0U 0A U0H@0輫0H- R d0P0U0A  U  0t000UJ  U@0h0H- R l0P0U0A   t  30t000UJ   t :@00H- R x0P0U0A $0t%(000R U J  $((%(R@0X0H- R d0P0U0A  U  0t000UJ  U@00H- R 40P0U 0A U0H@0<P 0(  SQ 0S /0H-Q DP@PT0A  USSZ0$%o0訨0H-Q DP@PT0A  USSZ0$%o0D0H-Q DP@PT0A USSZ0$%o00H-Q DP@PT0A USSZ0$%o0|p@-M@`P``` ` `Qe(PQa +R 0R -R~  p9:p"P5FxQ PA f  ^  p:P"PL  n"p?"P P , P uЍpQH-$Y-`lllT0H- @0  Q@ PRP0 TQ @ R*0T300H- @0Q@ 0PTP0 R Q @$0T*0R30@-@ k0H-(M@P&* P0 P    P0QUx PwP vP HP(Ѝ0,, ,0 0RF Y T U j PH-P 0 0@TP0T`Q URSZPP!&oPH-NHlNTi8i /0 0CS/\/H- oH/K-`@Q p0 PCU pP<S p0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP`p,`>PX` P\ aP/Q PY (>Q (>Q $Qx PQq  Q&  Q@=R(  P R0!$PP"Q qR  PR "R $PP>Q  0 04u O- MpQo*0`QP@ QT "QM  \Q_" @SRH 0!Php|ePWeh_  \  Y  V @P ?+6 R 7 R P ?+7 R P#P P.0  4 T1?.! T 1 ?.!00 (R ) Ơ?1? .1  PW [* P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X\@P ЍX\@ 0 0$m O-IMp@ T'pP90PP4 <T<Tp T" TP! P`Ge P AQ @PZQ+[0A S2 1\@60@"Q3 6+Q0: 6-Q06 |60A P01:PaQlQsQeQ( PrQuQeQ(50@50 @P5"Q0(50 3/Pu E/F?PO 1A 4/Pa  E@ @Q p<Pl` >P"  7P  0P\PR PM -R-P >Rpp<pP> >P pPP4  0 0CS!  E/F?PP0P! `~EFP1A P4/ 0PP Q {PPIߍ< pPP (PP Q ภP[ PP P@GEF@PxT4"Q6 $"Q6 Pd\010 P'   {PO pPDH eP9< $0 A3/P  0@P 1a 6/P  aPVa  +P PXU E/F?``[P P~EF`1A `4/ 0`GPtruedatadictb   P@,Ȧm T?:D;d[  O-MPg`,@p? P$p F0f pW*0  0P7z  [  0 : p l@   Ѝ G-p0\WG@0uSČA0IS*V0 a0I S:00I S3'P `A0ES:a0E S:00E S%'pA0GS:a0G S:00G S'@A0DS:a0DS* `00D S'` 0000H-@@P 4P,P0P4P8P(P;"P5 0 ]P, P3*P "Q :Q  P  P x  0ppP pЍ,, ,0 0ML _  $ y 1yp@-M@004 R;P,S Q R& `V7 P)  0Q 4,A4P- A `ЍpQ 0j 0aЍp`Ѝphh h0 0ZTT T0y 0<< <0 0c ( 6 Y 5   H-4Q , 0A40Q H @@ @0 0ྺ(( (0 0ൺ i | a O-M@T*P `4P  p4P pP P Ѝ ЍOP HD `P <  *@P<Pe4P,Q\ @ pPX pP\ ݷP H¨PpWpWv  @ PW-  rP% P  P  P  2/P 4!T  R! P R ph N @ a pP^ ( pXTT!T1 0߹!1 0)׹!1 0ι 0 0Ź 0 0༹ 0 0㴹DD D0 0ૹ(wvu uTu!^ [ \tA v 4 E h D  h e  ( K-P: P`VA@V U1U144P pP' 5 , !$ ,,P  Q,Q 0S p( pQDD D0! 06,, ,07 0-qm  I [ @-@@~H-H|,p7T7H-$٣<7H7p◶ᔶp@-@P ``QPKP Q < `R4 Q ,a5p`` `0 0̸LL L0 0)ĸ88 80 0໸4pż * e  E l 0H-@P P H  Q< 0H 0 0o l } @-@DP*5 0 0zX5} H- Q 8H 0  0d% |n@o/K-S, `pP@V  cP u P,Q 0Ke^ \  01 0#! $ B H-Pp?@P `, W  /P  `᭬`, 4mH-P@`P oop, WP@P @lH-P@`P oop,WP@P @(lH-PP@pQPP T@ p`P  @PpkA-@P PQ P`@V pPW P  P*PP (`@P LkjQ/ 0 S /hjQ/ 0 S/ PQ 1/`@MUPP>  2/P T 4/*UPpPp# T 4/U. 1/Gߍ 0 0` 0 0Xxx x0 0P|| |0 0Hhh h0 0@TT T0 08 J * R ʛ a + P/ O-KMP( @p$TQ QFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( tP Qq $q(QQ T JI/0P @J_Io($  2/ 0PKߍ 0# 0஭낙  //@-@@Q0H- R PP @Q~P  ,  @00XX X0 09|DD D0 0:t00 00 0;l럙 ڙ  _ 0H- R @PrP  R00G-MPP*@PlЂp/W5`x (08<<bp\W W  0o<P `p[PX Ptpnpfprp\KPH FPC @QC >P; @;Q <Q >Q&1`P. g&Q&&`P# a P mP p &`P l P tP ;P`Ѝ` 0 0㓬 0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H 0 0I p@-@P1*`PPQP& `pcPP P<YPP /SP P `pIP P>p@@p 0E 0֫ H-@PP*`P%PQG P ppP> P QP,PQP0 `p PP) P%<PP P `pP P/P >HppP P 0 0Yu냑  A-`PY P @TT pQQPM  lPC W` p 4/P5  P0 P" P( `)@<pP P  P  P @L P  zP`ˑ @:' :K-MPP @2pUPQ. p&  Q:?` ꯬`㫬P맬Pۍ!1 X 0zp  `P 2p `  wp pMpp`P`uP #W `mPצP @Q/Q /Q @P*U @U P/Q A`lP`1 p *istX/.plXXXX kj/A-`@PpP P P @*QrP@ LL L0 0BJ 0 0A@뉎 Î Ў  @-AT \ T'@QARS ^ DQ B@R S ^   0 0Z뉍 % 1 G-(M@RPU tP0  ` p  8P PT(Ѝ8z |     /     / 2/ / /     / 2/ / /     /K-(M@PP `P TᏥ$P-P (Ѝ(ЍK* 0  B0  ppZ P QPT T (Ѝz Q   /@-@T p00 @-@P @-@PH-P 㚪@BH-P ㏪BH-P ㄪAH-P yAH-P nAH-P cdAH-P X8AH-P M AH-P B@H-P 7@@-?^ ʎ ! 0@T 0 @S^ 0@T 0 ^# O$-A(? b  @0   / //@-@P 1/p@-`H@PP ֩ pP pp0?/H-P 㿩->H-y5H-P 㱩>@o//0H-MP@p 8 PЍ0 0 0;vt( _ f @-M@p L qpЍ 0 0;wt@ 6 0H-MP@p U U UЍ0DD D0 0:٧U Ѝ0t b @-@p 0 @s 0 08㺧^t  0H-@PP $@(@0 0 07㤧i O 0H-@PP (@0 0 07㐧a 0H-@PP $@0 0 07|[ @-@P X A    0 0;]) ` 3 @-@P ( 0 07J(# \ @-@P $ 0 077$! Z R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pj800 @  0  /UUUU3333  0H-@PQj   @  Q d8@HHPHXHtH|Hpc? b Aa-lswr  - w-! Q -QxsSr - w-  Q -QxsSr - w-  Q -QxtT    0 0 09Х  ] G-PB 㭎P) pJP6  p P.*@籎`qPqP`@pW   P =Pᚎ1Up@qPT 0 0>}~ ~ 40H-M4"424R 0PPHD@P< 80*  @po  ڦp ttd PP|PxPap \PXPPTPPP P\UoBK 㳦 㯦?@QPN-P-d-0p-떏8 0  Pᢏ<-U P L@ spP L w sd L@Ѝ0qn \2 00D2O-MP@P T D "P fpXsЍ`P+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0@I" 0" 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?Bkz ez pz _00/O-MP@P T D "P ¥pXsЍ`XP+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0M@I" 0~ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?㞣kw w w _p@-M($`P4@`P 08PpЍp-O- M80`<4P P@]:@p[c WpVpT D#P:PC`D0  @P `P Q < 80 Y*P" S*P"PPPV < 80W Y: S3P@ P  Ѝ@@ @0 0K(( (0 0Mu 8v Cv u v u |A-MdP`dp@|@@` R |0RЍTM tC,*o p@-M(0@,4PP`pЍpO-MP@P HU P[ LXh#  T`E@T pPK"P G"D" oPi b ARE0!X    t            $w t!'/w '%w u'*w z wTp'!w qPQ( xQ*Q@  D  0L j0 Q)! P! ,!` L0w1Ѝ P   @`DpL0 V    Ѝdd d0 0 6LL L0 0044 40 0* r Wr ar q 3r Jr q r 2r )ou s Ds s ( 9  /mNAH</O-MP0`Q S U Y S + @T@@ лЋP VP` 0싟ػ + 0@@@PP Z@ TT QT P-PZ4 4`$ pP+P -Pp 0j `@v/ 䪟 z PJ @ F Q FQ`@6iX\ P p0 R ``e 0SAA@ i`ĩ z YA J @@ EQ EQ@hX\ P 0Q R``k 0SqQPq4 PkH@( 䈟丟B  ``Xq q@-ZPP PE =WPPu `@vp:Z P+@opA0 P WZ;Q :Q0( Q ,PP:P=?v` ЍЧ z GY@ J pE ;EQ 5EQEUhX^\Y P 0Q R``k 0SAQPA W`PU @ppPU  ᢝP<PE t  0S 0S Q@Z2 LPZ :PV , P50% BpP @@TPPa@00t RP)S' ` @P:PKQ 8-P+P]X8P :P ?+ @R[SG 0O:PDD#P :PaW@@T N#P :P|-P+P::Q :P?P!30| PpP  P@P@< `P:PZQ 30 # A-P+PPW0``!@\1_ 0%0SU88!@41 00UK!@1a 0 0Y@ @0 00S6 @0 00+\ 0r 0 0ߞ00!01 0֞Teg g g 5g mg g g 9g Lg f 9g g f g f l%@&H$#! tMf f f 4"llܽ# 4#pXXH$T@( S 8, aO ! UN P!T q عȹ)f f jf ȷ LR X(AP M dlgQ K-@PQ T 4P+ ,,00 P!-Q ``pWp% -W -pR)"2 0 xpW "` p`::W 1\b-p``-㵐P pᯐP! :Q1Q `:P $$ P>a" 1 `0P?PP:P lP a< 80,.  $$:P:P ?PP @ 0DD D0 0R㲝T?(( (0 0S㨝6"b kb a a Cb Gb Ȱlh5 @4Y  $c x I دԯU خb @-@P  @  0 0/oa a ܪ @-@P @A 0 0/[a a a H-MP`QP3@P AP p 0PP 0PP PP5P ` PP꿞`P깞`P岞`Ѝ\A-@ ` 0Q pS P1Q*P pE⯝ Pp pAWp  k Q! H-Q Q Q+s$ 0 0㧜sAQ\T 0 0㑜Ϡq  0 R1 R010 <_ _ _ [_ _ _ H-! X-l0 X<Lp@-@P`P o 0p@M 0 04o^ ^  @-@P  0@M 0 0AYB^ ^ p 0H-@PP o ;0HM 0 06@,^ ^^  @-M@P  0kPЍ 0 00$] ,^ 0^ 0 H-P@P pŒ0UaU V`q4 0 0/] ]  A-@`pQ PTPPT jP  0PT 8PP 2PL a`P< QQ `EQ `2 "=0503! 20.0,0*0(0&0$ 0" 0 0 0 0 0 0〙TWX 0 0uO0000x  `2(lpT  چ4P8ЍCU U U lU U U X X  X X X X X X X X X Y X Y Y /Y DY V H-M[Ѝ@-M@@PЍO-MM`p PV W ДZ ؄Y %u@p0  Q(,048<(  0$岑P @劑 t@]Q PE,@c@<<D* PA P>hPW Z Y t@ ;$UP9tP6 0 p6T x0 wp-xp+PPs T | qg@ 0@!@,PЍۍB L@@HH#H3 0ipWS,,#,3 0jfJ#3 0k]D"2 0lT>"2z 0JZt"2{ 0?Yk"2 0_5b|EPJ@pڄpT7p|1pPLAxZ|X~p P$tP!rP" mPt$AQ@@/!0P0 @ 02tp l/P/PPT LL HX X,! (! 1 0   07 c_T T T 7T T oT T yT [T S UT z Š RbSV S hV S S L {J L J SJ K J /J K wJ J K 8P MQ BP 4P O O EM N M 6M ,cM @-M@@PЍG-PMԁ`PpVLG UO pZU x@Y[ !w,pp0  $ $(  0@,P @ L4@t@Q $q,p܂p 0@@LPPЍ? 0 0FUtt t0 0<\\ \0 03DD D0 0*G H G G G G kG G G GG G ol d@-@P  @  0 0~F -G 3G K-M⼑@Pp T^ 㬕W W&U```U` 0 p`P:JWPW p ڲp)a/$\@ X@ pp pJ0P @ P?#PЍ> 0 0㐔D fE SE K-(M@PP. U6 T? Dp$p pppp 0 pp&P`V  0@6P `Vpp(Ѝtt t0 0LUXX X0] 0AT88 80^ 06C hD lD C  TF  - 0P PU  PRK  - 0P ㋅P  0` rOp Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P.!P/ @P/P  P  0 !!PQ @PQP  Pp  0 `   :-P +P&TP- @P,T"` 0*TP! @P3T"` 0` ᦏo `嗏oXP p x XP! - 0P}P `K@X PߍV< tt t0 0XX X0 01ݑT<< <0 0ґ7: ; ; : ; : 9 `; : 8 @- MT@@    ! 0 0z Q Ѝ<(O-U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35śmԪ њp@-<`P@`(00 @p@0H-M@P 0PX@X P@ PЍ0 0 03わ4 4 v i:p@-(M`P  00 0 @PP@@Q d`$P @N 0`@P(Ѝp 0 0BO4 >4 Gn 4 O-dMRXP` Y 0p`@" F `@uZz  0@@Pi ,P` p ꩐  0@`PP tP& X?   0 :@P,0@@pf  @L``bc <pdc gPb!5_|Pb!cQ fQH00gQ%P3?gQ%b!0`1 Pf1#0-5_f1#gq 0=pa1`1#PP0`1#5_fa0=`b1a1#P P0a1#5_`g1b1#$P0b1#5_a f1P(Pg1#05_g1#b! -,0PP`!f!" 3?0f!"g1 -00pa!`!" 3?0f1`!" e1a1#4`0a1#6o`-g1t`8`e1# 06oe1#a b1<@g1#0`4og1#eA0@=@.P`1b1# @$` `$0OgAb1#0pp`=`p)@a1`1#p' p'0xϠ`1#b! - |`pp e1`+a1#`&p&0oa1#` 0c h p p"p'4`da'ea&`pea&a@p't  p'/'.od `dq8` `.`&&hqdq'/eap'p /}@ xaq` cq'`&o&Ph!p' -0Ppp P`n!p'_'opPPl"d!a!"`c1`%o&& " ?-o D`da0(`xl1d1#@&dP0#O$$Oa|l0@bA` nA$o&o&l@$ @tp`p`p!d''i cb 쿠nq ~ p$`'o&&caP(h  ! $ b  ! A-MЀPpU" W)$pP ` V@"2  0d@p (PЍn/p(( (0 0FW Q oO-GMMR@P@PjJD@u` ኻpZ xp|X 0}qG W+  RUA_⠰ W+  RL@P  WpW EPAPPT@P(JY)P AOU T p"2  0g@p  @( ͹LP@Pǹ0PP@PGߍۍ./,mH-M  0kЍA-xM耟`pPVt) @4 @W)IpP `P  U@"2  0d@p (tPxЍ.p 0 0$ꔯ  wl@- @ 0@@P#EgܺvT2G-`P@!?00@`pZ!W(  D zxpP  px p@P@pPO-lM@P `0p%(    e+$\0 "0 b)d; $p0#p08 e;`{" `ekp'pgzd{bk#`&`Pd[X` `m@@`kc['` P%` P@@b g[&b+P% ,c+f[ c;P%0;L@ @g;`["g{P%p$PzD@fKb{#fkp'py(`kc{$` p'` dP,Pb d{&b+p' (0c+f{ c;4PP'0hc=4d[`;"dK0#0<8pf;bK%fk@$`<k,`ek#` @&` bˀ `Hbc O  e X e+n ac l+c; 0  b,n+hP0`;n[0P009l;PpmvmzA-MhP@? @p !yP:y&`lЍ 0 0HH| 9 6 RRR(RQH-M @btaP@P`P@U Q * P, bP PЍP b`P  bPP!p?pP& PV-PV+P`  MQ QPJP+Q`P!EPP#P+Ď s}?QL Q 0 !R/?Q ? 0R/Q /, @>R/Ȍ0H-MP @,}P*JDU ?P :9}?P:3}p  P0 D  P0  |Ѝ0X(/ Mp@-M@|`0T` P P  P J 0` 0 PP  @@`Q Ѝp@ Ѝ/NM#MiUP0H-@PP^ I \ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0 0 0bzt O-LMPP @<8400 ֯{`y ͯD D$$@H|@F|PD0@G0 ppPaIQ+  T`8 ' (8] 0 ez =+IP} =YP|0 ` 0D0P`X@ PISp  @\* p- p @1I? GP;#GP<#|#0I0PpH 0H i#{{PDH0 @D  }D=Y@+Y @V \*p"H  H9#]{[{PDH@Dp\$ WXD\P:H H`#@7{@5{PDH @D:$4] 0 @y Sp=Y[ p@*=Y\* p@H pH@"{zPxDH 0 @p@D  DV \* p@ pGp%H Hp"zzPDH @ Dp@G\ WXD0YV ,YPyz) zH cPH@zT "PP : U*D@T* z@ o|z@LЍwz  K"`oz`mzPD @@D@TH + - P XA X+- 0p P 0UP0V`0@+TXTP`@@`@+T XT -T@`P@@`P@-T AATDD D0 0]yxDD D0 0opxX S V D  B 2 H-P`p@PY WW/XGQQ <<<<<<<<<<<<<<x<<<<<<<x<<<<<xVp & +W-WVp=U -U +U=W  ,V-  @+p 0 0]w S V 0H-M@PP  0P@VpЍ0 0 0:w ) P/H-0xP//// /  / ,  //// /   0/   $0(,/A-M@PPU T] `pP- ԁ@P Ta떭p PP PbrP 3 `xPaP `7߽ 圬嚬xPЍi3 p劬 P@Q Ѝ 0 0'wTll l0 0w \PPP P0 0 `p:ɭv υ N } h { ;o) LLEHEH-`P@eip+|iP W 0`㨬PZrjpp WpP   幬p ʷPbxP\xP`?Ov]7p@-`P@`V `VrPP 㼬+Ppp@賬P 㬬p@ݫp8CG-M@pP 0R TZ P `P* @ P W뚬p PN `rP2 PwPP 0=墫堫wPЍo2 p含 `@Q Ѝhh h0 0-vTLL L0 0#v b  _׬ f d wddA`AH-MPPD @a`P 0(A@T P p@T P P wЍp2 WR P  D`pfwP SvЍ 0 0u uT@?LH-HMP`P6 @0 ᛴp pP" @0 ፴pplPp$wPP kYPP[PT PHЍ 0 0>ku   O-q@@PpwP VA T  `W Ѝ     P qЍ[Ѝxx x0 0>pUXX X0 03p<< <0 0G*pTڼ Խ 7 0H-P@P U 0HWKHH H0 0 pU,, ,0E 0p . I  NO-MM<p` P[ U ؔW Y ܄Q$ /pPQ @S.*qp@Ӳ Q0/Q TM/QPpU*/Q Q[ Y [     P31 @9$ 2/Q"    Q :&q/U/P     0 $QЍۍ   P P[l  00   P @( 2/P   PU*/dd!d1 07oUJHH!H1m 0,o@,,!,1n 0"oY:  ! 1o 0o0 0C 0 oYT 0E 0o[K 0 0GnBp 0Sp 0n| |0 0Gn] 2 4   j ޸ ' > t  · o N 4 ' O-MM,0`[ V ,tP DW TT @(`@FpU$@ **`iPP! PU:$ `P< DT  00   PN @0괐Y ,QGP (,0 p P.$ 02/Q%8 Q!DTi P    Q 00+[ @J 1/pP @ :/P H` P, :/DP   d 0R0*  .RK   .R R .R R (@ Y RY$P P3 (, &P I@P/31!@  0 P(@d, P I 0 P , .RP 0    0 S @0BP$ 02/P8 P{ 88#83E 0mPU#   "  PJ` @"HV 1/V oP7  2 -n5/Q%  ( P0G0 RPI(ob$n( /`$QЍۍ`D`D!1 0mVa 0 0mX 0 0 mR 0 0mK 0 0lD 0E 0lXll l0/ 0l,Y^  а 6  ɰ ˰ y 0 ̯ n C X* ` S[ O- MP X Z P X:U Ѝ]*Ɍ p`@ 00 T 3PAuPR PF V: Ua?pyT! [pyT" &   >hP =P=Y]Psl -hP =P =H]Pb ^ 10P! sT P M J @G D A#PP P P P P]P Ѝy x\MHQ tm֖ϲز g P ѧ  H-4P ~'$0P H-pPPD @!P0"S S, Q\S `  "P `Q`P@P `CV: S #S P@P00 0CS   T#P 0 0j ) H-RM@a` %P bPRލM P  0 Kppp x PP 0\2PD+%PQRލdFH U9O-MH`@PY U V:kPxx(x8 0_iUX  Hໞ8p@<8a x( @`p4` $H ǟT T Pp`,Pp(P2$x, jY Ze  ]@4pU {EP) ,`0 @  `  GG@`,Pp(PUpw@8< 4,$`Mx ,p pG@GP) P 0 ALHH+p0 P$  P(} GRRQ RRQ RRQ RRQ RRQ RRQ RRQZ RRQS RRQ RRQ RRQ RRQ RRQ R RG@Q P G@Q RRQ RRQGY :U V^GP^Y\ I,p PYgP, 4ppP; PGGP GL 4GPG G G GP QQ G@"   ,p pP @ Y IP  a` Y `P  4p$p(P`pki<diY$4p`pp(P Xix G*G@Pi@V +U IiGG@Ci@V ,P@@,` @[  i3i4MhT@P@PЍ\ U0D . r  ?X@?> $?<p<H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpF.K`<v` > Q|O-MPP? ($P  `Tp. Q  Ip" Ԡ԰@K   RQ Ꮽpp`P  *p``Ѝ 0 0<fX H<@-h෽`@@PPœPJ4@T@@࠽h p@-@P``PppTb"`P<`0h` tp`I- \H-`   G-MP  OLP. `P*  PJ00P Q- (q@pqApSڀ0  TdL<pU DD! pZ@$ЍG@&Ppp@T T i /dhgV x0H ʱʯ`l@-@P( P P P aPxXX< 0 0dꌎ rX^ @,0H-@P( P ^ NP >P PPMaP00XX0 0 0cꄍ jP] 8H- P @0O-$M`p@Pf Zn Vv F `   p P`pP X pZQ*Q) ?QHp/Pm PJ .PkPh ZB Vc Z/P`<[Q+ \Q Q X qP @#X p*Q"p *RX  p/R0 R0 @Q X A.Q  R pZ V  Z/R p/PV /U @P~V @xVX\\ `^ @!@/oo"`0p\]\4R0`pX  @@  r@OoB=r\P /P ; P pX  @r R, -PX ```\\ PUP\`X pppP PR0@S@@pt `T[` @[PVpRP pPK /TpPpDp@X  q`V, 0  P/VP  p/P PpXX X0 0{1bZ<< <0 0|'bVp$Ѝ蝇 · g u --0((@-@P PT T P T 0 P cU0H-@lPe_P X__P c0T 0T 0O-MBp`@ 0 ͗PP uYc`-Pc``᳢PP `  0᳗pQ  㥢PM PPG p p  `  <52   0@ᛗp) XIPP1   0pᇗp @  0lP  `Z:p@@ `L@@`ާ P ߍ d%##O-MBp`@ 0 <PP ub`-Pc``%PP `  0"pQ  PM PPG p p  `  <1   0@ p) XụPP1   0pp @  0ۖP  `Z:p@@ `L@@`RP P ߍ# ,#`!|!O-MBp`@ 0 ᫖PP u=b`-Pc``ᗡPP `  0ᑖpQ  ㉡PM PPG p p  `  <1   0@yp) X-PP1   0pep @  0JP  `Z:p@@ `L@@`Ħ¦ P ߍ  (Dp@-X`@P`R JP` R˕P pS p@-X`@P`R P` RP pS p@-X`@P`R 2P` RP p S   tMH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S" QKHЍ/ tMH-MPP@ 0 0@  @@@ @0T 00@MР0    R  ! QKHЍ/ MH-M 0 00!.MH-M  0 >MH-M  0 PQ R /ᠵO-,MZ@TP(<  CP8J|jf`_ R :R|R  P :     PJ @\P \P pXX Xᒥ: PX@ Xd Xp ,(  y p 0(q p , i p 4PJ PU HP@ xPp P P P P P P| Px pPt \Pp HPl 4Ph }Pm wPi qPn kPj ePf _Pb YP^ SPZ MPV lGPR L rI  PD:8 6420. ,$*((,&0$%5 0h ^48%5 0]+< @ DHLPTX@@\%  rL k, 00p,p 8p`4 80pp P @OTP >P @ETP >P @;TP >P @1TP >P @'TP >P @TP >P @TP >P @ TP >P $@SP {>P{ (@SP q>Ps ,@SP g>Pl Z piB`@SP R>P' @SP H>P! @SP >>P @SP 4>P @SP *>P @SP >P  @SP >P Y `p  0@ Q0!  /S` `6^  3:S3    ϟ0Bp5Q p "UUp zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   <pG@3T 0@ P>pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@QP P<P @QP F<  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`p`0@ V:T@`  @V0A`0@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A P@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ       phɟ B  } xR3 800``@h JQ. e 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, ax\ [ `   P pP@ P$(PpzUH0}`Z 4 t9PP  m9PK ( @e9PE  ^9P? ` T9PA  M9P<  @E9P6  >9P0 @N 29P6 @N (9P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 iQ Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "QߍQQ )\P ף$IL | <K #K t h {K _K ?K K J 0O-M@<PTHPP% (( P p1 R 0Q1W䀟 Sp |* W 1  \EPh`at  G ` P:@TPZRPЍͺ   '3C C C m@-0M@ P0Ѝ@-0M@P0ЍH-P HO-4My0 [   0 0:uP[ 0 0;kP P P P H@4 Q0 Q4Ѝt,H]B B ' 5B lB k> 0H-@PP T PP@P0@0DD D0 07"PT(( (0 08PWA A A /A bA pA K-PP( X0 pW!  L@`@DU QF 8@DQ F 0S  SQ``DD D0 0HOX(( (0 0IO@ @ @ c@ @ @ @-R 0@T@ 0R@B@QkPO-M@PPE TM 8PS `p*:PR  8p1 KD [ X 8P  8P pp P v8  C= C9p9hh h0 0C\OTLL L0 0DRO78PpЍ> %? W > > ? T@-MQRЍ@TP @PЍP P@ЍO-uMM‑pP `w W P@F88!81 0DO B@p7 @P:P/~@$E E堥OW dE`E\EN< 0 K px  E匥pEEa@PJWBP@Puߍۍ#= > " 0 MH-M  0 ЍHЍ/MH-M 0 00NЍHЍ/O- M@Pq Z `Z^[\J;EB0P @ P 0P` aa``  PZC1 D[  P`X UP' `P [[Zpp{p0 {/k\E Ѝ` [ &`P ll l0 0?NZLL L0 0N44 40 0N{: : tO: : : +: ^: b: @-M@D(P ;B "( 01/`p) p 0`VP <`VDhO`p eP @`DЍЀ`Dp@-M@^D(P A ( 01/`p, p 0`VP <`VD OeP @`D OT`ЍЀD0H-PP< e@LP@ @TH EP0P ܓ P Q P0ғ (Γ  ʓPU* “,P 4P 8P 0H賓LL L0 0K M44 40 0MMP 06 7 i$ 6 6 6 0H-(P@Pk\0HXl@- @@ڣ;\@ԣ lЪ0H-,@@ͣ Z\Pƣ0kO-M@Pt  `P0V ` xP,`p0V+p0 V% P 8 B/o"*k"0PB`pV   (` @ P` @p0V`W Y$*U".VP@ЍV @ P  BQR Q Q QЍЍ 0 0F_L=4 t4 ~4 4  R  *4 8/ 0X\S 040:8 R РS /6MxBH-P`@MD @psV  B kOfp@-@P`M 0A-p@`PP T   pQ @(L|,Tp \V\ \ %VZpQ:pP P ^ FnP0<LT`lx0F:-V ^V?V0P"0Q v v dhv   8W@v P P v   v Q Qt =Q v#P.v;QZ / ,BPR0@0 ̠ ^ Q+W@%0vp;pWpcSb`a `0XV^"w Q" s `0dRdS 0@ hf $ &V" ` Cq0 0K0A  =V  9 20`$ ` DD D0 0JT(( (0 0J]+ + J+ 5+ d+ f+ Dh$ |0 O- MpPR P XY @T2 `  0PU+ PEP'((U PE@T P &. U PE`U FDK 0 0I8K` ЍHH H0 0IX(( (0 0IU) ) E-) q) y) ) ) 'i 0  0~0|  {~s. A-qPpW2 !=@EaV P $QPXLP+ V(D`41/P. V<  $P6@`@`P= きpWpQ 1/|tV@V X   0$PKX@/>3Ȝ`\|`]xA-qPpW1 @EaV P $QPXHP* V(̉`01/P- V;  $P;6@`@`P pWpQ 1/|tV@V X   0$PX@迿(Z[G-@Pa `|DP\ qPpW  U` "= ,@ QU ZEPC HP U' $ P1= 㝌pWpQ 1/U((PP   51/P $@Z $81/P />3t<x4YXXG-@P_ `CPZ qPpW  U` x @ QU ZJEPB DP U& P0pWpQ 1/U(㨈PP   51/P $@Z $81/P 꿿x@|bG?_p@-P Q @>|p@p @TC 1|ppG9G"P/㵊PP- |pp|G"P 㤊`P  |ppkG"P㓊@P {pF@pp@-PE `A\⬆H\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 00  pF pHA-PpP. U6 @R" Q `p:Q 0S R p 0SRpGS@R :XR :R@PDD D0 0EU(( (0 0E? o  G L p@-M`@PP T V   0`'Ѝpll l0 0DTPP P0 0DV44 40 0D  _   7 | , O-LMM p`WH* Z3 pY9 tDPA  TT!I@T pQG  R 0S Q:Q |Q P @Q:Q |Qp ㍅Po 0PS @ p,VJ 0=)H`  0P y`VJ(H` p$0P4``Jp [ :H+Pzy@PfH P7W4 @0P@ppP 0#P pQ 0 R 0S Q:QX |QV P@Q:Q |Qp'7 0DpW4``9P P P :P \PpVp ``p,Z:0P,@K᳈PD ,J0$pW )y(t40P@P ``0SLZ4($4`D@ p ⿄P p@@4,P (Vt @PP `@:PtPp  0pSR@S@Rq =R @R @Ri @:R  RD( 40@@H $0H@[ {{$:d 0[  F B 0S:S 0A0pQ:W:,0` AV` A 0pP , D@0 A I` I @p ,  ,@孉@F$D ,@\ 4\x  T K ЇP ᐉD  XDHP LЍۍUD@0w삟D@`npP @>@8P pD 07/p P 8p@T <@p@1/>PẃP  +1/pDoᠲ 1/.$ @P w4D@#0D@<V 0# 0>X 0$ 0>W 0 0>Vtt t0 0>w\\ \0 0F> s ; G  s  / K { # S X    A-PpPL UU X^ Wg Uo @Q> `p:Q 0S R p 0SRpGS@R' #R @R! 0R xP 0/p0`C V:a`CVpV:A`C6pV0S0" 0q 0>U 0r 0>X 0s 0>Whh h0 0=ULL L0 0=?    D   3 O-MMp @PW$  P 9( /U0P,D 0t  b4 `SL&bKP``$pN4 "2 0E=($@VQ:QX@`P@F` P0 r r r=K$N ;!K$N/0 1K,D$N `Y  r>P @PFLdL:P `  P ؀ `AР Bp1 rr($:P4 ~ 4P > >P>H$PKu뀕g A -[)4  H-   MH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 r QKHЍ/2hO-$M`xxrp ` GTP"  0 `币OPP U: @  P  E p  p1AP\ qp X#p &Q!&H@v00 P"3q"  Q$ЍE8 P9$ P2 @"P QX" 0# " !  P 9PHP  )P* H "[ 0,pp P $Ѝ+4Tjmix H-8M, , ;fgZk@-M$@;0@03P@Ѝtg@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T =PT ,0 0#0ЍH- M pP ЍH- M }pP ЍH-M mpЍ q q0qG-M<pPW* U2 `@$A AaO:dA`A\Aqpq57pp#   0qtq@Y!Qލll l0 0G;UPP P0 0H;88 80 0N:Tyh! Q-`f/0 |p@-P@`1( 0@2pHH-`@Pp1 0@1O-M࿟P@p Ua Wi 0 @Q@,$8p`V]  5@P Q AQP 5P%Vp@` p@WzP2!  ,p,|8DP0`@py@pv@ps lKpkKphJpeJpbpPaPnVA%LQ AQDP 4P%`@ @x@u(``-^[ ` @O:[ p)0<0<- 4 p-Q*-0][ 4oO `@PJpp W  pp pP<-Q ]Q0  $$    I II 8PP  a4 Z4P @PPYi \PV`_Pu  0 P iV`Wt -΍ DQ %  0A D`V P @^PGQ  0 @BD D `VD @Qw ,V`!S @ D@ 3P0A``D ``SD PP DDH,,FPϐl# MD`V +@MQ l4l44LLLLLLL44444448888884444444444444444444444444888888444444444444444448 Q;M+8 M8#@/ @@8  BR#:M     0$(D QL88QL M8 MD D @PjqPi  @@F⠄ Tl#ϰ@04  (( T<@D*<@`+Vd -Vb Y} $4< <+VPIF%P:$$4  2P 1P0VK0V_ xP<( 4<@( @8Qʔ V VQQ @(@( }P?4P aQMdVEV PV" M 1 @ P_< < @ UpV eV74 @PV 5( <4 @8 <~ <( 9( @ )V  0P@ _V i  @ nQ b(V( @]4 @  U2P < 4 ( S1PC < `@P`BP2(`T<@:- pFp @ @ (`nP4a  <a(  4  <@Vk`F@ P T{-Q/  Rq @V0A h QPt 1@PV@` 1@`PKY0A  QP @<V7 q[ AH` @ 6< 0p `P p4 ` 4P<4P< `F<,@PP [4 @,@ N@<4VB ([~ AH@`  6<0 0奂p P pf <@ `<@<@ ᥂p ᠂-P 4 ` 4(`IP@<@P8P [>4@T` (еP ,< @< 0P6 4P<,,l \ rala(`@K(`V*TSV:@V + n WD  VD FN@ ᖂT AH(` ` 6<@ 0p (`P p <(`< P4`FP<@<PP Z0PV@q@D  PDP,,  T@,Q[J 0`@`V@T@T ,,<8Dq XRD,D 8 0.8 0     0 0 0 0,0 0,D H$$ @T @i`Vs@T T # 尀 D Q   !1 0o4@U'@İ $P, QADQ3ll l0 0P4WPP P0 0F4t , RߍA5Lzxov;nt@tLtη  sO8oO-M@Qs y{ P"*0PPW  P(PQ0PpyW `P9  RQ8@<B,@W PxP' p  Q(0pP pR tP   JJ* 00 00 0`3yЍwo0H-@PE* D@*0H-MPp$lVP dd d0 08x3@@T 0 4/P @5@ЍWgH-MPp$lVP hh h0 08N3@@T 0 4/P @4@Ѝ8lvA-M`P$|WP ll l0 0p$3$@$@T  04/P @4@ЍObA-M`P$|WP pp p0 0p2$@$@T  04/P @4@ЍjA-M`P$|WP ll l0 0y2(@(@T  04/P @S4@Ѝj9JA-M`P$|WP pp p0 0y2(@(@T  04/P @&4@ЍxiA-M`P$|WP ll l0 0r24@4@T  04/P @3@Ѝ2A-M`P$|WP pp p0 0E24@4@T  04/P @3@ЍhRk~G-M<&`;@RB    "@\DDeD%` ` `X @  6/P X@ }P P$Y:1D`@p wv uv svqv(PKߍDw14D`@ (0@Y P W p$0Q+* @ LpRp( |`P W Pg* ($ PpvN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%*  0U 0'oCBQSH-M,`0@pPr\Pp$ s^`p 8  "! @  "!]`G)tB)@\>)@`ЍO-\P 0 0)%Oꋦ0H-@PP U T:t'0XX X0 0%U88 80 0"%T*E0ztR-A-`@PL   I'pC'PP-2P P-P P$lU V, ,LP/P , PZp `[pZWPPP 01 0^%[ä8p@-@P ``P (/|P3P (%|(#|(kkp@Z 0 0B3%`2  x3K-(M q`pP @P p; ;$A 0   P&"% (ЍAQ 8@LP$ 0K $ (Ѝl `2N k 0H-P@P P P P0@0 0 0*$ݢ0H-@PP T 0H%"DD D0 0B$T(( (0 0C$꿢ˢ0H-@PP T 0H"DD D0 0B$T(( (0 0Cz$/c;000O-MP@P T D "P %pXsЍ`P+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0 @I" 0% 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?#kbxx_p@-@M@ P`   0{P @ЍpP  0`'r@Ѝp0H-@P XPu  -P09%@X5%@0 0 0F#긞ݧp@-P`X@t  Pp%PX%PpG-MMd`p 0gd@P# 8  P ZdP(( -zP YPJ  P  p$Pp Q p$p>P P$P$PP ( z(i ii$@PPЍۍ}nfs+4+0H-M PY@p   P  EXp  @$Ѝ0O-M`$p @ KP Y  PP@cP T pPP pp`P`&Y P gP8 `E 0  Xp `FPA$PP +i 0ePPoP WWp $P]  pH@ p` Z*` pp W * IQ  Tq`T\c@P&0 0`V `V P P  QQhu` PG pP$pPЍ 0 0"'Bґ0H-@ h P PhU 00H-@PP T  0HnDD D0 0:!T(( (0 0;!꫘ޘȘO-LMPP [ Yl#LЍ ,< 0x![ ,< 0y!YX 0bP `[7 U PD<@`: XL[ PXi$ PU $` @Xp p;/P  Y$ @`W` S +;& 0j!xKx+x;'@ 0_!\+\;r 0W!X:H @[T% pd`T@P$p@P@p  ;/P<0  S$p@ @PZ<P@U@p  ;/P<0  S$p@ @`Z<`@V@p  ;/P<0  S$p@ @PZ<X@ @T)p` p , ;/U$@@p`PPPÉf84!  Y$@`@W$p p;/P I P%X*Y*@HP8p D0p3/HPPQ @p@W:D4T#$@@p  X* A < Q0X H0A@TA 4$Y&*p @ ;/HPP% I < 40Q R0A< @Q: p  $<@0pQ@T0Ap<@Q:@p$@Yp:  P;/PHP,gi <`Pf i8p@( `PV `V` 0  0S  P00P@p0CX3UX4p*U, `FpG W3 X3 W1* ;/P4H8PP P 0 Y@Z*@ p 3/HPT Pዐ Yk*p D0勰  P U8* 0 3/HP P U~*D0  3/HPv P Us*D0  3/HPk P Uh*D0  3/HP` P U]*D0  3/HPU P UR*@ D ;/H @4PI<D[[8 @@p :/H P<PѫP: P Xf$  Z $p@ XP9/P  V$ @pUPp>J*:'@ 0*:r 0X:Hf⑶ V@0$0P@ p2/P   V$0P W0pWP@ 2/P   V$0 P @Z0PU@@ 2/P   V$0 @ pZX @0@T)Pp ( 9/ZPD$@0㆐L p8   V$@P0W$p9/P A  0,X* PU*0`@,PHD@ P2/HP Q P@U:<`p8,T $@  X*  A  Q0X H0A@TA$@Q': p p0PW R0GP W:0 pQ:@ P2/PH( 8$@ pW*@ @p2/HP, G 8 0Q R0A@ Q: P@p PW @f8 (@p PI  X  p  R ` P @P[0A3R`[*R0,` pGH0,` X3[3 X1* 9/PH8 @P@ PPr <` V+*@ 2/8H<PP` V*@ ቐ2/HP<@D@YY80@D:/H P<P`ѩP:"$@D@@TD9/HP@0Hr0DD D0 0W U(( (0 0X  L=LlKKL?0H-@PP T  0H:rDD D0 0g T(( (0 0h wKKJOKKKH-P@P. U6 T> UF q`P  >^rP pqP P `P  H/oP Ho 0 0wQ Uxx x0 0xG T\\ \0 0W= U@@ @0 0X3 CJJIJzJniI%JTIII=0H-P@P U" oqP P P7oP 0H1o00HYqDD D0 0 U(( (0 0 HjIXHHBIRIp@-MP@P U$ oP `/qP P 00 rЍpЍpDD D0 0 U(( (0 0 HHhGGqH{H H-P@P$ U, p`P nP pP nP nP HnDD D0 0~ U(( (0 0t FGXFF|GGp@-@PPE TM P P`V T_ FP p `T< VE V ppp`p  p p p p 0 0I T 0% 0  0  0 Vp44 40 0 gE.FF;EFFDEEEEE @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q* W2 T@T!  0S  Q@Q  0PU 0UR  @LL L0 0:z W00 00 0;p TCDT/CCCO-MM(Z`pPQ00PߍڍKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  N@TJ P T*0S; (I ?PRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8l ||`2 0|P p P0"'00p @ۙp P P20 t&w00p ř PVpP Q:`&6 0 ᩙ P`J P^*P&P6@pI 0ᙙ PPOJWM & 6@pG 0ሙ PP>JW<%5@pG 0w PP-JW+%5@pG 0f PPJWl%l5@pG 0U PP JW 0%05@pG 0D PPJW$4 0@G3 PPJpTpp[ `@` H4Z@$00  pPJYI`p [f0pSa #? Ip s0P|J P PO:x0 !o 0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @?[P' @VpP P PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @KPJp P:p0 <`geP 0P Qp pP0 _P  0OePP p| @|Z!B= ) W@ ::YL@@.q&o=?px?p4?bp>p>ot>oG-1MpP@ `W U V] Tf C/<eP C`Z=C 0S 0@P P P  `&`$ P P ~pP Z0! ೗pP P  %` ` P1ލxx x0 0MV\\ \0 0BT<< <0 07 77j77w>7s78O-GMȡp` @P  W pQ P PV {P@V @P5wp  0 p0 P 0S:pp PY Y `20P  VPGߍ뼾 H-M`PPJp@P Q R 0S R p@@V& pЍ0H-@P 3P UP0 0 0@p{44P#/ 0H-@PPP P0r 0XM@U PP M0Y446O-M_p@P`S* @8 T8p<`4@A 4PPPP @T@_`TP  ` RߍfM@W pP M/40S  4 eQP9 B&p. AT- pfP` c 0S6"#QSP @T R 0@S:  0p 0Ph0P  x` P<@@0 Pq0lxlll ` `q ax0< Q9Q  Q P   P0 S p SRP`U p UVPSR UV`8`Q4 < @0P.Q QPx P] 8P%@Pb ܰP HPP< @0 P(c L(Q }<pA;PF< @0@P>l-P PQ4 @  u P < @0%P* PULV `P ML8< @0= < @0P1 P0 `Z0`V ,,P `V PpW$ ,P/ P P P  P ,B SPP P l l+l; 0\P @`\[PH8P 7,(<0 P px P `< P9Q QQ   QP0 SQPSR   @0@]P 0Vp SR 8)9B 0v0@P" ||||A< @0-0P2@T PPP<AT < DK@U PP H pp@W= HP U:P>EpPP2 Q @@JQ@J R R R<QPQ6P 2&6 0JB( D98 4[$ @80偢 @<z4@P P?B `   ,  +!AܐY& S Y @<`,Pp00P@pU*P  RP pqʀ0P<  @PdP_= 0!Q @0 9PxJ P8PpJ  9pf $PP PC B<<0      +!A R'  T R <`,Pp@@PpU*Q 00 SQ q0sʁ@QT < R Rp 0p 0 BaP@P40pRP PP$PPBO >8 9P2551@10@`0 O( P`V DI,P Q @@7IQ0I.I,Q UC %I@P>@IIi '\'Vt 8 H i,// | , v* It @-@ FPt  @ H-P P R  R' R R.Q*/0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-M`p@PN WH PPD PP9*P +  O$P P PYJY'yP 0SS 0 P X QQ P PXPЍ(( (0 0JW!GM0O-\MM||0lX0p0 pp0000 0$0(0,0向@Xp P W T@P} *0PPw  *0PPi #P  P P pPPW `` P P P HUPP pp ՍP8 840{P4`V4 p`V-  zP4PUtt!t1r 0,GPV `P $Gp@Z!  Zh4p 0  0~W] 0B 0sT\ST ች ,QdX Q\Ѝڍg Y,(gY'iNfN O-Mp W  PP @@@ N`PP PVZP: 8tplhd`\XX@P3 XH 0^X@P' 00  PJ !  0fP t@P@T^X@ kFP$ H 0*P 0l  PJ !  03P CFd1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@DTL+PF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7_h@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@T%h@Q507ЍL4 K-XM,PqpP @p8pP  PgV $T$U R D`VK H@Wp$U9 `$# 0` Pf  PTV`f=V Q Q Q $$ 1`V  @Q 44"42   0$X4* +Q:f)P 0@.P!PWP ᵌ  iPڐa`(p 0  PP LP@Ppw sfp$0@,Q 0  PLP CC$P Zf `P`(p Qf``(p CCPXPWߍۍ~$$ $0 0, 9   9 }Ȓ  ȓ ܖ O-4MMPt@P0,{ U $ ( $ , 00  `Pa 0 8 `PP  0  8 `PA0 0"p(  !$PU0 #"(p0|?  /r `V$P`2 dd d0 0oUz`e80P4Ѝ؍æ 4 Q )ď O-uM MD崺Pp Qe UEk Tt DPy @@@@@@@@@p* Q Q Q 6Q !Q2@* `vpP'  0 0 @UdPJD 01/P 4p%@RRPPee%(PπR( &p`V P @Z* ,Boo B/o"$p㈐P,@ @40cP} ! Pw ;Pr  !+KD@

0V\5 $R2 R1 dV.@(V%h lP QPo PPph   RpT @P v> 0 0Tq 0 0gpp p0} 0b`` `0 0 }Q)Ut S( J$~ $~ O-Mr`@PpV   *Ep ?p [P P Q pP Q[ P php@Pa[ f@PW XRp0<    01 P8Q4:Zp Z.   P&P# pp Wpp Q  p WY vP 0 pphpp Pߍ[ 0 0L| Q4z z Dz z @-@P H@@ @0,, ,0 0#EgܺvT2ZK-@`PP( V0 !>?p㠑@piW   /*)P*#@pP: D DD D0 0V(( (0 0^ 6O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b PQJ(0PM P(0 >PkJ( @$PPh  0Q^*0S0S S0  0p `C``S`p0∀R 0S! 0 p@ `@F@@V@@`   `PFPPVPp 0pCppSp@`D``T` @PDPPT`Pp  Q $0P b@(@P$P0`(`V*PP. P   ἐh@  pᝰ^ @PpDQ 0 ሰ pZ P   p   A  Q   @P  @@P     F p 0   @@P@   0p P  @@P@  p0 0Z$ 0$P@4 DQ* 4 ,Ѝ  0 0]>B#+D  @-@P @4 0/ 0'aH-M@P#p/ `$p PUY#S# 0@@ @`pF#w <00 @P~$@ЍO-M(Q:px P`CP s@Ѝ<(. @$Z  $ (*PR,"P(P-Q(  +KQXᐋ ` pP:P P!*7%4PY& Y P1 3P1A2P1A2P1A2PP` US @ 0U08`PEU8PPE9P R R P1 3P1A2P1A2P1A2PP` US@0U4:`PEU:PPE;Pk@ # /@- @T ,@T  T  Q*! @ Q*  Q:@Q A G-MP$PU (@0 y 4@: dI`J0;p62A@A4"0$372'- A@J0IR@ 0 R 0 "00008 090`@61@R ,0S SQ*J#Q*Q: Q8Ѝ0 0AЍ@-0@S 3/@3H-Lß) QN: @p`P p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T( QO: @ p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T,@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :@! !0$  'T:! !@   DR@!(    T  ! N  L$"pA!p@! p B("pA!p@ p B%"pA!y7 ȁ H @-@P  @Z 0 0/O-lM0@< )pIXTP8@Pd SCH-@`Q`p`+T \\\W `V Q( X`fd9 $9 BO-dMMD WPD`0``P V D*P pL 4`@DP$@XHp<(,Ppp P@XHPH  0UyH`r u8| uW`ll2  0+@岰`*[[ [ [ <[ [  OWa1` 0+PLn.H`P (pP 0QP-ePQVP!4P 0a `P 0dЍۍOcE6 wpPPW *.`PdЍۍ06 xC 0 e(8 7 X C W< D= @&E`7 =2:~ţ =9M > %% = d= H-AMp@`Pp 0  OPJ` P ._ $QAލ; H-AMp@P p 0   kOPJ` P p.7 $QAލ{; A-MP0 @ 0HO`PJp P Q.Q Q.`ЍK-AMⰐ@  0   !O`PJ PpP Q.Q  P.T ` PAލ(9 p@-`P@Q sP  @QUpH-@`p(PU Q PU R( \ UT{7p@-@P`(Q  R  R<l UTpTp70H-M@(TPP   PU RX U$P @PP8P80P0 @)Ѝ0- o6N2>0H-M@(TT T TPP$T T PPPPPPdPPt   kU$P TPP4P40P0 @)Ѝ05U 2Z5i0H-@D( TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01\ T000000000p0P0H0H0覺=ٹYC0H-@'YP\( 'px' ( 0itq'0Mp@-8M`HP`@I4@PH .0~Ad00. (@U PE =04P8Ѝp@Ѝ/V2 O-MP`PP@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P* P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P* P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p: P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ 1 xi O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@`\+ O-lMD Q@@R l   Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<+$p 0+Q a@\p) b%!AqbdP@჌ $p 0 Q a@p* bd%!AqRd`@`#p 0PSp`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/PgPY 'Z 'W 'lЍQigMbsEYJZ"|` _ 3t_ lg"(0H-@P  0 .SP Q0* B/o"0 PAP P.PPu00$$ $0 009oyK- MP#PS_0 ?;@@04 P_ `oP% ЍH-M@PmPK mxaP`F tmPB `mP> L|mP: 8vmP6 $pmP2  `pP,$ pp .`PV3opP $0<H`pTpvЍ! , ԥ< 5ߞoH-M`@PmP( Q PpP pp n.PP U3opPpTpuЍ  p@-P@Pu`Pu` V Pp`p 0R0p0Rp \ 0 /p0H-M@tP P0Q PЍ0'0H-!Q  Q  P@@PP P0@@P!0  | p  @-@@p $,X0@ \  0H-P<@p ,00H0x L p@-`@@Pp  0p@p   H-M`p@P|p 0@<8 40 p< 0:ЍHЍ T l H-M`lp@PRp p8 0ЍGЍ   / / <x H-M`Tp@P p p( 0"ЍЍP   H-M`lp@Pp p8 0ЍGЍ   H-M`tp@Pp ,(p< 0MЍGЍD   H-M0  0AЍ H-<p Hq_G p  0 ; 0 G- MPD`tP@@, P    H0 Pp@ ЍO-M M` PK⨫⤻ {Pd q!PT  D p$` $``P `[  U!PrP `\P P .PP`FP Va V*  p 6 @DK[P=P.P T p T.@DK`⨛VB*TP(:fa P P嬻[ ` pDD?07/K `FV P*K 㨛T Dp TuD  㨛 {K  PbJP[` W *?0 06/ @pG W . P*GK 㨻T   P =0 p7/ @  圻t}k pFP@T<4<4"<4 ll l'<4TL $<4L3&<4<41<4,(l(<48<4,,4T L T T <4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4.<   /$; P Z.P P PP`V`F[ : Dd 0 p7/ @  , [ : ID@ p BD`  `?0+ d `@ P$+  w P*?0 p7/ @  @ Pj : D \?+ 0d k@ P+  ; P*?0 p7/ @   Cx?+ 0d 4@ P+   P*((?(0 p7/ @   Cd >0+ @ P{+   P*``>`0 p7/ @    /$;PMJ> :P J P P<:  Pdd?d0 p7/ 0o@  `  / ?PJ~py +R    P>0 P5/ @V   P< / ? PJ@?  Mĝ@ [7 : B + p+?0+ d 3@ P+   P*00?00 p7/ @>   :P JN@P JP  P}:  P?0 p7/ o@  `  V a؛  ݙTT Y d ?0+ @ P;+   P*>0 p7/ @d   h>0+ @ P+  Z P*?0 p7/ @    Ad ?0+ Q@ P+  ! P*?0 p7/ @p  p Xz ʰ +l @X  p  d  0@ P   P*pP?  05/   P* ʰO _p  @   P*  01PJJ7  P * P   Px  `dd?06/ 돎 _ /$@pk0 kPJ P   P?0 + 0d @@ P+   P* =0 p7/ @ V  ʀ 儭+\ @`V    d  0p P:   P*  @ <04/ [- #S, J1R/0 SP PyJP  P:  P?0 p7/ o@  ` = GRaؑ ɐ $` [c  d ?0+ EP P+   P*>0 p7/ @   pW- wP J P# *P@  j\XTP+;2[Y@ P*LL?L0 P5/[ @W  A ꍏ 7   /$;PDJ P=   PPP>P0 p7/ @`  `  ? ? K ? 0E [ @ P *\ \=\0`p  / ?PJM  ;]ԍ [A: >d <0+ C@ P+   P*x x@  0+ d @ P=+   P*PP>P0 p7/ @`  `  P *+\ :깊00 [u;+H1[@ P*HH?H0p 7/[ @  @ՉLL r  =@  = +`?0(( @?@ P(   P*  ? 0 p7/ @"   J1R/0 S[U:xK  Eꑈ   /$;PmJ Q*`+\  Q$L   }$ Y? P  - T=d 0p P6   P * @?04/ @  Z   \\ $Q:cՅLL   V qVUUU 럎 _ /$@pk0 9PJ P   P>0 + 0d #@ P +   P*?0 p7/ @   9l?+ 0d @ Pi +   P*?0 p7/ @   H9@  A9P  :9?00 ]wwvv [: %9@  9P  92 ?0P0@ P P  T P*?0 p7/ @    /$;& P1Z Yuu P@ ~@ P P   P*>0 p7/ @    @ h1tt [s*~p>+[J0+ d P P{ ` +L  P* =0 p7/ @   P'*ܿ $ essX q8r@    P *t?d 0+lPJZ Z  R>Y@ @PY p   E>pPTPE P   a` P *P `p88?07/ @Z  `x P )  P  `p>07/ @.U  `K⬋/*X:.eQ   P  `p?07/ @PE U `( P*noupp X   P  `p?07/ @  `?+Ld 0ZY0` 0  PP .pp0S PupWZ.pop `P@QC    P* p?07/   @+ 嬋 K" $P Q L[|: @✻yn0o0 P PJP P :  P?0 p7/ o@  ` P*mHnH m@K  `牐  [ P .@  `d 0p P    P* `@?04/ l04/ @0U   @0@PP   P*  pxx?07/ YdXo`ʰ Pii ')Ahh @0 0PE Y  bp P   P *  @>04/ @0U   @0@PZP   P*  p>07/  Af P8:)  P =0 p7/ @  wp[~:$ffg ef Ke=+edd [m:?0+ d v@ P+  F P*dd?d0 p7/ @d   >0+ B@ P+   P*?0 p7/ @d   l?0+ @ P+  ޿ P*?0 p7/ @   PP @ b\ PT:.  P?0 p7/ @  D@pP b0c %bb P$-  P>0 p7/ @   3P`  P  Q?0 p7/A+ϟ++ @K0=+,p`==Sx*@K0SrP!h H !  ! }aa P!  !%#       " td `Da P!  !%#      P "%"      U>` P!  !%#      P "%"   P  #   "!    ! -( _` P!  !%#      P "%"   P  #   "!   P !"      *[U*Р+JPEK[ZS+H:*@K0CSHYhn`ʰ P^_ ] @0 0PE Y gp P  9 P *  @ =04/ @0U   @0@PP   P*  p?07/ \h]@ Q2* P:  @ Ptt?t0 p7/ @    /;~p\x\x Y% P`:  P>0 p7/ @  <>00~ @p ~@p"@YJ n`ʰ Pꕲ ZZ@0 0PE Y p P   _ P *  @?04/ @0U   @0@PP  8 P*4  p  ?07/  yYY  XY WdXWW U   P>0 p7/ @   PD. @8>  @0 @1+R= B0 00+@ PtJ@ P* =0 p7/ P@T[⨫*U@:8ʰdA `  ` P p <  07/ @@D T  P*VT*+\   R$ K @ ViVV U$ @T< P  - h?d 0s p P  C P * `?06/ @  Z   $@KT: UV U;+#[@ P*?0 p7/[ @  +T@U@ ;+#[a@ P*  ? 0 p7/[ @   ShTh S1SS   /;POJ P*J`-1R/0 SP @PJPU P4:  P =0 p7/ m@  `0RS Yk P:  P <0 p7/ @  D====YAl`ʰ P Q@0 0PE Y Dp P   P *  @ <04/ @0U   @0@PP   P*  pt t;07/ Y P: Q :0 p7/A  Ꝧ !NNUZ   P 90 p7/ @   P6  @)  /+@ @,/+R8 B0 00+@6PJ@ P*80 p7/ `@Tkp{C*V*:ʰdA   P   P705/ @@D T < P*.k { MM MM LLL KKK1V   P70 p7/ @  Q\6+A @0@+}.+Rk5 B0 00+@P_J@ P*50 p7/ P@T[⨫?*U+:ʰdA `  ` P p\\5  07/ @@D T 8 P*P J0K JJIJ ; serial qHH | G0HU   Pxx4x0 p7/ @   P# @3  @0 @-+R83 B0 00+@PJ@ P*``3`0 p7/  @R+  P20 p7/ @T  娛[2*U*:ʠdA `  ` P p<<2  07/ @@D T + P*[U5   P10 p7/ @   P: 0 @ m ,0 am 4dPߍ ۍ+nܽ EFFVUUU ; refrestry ; expiry; minimu @@ >P?P A== !>><< : ; ( i;;e99ܰ 8\9\ y77 د 88B,C, @A qEE D4E4 mCC dB, A B @pAd O-M(`,@ P0+P:J@ pQ pU `Pa Q p\Q Q .QQ pG0`,@Q W UQ;Q.Q  R.p Q*p"@p  R *00 P5/ BwЍ.Q Q Q pWpG,, ,0 03p4p Y333O-M`P@V:"pP TT2T0 Z(( (0 0? 5!i! !A!M!X x 8 A-P`KpU. X Vx@0VP`. Q p`07@V0@3&b``7@` V0@3```@V@ õ 0 0g½8 % /Ho/70///̖O-TM`2 |#$0plu ` P Z:8 P<32 ! W0)PPH P $k  A$`Q` 2D`p02 @ Pe  Ip  %GX <2Hp02 @ PG P} I P P@QAU 1M`02 P@ P( p^ I p p@JP 4Z[XU 0 P$1S`02 @ P % P1Ԑ P @RP  00P ppWJppp pAEP QTЍ'gE.‰%I$ųMn: x  0  ( H-p@`ᲸPP?( U E  APEq 0 .S R:0pS\WR: S\R   .A-MM`P `+@P J +PJdIoBPЍۍf @-Mr @ 0KPJP*Ѝ +Ѝfp@-RPPӽp@`PP  p@p@-RPPp@d`PP ^ p@y0H-@PkP  0Hp@-Q P@=`P }prP 2 p@G0H-P @PP :Q DP [0Q0H-PQH RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0ټ00H-P @PP  D`P @00  D O-M-MP@`t@ p@`P P P P p p p |@x@:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW DP9 6 P4 4,DP. 4,DP),& #x|4jP:PPpP pPTʛPP8P_ Y <4P |jP*RBk@x? ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4꼄 x xYH <P\ |4 jPV@j @ Nd 8 4 nn n nn<P o 0 !  Q "04,DPL K f`"|  @  |x8@pPxS갂 <P |4 jP@j @ @x|4 0 4 4@ 1@  |xY$4 ?(oP o$P4ꬁ P9||bE?# A-P@pW `P P kPA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0C㙴DD D0 0D㑴00 00 0E㉴@y Y90 0 '0H-P@P P Q080QQ R:0088 80 0eR$$ $0 0fJ$@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Qʊ 0P*r-w--xu  0vS-S rS  wS xS S //H-\:Q  P/P/ Q Q/@-@P ᡯAQ @ R RP///o@o"/ /o@o"/H-/RR 0 0p>(H-4 /RR 0 0p+P/P PQ/Q /H- AR*Q *QQ 0 0pH-PQ0H- P @ v\PᚴP嘴P P됴P@0p@-MP@P"  AP U\`y`wP ЍpQЍp 0 0Z²P/0H-@P QQ <P:P5PU:/0H,H-@PP `V pP P p`V 0 0ヲO-M[# Pp@aP @[X  P*K! !@PK ЍH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0] P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ Q A a Q1 A/3` Q3 A/H-`pP V P 0P@T PT S00DD D0 0L㠱V(( (0 0M㖱j00d O-Mp@Pp PT D P"PXЍ`ᬬP+V  -V  `0V  p0VpTp xP0@ Qa@"Q#9*Pp`.@PE" ڲ `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍA@Q 0 0? :y00b O-M`pPP W G"P  XЍ@ P+T -T @0T  `0T`W` xP0@ Qa@"Q#n*`@P?U  p 0勬UK[ [ @pI" 5!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" S! @T "Q/@X QPPPЍA@Q| 0 0?FK? rQJQ H-Z MH-M  jЍH Ѝ/G-`PG YO Ѧ0@FQ`V mP,`pPVPt  P F  @TP@F q ꄱ @Z  DD D0 0BկY(( (0 0C˯(Y18hp@-@P?@ <` @U  @ p@ ^ p@-P@WPu`Pu` V Pl@`㺦p@-@P 6 `@覦 0 06r fH-M?  ЍG-MP`0P @V   0 $P p  0 PЍpЍ 0 0/=QO-MM⨃p`0WXQ0 `Z Z \AP 婰夰/r .0匡PP 0  `> O-MPp@P@ Wp W (`P ` `ಕP ` P P P ` P P`dP @ @oᠢ@P P Q : -P  A  ` `ZMTY ` P%H`Q*  P  @`P ` `!P#XO#`P  R:0 BpC0R*n xe ߍB@Xp` pP` R?G JAP@XPpὢ`Z*PP E,U@ X@JPqᤢ`Z: JAP@[ PP88 80^ 0x `} ,zK-MPP6 `PqpWP( pp@U@@ T0   Q  n@ T ЍЍ 0  0%L=|=h=;Dp@-M@P`9,0,)0 ЍpL<h<@-M@&   9Ѝ <<H-M@PpᘧP P0`L0 @ឧЍЍ;;0H-M@@Tx|p@@T dPP D  97Ѝ0Ѝ0l{\{P{(;;O-MP`Pa Uk \v P P Ѝ  R !1MN 0@ `LpdV7pK``pW [ p帐 pppppW @eD1D!DNM0 [10 @R1NM0 Ѝ 0 06 @:Uhh h0a 0 @-\@@ @0b 0 @ |8R_2dFuE-E\O-$MS@PQ  Z T# T P $ЍOꊦ`/@@#@3 0IZ$$#$3 0JۤTY Z @``T``` :T:P} rPp` ˙P ™P V1@ `@T:TBV Pj `PM +` `P  <V `@T4 +Q`P- @P T- DP  A0ppB0P.T  @T4Q`P `T0` 0 QP P$ЍNP`PP`P /`PP`P`` `0 0'ZODD D0 0F@2 CwCO͖K@#mՓll0 / . / $/ L/ A-MPPY Xa @ `Ѝ  00T @ xP `9T pP 0D P p@q`p` 0D P:.T Q*p@p`ЍT @ A Q  ` V3VX  0ЍDD D0 0m㟣X(( (0 0n㕣+j>B. O-|MV@`PQx$ V, T4 T[w V 0p& :2P P*: [/`S%5 0HTV%5 0IJT[W V`\  0t 0PD  0 P 0 PąW 0 0Pp,04 or0T @s P_oPR0pYt"W pTs@@0Y t P_o PR  @pZq00@Z 0q P_o PR  pXsPPX Ps @Oo PB  0p^u0^ u @Oo PB  PpP `\ q 0?o P2  p q/o"0P0q pWqJP. X:[C x [ [[ @ TX*[:XW W W ,P4PP 1"@J 1P8P6P 0p! :1P% JP"*:᭏6Px Y P*: Q* JAP ` Jᐏ4QPꩣ妣 Q`PxP|ЍfL 0 0hV 0 0ivxx x0 0`` `0 0ݡD, XY=0d+7ĵ7|ҵՊB6L& t& O-MpP@PP Pd(Y$ `V$ V, VU + 09/p ! 0XP <X#6w2P`PpPpPPTPaPpwPp`PPȖ @Y  P P   PL U PP  Z   09/ pu 0 0P@%0,RP <X8 0 BS0< @X0 pP  U 0 U  EPA0u0rPP @P Y ULa? pp9/p 0p P @ P ;U 6 1^PP'*P ƗPЍ 0`9/p 0P @ P 0P! 㦗Z@㚗Ptt t0 0Gddd d0 0[@@ @0 0O/*,& t$ ٯ ۯO-MP@pP U` ߖp@Z xX]p@Z[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ PZ  8@pppZ֖@> @V[; ,P6 p@  W)  0WPpp_oRWWUPU U@@ U@U @ U UQpP PpW q@@P@ Ѝ㉖Ѝ 0 0hPRL&Zp@-`@PP T$ 0 0GFp 0ap``@ ɠTPŠpDD D0 06 T(( (0 07꠫ӫ%xH-M  2/Ѝ/p@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 0՞T(( (0 0˞ªݪp@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 0㕞T(( (0 0㋞©0H-@PP T P P P  0 0H/0DD D0 0aT(( (0 0W_ʨ70H-@PP T P P P  0 0H/0DD D0 0-T(( (0 0#"qyp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0 0T,, ,0 0 p@-M@PP T) `P P P 2/`  2/P `ЍpLL L0% 0ઝT,, ,0& 0p@-M@PP T) `P P P 2/`  2/P `ЍpLL L0E 0hT,, ,0F 0]˥p@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0Y'T,, ,0e 0 Ҥޣp@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0aT,, ,0 0ۜڢѣp@-M@PP T) `P P P 2/`  2/P `ЍpHH H0 0जT(( (0 0i㚜֡ĢϢp@-M@PP# T, `U2 P P P 2/P `` 2/P `ЍpЍpll l0 0`TLL L0 0qV44 40 0M܅ƠաZtp@-M@PP# T, `U3 P P P 2/P `` 2/P `ЍpЍppp p0 0TPP P0 044 40 0ꮟǠs^Pp@-M@PP$ T- `P P PQ 2/`  2/P P`ЍpLL L0 0ྛT,, ,0 0೛fT:_xp@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0}T,, ,0  0rbT6eA-`p@P1 V, W6 PPeP P# P  03/P U 0  03/P U  0 A/DD D0* 0*(( (0 0#!O+oLQFK-M`@PPb Tk Vt Uz V P P PN 2/PG  2/P; p` WP5"P P P.W$ X`0P  cV Q`PP```X H ``  `Ѝ 0^ 0चT 0_ 0V 0 0&㏚hh h0 0㆚V|LL L0 0|sC~ҙݙx~^}~o0H-@PP T  ;0HDLL L0 0TT,, ,0 0I꾘(}{H-M`@pPP= WF TO VW U` Wh P P P) 2/P"  2/P  R Q  R 0S R 2/ЍЍ 0 0W 0 0T 0 0ޙV 0 0әUxx x0 0əW\\ \0  0ྙ:(|\q0M{fG-MPPb Zj @T `TYL ផ`pT T T<` 2/oP 8 2/P* `P-V+@T T! T$! p@Y@P p  pTPW  ppp pЍ||ppHH H0 0/9Z,, ,0 0.RDy&ѕnx0H-@PP T /*0HlHH H0? 0T(( (0 0 ꪓax9ΔH-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0W 0໘U(( (0 0㱘Z!Hw2H-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0{ 0gU(( (0 0] ޒu0H-@PP T 0HLHH H0 0CT,, ,0 08zjluN>*0H-@PP T 0H{LL L0 0T,, ,0 0ݑt0H-@PP T 0HHH H0 0T,, ,0 0NV@t"*0H-@PP T 0H0LL L0 0җT,, ,0 0Ǘ궎ΐse@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / p/ 0(/ $ / $ 8 ̠ 0/O-MQ p\P Q*0 @ P P*.000@@P PAS01P!0P*@P0AQY YcY !P*@`pY: P $PJ`EUpPGPP` ! ~S p@"0D:SG`10S\*@PAQD!0D^S:0SO*)Pcf`51&VაDd0 ey0&fPD0uPd\PP`E0@P3*@ P|`  2P$J`p )PJ@p \P pQ PR .P* @ЍK(ЍE\[xӱ{؈10O-M@ 0`pW  \W .W9  [* R Q.R @[W+  P sQp P {PQ ` sP Ed @ F!p W`` X*p@]ևP LQxQp   QP2(@ U1*@0/R# ]R* PbS````  P0R| z ^x@ T" @` Vh* Uf* 0pS P[  `P]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ QH(Ѝ RЍQ X* H Q@(@.@+ @ ?.//A-R8P0U9  0 PU. U'*PP`@V VAU`PQV!P`V*UPPE`Upw`VJ@@@@@`(C H H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PQP!P0[0Z1*` Ꮘ  Q*?0 0P `T@@X`Vꍕ(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pqT!pp P SP@ P@(TYTpQX @QUAPT qP!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ ᾇ(`W @(p˔pPP Q* H P(P}  ( u@p갔 XY(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP Pލ== H-BMhp`@Pp 0'p  0!QBߍ=l Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H- Q 0S AQ:Q B(G-@pTWo᠂P` P0 P1*T`P xP@pTWѓΓ(H-@QSP`p R xPpGP`W@A-PA@T  QQ*(Ap`PJPQ`@芓?@-Q 0S  AQ:Q @(@n@ MH-M  ЍH Ѝ/@-M@ >p TЍЍH-R 0Sb 00S0 0s 00@ O-M`PP @U E @"P%XЍpὌP+W -W p0W `0W`U` xP0@ Qa@"Q#L*@`pQZQ>YZPEUP@@D"p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRڽ@pX QЍA@Q 0 0?rou-fG-MpPW# U+ `@$A AaO  |x 0dA`A\Aqpq"p@!Qލ8;LL L0 0FːU00 00 0G tuLxttoM0  MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/8 O-MS \ Z@Y"@@`ЍpP0Q  ApU/W MP%p@ nP@Up`T@*VJV:@V@3D    @P @`@V P 0 0@)rrH-`p@PΆ 0P@0H-|@P@ ppd~PP P P<k @0 d$@ tT$$$ '# 0H-@Pv 0HH-`p@Rh dP W  8 0u H Wud ׋H-CMs@PTp, U @ hPR  `0!P0G 20" 00 @P8($ D:@P- PLP3 @" ,0 P),%P" `"P 0  3/$P QHP  @,PCލ9a`|QP P TaP` x8U ((1 0P@P ( R $2/P ːQ 0 0PP P0~ 0UO00 00 0E %nYn^nm-n"|" pp p L!@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:D P@! P堰gQ VQ, Hp!0   Y *P p [PE5P Y: P Y: )@P"d 0Aspg@G'v Cr r 0 @:"Ѝ4 P/ P/ X P/X @-0Sm F,@T@R @0S\  H-\ mF< R0\pP/@-@@@W O-M@PQ<mP `rP: dP p/PpP ZP:PPP U SPIGP ЍT SPhm`SPP @TrP:8 XdP`/P `HPJp@P:P 3r@pPCP U  P x` VPZ8R P/y "2r p0WW+ `V)m@㛿>\ FL0 0X0 0p0c00 S8 R `V ( R# `V ȀϠ ˌ1P AU@ @A00c00S5 R `V Z30 #N Ѝq`-00r(|LpLLV rV ,PKDK)J J(U ,U T IS ,IHHV KH-`@Q pP*  P P:P   P PPoPk @U@qPPTh PPP PP PQPP_ 0zSp1P{ UTC/@-hP Xp@P̄@@oT@\Ꜫ O DO @-hP XP@P@@oT@< O N 0H-P @P  P Pz뇄@P00H-@ငPo|P00 O-MРP) @P PZ Q(  P R "PZ0`b  0~ i 0&'b\B@ p4 P (~pP  PZP ``aP``Z```V RBa P  PR /+m FY /+ ( D D1Q0!?0!a 9!0*~`1@ &'0 0p0 P  p !P Rуp PPP .0"@0pZp SpЍ 1p pY`C4L lAA-(qP@pP P ```r`P P &@PP@ ox 0PT P P `@>P Pإ @J J J l1 AhJ p@-P@P `PC@``\PoW@ 0@V ppx >I H lI p@-`@P< 0@@ 0 P(pI /,?0H-8P@P P /T(0>p@-@PPP P`P ,P`` 0 P(p1P `4P  d> H .xH .,>H-pT@P`@PP 0 P /T(PG -x=tH-P@`P` |PfpP X`lpp 0h P t/T(P p4=P Oꔡ <F -|pF -<p@-PP @PC@P` @oZx  R l0 ``TT  0dP`T0px E lE HE +pp;D @-@P < 00$$  0@<LD @+:@-@Q  R 800$$  0@8D *dd:P 0H-PP 0@,   00HC \*9O-MLpW0U PP  ( 0/ @/P `(p> 0t @/`P (p/ Y.JZ' Q⣀PTB$嚟P>.P@0S0`Va`` `V 0` 0Pp@`]p0Pߍ *\Z$`m@㚟FL/  PS 0 V 0 0PX V P/P1o$PP  0 @/P/ 0 @/P  o0$Pm@㚟b/FL `Tp,`(pTp@`-00 t K-0M.P$`lh   (P$`DD  0  RJ0Ѝ? & 60H- X\ @LA@RPp  R/#0# r0ȣT0pC-@PP 3`P`@P%`PoP "X *Q ЀA B0T 0p@T_V p訙 3@> > = H- R` 0B `Pp^p C0S@0@/_!`!PuTJ<T &p%S00S^G-H`pP 0@pP p@0P,P! Q` A ؀@`R ` AQ@p ?o$P$`vWJT`@ `X`(P)``Q`Q``R@ȗ < 1h< ; O-MFM<0P 0` pP*aL:Pp /P{PP  w{P P% /P?/P A/ .P P `.P`.P0.PP./UV0S/SP ߍFۍ>(/R -k` ?P˟ ==P Grp)`UVJ/P@1+,P@L1 oF nF ,p  mF  H-,$G'y08up W4mxtq`hdzt{vrw0e no04rspu|@Hfp$1pg` ipĆ ($jpTP kpp$!U2S(PT[RJ [P^NJ}^LQJJ QHRFJ RD\BJ \@@D  $"4@@ )"@p  ,@W2@IOoB $P@ >K :@ (PL Y~:HD@T T\ \^@ 0g0@ $ @L 0! P @^<  YPr `p dXP|_ `p$( XT`PxpU($p`'\|!PH pTp L Dqa V  X H @ @B @ [L0D@0HppW okp 0S [ʦ$[0 pPX`rP P p PW C0[ p0PW `P`p/+00 R\p`  Pb4  `pRH 8Q Y0p< PQ@Q T80pˏ Q@QP$( 84@ 0XDPS($P0%p PP0PP H4u ^<  0D@8 V RP  BP  LAP P ,0pq P T 0S,pS01 00P \ 0SS0PJ@f}Z Z@ QP PA QLQ@@L 1 DP L P7@H@Y.D㉡ PXH@` PxP PXPeh@TpL oH@P@TqLH@ P >>,@0p0pS0@P  Q>͠X 0Ȍ@! @p`ok@@P0S% A`P@r@V Ѐ`FpG UL  rpPo/$@$ RJP!p  R }PH`VLp @1  @`VPLP hԖ h O-tMP@Q <Q ` R >R `0 A R+A"Q#:Q`@FpQpP ϠˌT' pQ@p!0@^p*h:@P@ P 0QX P0 p p0!p@㰑g @Q <Q< *  R >R-  p aK nPPpY @  n P 0 A R+A"Q#:Q @IQs400@Q ,Q;QepAl dR;P,P_X@PY ,QVD0PP PM  p@ld0 lğ @@L0 ,P(p dN"d@Ao R H$  /_+p+PUJ(p,P0W@000S@@00$0l@PptЍ$@ ,P(p0F0@ lll# `Q`#`3PL80/+0+PJj0Q@00 aTp @ X @D "2!!a"R2a  3Qpl"40P F-) p࠳ pRH QE 0<QmQ$08?+pP+0SJ(0Q@ ,0 PP{p,0p 1$P8_+0+0S(0 JP@,P ?; ,P40@@pR< a$800+ +QJ$pW80j 0P   @pGP š{Q)\P ף(\H@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s )z&zT@^ l @- MR JRR@@00 C Rln ̌! 0 B Rk00@C T:Rb@S 00 C RZ ! 0 B RW00@C T:RN @.RU00 C R@ ! 0 BRA00@C T:R8  P@.R?00 C R* ! 0 BR,00@C T:0 B@ R, 00 C Rn ̌! 0 B R00@C T:r  /R@/yyyT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$IO-$MR"X *0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0sƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0rp%P0 G`r."D㐲(97 @AP{p { oc 0r`.0r [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0]'@Q.0]@Pzp z Oc 0er@.0_r@P[p{}d 0]%`Q.0] & (J/0 !# F[ BQA! A@ `p{ d 0](PA.0]wT$Ѝ{p(_d 0]PE.0]p @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųжܲH-Xct DcH-88 aP  HԱ pO-M0,0 04 0$0 ppQ0 qR?"c@qGw@T0g003`Vg pp(p3`ȷ嘧 |gt7&s'p7v'Pl7 `%  p"1'?Xw&BnpVLw^eH$k @-@4P P 0/sWW0H-PP9.@T  0' 3/P u0H-ph`@㏳P PT@ t  P`  WK-@pPP UWY% W- T&9/P pG§PP`Vptt t0 0FSr\\ \0 0GJrY@@ @0 0H@rW:nrJZ"Np@-@`PR  p@" 0 0 r!p@-@P`R  p@  0 0 rp@-@P`P' T P   @@PD  A#q B0S0S@Lp 0 0qTTTT8TO-MPtll\qpW9 PP @ `U P P#Q P  1/1/Y p `PPW:#W*`@@pW@xxp A S`PT P@UЍSSSSSStSPS(SRRRR0H-@P$ 1  A#q B0S0S=P ll P P4PL0 0 0&qI[R(RQQQO-sM8p `Q W$ [, v4@P$Q QAOVp|  0`FdQ`Q\Qqpqaxa'pPxx x0 0Pp[\\ \0 0QpvnrT!Qsߍ1b `8mH-M0 0 Ѝa MH- M 0  0 ЍHЍ/a H-MЍH-|pPpX@Ig`P`u`pPu` V XXP^`ga P  `0Q`0pp0Qp \ X0X /XAa MH-M   XЍH Ѝ/` MH-M00 0 XЍHЍ/L` O-M@`S; p!W!VP Yj Z7 fP pU6@Q qT @S -P[p IlpC0 *g9!1 0=o 0 0QoW  gdpGi-PP  YdZ0@  fpfIlpЍ88 80 0ofhfeAMH-M  0 ЍHЍ/MH-M 0 00.ЍHЍ/H-M@PP8 S,pP/ `]P+  @,ᲤPJPäqpp  00`|pp@$0 p(,   0hpЍ 0 0>Oo\ [ \ \ p@-@P Pe`gf&p 0 0;1oe@-R@ Xp@-@PQ; 0QQ 1dP p p @QcQp 00 B Pu`Q  VbQpp 0 0<n~|dp@-P@`e( 0@epY O-MMȯ` @X0 [ 0QmpP cP :p` \  PhAP< ~[ Bp$v v堖\Odv`v\v5ohvBύƍ, D0p&6Hg 0pƍˠƍxƍp`PJg`bP`X@ h@ BlcBd8 4,(pg\0p0``0@帐D$@@DP[U%UT, p`V J dBQ :X P `P  /? 0nPg00pU KߠӠdH`@ Pt P *P@0P@0D P:$T6t @ZP*8lHPTlx$htTTlxT0<( H @*T 0D P Qd @ 0D Q:d vPr >@n0@ PQPS\0@XP @0@ Q!P0@ Q:$P7Qpl$ p ` p `00pQ@ 6+@/@,@) @@@ʌ@! @ @ˌ@ˌ@Q `  \\P ̅0@`  ` zj@@0 A R1@0 A R:0 $QR pl$ Pl p 0R d@R `P`P P`Pd@`PPpl$ @? 0p`P / aTX0Ppppx0Q@p0T ` dp`P`Cd`pd`pDV`V`CPT `  0P'PU6 DȀ@pP ײPD1 H4d`I     P P @p  Pn `n k   7  QD `D/ d   * ~ Q: `:n`' @3P `    P `P ` dPT P `o` 5  O  K P `BulP{ `{DP >P `Ts @ELpP@ XBP|P `Q dP  _ 0hPo  PR@ Aq4Dd P 7PDX XPT`P-`0u` DNPC/`T  P @GPd@4 uTAd@ : UE+e- P jP cPQA110@000 B0 0P]B@@  _0Q`TPL pPX@H`dAUppp@\H`dP U@P U~XL\PEX@ RX\L PLm UjLXi Y EQ 00d@ T Ap@LXDP, @PH`@7  P `@1  P `@+  P `Q `QQ `QP `QP `LXLXpD?P `p#oxP`ʌ Q00BB/p. p0@``LXBP@PRa@T- u{ڀUBj`00PB/`Qz:d`PtP `PUP `P NP `XP8P `P `P `PPP(P `P q`-Pu`B_@Kj0 0`㻶PpF KPA @BO`6j0 0᧶p0 0P `P `P `PP ```ͯ`VD`H`dP: UP J G^T0P:tT d0 P p Q R R R0%"0.!R!U0@P@*  08@R"8@S p 0\8@@ p @T܋8@R8@0Q \ `\P 8z T@8P@p@eWY`Pd@`@LX H`0 TQRZ <J`JT儀VP V?0P0 <:hpP Q hZP ( G Wp/ P :hP gQ hZP0 u/? 0g00pz!n A0  @PTS@0Rv 0rqPp8@  0@N!@ E0 k%\ X pT 0 R@ U: 0P`pYc! F00p0d^ X0T0S X  0V0 P X@ g 0S@X@pP ``` ``gfff/? 0BgQMg0P.    Q :hQ P hZPg0/? 0g0PgP     0 Q  :hQ_ Ph hYPb XbhVpP VpPp ;:pXN QX YPpg0P G Wph/ P :X gQ YP0 O/? 0f0p!/? 0fPg0X h/? 0zf0Qg DR^R PpPp =:pX= QG CYPg0?7R D T@/ P :X gQ #YP0 /? 0&f0pXX/X? 0f0QgT P Q:0pX0 P#P@ dP0pU5T2P 0  S 0*@0pPED4P @H T @T VQO:hQ; PD hXP> mP 0P(00 BS0:X gNP- X0P00& F@#/0  S 0:X dPQ pX0P00 )@dP04P SA   :X gNQ NX 0P  @ 04EPFP?R0000?:X gNQ7 )X0P002 @E UP R  :X gNQ  X0 P  /? 0e000@,S:X6 P0000gT ( S :X Q W P  {/? 0d0P/? 0dP/? 0dg/? 0dtt/t? 0d./?& 0di/? 0dPg0 JRQRppPp =:hPl 0pQ: hPWPg02 D T@. P :hP gQ h1WP0 pp.p> 04d00pgPX P\P LQ@@PQ  LPXpPE\ pGXpWPp@@UpXPpLPP\p pGR :hP Q hVPg 0 >G -= 0c0Qg PP\ppHWpWR:hP Q hVP `p ` `,`< 0cQg 0\@PP | pRp s:hP= QG hoV P -g0cG Wp  R  :hP gQ hOV0 P  + ; 0Rc0RF *: 0Dc0Q g"P0pPP\TdPhP]HE(  0%B/Q0  :X! P* UP$ "\ \)\9 0cr )9 0b0 )9 0bPg0  (8 0bQ g0s'0PD4P @@T@TQ:Xs P} UPXg0u@sqcs70 .tC~1T r0 ½:0 ~ P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX: PI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@G4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0c]gfffK-M@`V`PT p]p]Q Ѝ p]p]P ]@Ợ]@Ѝ PF\`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UppP `UG\ X G`GWP!"+G@Q '"00@0r pPu @Q P USPO /P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  K\`"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLNP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQk]P (@ W,p{J @v @1`t8W (@TZ T  J@DK Q(@R P 8.P @848@8m@P P Q_P 8p<0pSD0`'4p  S4@0PWP o  pPQ ` `  `PP:@ (@@` @Pj VV b(@P  @Q+P8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y P! $(P*< 8P <p_ 8P ( P#P6 Tne(`Ph@8r T@0W@ PЍЍ[[ 0PJ @8 ,pP` @P`@8p0PPDPPV   8(@`FP  {8 (P @P   k( P`W`P @! L(P 8@Pz@9LP pD4$PQ D @ @ 8P @0P< Y BoD [JR $P PPRm4P f YXPD6  P: P  8PV Z.  PߢZ(! 8P @ (pH@ `Pg`40 (P ,pP@ 8LP 8(P4/0(,pi,p@T@D0P f`,p0(`4P: Y8 'P 8(P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1DX ,p0(PD d @ x  L  H-MP`@XpVU PPP Q:R:P PXpЍXPTPR ":S S/$/ /0H-@PP:P QP]PP@0H-P`@pR:pPpFP p@Q   R@U0 12 xO- MP QepB`  @ R T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PwP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-,A-RM(P@FVD@,  (  `㓊H  0ޤ $` `````VV&H-넌H-p@-`@P PV P PVPM`P  Ip 0 0?@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\ށ` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!< U!0@PP4U28<Q0  P p_ P$D <&U @Q l0q0pS*`v 4pl8|PhUXPQ lUPljp < eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U pN  `1\0 @`\0X 0Q @0 !R8<Q=l! RH@PPH~ 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!a\ X |lPA|4pQ b.PPh X`Q pQAH ]NHV f1lP.l`X<  BQ| R`P XhPQ pQAH -NHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R Bꋅ O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ NN"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-m|K-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! @P O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝ  O-MD@ ݗT `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  K"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp kJX h 2 @=@ ` v @ R 2K"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q zJ"P@!@@ ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁN-I0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@0舰H-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P 緞 TQU  tĈPU P 睞 xxPtPEQLUPP $} ؽ b a p 0H-P @!P:0HdPPQ TaH0!S A ,0HT ! A0 8P H-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! ;!P : ᘍ7!P: ᒍQ& ޝ0!S  ҝPPQ ɝ0`!S `缝d! P$! ` ԫ x t ,D P13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@5GZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP qpWHPa pqpP 똡 猁PP$ fPG pT !P:ᅌQ ՜1 0RA ʜ  A@[ p`WP ḜpW3P pPP HPQP L⛜PЍ D ԰Xܶ l K-` rW WPF  V:RUPFF 1` fP@VPPR5Q:UPR:LY! !P: lPPQ \CP0!S 47$! H  س  0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-M@Pp U mE@H((!(1 0ECP3 ` @xP3JpQ Q& ]zp%   P'1P @`  lhP`  \00@$ 0( ,@%E"EOЍGAG l z0H-@P %:@PPP:0 0 0=ZCEQt@-@P @P@ 0 0I=C!EQEp@-`PPE aP rP wP9,/ < 0e@CT0APx5 S +S4 ; pDp 0 0>BD8D=Dp@-@P; P3 9 0P QQ 7P Q 1/pPӼ M0P @ P E0@0`aa9 ``p?D p 0 08B"CTCt@-@P 0QQA  0 0;xBBC0H-@Pa Pp0P HC @H0P @ P ݈0<PPP 80 6P%P7 PPgGb!$P  5/PP0 @ P0 0 0JBKA}A$ d @-@P P@?6 0 0;A@AH-M0 xCЍ0\ \ \P NЍ4 'eЍ Ѝ6@  //O-OM`PBC<PwpP3 @VQ   xP &CP"CPCV 0 p x|Z zҰ pDp4,  0P8P0  BV wP P > X P 6 Q P4P PQ *Q Q4@>P3  P0!! P$00oP0 p|@P73(, 0<0 R5PX Q! V0 XA/Q v12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0>BP-;BP3Q&@P"l ! 2/@P(pSP !D 0@0!NPuu BBP@BP Oߍ4$$]P  p`0 P  p`0P @AP9APa@ < ;T0A-@PㆄP UQ `pzP U  &1!!UAPAPH-4!@9 P APPP 僆@P  @!vP U}APQ NoppWP ap uYU dAPP/0H-@PG0@-@R * 0 0@^DAAA,H-Q p2A@-@S )A,  0@6@-@ A,  S 0@AO-M@S`p $PPJW $(XPv Z WW)(Q;$ ($($[  0`PU  P([([$g(p (X!1 0? R(Z (Q 0*P  (Q P$ $!1 0>u@,Ѝ(p pQ   0pp>pQ Ѝ 1S R00: W $Ѝ 0 ,S  Bp  N (qЍ55505w0H-Q 2@0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ fP.  pؑ ` D' ? pa㮂P !( !9 PD  , U , 0 ЍOgЍ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/4p APP`P@U 8Q 0,`jP ލ>O>,ލa1O-MP@ ! `2/,( 0<V`Q0 0b P{  尀@X_:@ `YVZ :FW wP,Z 0 p+mP!y@lmP3   0!P  `@㲀V `Y ) Q] QA0 _m P;@ @P Qg R  Ѝ e P 9g P  e P(@Y TP ( B  ($ @$=O-Mp`@ S [9p P`W  $80p` " (12/ Q, P  ` F P,  <O@T p }pἁ@Ѝ$p( 2q"k,<<P`< ` +P ` +P pP ; 0- {XX X0* 0:aFb1 \ < ԏ ؎ 8 | d M)q%%%  0H-@Q P-P 0_<0A-M@`pQ P,PW J<PЍ P ` P r 0!P!@ ,P ,G- Q|  D Ƞ " @!D!Ƞ! #@#h#L0"8 "$ ! @ @BT 0 `* rQ~ QP P Q"40A Q0Pp` @p`P @  0@ p`@Ppp``P`p `0p P0p` P 0  0 0 @0 0   00  0 0 @  0P. P) Q"4 0A0Q `@P``0p@P`p0 0 P p ` 0 0@ p ` P 0@ 0 0b9?~   G- QW @@T* rQ~ QP  QP"4 0A QP "x"4pp00`@"`@ @P p`Ppp```p `0p @0p` @ 0  0 0 P0 0   00  0 @0 P @  0P.  QP"4 0A% 0Q 0`00P@pP@`p 0 P p ` 0 0@ p ` P 0@ t h \" p!t`!h! P#Tp#x`#l0"8 "$  0P p ` 0 0b8p@-P@Q `*`'`p" *p P  P P a~~m`P`pp@-MP@Q `*`T 9Ѝp "    *P @ !pb1   `! k**P Ѝp  Ѝpb1@-Rq0 @8@-@ / ?!BC4 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW# Pp !;@a @V p0oW  q pYpo@`W@@T 00 0  `pW; p`W:B{pP- {P$ TDY ā o2   dPppYp}Ѝ` 0ppdP0S  @!4@qWF 0 Q  ![( @p@ v Q0S0`S 0psdP@ @  R `@@ @0 06,(( (0 06PVC2H- 0A1Π\1>-1!!K-M`qWWЍ@P ?}ppW R T T  0 dP U P M7}ЍЍ 00 !     /p@-`k@p PV mp p8`k7`pA-CMLaP@`,lQ$!1,P00 P P:7?-$  Ok,Pp ,lp  lkp T lp  5k 7@ .k_k7@P,PCލpw :O-DM p` @@Q P/(P XXw P0S@PP%{7X(P r7@ QDЍ5 ;p ,00 ( 040 P(p0S &p $0 8 8 <0 P `PX  U'P 1 0@p7 0cPE  @'P0 0! ⰱ BRᴰ&:QQ @P*p P :PJ   '~䱄 P[   '4  ' Pi 0XP  o']P    !   BR *0  0 ^ |P @S@P0n*pS*@ 0! A 0 q! P ( PQP"!娱P P PR  P@U8*pQ!  & X    P] 㰰o a 0 0b4 0 0 0b4 ,, ,0 0b4,v 6 j p p Ls r   q b   O-M`PQ @&@ U U =P P p0  P  P@@T *pU*  P 00'07b 0/4P@X)*qEoR@P  P 0  p @PP@@T*   :&UXX&X6b 03<<&<6b 03  Pd  P PQq5(k5Ѝ |%P `P@U=*8EP @ % @P `QA % W%D`P 1  ApP@U*  lP  %X  P@U*   %o"%, P%Ue ZO 2! %P~ `pZ@@T*pP y%뼡Zll#l3b 023Z Y㴀 pIx !01   O% $P? `W pG =% $P- `QOu P `@QZ?  %qWD  2! $P `WP  %qW @Y㴀  #!1b 02x p$ `$P `P@U*奀Yⴀp $  J$`P 0 0b2  cPtt t0 0bw2hh h0 0bn2Bv|    . 4    6<$28O-M(p Q R QR @P  p   p  p E `P@L @Q01`@X*   @R 0 A(@ Q R QAˁЍ ( EWT Z J  P[ @@T*p P  Pi ZK @@T*p PQ Pq#P2 @ QPP  #W㰡  갡    0P((O   0ᰡ P Ѝ(()Q /#P @ @P@U<* ?P  #(( ( ( #  0 0bF14dd d0 0b=1aXX X0 0b41l(( (0 0b+1NT *0>rxO- MPp,ATw  2! "P T`@ p@ @Y* PP. yPdP ^!1b 00 p@[  AR 0 1   ".@Z+*  0@S000B @ "P "p pPpPp Ѝ,, ,0 0b|0JPp@-P@Q ""P    "Q `"P    "ppp@-M@P  0PЍ 0 0540pO-MM`p@PV TUP WJ PJ P1? F @Y:@/"P 1hP ЍۍV @,XP>JIY*F  @;{YFG    U -dp JT$ RfpDT1P P p尀8? $P P0PpP3fP* P+1 /P HXf/P   P 1{y<< <0 0Xm/H1@oᠲjG^  T8<^ @-R@QPTP#A-M`|-@(ptplhh  #@ HPT P T |PЍ$ D[ $ H-(MQ@PD▆fPU 傆`P% t @p!0    PP_} Q p T(Ѝ fP' `#+`0 : p  `TepIe`)VeP ᎅ `$`/`P L<O-M⤑$ Q"`Hp  #  #@ V8  V-U)]`Hp  " <<<<@ V V `   PЍ$$ $$ X d P X O-TMAPE[ B*Cp`? "TP CYL? PQ[Y*[   ~ pp"@Z*p@Z:`@dp   jVp`p@`@P:Y p  [ c"A @ @ s PPTЍ8 0 0-Y 0 0-dd d0 0f-[:HH H0 0-V _;fU O-|M@xd+yP(`h  tplh "@ Hp W:U d U *Lx P|Ѝ$ =T H S p@-(M|` P`$9 @T L T $P(Ѝp $ tS T O-AM  Q0p(P$0 Lp Pp 0H(H}{(Hⰰ  r  z! \\\\@  2 0 U{p,  P)H( " Q H (PH`b h e  I! ] Pp (PAߍ-R Q A-(MⰀP@q$ p `lV | V $P(ЍDD D0 0, $  aP  O-M P@  `,`(`$` ````` ````T PQ0F?v`QLb4HHRL`(("0 0`2r  HDP,($ p@    ,($   @   ,($ p@  , h P:ZPD   F J P  @P@ePfd`PЍ*, O @h XM @-@@ᎂ $ @B 8   H-@P~`{p$ * #q(HbO-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.gr .4*Z`.4RXp@-@`PP Ri (aP(pO- Mp @PPw `PF  ]p@Q  @崀X  QI R   <PK p@W *@  K P* 00!01b 0h"崀@@T5*pX @T  PP! P Q  xᴀ@ ЍQ g(( (0 0b#"O-MPp,  @Pv ` j0t @1 @  /  `PX `@@T*  x@ @ P HP㨀 X  z@T@J$4b 0!  " ( @@T*zpQQ @cP  @z Q(  뼠 @ЍQ DP @@T* U Q8     q Wq  2! P `ᴰW@@T*p P8 q0W7"2b 0C! w  A Ts  2! Pn `TP5 \AT4W 0X㴰 1 pH{ ! @ᴀ@= P` `W pG1 , @Z @Zⴰ ' { @ P `p@W *pZⴰ@ 0b 0   @#XX X0 0b (( (0 0b !6flʼ"(*Z`2bhR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/00/p P @-0 @(@! $@/_O-0M$ `pP@  (,V0 pPD$@g#%"A4O`P,"q`pq (p,pi A p( p p'p p  (@0 p  @S,@@0A$((" ! $%)@@PsA`y''  cqAv'eCE$L$   $`c'@p@  (p  @' @$@ p 0Q ` pP@0 ` 0ЍL_^A-RE ` P?@Q @pa(W0 %(LP@D @T:(p@ >@P@@D ?T @T :0@P@@D ?TT ( H- K-@P6 `P? q<W (7W (7g)7 ( ?W (?'  8@D((P ( 2/ PhP @-0 @(@ $@/$\H-\H- P @-8@ @P@DHL@/[O-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P O-P U  @A,P  5/@PX !P @ ЍDD D0 0G Y(( (0 0H {nnLSnnnp@-P$ @`) PU5 P`AV ,0 3/PP`VDQ 1/`|@@ cp$PcpP ^ ``@`p pp@-@P& PUpP`@V ,0 3/PP`VDQ p@/@pp 0 0Z ll@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0R/q Q/ R0/@-@P5 P 0 P @0P QQ0 $0 P   a 0 0< @iri O-Mtc@T` P 2APJ p @oᡒW  PLp(P{TPQxPM"p0 @㥙PzJPPq FA/QV PPPPP<PPPPPPPPHPPPPPPPPPPPPPPPPPPPPP<PPPPPPPPHPKP9 ux!  GڀpYP PQPp*  6  ^PP P U C   PЍ/DD D0 0| 0DD D0 0 x fCf hh  L ef.)p@-M`P@P, U4 V< P G@p*A/o"P  L  Q(   Q Ѝp  Ѝp ll l0 0o UPP P0 0e V44 40 0[ dedddtddd$ p@-M@P1 0P#`0Ta`V ``0TP OU```0UTXa 0UXX \\\P`0_Ѝp 0H-@P 0_0TQ`0U TPP `0 TX!0XXP_0 @-@PP 0_0XQXTO_0@_H 0H-@|P 0P_U 0\Q\`}`0XQXTO_00H_0 @-0M4@@,  P, Q0Ѝ 0H-@PQ 0 0HD? 0 09t,@aap@-M($`P4@`P 08PpЍp O- M80`<4P P@]@p[c WpVpT D#P:PC ` D0  @ P `P Q < 80 YP" SP"PPPV < 80W Y SP@ P  Ѝ@@ @0 0K(( (0 0M _ ~ _X |p@-P`@P PV' P =PJ% 0%p ,phh h0 0APP P0 0BV44 40 0C _>_B_^_-_^^3 H-M@P`P- P3U; p|  0Pp ) P ,P ЍH<Ѝhh h0 0TrPP P0 0UiU44 40 0V_]^]]]]Y]]H-MP`@P  pPP 0pJ 0s *0<  Ѝ@@ @0 0i,(( (0 0j#\\\i\\\@-@P PP@X<@@ @0 0{(( (0 0|[d\*\[@\\=00ꐺ O-M`pPP W G"P y XЍ@P+T -T @0T  `0T`W` xP0@ Qa@"Q#n*`@P?U  p 0zUK[ [ @pI" $!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" S! @T "Q/@X QPPPЍA@Q| 0 0?5KJD)Y<?H- P,Б Z` 0H-MhP0@PX   ;%P PЍ0f댶 ZH-  PБ@YH- P,Б YT H-  PБXH- P,Б Xȵ H-  PБ LXH- P,Б zX< H-  PБhWH- P,Б WW H-  PБEXWH- P,Б 4W$ H-  PБ"VH- P,Б V H-  PБdVH- P,Б *V H-  PБ UH- P,Б U H-  PБ pUH- P,Б@ 6U H-  PБ@TH- P,Б Th H-  PБs|TH- P,Б bBTܰ H-  PБ PTH- P(Б @Sܯ H-  PБ/SH- P(Б \Sh H-  PБ S @/ /H-M 0ЍH-@P`p%4#@ W5#0 p@-MP P!`/"/R?#?@@6//" !PЍp  0S RP/0?c0 3??oP/0H-TP @@P@ ?oP P00舭 ZO-M(@Q [ Z# oo A R>:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /e@- 0@Q$P / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-pP@Q`T W   Q 0 0MN*Ns R US  R/ /p@-P`@R Q U T  Qp 0 0dLfM2 S#%U#/!R  Q0///-R/p@-Md`@ Px`6666PЍp 0H-MMdd@ddPRP  @P#  @@p 5 띝LYLLH-0 G-M pPdpKXBX`@`zPA`` AB+Q8 `````R000!01U0P0 PP0  0  0 Pp$ 4 @- 40 0NTPލa F E KJEJJpD \L(D kyC 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   4`QP  Q 1/W  3N5t @-0M@ $(,D?P:\ D   1, 6PC0ЍX@-0M@, $(D?P:5  0 PC0Ѝ@-@C5@C5/, H-M00 00>5Ѝ贗 MH-M 0 00ЍHЍ/P /8 p H-@-D@@4@@p kg@ȓ//////? //O-4M@PqPpS@pPi pԡԱ!1aސ  0`Q*@T At @ T@(!(0 @PQ  0S0 0@ 0R:96,($   (4/4Ѝ$$ $0 0B4CFCԔȔDDDDC |t///O-M`{@Pp`Q T U v p`PUP %P T4 0ppxZP l($8LX8HXd*XS 0H Q 0H Q: P Q 0A0@ Q: 0{wytio0m i@ea`plQP0 00p`Q M I E/BX ` y  m p`w I ǟ Q`c   p'  | `t  h 0`Ɵ 0x`QR `<JpcP p@ W pW  K 0`k8Ɵ Y  M `V <@pp9p00?o#0Q -0CpEppʀ%5V 0 @z0`&  @z0` @z`0000rRQ P P- PWp  * &2&b @S0 p9p . 10a@S `9 0Q00 p Z:p0   0! J0  Gc z `: p 00apG R  p 0 p ps 0  Y+ I 0 00P` T4`FVZ ` T04 T4 00Z` T*``` RP T04 BR  BR T04 BR 0W T 4 4pWp P T4@Pʃ ~@| z`tp``v0 TKppxx x0 0UH\\ \0 0v@^TPЍ l 8F8P878\<*=]H\: A-@P PX P`ppGX`WڼP 4/P 0 0:K7|77< K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0FbQJ`PU+c(c XP  u=P $QЍۍH먆 ԅ O-MMTa@ PU`p Q RЍۍ/ ' 2 ' 2- qpqpQ'`0HX'  0aPJ`PUbb   0 `oP`` ``ꐅ \ L O-MM⤏`Pxt  T PP Pd `a || Xp0  0  U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG ̌P? p. J./̌P2JP P  Q%Q Q QQ  QX M̌P  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;P4 X0>\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0㬢P ]P[``s F0 / i\ 0pP,PHX`a8P ᇿ`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|{,P PuJh&0_,P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 hX0Y F Le! \-p`  ,PJ`  X0wX P 0oO+@P ~ FPD``儍h E0 dd- 2`\T\`'LF"P ``8 E0 - .` X \L($!  X0L P`` uE0 PP, ` \hYJ \\PP  P t$P``刋h DE0 hh+ j`\h x " XPh 0 0Y d  8 \LhP% hZPP4  `  XP 00ZY P0  `P \`L  L v\L X0 ^ L\`P 4PY @P8PcxtX$HTPPP@2 p $|X66PPgP5J. |J| 4,PJPP PPP P(@ P z PJ o  +Pu> g*WpPQT@ptP^J^ : X2d  *PPp@DhP`q *PmPA h^ Y`@ ꌁ \  @X0hPq R:q )PPA  ,T hI q  R,#J)PڴA Xh1 `a   XP0@h0Y $Pp` C0 xx$ ࿄UP D $@\`p`!! QX0 `a  p X0 R ` "\ R   y qW )P6t xl0p00 07/PU qPEP P _ $@SP< $Pp` 2C0 # Xp B RP笂h`;-$Pp` C0 PP" +@Pd ` wPup` B0 ! fp$b$_  0 -m`QP X ($D@Y$@|htQP=H  RH Z \$@PLP *<'P#p$ <@U @=P`` BXX 0  ྃ`< &QߍۍÝCzok s q,o $n t xr *!n hq I Z0l m x ((v &&@z )X3'(w x (f'^&(#x Y({ !+z e*Tw &u u v v ^&Tv { *%p x o G-8MMp`P4@, X0  ;3 P 3+K3 /BPH30 4z@4P8Ѝۍ>j DHj / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ (P P)p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp    T 0ἁ  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 , Z P$Ѝۍ.PȐ А 0!(/<  | 0t#x s0/?r s0wpp5PPP`2`$g 8e |e ]e $e O-4MMp0`` Z R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^ʗ=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ YP0P4ЍۍpPPP Y Y<P0$ R 0d ` h` \` pa O- MMAp`@ &P P Ѝۍʚ4P $ƀP `d+0@PQ1 P@Q$ `E3P  @Q ER @ R``PK  H` `5` 9_ _ K-AM(@0P `p  V  0V ` ` 05 P P YP 0@.Pl  ` p`84 0 $QAލ)X^ O-TM`刀xp A v P B  0=@X YPPPPp W@/P WB WmYk `PP I0 PWP`JPxpXz`XW|PPL A QI A0WPBJ@ XXpX~X P @"` I Q'x p ppkXzhXiXvbX@PLV | PpL   @ETЍD\ A-P`@p p@ Q)``-X Xp&X``PiXPX qE  A- Pp@` ` A0Rp RQ$WW` (P`EV:44 40= 0GvWE    O-MMLP  W cU  q/  " `@@ lVA@lF5 p@@@S/P PpBA<̟<`8 … `,(@ cWd d  PQ `` F\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 >~P `v+0=P , \8H` @0($$+0k=P #P;P  P&  PO  Px  P  P P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@GP( 0@ P h0 P  Y;Y yQJ@ @ P @ ᠥ 08Px  1P,qH l0 P0hdP P v @H54  0/ @ <0PI X PA E_BP& 4 y PA D _P `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (0l< R(P2c(P<uP(P%(0P x|8dd<  P!|ۨ@|h"p 0rapφA"xb"|3x#%5v 0UUUP P`P v㒖Pv.P D4P1 `pHpPP a .PpRW :P@.PPV*GWp MDQ PH@PzQ?P   &Qߍۍarpaip6.intDX   LKlĐ${w(O M R `P XQ O s@B.!kK-䁙PJ]  `Q vP@PU*p H AX xp C!Tx: |p 6 u1P o10H-MA V!4PTPP!Ѝ0Gp@-pM|``lQ P P 6P  /P0PdPj Eyfdd` :y[ PQ ,yMId yHq:    Z& Pc ?P? ! +BZ PO ?P? ! B(PP P P  Ѝ-/ hoU9%6JA-M\aP`@l3h##<10 "=p Q9xq, sW qkx|0x#T0%0P00L0H\X`H 0$xp 0 xP T T000Ѝ?T  pppЍ@@??H-@PJPQ vO`p`V*p q Q/( Q/K- \R 0pP P U0pUa@V@@TÁV C `@ `@ `@ `@-0@@P @8x?  @-@P @8xEl @-@@P V> @-@P L/ O-QMP@P pW xP P`)P  , P$(`#X:zP(`U#Xt* P Po;Px tP PP `tP PX $ P$8  P U:$` E E Z #P P ` V:  1 F ZHPQx* Ru ,(`PE$ P$#X:៤ @ᗤ @_ᑤX`   0W G:1pGWB:`GPpR; `FQpPXR V(: PP FP @`Y:  IPP -Qߍ(< - @Qߍ @-@@ @0 0|(( (0 0"VR p@-M`@P. P   IwP ` V:P 7PЍp Ѝpߣ Ѝp 0 0& O-M||x|| p@T ,X@@0(@|Ta TudDPdpHHHHD$D885T pU U X`VDQL PQ Q4' !R6 (Pn PPm pAhV@F5 T&2 /oAo"VT`F`A@DfHy V*P U*'D<P0WpE  XPE& 0%585,%!~%Q t dTH@8P DR(T섟pʲt@Pp$o0S !<34010StpaVqtq X(:`P 'Pq Qူ1Ȱ@ a*P PH@A *P ! B гR @@s娃pQ  ',Qq  Rၰ1P/ 'Pq.*Qpp1%Ȱ )Pz DAPa`)Pq ! B @@r@Q p@@`^p )PS @ E@ Q0)PI ! Bp  ddqd pXA@P8P,P@-ЍP 'PqnjQ`1`Qp%P @@i)P A` PpPp$ЍЍ\{4#$<707@7,7///86Ѓ8<1///܀//555x5t10000l5(\66 T5 4? <4<4(443333l6t3$3222̀\܆L211x1|1H-MPPL \TaT`@ P@DQ 05qP% .qP P p$qP pW:PbTpЍ  !  0B3Ѝdd d  0 0/ -p. ` 0 2<-,-e O-M Q = R  LP @ P XQ , P  , 0||p0t|p0d, PPPP|P p 8\P0  (  :R 0`B6V  `0`P``R ` ;R`ۧ0r0vP@v0@PK@ `|; D0 h+Q ` H+ @@k` 8Q (Q + 0 S ;000Q @P) ˟ ;0[P,P *   ,j`VhVPhZP(P 0  0 R0,P  `P`FP  EPPP3 R@ 'P) F` ` P  UZ#P$ `@ 8p P ) @U@pH P t p @T@,XT) `  890Br@$ T@+ 1sPv P  80r@T@ Zhs`PH@|8 T0pXP@V  @, H@@8 04XP,H@ `V@ &  P  D 0য়  R`P @P"PP @4P\@DDLT`hpxhR RT& @UP@y* @ R P` 0AS006P |PQ `;Q`ۧq@vPv0T @ 5  R00/䤟  R& 0`AS006V ``P``Q `;Q`ۧ0q0vP@v0@PP A6P 0Q p 0 P :RSEC@\$  L4P0<^ ( `V ``B6P @R P ;RPۧr0u@u`S PsPm,2 0$ Z><AЍ753睋P) @P P p匁 p`V *PDЍЍ @BЍP/ Ѝ\dL,P,4,,,+8. ++. +++++++t+ 8z ++u**`*\*H*,**T )) h ! |" H!    lu)x)l)t)4)T) )p#H#D#x"4#"",{l"\"z !!)(%((('''t'h'$|X&@& {0<'0'&'{&&&&h&&y(&&%z%%%`%t%@zh%0%p$d$t$@$<$!!Hv`!P!y##(|A0H-P @@ D R08P$P  !      P0 @P000 0 00$,@A-0` PD @ ` P= P`P[p`P,PQ!0` P0P``0P0P  P( `P$p(htL/O-MP稱q娡娑威 p P AT `Mx@hdA`T  , PQ!0 00 @P(P P$ |x  `1P0PP0ЍPTP\PH- Bo'l @-@P !R' R  00 !0!000T \hA0`  00LL @  <@,p``(P/@-@\P PQ@  P  %@%Q|d%H-P)   0  , 0xQp  !R`!X0 P 00<< 0 lxP/@-@=  R  1S 001l000dA0\00HH @ @@/,  |H-PPU+ ``AT& pqP $$Vq Fl  Q X 0Pp p00< @p߽ qRBApԽ 0@ 0 @T;sFᴠ 8 Q8 (4@ⱜpP ЍOFЍ 0q 0 `` `0u 0 << <0} 00$vzBЩ'O-M4PP34 $ 0`2S D @  A2s2U$ @Z @H XZ允` PY 8P` P P @GP 0, `PP@`P Y  0!Y $0?=2Qa0s `Qڻ` p`R pR  ?=2 q@"! $p @h# P$ TDp aP T R @C P+0<R !0D0 C P \ W=1 Z`0/-"1p@@ ` 0t՛P ` pᰠ  PᲐYH 㱀I`@ Ѝ P) `K @+ %,D  1X8aZ  D B`` `(( (0 0BlTG-MP p|Ppx@(Q `P`@P n`S <V  @< Y @ / 0aa03! Q`S!Q  `)`p9 P P O1,P `P& ` V" P!$!8!| 0p@`P  +Q  PQ"4 0@Ѝ `PPP P06 0 0 0 n긠5<ؠUXO-MM8R`@PLp P@{pm P, 88P U Q QP   P"4"x"\ 0pP  PQ/ @QPY <Z p +@< pW @  / 0aq03! QpS!Q  p(qQ O QЍ؍e|Xڠ8G-` P  JpAP  A  !㴌8qK-MPQ ,@$ p@P $p7`A8PP$ P 0,lPP /-"1pЍK 0W 0p (O-M`@v yڰ@p@W*Vs w V p@wGqpPpwA@ATE*p@ P `V)@ಠZ  Q R@pP p@wDp PP B  App@W * V"2y 0"2 0Pp@W*Y^ w@Y ` @ Y @ t Pp@w潹qpPpwAAX!* Zpᲀ  ,PP& Pp@W *tPYHH!H1 0,,!,1 0ЍЍp 0 0b`|| |0 0e|`` `0 0krVtXX X0 0gr#,™ә›ԙnRd*_<K-@P`pPV% W Q! Qp  RpQ R  P0 Q`U Gp Q: P00 ,P  BABX*q PV㲀 UU 8@8(( (0 0 RΗdO-Mp (R B@pP U `" `ተP #P$ 0P p 0 P<@@`FpP UV P ЍЍЍp@- @P0P`㴗 P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0Pᇗ`PbQ 0PxPV 张`Ა# 0S 0p[0G ) R-$p q(9 ᲀ᱐R 0㼠QP/  Hp 0,pp% P pQ 0p.P  (P$p q$pЍO-M`p @ Q P@Q'PP@P ^)P> [+ (P  P0P . P$ $ 0PږP   0PP@P P  x) Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P  @P. 0  0P% 0Pv@P 0 0P P   @@ ЍO-M@P 0 `p  @<ۏp P06pP  RQ 0S R Q Q  0PTpPOY 0@00``VI0s0 `08v@ 0NY` @*@岐P:฀ ᴐ@?R4*pᴐᲠ `P pḀ<`QpЍ 0f 0 0 0~hh h0} 0rHH H0 0gw{ʍSl#nA-MP`pQ @ㅿ@!P VY,\\,\\\/H!R*PD 0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ~ЍB P " @@W 0"P ! PG 0P Ѝ V Vp$p   0EЍO-$M\BP@p wQ p  p  U U  P 3 k`PW @pU Up `L P  pJ   PA w`Q*  0p蛡 A`P@.`)p@W2*pV*@ &1 C 0q @ "   ``h@@ P$Ѝv  R$$ $0 0b|KjjH-4QPv |8H-<Q $P4v 4v H-tQ\P PP  R 4  rH괋u \/O-MMll10 RIN``PW 0 @0 p, `Z):ԐĀ`p @0ppT@``![*tP P XL P <00PЍۍu뫪T-~-,A-0S  ppp2  P@`p@`p@ R *PU Ul@-M @""!ЍL@-MlP ЍXX@  @ 0 p P Ѝ耻8X/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/}*/z*/cw*/2t*/q*/n*/9k*/h*/e*/8b*/_*/\*/Y*/V*/ S*/P*/M*/0J*/QG*/D*/)A*/{>*/|;*/#8*/)5*/=2*//*/,*/")*/&*/#*/ */*/////^*/*/*/< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/_ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/^*/ [*/X*/U*/R*/O*/L*/p/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20260406225551Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s address%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest truncated%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist