08Pi'&<  'iSpP''`'". ".i'&P@@<@T 08Pi'&<  'iSpP''`'". ".i'&P@@<@TU i`'".yAiiiQ$f iiiRAiiiuAiiivAiiiwAiiiAiiiAiiiAiiiAiiimKps%iiiX`hpx$iii (08@HPX`hpS$=iiixP${iiisQ$iii (08@HPXtIAiiiCiiiAiiiAiiim<iii`hpx\$ iii$iii$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiii$`aiii (08@HPX`$iii$iii$iii$iii$iii$iii$iiiAiiiAiiiAiiiAiiiAiiiAiiiTQFo w8O^n ^6R*C'E8 ^`*u`XwvK0l%BcIO eϣ$o{+a%`]l*> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4Pp%4 (""(($22x` TTT,,$22Ptd()QtdNetBSDKwGPaXU,SR ffffUSWVP[o.t$DujPjjj謡jR30Fɉ$ux& Q/tu|$Tu?;(s(U9rA\|$u -t WHPH;sU9rHPZH$06v? PzCUSWV [hn.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]G.USWV[Ûl.; s' ~*u.UE9r^_[]-SWV[Ll.;s9r^_[f$SWl.5u1ƃ5$tЃ th$k_[SWök.4uYƃ4$t|$h<$kt(?t<$nktЃ_[WVD$0tP>tKj/Vt@Ƹ!"&PV"t&uVh"hȐ"h3[K^_`SWVh"h"h35K 1۸!"&PCPrFh3j fVwh%h3J uh3j 7Vj]?D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5t3 u$1^_[Vh"Vh"R 5p3hܓ"jwVh"jUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S(&tutD$D$$D$% D$t$@N D$l$hx3h$?D$ @l$0tD$PhB$?j >D$  |$\$4t$,s$L$)L >QPh"? D$  L$s()@L$L bQPhە"e?L$ D$  s D t 4h&h"9?L$ D dtPh "?D$(@9XU*\$D$T$T$9tt$N9BD$4h&5p3h*"> 1h^_[]t$|h"J%WS$h>"h["j%U5p3hy"j:t$|h"5p3hn"3$h"jhc 5t3 u15p3h-"jSWVPD$Hw#t$>H&Wt ubL&$h""Wt N1AQhc5t31 u 1^_[5p3hB"jOUSWVP|$t$7[h>"WV fu T+=p3u ԟ3)u p3uhA"I"t p3hjQ t3u 5p3hR"Ih8u3$(&SUt uUh{"jAh["je$NPVS& P3VF"3PhV"V? Vjjh"&&h"h3> ujQ35t3WVοV&tuVh"j脼&^_VPΉj PQ̹ x $9u^Vh"jKWVοV(&tuVh"jt,&^_USWV\$$103 ,33 3sV2j=Px<$h٣jjhP&U,3 L3H F H L3VP3uL3t;#=t%{ L3##=uthR"EL3tttut!tcuL3h ܯ3^_[] L3VhȖ"W Wh"4$h"4$h""j蕺hl"h"D$L$011PjPjt$h$\03,3331PjPjt$h",33h"j1hjPPt$h"331PjPPt$h"Ԥ,3tVjK0L3u$1PjPjt$h)"蜤33ËD$ȯ3h:"jw1hjPPt$hP"^ԯ3Я3h\"jCL3u$1PjPjt$hs"$03,3ËD$83h"j1hjPPt$h"D3@31hjPPt$h"辣33fSWV3t/ 33 t53)փ>8F u롨333 3 33;,3 03r*jU333 3 33^_[á3 3 t 3 3hb&h$jhb&h$jַh`&h$jŷh`&h$j贷USWVt$|$61U#SjSVWv u=ԟ3P]ȯ3u,ȯ3$̯3د3x&Ah"j5د3x&1QQPq ̯3y 5ȯ33 3 =,3rį3uhN"롡83u#<383"H3x&1L3HH3x& hQPӄ <3yJ1L3H H3 hP583Q <3 43y 58333L3utS1V 33393rZ 3t= 3 ,3@ 3t# 3) 3I ,3 3ujg3 33Я3 ԯ3t @3 D3t L3h`u;5@3 ,3=H3 D3503VP5<3W L31Vh3fhjhj53535 33h/-,3`L3t%`3X3 d3 \3;3 3ss$3 3tQj QjP( د353535̯3P$ xd53-31‰1 3 3=3 3X3\3=3 3L3 ȯ3xPh$ ,į3u6د3j53535̯3P  t5ȯ3h$ܯL3 33 33=3 3X3=3 3\3CL3s 33=3 3`3=3 3d3u@s)t33H 3PQQJ 33ܯ3=3 3j133133hz"j(Ph$jVWVܯ3=t=h=u <N3 3 3t;,39щ503s))Rj53 03 ,3 3 3 u\5T3=P3 tJ5,3j53b 03 ,3 3 33ʉ3)Ɖ=P35T3 t jY=<3uH3jPu 8u*H35<3Pt^_h2#j#h"USWV,3|$,t33(p‰D$l$|$,u N3 xT$ T3P3 t!H3jQP5<3R !ƒ~t$VSh3 $~ D$ `18D$ Z T3P3 ʋ-33t>5035,3QP赲33h3l31T3P3T$<$t$ 3-3l$13L$ p3t3D$11 43t,3u#3583h "$:T$43L$ AD$)ʋ$tЃ|1@|p9@|5P3T3*,31 03T$1 uKh3l3I$T$ 33)ѣ3 3503-,39p3t3$ t 3)PQ53 3133 33 t(p3h35t35l3QPVRY tjh%jz$^_[]583h/"583h՘"583h"jϭ583h$jUSWVt$(|$,\$$Uh3jz C4WVs(P( #8jUjz 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h"jUV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒuP8u F ́Ĵ^v$h$j跬VP议9v VrVPQ蔽 t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV3 3t/jhmS#jx 3 3tjhmS#jw 1t$PV脽FȺMb׋ 3-։+3D$H 3iى tL$ 1FD$|$ 5t35p35l35h35d35`35\35X3h"jdWP(,WPWj w 33 t?ƒ ʺX%t+#RQPhԙ"jd|$4W(WPWjv |3x3 t?ƒ ʺX%t+#RQPh"jd|$4W'WgPWjkv t$ 33 t?ƒ ʺX%t+#RQPh"jd|$4W\'WPWjv 3D$=3jPt$ t$VÉiL$it$V)QP賫RPVSt$Wh"jdt$@V&$VPVju e^_[]EVt$;Vmj fUSWVį35Я3=311Cد3W535̯3P$ MtgM3u5ȯ3h$詤د3W535̯3P$ ݅~į3t )u=3N{T,3rOH,3d5Я3 3=د3 ԯ353jVP5̯3W !ƒt^_[]hQ"j~5ȯ3h$j蜧WV43uD5@3 ,3=H3 D3503jVP5<3W !ƒuuJ@3 D3ti11H35,3535<3P$ ~J;5@3D3r,f @3H H3Phm5<3Q xw^_xof@ H3Phm5<3Q tD;5@3D3s5,353h3 3,33 03 t583h$jGfUSWVX $p $l 7Ch#j&j\Mhk"WS轭 H-$&333@33333333u3i33S 3G(3; 333$333,3=03-T+=E=3u =M= 3ui $Xi0*Ph$h3 h"'@0Ph$h3 hݞ"N^_[ 0Ph$h3Q hsg&hN 3uá3u tjwGjFUSWVjƋ|$11K< @u=l3t?jj5x3! 5x3p3t3l35x3UjW A)߉np3 t3N F5H3q0\3H3-p3F t30{Ph$h3 hsg&Mrh "]1Ht3p3x09Ph$h3 h"'O0Ph$h3 hݞ"LV1^_[]Vt$5H3q0F\3H3^WVL$ 35|39})=\379}>\3839~vRO9G9~-83X3~ZX3΋Nu#83)Ou9~83RN983 |3u 3uu83^_É1jDjDVT$X3t=X31X36X3t@9uхtX3uhX%hK1^SWV1ȱ3t3j?萢h#A."tWt|8/uWh4"Wh@"h3> 3tLP0t$hg"Px31ۅu@W^53h$ j"jM"PJV̡^_[Vx3tAPxGx33t!P/53薫31l3t3p3;530KPVh&h3h"I^Vt$x3t3P3t!PR/533Vjh 3hХ3М "x X3X3\313@=ujuSVL$D$ T$t$33533~A23BI^[fV13333PwP||3Fu^SWV53953t$3Vjjh3A ut=333jjPPMlth۟"h$[H303@u3=3VtVP/,G~*h "53r0h"h$G1N1Nyh/"h$G53~3H 331H^_[Ë 3u!T$73313xD$Q331HSVփuU303@u񸠱3jjPP kth۟"h$G3 3 33aˍ3)Qh3P 3303@u񸠱3jjPPjth۟"h$FVjjh3h^[Vt$ 3u3313x 1H^USWVh"mƊtx<0uFD uh"h$$EGuȿ|w WjP 1T L ш @u3hjV POW1FthП"h$De^_[]Ã?w )QjP; 1L$ 1 Gu@w ۃЃ6w1$d& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPX3 t uh@"XC^_[]eC$tX38u@X35T3Nj-T31;-P3M1WtÃ=t3tj jwSVVVSt$t1Ʌ;L$uWwZ?E;-P3|1MV31535ı3535353Σ53 3u 3uu ^j:jq;V53953}3I3P53ڝtC533 3u 3urufL$3r53 1^A0Ph$h3 hsg&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P 3ı3193@u 9uı3SkH3 t$$PPh,  $ @3| t %ܥ3ڃuhmS#QUuhq"QjD$P 4Ë $39}=3]39|A‰T$R53NjD$3=3 3u32$@PSWȾ =X3?5ƅtH3VPP,+ X38uK=3뜣ı3GhmS#5X3t:jPDžZ"x Q:? ^_[]Í|$0XPh$h3 hsg&> 3u3utj8t"j&7WV 35ı319}'3FىDuw9@u1=ı3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEhR#P,.UT1hR#P6Åt*t$Sǀ}!u?S3=.0PUh&h3sh"=eSx(=3uWh("h36 5H3+t$00胸PUh&h3h"=^_[]USWV |$$Wơȱ3$t3D$\31-ȱ3-t39-ܱ3t\$=H3t$ gDž~w1135̱3Y6tsH3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=ȱ3t!ɠ"9u t3 uh3Pp9¡t3Ƌ ȱ3Ӏu1A9|$t $ ȱ3 t3ܱ3t )) 3u 3ut j4 ^_[]j3USWV1|$=ܱ3t WrGHOHt uG `-б39}̱3V39rFU5̱3蓖-б3̱3 3u 30u t3F8W<1ۍF-б39~N3 ̱39wUQt7-б3̱3 3u3uhtḵ30 Fx09Ph$h3 hsg&9 33j2G @utḺ30 Fȱ380轴Ph$h3B h۠"Y9-1̱30=t3=ȱ3  )Ɖ^_[]js1USWV|$?!uGh5b$P%)t$WI,VP/Åt2l$t$ US NjD$8!u?S.=0PWh&h3dh"{8mSx-=3uWh("h3' t D$ )@ʼn30oPt$h&h3h "8^_[]USWVPl$Uƃ=ܱ3t1ۅtf;l$ `1V$th~;-\3u=t3t =ȱ3u8 GWPt$ F x4EEs @6;l$ |=ܱ3tt$$$^_[]USWV|$\$l$19t[=ܱ33t UPrUPO Fy0CPh$h3 h#"61^_[]USWVP\$5X3FEx @u}|~PVq6tjر39~l3Ա39SP)gƉر3Ա3 3u.3_tO5X3;^_[]Ë5Ա3W5X3V . ,1xщǃ|$uE@3| /5ر39$~Z39V5Ա3fcÉ5ر3Ա3 3u3t Ա3W5@3U1 ,$+HPS5Ա3D( |$tM1BDžhZ"4h0)Ph$h3 hsg&41 335ر39} Ա3|$N3Ա39͋|$|MVP/t05ر3Ա3 3u 3umua(/ 0jPh$h3 hsg&4 3t13uj-j/,SWV11ԥ3H ԥ37hХ3Iu8ܥ3@%fܥ39uХ3H Х3ÍF=39~Y39wW5@3=3@3 3u 3t @30u t3F <3CT0Ph5"h3 h@"2%ܥ31t @30@3X3^_[0蹭Ph$h3> hsg&U2 3u3u tj_+j*USWV\$ D$1tt$hR"ED$ l$1uHD503J 03;@3у  (3Q(3;=D3|h(3h%7f1GD5 | <\t<03H 03;@3h(3j\5(3H (3\\5tjj ShW"9 tVGW")Ȋ`"03J 03;@3Vу J (3Q(3\$ !003H 03;@3h(3P~(3H (3D50 03Q03ɋ\$ ; @3h(3P1 (3Q(3D50 03Q03; @3h(3P (3Q(3Dh(3Q4 03Q03; @3~;ȃ t3 (3Q(3D$F9h(3Qqh(3P똡03H 03~(3H (3 h(3j 01^_[]fWVD$L$L$$$0| $ |r13hi"t$t$ { ot9EtzS3ǃxtostypfT+=3먡ԟ3  $)D$|$ta$8-uW3D$|<ԟ3b3S ܱ3D35$L$jj衵thj1FhVVVjhwjh3fƅux'3|$t$8t$0|$t[h3hq""b$8u h~"_-ju$h3hp"aht"--y =3th3h$h3 3tPh$.h(3! xt` @3| D3x51gH3QPP M=83=3h3hq"`h":,j輳%ܥ383hZ",%ܥ3΃t0h3hq"s`jI51583h3hq"M`h"+VQ=3th35<3h"h34jrjkNPh&h3 j=3j蠲unh35<3h"h3f$j0yj`t$8!$h0h3} uh3h$h3g jL$ ɸ!3Phht@j( x#$r@3D$ rD3ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!h8c#W&tj/W藠th")1^_L3H3P3T3x>L3 P3 T3P3 X3;t,uQX39;uH3빋 L3| L3P3t9tT31Ƀ USWVP3X3DJ@t t@X3@DJ@t uHH X3~Ã=w$@&=D3!h;"  !=L3" X3A1Qptntl  Ӊ X3A˃=L3FP”^ U X3@߈\$ ̀1ۈL$QuH X3H1KDB@,Aǡ\3 L3  Pj  5\3j$1  ˣX3@̃=83t=3y=L36DB@jLǡX3@1Hptntl   ˣX3@̃=L3DB@8!h'"=L31Hptntl  ˣX3@̋ P31PptntlN  ӣX3@̡H3HQPN"X3@1Hptntl%  ˣX3@̍H X3 P3 p1Pptntl   ӣX3@̡H3PPv X3A1Qptntl  Љ X3AˡH3PPH-T3P3=L3=P3 9=\3 -T3P39 9w hl" H3PP X3A1Qptntl  Љ X3AˡH3PPl@ X3A1Qptntl  Љ X3ADB@;h" 1ЍrЃ sOj hX35X3c l3w8"%h3 X3:o t!gc ptrP  A X3< b=d3Ho1H3PP9 T3-P3 =L3=P3 9=\3T3-P3X3@1Hptntl  ˣX3@̃=L3F1Hptntl  ˣX3@̃=L3h" 1@T3 H3AQP2 X3<j hX35X3a @38"h"N@3 X3x w =L3\3tP30h'S&J X3x A =D3u;.5P3O1@T3 H3AQP@ P3jPP>X3x  1q1ۃ=3Ƀ=83 ˃hX% X3x  =D3u-5P35T3 5H3g X3x ? =D3uL-5P35T3: H3@;\3?7H3-X3x =D3u , P3IQ TX3x =D3u,T3 P39QPnX3x QVP X3y F( X3y 1 X3y P5P35T3g X3A1Qptnt lu  Љ X3Aω X3y  P3\3=@39|PRQ 1=L3u \3P3 ǡX3@1Hptntl  ˣX3@̉X3z !D3SPhAX3x  1@+33uF%X3x T+=u<3=3t13X3x =3h3h$h3& X3x }*x1Hptntlu  ˣX3@УX3x 'ܱ3G1P3T3X3@Hptnt lu  ˣX3УX3x =33u &|$Wt5b$5P35T3QP';\383X3x ==D3uJ)=33u5P3Q5;\3)83hW"h"h"l3hX%l31< *5 X3y qtp3@P p3@Pg>=3h&+X3x )5\3j 6'(Y$i*tEEp $A8GMi T391P3)@أH3=D3t W6U831 3u 3u u^_[]jjSWV=3uj貽L$ɸ!3\3Pjh5b$h"Hy|h#l#WdtkPآ=Yà PXtGWP|3/tf/V蝢ed.hDhup5\3jh5b$Vj=3ujL$ɸ!3jh3USWVPl$5T3'Ƌ=P3T3-H39ʼn) u)E1u1$3E@3V}tzP蘹t_H3PPj DžtO833H3u 3u[uE6MH3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~X3L$F$ 39} 3V339|BVP`533 3u 3! X3 u1C1E҃!%=3h3P Ɖ$ 39V39V53_533 3" 37 09L$]939|WP_=33 3]9~[39V53;_/533 3u 3yt v3 X3 (E X3QX39\u=QX3I ( 3G (E,$s X3L$A X3 p3y 3)9~_39VPU^I533 3u 3 33| p3A(EAp339r X3L$A X37 33/ X3QX3 ( X3݀ (539}p3R3p39|KVPe]t]53p3 3u 3S53P< p33D$1!P責0s|Ph$h3 hsg& 3 3u!u#^_[]h"qht"gj'jVjQtL$Qq p PIH10{Ph$h3W hsg&n1^V3t.L$19 3u3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h3XWV X3 td< uh@"1 QX3I t;8t7P1ǡ<3t?=`3u6P萈<395<3h"R5<3jP<3tV`353WP} <3t.h'h3QP[5<3K`<33/R0zPh$h3 hsg&^_USWV=X3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-D39}=@3M3@39|KUPYtYlj-D3@3 3u3uyS5X3W| 5X3=t3tsj jSWme00xPh$h3v hsg&1 3u*3u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17uX3 uH3E#tX3 uE1^_[]8uPX3HЉʀπwRӧj hX35X3{> 1w襧8"uh"1gu@X3ErUSWVX3H X3H%u,8Xu'X3L3h"t18u=P39 L3L1}5P39~[39V5L3W#5P3L3 3u 3\t YL3 X3QX3 u (\t u^X38uTX3H X3 L31< u0=D3u't @3| t %ܥ3ىX383L39|NWP/Vt8=P3L3 3u 3uuuw5H30L3M1I补0buPh$h3 hsg&1 3u 3uu^_[]HX3,j'jUSWVPL$H3T319P3}%H3ȃ Eh"Kl$ H3PUVPt$$KǸ1$H3PPT331S̪áH3tP芬EPPjM Ņtl9u 3l$ u3ue$H3P3+T39}yFH3@H3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=t3tj jvS肮vލD$jPjSu]t1t$ED$$D$1E $A9T$ 4X39Ɖ $T$~c3t$ 9V5T3R\5X3T3 3t$ T$u3=t3tjj RS藭T$=T3RSWu 4$D$D$ X3 $9~bt$ 3$9V5T3JR5X3T3 3t$ u3=t3tjj t$(S=T3t$SWt Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuf&D$)D$X39~V3 T39SQ?QX3T3 3u3|$~#D$$ D$ ud$th."$=t3\$tjj SV賫T3SVPs T3f |$%C=X3T3 3T$u3ml9}C T31F9u,$y^=X39}T3_39|W5T3N=X3T3 3tT$ 3T$M 0E+L3;H35X39}T3J3T39|KVPMt)5X3T3 3u 3u^u`Io00mPh$h3赸 hsg& 3u 3uu؃^_[]jjfWVd3 `39|ld `3j Qh\3y# tJPlPh$h3) hsg&@5\3R1\3`3kd3L$t$T$ =\3@Q葤 \3d3RDVu\35d3@LF5d3\3^_SWVd3d3r9 \3@<u|L19tWWQ9ud3H3H3\3L3^_[USWV=H3=L3=d3t 83H3$\3D$j荣3d3 \3ÍS4R4nr@44v\1L1 [ \3\1l1sRt6,lmL)1 \3t)|?wt)LI1 \3t~l)}L1 \3,u44vL1Y \3l1}w4R4Ӆ HA9~R\34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=D3t׫H3H3$H3L3\3D$L31 3u) 3u&tj\hI"$^_[]jlUSWVL\$d3fhY"J^"tNjt$`hi"SV: fttu=T+=߃u ԟ3r|$L$ D$1P&"D$PƋO9rPSt$  tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ hn"j1L$j QP,/ $;Fl$|1ƋD$8u&1zPUny!Uh$j1D$ th"jv1NjC=m@!sHQPWc xs{QPWB x4$Uh"} =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W y?60Phϣ"ӍL$fqQhmW 3UhW#D$ukD$Ph"h"裯 T$#h"T$"h."03H 03~(3H (3 Phi"kh(3j t$8t$8t$8t$8t$4h"t$Ht$Ht$Ht$Ht$8hƤ"t$h"t$ h"ծj薔PhC"h3V jܥSWV֋|$t 7"?t="VQP舮 JB803H 03;@3h(3j<(3H (3(3H (3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hj"Eth|"Puh3h"xEth|"P超u h"jh|"h"Qh >P7u h"j,0G7D$ u h"j-t$,)݉\$D$$D$11D$$h"SU4 c7~+Hr߃8tlH w&$ط&T+=$뼃4t6맃dtket/1@D$>=T+=umWt$胄Xhͥ"5T+=KD$71@D$$+L$ ԟ3 ԟ3T$uAԟ3$T$uȋ$D$,jj@Rk]l$L$ $tL$ $L$,1ۋD$PCEu S7)St$PʼnD$$19 U訁l$$T$DtIL$ىL$$U$E L$)QPR8 4$REuED$ushͥ"h.?%~u]h"bhѥ"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vhl3t$ t$,QPR-ft$ PFyjQ=l3y h"|$$tQt$(jVjhSny h)"&jVjh5l3Zny h;"%hͥ"}ǽt$(1CUVSwD$PnUVSw5l3nt$,;1L$XAAA @D$HPQS =h3u'l$hD$h48jU&Z ul$u*Džy hR#1O~fVS5l3pq VSt$Vaq |$h5l3l$0fE<u1܎u@hWj5 u踎8誎18tƉjjU tD$68Zth8tEVSt$ x )b>8#Thߴ%|$l$8fE=h3ul$0fE9EjD$LPj| |$@f9fGfGl3G$jVUL tQf|$<tٺtf|$4t?l3L$0u+fD$<=h3ufD$4 ^8t$>Nf|$Dt1BuNfD$Dh|$u%j t$ hM"jt$jh$y{h"PhR"h36j輜PD$L$jQ5l3 XUSWVA1K8uSt<։茌hU7 ~WUV ~)u1P1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSyƅu]jj.;tqƉx jPS" ǀ;t$8u<8"u(G=w(rfljF^_[ÍG=rhh"j$h"j%fD$0qijbfP=p3tD$L$ $QPjy[ XWVt$|$ t8Ph"j%[ 4@ t3A9tL t3^_SWV\t$lt8|$jYPW%^ GYp&Ӄ(Ӄ,P6B60\@4N@8@@WVd^_[USWV $8 $4 5x3VBzPVE-0W5`&1WWPփ (JWWSփ _ƍ Wh Ph& WjjWl& TVp&h .<Ƹ jPPV(t& hVU\ V$?E=a==hD$\jPSd& 1Nxr$ S yǃW9.0t^SWPv; tg0$8 hӦ"jX0h "jX 1N ^_[]þhӦ"jlX۾Sh"jSX ¾hH"V>=bt =buk $}u+Zt$WSVL$ S FYD$t8Shv"#Shj"WVPS 1QQt[0( Lt5|3tQP!0,tt|@Pq,Ɖ4PY,8tg04@tt| r>1A8Љ4DAtt;L5rSh"jrV 10h"WV|$x$t,WDWHDWDW4Dx uWVbjtw\wXt=39}5PBt853WVhʧ"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W,$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RPL ̀ uCt1t RP L$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PU(D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"A|$PQt$t$Rh["jEC$t&8$\T$XT$H|$RQt$t$Vhګ"jD$L$l$8h#"h"hh"nUSWV u|$W| 1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h "jCNN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPFbl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PS#D$HPhh& |$0hSj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh-"jA^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhH" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 3333353D$D$TH Qq T$T$ t$t$QShk"jd; 11KL$0t.iSPh"j=;V53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP8Q8H H;1D$8<9ص38D$D$ tD$tD$|3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP""PD$tD$t$t$8WSP""Pj98tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhb"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L 33tt94 S.8|3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVḫ"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh " Qh"j`4 $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qh"je1gD$4$DŽ$߬$D$D$D$@$߬$ |&a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh"b11ҋt$  t<=33$T$p$1߬$$$߬$3333DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh"W $PhD$(h& yN^L$ L$tL$L$8]:u*t$ tD$Phn"j|" ,uh2"jh" uhO"jT" M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P.D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP33D$ t(Gdt;<r61@h$t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP " ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vha"jCT$$BRt RPMRPVWjt$$Vh2"t$$k,PAD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhh& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =p3yh"jYe11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](t&[$t$ D$L$9Éʋ|$S=p3tQPjWh_"j]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh h& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QcD$XD$TPh]h& |$t$t$kL$,9 $ ?t$F0PVh<"jD$,]|$t$t$t$L$$QtXt$|9|$11k,D(t P;|$}L$֋L$]t$QUt$D$,TD$, m4$yD$,`14tPP3hp&j(,u׋$e^_[]USWV3tWjjP/ 39u 34t0jQ躬x!=p3h"jt$i3xi8tPWh"Q]V`tPSh "W9jTt8Vhϱ"j  1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 3I 313Iu顀3P,3 3~ t1@,3@9uUSWVD$931A9|G3S3Ɖ<$~ SjV> 3D$~Q1ɡ,3t<3*tBEB(B$B4!؉B8<:tWBuA;L$u5,335,3$3^_[]V$3 3D$D$ &T$ t$ 353t$T$L$D$\$ $x"Z$^Vt$FtN H N tNHNfr v V 3^VD$`sH) 3 3 3HtP4BPQ@@1ҋ3v9t3,3rh"jtp4F@3^USWVD$T$#35,3tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hhг":USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 39|[5$3tFNu (353t5FNHNFy F4VPV3@31@j@P:U1@P+F ~4D$F(^$F0^,n#3^8,3 ,3t q4,3^G FtH 7~ F^_[]É 3=h$"h"hh<"h"hhг"_8Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H 3N^,H 3 33H@3P 3 (3H(3H4I,3H89t;tprp,340,3t4F ,3H^h]"hV"h4hг"6USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv 9 fUSWVP|$gx&st&G4$O,53w0VPww D$0^_[]USWVPt$ffx&st&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j>8p 03HtƒQ 03@ 03^_WVt$ 43F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv<7 v^_USWVPT$|$:%483\$ 83$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4831ہ=43| t Pt<3031t 98t@^_[]Ã^_[]`V15435@3hVh836 503^ft$ t$ 3jISWVt$frLN4F,=3~0WPvv 1x&t\fv4V1AN4F,=3~0WPvv 1t&1;NuN^_[h"h1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRE׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSs$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"9/USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RPm3T$3D$M u1^_[]USWV(t$F<FF F F$9D$4toh4julj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"&v$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthuW1$3L$1 QWPUSVh4jÍD$(Pu S \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4jËl$hu P $\ E1PU\$tE|$8t h"s,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th"\st$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh˷"CB$  $ V)19tQRh,"xC 1@^USWV |$,\$$t$ tCPPt Ttt4RQhr"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"ZBh(3MD$(u KHKpStURQPt$DljT$t h,")qu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k D3VRh"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$L$89L|$|$t$L$ T$D$D$$|$D$puD$ 11L$ I,$t$UQPhu"D$L$9tQP$$h"t$Ht$wL$tI9ȋt$ tPQ$$hŶ"讋1t$\^_[]h."h "h)h@"jh."h "h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt±|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$9"pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ R,@o M|$@ t"D$D$D$$D$$S"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DD3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWעƋD$0T$UW転ƋD$0 u$$$UW耢ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPERP$GW #RPERPޡ$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWJNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPʜt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP?T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP茛|$FV D$t RPo|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPZ|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPј$ D$TBL$?ttXLT$BtJ J T$$T$ QPbL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP̗ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV贕D$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv - t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0h"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hn"h h"h"h h"h}"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p ^A L$H SjQ ^_[]fUSWVL$T$ BH3ulF1G &UhF#,$03H 03~(3H (3 h(3j -u q1^_[]V#3PPh"VVjjh"2"@&Phc#h3&uj'USWV׉΋*h2"U0&tCt[PUjhhL3s 5H3FL3t2H3L3WVS5L3lg^_[]Uh{"j5H3h$j%USWV$:$D$VuP 9$j uP 51ɉ\$QSus Ƌ8 8"u11F9Ή$<$1ɉQSu | ËD$8Չ8"u !t$$Vhyd5L3 tbVh"^_[]jh"7jh ".uh;"$hS"hm"$p h"h"jW$05H3hW#jlUSWV}E phi%VFh"V|h%VfSD$(P5L3Z#D$0= M$L$A1yyy D$Phwd5L3g D$tG\$ D$ L$|$j HljL$ NjL$IuɉNjD$ D$|$uhjD$v1111O w+Ow?u$L$A1AAA D$Phwd5L3}  \$tmt$ NL$,D$(H3D$FD$FD$ FD$$~D$(P PWt$,t$t$t$h"{ KuD$1D$|$Ynhxd 5L3R5H31111VQRP5H3hY"hxd 5L3 H3LQh"ww ww5H3h"w_G|$9w  jPQ5L31!¡H3tNSVPhһ"eWt$ 5L3` [%9tu"QVAh(3)SVPh"7كT$;r ZƉ[|$?e^_[]jj角5H3hӺ"lhb"hC"h "h3J jQh "WV$u>$jvWR s'Wh{dЀ5L3 t^_jh"jՑ65H3hW#jVPPhtd@5L3 $t%t5H3h3"$K"u"5H3QH3$$""s#QPhi" H3$$ "s#QPh"t H3$$"s#QPh"O H3$$"s#QPh"* H3$$s#VPh" ^5H3h"jÐWV$u^Vhzd@5L3^ tH$D$PWVhO"$PwwwwVh]"^_%5H3h>"j<USWV}D$Phd@5L3 tzD$Phd@5L3 u5H3h"&H3$|$\$ t$jVSWVRPSWt$h"e^_[]f5H3h"j}SWVP|$uX|$_h&#Sƅth"Su+1Qhwd5L3 t ^_[75H3hW#jUSWV|$0t$,1@L+=ԟ3$1ۉ؉D$hν"WV芖 qt\$te+$95ԟ31|$7wWh|d5L3? D$ ;D$t-i9l$sUt$ ƉD$l$묅hhPV諷H3L$ #t$RQPh/"# |$ t\ư1P`VvvvvQPh@"  G;|$ ru5H3h" $t1^_[]W5H3hѽ"jn5H3h"j,jP|$u1Phd@5L3 H3tQhg"Q XD$ 0QhW#jSWVP|$t$^h.9#S(tDhR#St@h5b$SttT$da3 D$dD$ tTj/S{tF1;tٍT$d#3D$dD$,t>\$:t$1\$(XT&P&hA"k u1\^_[]h"hr"zԟ3=\3uj=d3l3`3X3T3 T3YhJ"5T+=h%"Ph"jdX3=h3u thο"0"`3 T3t uh"t=3uh")ǃ|u D3j=x3|$\G1PPL$lQPjW脸t2t$d譐t"1PPD$lPVjWXt53=x3u4$P53fu#$=ux3h3 d3 l3 `3=3 ɡ3=x3t&jQPYR 3u[53h#jhh3QPٚ3y"h8h3h."33=x3u'L$dQP53h^"h3hrdAPQ 53h"h3hedA53 53h"h3hK"$$t(hQP53hh" $$ƒ 3>s1@![Vs ) ȣ3333? 3 3333335353=3=3?wd3h3=l3L[Vl3?h3) d3>r$r$d3 333u 33]u1hQPO 3u253h$}53P3j53|V3u VhD"8 11h3t1A1A1ۉL$@1h33 3h3=P3u#3d33h33l3 t$\F|$LSSWSjV)t$LO3n 1QQWPjVy53袜353j/V1t@UUUU)ʹ3333!!сis31f3t!ttb33cԋj3 t3x31n3‰ |3331 31AhQhp3wi i-p3=3 / t3ًx3P+==w !r%1H$D$ ʀŸw1D$ $}ȹj3yt\3t  u31I $L$9 p311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh8"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$d3-h3=l3x3D$t3t T$$T$`3=t3uu 3; 37=X3lP3_hp""E381uh"%'3L8L$(L8L$$L8L$ L8L$48\$81=3Ɖڋ\$4PVQR{PSt$@t$,t$4t$<31K1Kޅ`1PPPPPP =38hT"1b38LFu=X3uRh"%tajh"v1""WjWWWP+h3"t҉3u b3=h3u`3u l31g=h33D$tD$|D$h""631N=t 蹵@ 1"WhVVWP+9tigfff։f5633L$ȃjP虉D$ u h"jsh"="1HL$ Ajh"1۾83D$3tB?t=kWUh" 3L$ DD 3$ D$tD$D$ u53 31p3|(.tq<(tk{PWh"S x3t3p3t (BD$,T(2D$ TL 3$3L$ щtT$ 3T$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$Rr`3=ue53$@D$ $#D$u D$ P&1$L$19;ta $Ȣ43=`3ud3ul3u h3=X3t83~ h"3~lh"]h"=`3u1I3 3t h9"]h"t3o3e$j9t1 43j3t \3t3$ D$ 43 u=35p3x3t31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 43|$E9u KD d3Dh3Dl3DL /3 3WQD$lP莩 D-31ۉl$(-D$D$DT3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$x3 t3533D$t$u~t:t  Iuh3 щ $ l3t&=u53օ4$u 53GX3ti3Ȩuh_"h %3tjT3=u)3Ѕ$tN3=X3u"Ph"0h_"Ph"t 3 =3uQ[$$tߘ%t͘%13ti)3х $t4$P53h"!=X3u53hq"1t"1`3=u )353^_[]VPD$ L$ $QPdh"Cԥ3H ԥ3~Х3H Х30hХ3qƉ t9tDԥ3H ԥ3~Х3H Х3hХ31ƒ1Y^hT"jPUUSWV1=|3˃y CS t 35311 uY1ɉNVt11@5C C"t?"Ph")Q h"j1He^_[]SWVP$3;3u+x3u"QhmdPM y hG $P11h3<=3u;53|- 31Puh"V=3~e1p3111 t3x3Pt,p38C;3|h"PSh"P$3;3u+x3u"QhmdPB y hG $O^_[USWVP։ɹ1ɉQPU{P 1O}t#Ë$8u蠹8"u r1^_[]USWVP։ϋl$=\3T+p3 3tú#t$76PSRh"T$7St$h"D$7UPS\$ Sh"7PUSh "77PUSh"e7PUSh."M7?PUSh@"277PUShQ" 7PUShb"7?PUSht"'1PPPUt$(SRh"^_[]USWVˉ1u=p3h"T$$8$43|$͉)uh#WhM" |$Z)uh#Whp" D$|$%V|$th3H9ul3H9u 9vtGWVh|"! ^_[]ËL$D$1;|1HUSWV3(53ӉӉ؉!!jPQUi!ƒt&\$ 33QSP> :1H5Q53P' ;3uN!53hVS ^_[]h"h"jIUSWV1Hf3t$u9e3d3  c3l$M?>j3:i3h3 g3l$M?>j3n3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$}"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h4" l3h3D$HL$LVSQPD$T$D$PVSUPD$|$ D$@VSPWŝljӸ1=3ƉT$ L$@PVt$QR艝PSW|$LWVUl$lt$,t$,t$(t$@h"&,hХ3jdh<3" |h`#h<3h<3\$ $t < uC{ - 3DAu<-j D$$Ph<3: D$$\$ hE&S1TK|$(@D$PhX"SW $ϋT$ t։t=t$h`&SW t't$h["SW ct$ |$@D$1=3ы53jVWR D$ՋD$D$D$D$D$$t$t$D$$  T$3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th`#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh"<3V<ƀ;3t$Vh_" 53D$,$t$P։ω,^_[]hT"jEUSWV΃ twttu"^T$(|$$+3уD$ ;t3 "L$ x3|.|$,T$0 3|$9=|3|=X3u|$4u 1^_[]Ë-3~} ʉ$9twp3|(tk t3t( T( (t1+39\$ \$$}2;T$}#=X3u6|$4ttD(OG1nF/"t(n9Չػ}n9l$\$QAuƉf3tt  $tt ^j3 t311 x3t$ -3t$|$$|$}p3] ʀ|(tP t3t( ;L$T$|L( (9Ή} =X3{|$(t ;p3KC x3t3S"1$t=t t3 x3S"=X3|$(535p3q^13333|3x3t3Ɔf3t$ |$(Pf393u85p3^13333|3x3t3p31Ƀ|$(T$3\$1 53n p3|+D$Nu p3[\$j53t3)؋ p3P|$(t$ hhjkVp3VfǀU3L$ x3D$t3ƋD$$ȉ5|333113up3=X3h""u)""=X31|$(9 3u85p3Q\13333|3x3t3p3Ju UPQ$I 31|$(tD$t3D$x35|3=3^_[]h"jn?WVp3t^ tڋt֋|҉tΡp34 3 QPVH 3ƀ^_USWV T$L$3@hPhp3+  3p3~Cx3t3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRRG p3;UjP fDŽ;UtZF , M ;M;MU;; t3 3T$)ʉUL$  31 EE=l3 h3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M3 ^_[]hS"j<WV1=p3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 3D$Ӌ53݉t$މ$!!jVWt$輄!1Kl$ 33uhUPHzQ53Pv  ;3u[jVW53Z!1Kt?D$H53#$SUP u 53V53 ;3tÉ؃ ^_[]h"j:USWV$0$,1@D$l$D$D$ $1h"WVB suM3j U5T+= áT+=8=L$908"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-ԟ3)1<$L$jhQP4Ph3hedAP蘂 =>3W9l$| V@f>3UjDž\$ t|03H 03~(3H (3 h(3j Cjh3h(3 03H 03~(3H (3 h(3j <$ D$tt#tv"PhV"D$f<33Waf<3gdWPVi xnu)D$PhwdVN h"h"V1^_[]Ph "25T+=h6"j84 h"h"jj耮Ph"h3۹ jaUSWV\T$3< $SCD$9d$ՉjRPt$ V蔀11 Sl$UVy 9 1U\$tL$j@PQ/q 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4X&h "$T$l$ >31ɺT31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$H3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf >3ŅtMaQ4X&h" T$ t tuf f111H3|$ L3P3T$T3U3fV3l$E<$g\$ttXaQ4X&hP" ;B Q4X&h~"b <$\$t4X&h"B<$l$!F1D4 "MfGXtVjjhI"4fGXtVjjhN"fVj pw(hW"V w,hi"V w0h|"Vݴ w8h"V̴ w4h"V軴 w(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ W'\$tt$1F9tWhw"'D$ 1tt$ tЉ|$TB7D7R0'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"3Pʞ |$)Wh"3P諞 D$ $L$t$}D@tCWH&1@9tWh"E&L$G$D$$|$tD$|D$P$\$hT$,T$ T$@ VjWi t$ uT$B|$tfD$T$|$tfL$$+|$‰T$D$1C D$8H4PQ|$HIht|t<7t1ۃË|$71ҍt$8VRtRSP"tPjh9"fI D$ uD$8r&1ɋT$P: $D$81ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWFD$(+D$L$,L$ ʃ{1QPWVthS"j1F\$D1VPShY"+kD$XWVPSLA%|$$u1Ʌ|$t1ɉAw1@|$Ph"jD$tt$535x35t3t$\t$dt$<535|3Q5l35p353PWt$L@ƃ|$4tVaUSWVӉ $Q|$j W\$ Sq Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ P8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h " QPWUt$t$h:" t$t$h"jUSWV31F/WVUh"lWVjh"[WVj!h"JWVjh"9 WVSh "$WVj+h"WVj;hB"WVj$h~"WVUh"WVjh"WVjh"h"WjWVj h"WVSh@"V_fD$t1B9| 3I 313Iu顴3P=3 3~ t1@3@9uUSWVD$931A9|G3SƉ<$~ SjVJ 3D$~Q1ɡ3t<3*tBEB(B$B4!؉B8<:tWBuA;L$u5353$3^_[]V$3 3D$D$ &T$ t$ 353t$T$L$D$\$ $x"=f$^Vt$FtN H N tNHNfr v "V 3^VD$`sH) 33 3HtP4BPQ@@1ҋ3v9t33rh"j#tp4F@3^USWVD$T$#353tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hhг"EUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 39|[53tFNu 353t5FNHNFy F4VPV3@31@j@PU1@PF ~4D$F(^$F0^,n#3^83 3t q43^G FtH 7~ F^_[]É 3=h$"h"hh<"h"hhг"CVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H 333H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^h]"hV"h4hг"rBUSWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv D fUSWVP|$g&s&G4$O,53w0VPww D$0^_[]USWVPt$ff&s&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjvB vj^_`USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4 41ہ=3| t Pt 431t 98t@^_[]Ã^_[]`V1535 4hVh3A 53^ft$ t$ jAUSWVt$frLN4F,=3~0WPvv 1&t\fv4V1AN4F,=3~0WPvv 1&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS $O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h":USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$F|F|F e}F F$9D$4toh4j lj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"辁$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthݐW1$3L$1 QWPUSVh4jqÍD$(Pu S  \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4jËl$hu P.  $\ E1PU\$tE|$8t h"n,$SctUO ^_[]Éu C4CHKL1},$Bt؉Ń|$8th"~t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh˷"TOB$  $ V19tQRh,"O 1@^USWV |$,\$$t$ tCPPt Ttt4RQhr"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"Mh(3D$(u KHKpStURQPt$DljT$t h,"|u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"  4VRh" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhu"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$hŶ"^1t$\^_[]h."h "h)h@"h."h "h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttZ|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$9"pu0|$ r]@hD$D$D$,$D$ G,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$S"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$D 4uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWoƋD$0T$UWSƋD$0 u$$$UWljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RP諭ERP蛭$GW #RP膭ERPv$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPbt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPקT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP$|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP菦 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPi$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPdي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVLD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0h"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hn"h h"h"h h"h}"h"h"CUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ, ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP(1 ^Vt$ V(1y?1I+F$ыT$ptj42QP(1 ^Vt$ V(1y?1I+F$ыT$ptj42QPZ(1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jL;Ɖ t,UFtf^81FFH1|$<΋t$  4uN $ 4NVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVh"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h("h"jHt@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ $ 4 4uPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp  ^ hjS V^_[]h"h"hhM"USWV l$4E}0I\$8u tȉFSt T$$t< u6AWhV űD$ 1GtPh$^_V׻1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhH"+C< t< t< uhR#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P衣 t$$$ىh0"rC< t< t< uS藺=$<rLjSh]"Shy".`Sh"kh"Yt$<L$D$D$L$ oPTotXljo 1tX L@uH~vCtTjhh" Vz$^_[]Va )UjS D$ D$ CD$CD$C D$C$Cl$Uh#Vuv u D$CV)1$<;obD$D$PSh" =USWV$0xjWwƅ~F$0h$1jUw~4$hP C9uЋ$4hR#S/Ǎ$ىhk"$0SEt| uƄ$ $0ph"QUMD$$0qh"QP+ىD$PUѷPUSƸ u׋$0EED$1ɍ$D$ $PhS7 D$PD$PD$PD$Ph6%S D$L$ T$ ыD$E L$ T$ D $A9L$D$uPh"h"\}Sh"h+" Sh"hK"\ $02t$t$h"$@t$Ph# |$WL}~14J|G;}|V;|1^_[]USWVD$(}~;$ ~VE pSm $PjVWjS\vD$11D$D$D$D$$D$ D$hU#u Vuf H5$&D$>j 5T+=Pm Cr, 4밋T+=$P+Crj h&#Vi ىVS *1P?uE$ ~S4Vh $Ph,jSPt$VEsuVh# kWhB#jZÍD$LPSFu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h#Qhr$PPrr @r ,r .%r0B$PPh%r0BV 豿8YSh#A*r'r)rzD$(h#Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQÊ $Ph#Phr<rr h#jhr +rryt$$$PVW>ލ$P|$xhM#PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP谉 $Ph#Phr"tf#PSh8# .1$P;$h#Shrt$V#9;$PVh#|$$Vh#h#jhr t$Cj =, 4:$h #Whrt$9 #?c.\$jh #WhrS$d|1$XAA$Pj2PQ  $Pho#Phr9rh #$`>ߋN8}&w&PVhq# `Ouet$$P\$ ZSh#Sh#$P\$;$PPhn#" V4h^#Sh*rt$  09rhe #hq #$\>$Th% Vh #$X~:$\1j hf$V۩ "tQC`;$X|j p~-h #_$`>VO`Ouj ?$X1~$1:t @`9u9u$\Ph#1@\D$,\$H|$PS1$hjV! L$,9F Vh#VhrWN h #F0Ph#_F0Pv,v(v$h#Bj Xh #K$Th#Ph#h#FhE%V D$0L$4$PND$8Fhj#Vh(r W  FtsSh#$PtPh%h#$Tt*Mbi)QRh#N j d$XqPSh#$ ]h #2$X~n$1Wȃw,u"$p&L$S7#!##}& ##PRh{# F`;$X|ۋt$~G$`>G8tu #P}&w &QWh{#Q `Kut$h#VhrP > #t #P9t$1 E$`$d $jj h$QPjV5yjh$V\ V$`t$Vh+#$XMbi)QR$\Vh]#n$|$|$|$|$|$|Vh#6 $\uM$1wh#5L$!r9 #$PPVt$h#!11҉4hӀB9u๔#t$QPt$h#=, 4~S$h1h9#y1PQh#\ C uߍ_ j i rt$h #Vh&r@t$^#;$Pt_#"tf#RPt$h)#t$ USWVdp׉L$$xph #SۤtÃr t1C$|L$ PVQ Ou wu pu o$1hoVW议 owt1$4 j2tWY F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0GhhI"W$Y Ƈ$L$hJ#Qh+r|$W9uh#jhr Wdp^_[]ø #1@$ #  #$Pt$h #h3TWV1VFF FFFFF h#VhrQFĘ^SWV։ϋ\$1D$$jh%SZ tVjh #SZ tBjhr#SZ t.jh#SnZ jh&#SVZ u$D$D$h#PhrWh/#PhrW=, 4t?|$#t#PVhB# |$u$4&Vh]#k ^_[$oWVƿ3PhR #W Vh #W Vh #W Vh #W Vh #W Vh( #W VhK #W Vhl #Wr Vh #Wc Vh #WT Vh #WE Vh #W6 Vh #W' Vh0 #W VhG #W  Vh^ #W Vhu #W Vh #W Vh #W Vh #W Vh #W Vh #W Vh #W jVRhQxG t^Vh$jbGWVPΉ1WPhPPj PQ0 u^_Vh7 #QjFUSWV։ωl$PU\$hjS۩ E9C Sh#ShrW Vha#+ssss hz#ss3h#{##t#t$(Ph# t$4t$4t$4h#$t$Ht$Ht$Hh4#D$8Phg#$t#Vhz#m$4&h#O$h#;Ę^_[]t$ t$ t$ 诎 tt$h#jEUSWVӉύD$(jPW1t$`FFF FFD$h#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPGD$HD$PD$P &5&|$D$ fD$ l$ \$Tl$+D$Ty1&Ph$j($PT$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh #j$P DŽ$ <\$D9r<#VSG M~%Hwv$8& L 4L 4ǃDt*Mh &5T+=X 4u5T+=M;4D 4nNRt 0 4j W5T+=C< ` 4L$9&-T+=3< 44 48 43j W5T+=; 3L$9]`d 4@ 4}H 4nPItW貔PIujj>QPh#j=D$كL$l$ umt$"Zl$ 1  ut$)KL 4h!#5T+=h#p5T+=h#` $L$L$GȍQw[sV?PʓPH-G A6PGu$t L$-AGL$AL$$j=H 4us5=< 4 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S߀t jh#S  t ;/u f. Gf./W~S~9SWut͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS |tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 53 4H $s-t$$tHfHxt P2)1^USWV=< 4th(3jjh!#Ujj9#tvƃ=< 4th(3jjh>#|U41GNIIˋ^s 4 tVfV(4ޅu4=41WS"ơ4Krk=8 4tV$PhP#h(3趣 ~uV7dV'%V`v v"@4F$5@4vu;44K^_[]USWVPl$4M1t$"Džt.w w!ƅu h\#d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=8 4tW"Pht#h(3s W_1l$$ttF9u t G9t$4&Qt$hE4hY#h3 <$WbWE&F~X|$<th#V_VCbV&vfFt$ t$ t$ h6#h3|EuFufFFV!|$WP`WV&N=8 41ۈH4D4|NILD4hD4uL4ǀD4|NAMǀH4EFNDt$hE4h#h(3Ƞ1N1@=8 41ۈH4D4|NILD4D4WEuǀH4FNDǀD4|INOW(uL4ǀD4|NAMǀH4EFNDVdPt$hE4h#h(3)C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=8 4#~VPt$h#h3薟1t$hE4hv#]a >W\Ut$$t$$|$$WX ƃ*Vh#V%]1@KGufGfG1@=8 4$ WbPt$hE4h#h(3ҞUt$$t$$|$$WƀH1@=8 4ىV_bPWhE4h# |$u V[v vY@4F$5@4Ut$$t$$WDUt$$t$$W.PZN1@=8 4t-ى,VaPWhE4h#h(3؃^_[]S1H4D4|NILD4t!hD4lrǀH4APEǀD4|ONTt!hD4FrǀH4FNDǀD4|INOt(hD4 rǀD4|NAMǀH4EFNDƀL4t(hD4qǀD4|MODǀH4ECHGƀL4[SWV=< 4th(3jjh#M4=41VWftmxtg 4W sJX tCf{u7=8 4tSPh#h(3t S\S [빃;=44k5@4tc~ tWuLfth#W Z=8 4tWRPh#h(3 Wy\W9 륋v$^_[SWV=< 4th(3jj h#L@4tS@41{ t$C$Su[SFuՅu5@4th#VKYv$^_[USWV=L 4R< 4utDh(3jj"h##L,th(3jjh>#L5P 4t$G!jj#^ơ 4;4 44,׋-P 4WV]Ɖ׋ 4 49sAWV2ÅuWVhS#p\ SPhc#h3i c렉1‰1 u`WVÅu h#%\Cuh#SXCt SZcSSPCcQPWVhz#h3:KP 49tPt$ ZU-P 4 4;4 44^_[]USWV=< 4th(3jjh#tJfx 4jY9T jj\ʼnT$4 4PQ\D$5 45 4J\Ɖt$U9\ʼn$St$p\Él$9$\$ 4 49ˉs6fx 4j8DTk D$; 4 4rM\$ -P 49sI 495 4s9-P 4tS P 4E9u 4 49\$  4 49ΉsZWVÅu h\#YSCPhc#h3 cWV[Ɖס 4 4911 uU9t$D$ rIWV<Åu h\#|YSPKAc9-P 4u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5 45 4fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=< 4th(3jjh#GFtVPXfvu݃=< 4th(3jj h#G4=41ҹ$RL$QtMƋhtDEt9VP|$ W.1ۀ~UiCSPW+W em븋L$$; 44r^_[]SWV=< 4th(3jjh#F4=4rc11CWS5t:FfN~u %fFfth#VYSvuȃ;44r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhE#V ~u,|$ t%hZ#VRWh+#h3Ĕ 1^_[]fUSWV`=< 4th(3jjh#E54545\ 4h#hh3`L 4 t=;4uFFF%)Fu9rV9=< 4tJh(3jjh #1@F < 4t(t$h(3jjh # @F < 41V9vtRPh:#h(3ώ < 4th(3j $ 9̓>t9߁^_[]áh4tPjt$t$l?uù3WVIAfF=t4|Cx4)f45d4jQh|4?u5t4F1|4PVQ =x4Ft4^_ù3Qh#4Lr8u"h #h#5\ 4h#h3舍jWVjh31t)h Xt 8@ W^_V 4  4t7#| 4=@u%o> 4  4t| 4!=@t^USWV$$$ $jhWVO,|4tE1M1 tmjWVS$8jWVS$8t$Shț%hV`Va$ p4U Rh5p4DžtGh%PbtShw#h3 5p4DžtGh8c#P_btSh#h3ȋ 5p4[Nj5p41jPP6R+^^$DOGrhPD$Ph#h3Z:hPt$VE $(j7V@ p4u D5p4Nj5p4j1PP6R+^^X^_[]SWV׉1jPP1Q+FF9tX\$)yWhb#h3衊 %؉jQP6Q~tF hP6w F^_[USWV|$_ OtGhS7I GO9}vDty)9|n4 ȉG.uFh%Pq`;-44rv=8 4tUh"#h3趉 \GP1=8 4t:Ph#h3臉 %1=8 4th3jjh#d:1^_[]USWVD$$P;D$x/@th%Q 1ƀ81Mbi)|4H1ًP1 t p4P RVn]5p4At\G9uGSVPB^ t5p4Džu*h%D$PDtƀ8MbE^_[]USWVt$!M1 tFjhRW@J,|4t(E1M1 tm`ƋU R^_[]ËD$0 5"USWVX=< 4th(3jj&hD#8L 4 ߉^_[]USWV|$u hl#>WQ(-4u`Ɖˋ-h 4UDžuhv#z>-h 4)ً(-49w؉9vlj<(-4|$(-4WSB^_[]USWV։ϋ\$ t;=44rVWhQ!#= -)4 )4QPVW*>{s LK$\=8 4t%[$tC1K 1 uhk!#S9^_[]SWVt$f~th#V9~u(~th#Vg9~ th#VS9FN tkQPDžuh;#V)99tt79uNH4~^ SW FtPhL#V8.>WO(-4(-4$-4F$5$-4^_[ËAP 9ttЋR9uIHËIH hz!#Qt8Vt$V2O(-4(-4^SWV|$t$Åuh[#V,8;^ty^C Fs j/WF=GSN(-4 (-4W WNFV86PLP1ɅF fN^_[USWVd=< 4th(3jjh#*=H 4td|$xh5b$Wyƅu0]0-Ph#h3@y Wh#;t$ f 441؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6)vuݡ4$4؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W([u4$54L$T$9΋$D 1$T$| )4~L1\$)4 tAD$t$ jjS}(G )49|͋ 4 $54T$|L$<q$Q Aip 4t 4QA 44QA` 4A$t$ Vjj(Q(F @t3[0b+Ph#h3v t$xh#8V=Kh^_[]USWV$=< 4th(3jjh #'e1PPU Džy0[0*Ph#h3[v UhH #88D$,PW?7y0Z0*Phj #h3v Uht #7$jS ƅu h #7SVW xD$j(PW y0XZ0*Ph#h3u Uh #{7WL 4RrD$l$t 4=p 4,$1Չ1 9$h3jjh #jj5454 )4jP)4u h- #6PjPh%HĨ^_[]fx 4D$L$ t 4p 4D$L$ 44=0 4u t$(6t$pPh!#S6D$ L$$ 44L$T$  )4<))4؅~ڋe 4=4{%#t43h 4Qh 4Ph%#Wehp 4hb$Wd =X 4L4 P4L$$VPh%#Wd T4 X4L$$=X 4 t Vgp%#Ph%#Wd X 4 4=4{%#t4h 4Rh 4Qh%#PIdhp 4h%#5X 41d 5X 4jjh%#X 4@ @ue^_]h%#j)WV 4(#fx 41| 4 4 4= 4Tt/<4 4 tP434 L43 4 uѡ 4Hw}$&hI-#]%= 4t|l 4~$1p 4t l 4G9|<4 4tP434 L43 4 u;Pha-#$h3jjh~-# 4| 4\ 4 4` 4 4P 4 4 4 4$ 4 ( 4 4 4 4 4, 4 0 4 4 4 4 4 4 4 4 4 4 44 4 4 4 4 4 4 4 4 4. 48-#"4 4 4 4  4$-#<4~Ph-#h3a <4^_USWVΡ 4$$D$fx 4= 4u h(#m#= 4Tt h(#T# H74ȅ @H744$FÅu5 4h3)##l 41~3 $r(1Aω~$l 49} $O9sۃ<$u9t5 4hE)#" 4u:= 4u1l 4 $D$$P6\$ $L$E4 4 ‹T$t61 t@5 4h`)#:"+hL74su)H7444!H74^_[]USWV}u1D74H7490/4u.=0/4!h"#!1ۃ=P 4D$$P 4T` 4@(/4L$L$ P 49$$541֋=41 u"$35t 4$3=p 4 iL$QQ3Ph$#V_ h4Ph%#V^ U=8 4t5834h"#h(3^ h3jjh$#834D$QPh$#h3^P 4=0/43$L 4 1A $t=< 4tPWh*#h(3V =;4 434(/4hQVP 834<34^_[]t` 4 PUh*#k s-434hh@34U :0 PhF+#h3>V jJUSWVE 4fx 4 4 4D$SWV|$t$;48;;4vh)#b ;48;4WVP ;4^_[5 4ho*#h3>m:V=;4t114Bu11Bu=Iu1@'5 45 45 4Ph$,#h3C1^SWV\$j/SytMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th1.#WWNƃ=H 4uhVآx=< 4t^USWVl$|$\$u0=H 4uCWSy5T#0PSWh.#uuI=H 4uWS軍xB1F=< 4t\`/#t #SWPhI/#h(3W>6Uh0/#2$"0PSWh/#h3!>1^_[]PD$L$ $QPh3A =@ 4uh""=tXh0#)ujO2WV|$ =H 4u1VVhWx!1F=< 4t8Wh/#h(3~= #"0PWhi/#h3Y=^_Vt$~th/#V.FσfFVqƃ=H 4u V x=< 4t8Vh/#h(3< #!0GPVh/#h3<^WVt$ ;54|$4s(WV=t xt@u;54Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$1@4 @4|NIL @4Ft,h @4ǀ @4|REMǀ@4OVEDƀ@4F t,h @4ǀ @4|TMPǀ@4NAMEƀ@4Ft,h @4aǀ @4|EXTǀ@4RACTƀ@4Ft"h @41ǀ @4|NEWƀ@4Ft$h @4 ǀ @4|KEEfǀ@4PF@t(h @4ǀ @4|EXIǀ@4STEDƀ@4 @4^WVt$ V蜱1t%t 4P 9щrVh0#h3: 1^_SWV|$3Wh0#S: S4HQP~ Q1 P" t4HQP~ Q P t 4@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft# D4PD40L~Ƌ= D4j@WtAt03_6Dju_t - Cu@ D4D4@jh1#QVPh D4*ǣD4V` 4 9| $=|JjVhhWy($ $=|jVhh5D4̋=D4VPhhW|$VWjj5D41@VWPj5D4=D4^_[]Wh1#=?j*h&j致h"h1#jDh1#j8SWV$$$VhX1#hW2D4S ^_[USWVӉ΋|$-D4R PSU薀 S{ 9u ^_[]j\=D4u2#`1#jD4SWV t$t$4hc1#jV`1$jfƅ~'|$01ۍ)QP5D4< ~9߉ ^_[jUSWV t$4|$8\$Whh1#jS0-D4S PSU WV5D4 1Bߴ% ^_[]SWV Ӊύt$sKt$ tVWhW#0 |$Wy01HFuD4h"#W]t9hl%WKt'\$j SW $ 9uy6hu2#U$~h"#Wt@hl%Wt.\$j SW« D$ 9uyvh2#jAD$PhU5(H4 u ^_[2h2#j7SWV |$t$ >h"#Wet9hl%WSt'\$j SW $ 9uy6hu2#U$~h"#Wt@hl%Wt.\$j SWʪ D$ 9uyvh2#jID$PhU5(H4 u ^_[:h2#j?USWVh$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"d tjUh3#P tG99ufD$u\$ tR$,4jVhX% EjVh3# 4jVh3# 5\$ D$7f@jh0uht$Vj P5(H4D$^ރ9tD$j@h3#P ߉tD$PUDaryDpriml$t?tD$P*D andfD D$PDgrowfDnt$VD defDectsDuVjh4#P V58H454H450H45 D4h!4#2*Et2tR}jhC4#V H}j1h4#Vs #}jIh`4#VN t6Wh.#)Sh$)UփOut$ h,9#X^_[]1h3#jԩUSWV}\$j S5(H4O D$t"NuD$Hj@PjSPh4#jq$j$Vjj5(H4rF=tPh5#(D$D$ D$$fD$t$j VE 0- 9 1L$81qAQQ a A j QV5(H4-D$t$ *jhG5#E pV  D$ @L$jhtjPjQ5(H4hK5#'h(3D$t$H1D$`D$L'Ƅ$0VhQ`5(H4 $j D$tPS |$'y9D$(ȋL$;T&|"@D$Ph5#'h(3j gD$$<JD$ D$ L$jhtjPjQ5(H4~e^_[]ÄtH<t<u'5 D4hd5# 5 D4h5#h3%) P5 D4h5#h3 )h5#]&hW5#jE 0h05#`USWV $ ~($ 1j4h5#k ?C9u1CCJt$LUPV_  CJjh'UVjS5(H4~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P58H454H450H45 D4h5#M% vL$D$$jh'hVjS5(H4Ffȁw$VhU VhU ƅtL$D$jh'h$PjS5(H4]$f1Ɂw$PUhWhC9#{SWh$M$vL$D$jh'h$PjS5(H4$f1Ɂwh39# St$ t$ 1؃;D$ D$4ƜF>|$Ń &hO{&h%# ~y)L$a΀-% plj\$ Cut$BT$ҋ $)|$4[1ɉQD$PS; D$ D$ 938**8\$ L$ D$D$W|$hv.#SDh(&S;hs&S7h#Sp3h_#SZ'h_#SDD$t$ |$@81ɉQD$PS D$D$ 9؋t$88|$1ɉQD$PS% L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShtN44t 3hb#v 1<==LN4 ڍt$81 D$ \$phjShtN4PVT$Rgy$1BD$L4JD4`L$p$QRSRPVxXN4 TN4u1$P$w &QhtN4h,b# hN41<=4 j=VF9=LN4 j=V&T$81 D$ t$ hjVhtN4PRWDx\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPL$htN4hb#D$49t 8Vhb#S1JD$ $$Qhpa#,=XN4D$t$=DN4$D$D$,D$\$(VGC@D$p9Vhb#K0 Pt$hb#|$oQha#=XN4D$WSt$hx_#VD$ 81ҸD$ |$\$ Cj"$PuÍD$pWVPSt$ $P蟝\$ E $tN4jt$tS7 $tN4jWV# -60PhtN4hfb# BXN4 TN4$PhtN4h&D$ $u1@t$2|$ QhB`#(11G|$1\$ tpupth#Q衁D$ t$D$t1@L$ ɉ%t^_#PQ^Q|$t 8t1j t$ 4$`St$h_#FQt$h`#7.l 3m 3L$ L$ ف$K{8P|$W.D$ t@j QS%v D$ ;$|$8tQtUL$4 T$hjRhtN4QWt$t l 3T$ gL$4D$ tN41ɍAD$4tT8`T$ Q$QRQPWcXN4 TN4T$J$w&Pt$ha#t$L$ $d$ r $3 $tu¸#t_#PQhOa#|$D$u |$u |$TF1@]%t^_#Pt$h<_#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qha#l0-Pt$ha#|$L$lj% L$St$h_#{D$$t&1ɉQD$PS? L$ 9t 9St$hm`#,D$ D$ D$D$0L$0RPQt$,t$$P軘tBD$tUtsD$ |$tN4jVPM D$h|$tA811FD$&|$tN4VVP  D$'$D$8|$tN4jVP D$ptN4jVP UD$1=XN4D$44$Vt$h#`# Phe_#=HN4he^_[]4$h*a#ًt$D$t$$t$Sa@9s Vt$h`# S9@D$t$|1ɉQD$PSLF T$tD$pD$ 9t8u8 St$h`#Qh a#1ɉQD$PS ƋD$ 9t8t}St$h`#St$h_#D$t$։D$HL$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h^# jj-͗PhtN4h_# h_#ha#hAb#htN4hW#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSH1Ht$L$ltT$d;WuT$h;W(u QTl ŃtD$ppPU9 D$DGXHr P|oXd^_[]USWV$l 3P48tN4t P4/P4ShtN4בtWtN4މ)ˉESQ|$ W趙 DWP4V<VWfǀP4/SU脑utN4UhP4;,^_[]USWVhT$D$W#&1ChP4D$ CL$;rjt$V< ufD$jD$PjhP4V込t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPlvWt$hW#|$$j@WVPOvWt$hW#jk^WVPt$=h 3Ph#WM HN4t5lN4Ph(^#5h 3*D$$PV5h 3 pN4^_V΅tOHw;s1rt51t ttt ttth]# 9uЋkT ;$tl  1L$D$Sjh"q {t+1:LtPh]#K G,;{r܃TD$@TL$9uj CV;e1A ^_[]htN4h]#+USWV }=HN4t D$ toh]#W֠tc1ɉt$QVW:+ T$$9t8u8,Wuh ^# =HN4j肾11CL$ t$PSQVuu{tWt =XN41=\N4u?=`N4u6L$1J1ыT$1 u#MUPj h]#1ɅRaMUPjV tK=\N4u-=`N4u$1H3$3|$ uMUjj h]#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh]#SUh$S t9Vb4$Euuh#PƉ$t^_[]h]#h]#j1Fh]#h]#USWV\։ύD$ jPj P輨 1u0D$F|fD$Y|Uhk^#j D$ P$L$D$ L$/Ph:#j D$ P[ $fL 3/LA .sD$ L<u\$ SjPj S E9[|$ t D$ PVhp^#kd^_[]WVth΋u\~8tU~4~`N4F8 I9rP?a1F0F4F8FXHr P aFX^_fUSWV\$(S4,S4hc#sP\su ,S4~h"PÜu S4jۆ0S4Jmx &蹶'?c.5(S4芓h"P]u 4=4c#tT~#l$PKrt Pu|Qߋ<-t<+u{uNh(&StGSM16khc#q4S4t8u)hc#q4S4Pqt 4S4H$hc#}q8S4Pqt 8S4c#1=d#t (`4d#!d#t ,`4=4t8=S4u/d#0`4q&4`4=0`4u 4`410`4#u 4`4#⹁$8`4t8u`S48`4#⹚p&q<`4=_4tt8u`S4<`4#S#:@`4t8u`S4@`4C%d# D`4t 8t1@ D`4#1H`4#e#0%VWWhP`4hL`4qZ2#ޔ&V5P`45L`4hX`4hT`4H/s#m%V5P`45L`4h``4h\`4`&m%V5P`45L`4hh`4hd`4#;tlj=l`48$mp`4%P&⹪$##tơD`48t,<$1QQP, PW<$W趍@$he#t`4%= 3#u#u#D`48t2<$ S4IQjP谟 PW<$W:@$7U#S>x`47$ tÉ|`4##tƹ"=_4u#t‰h#Ɖ5`4>u Hk4^_[É$p`4z8{lV t<0 1=_4u V՚^USWV׋t$$\$l$;Et*+u(m%#t D$ L$M^_[]USWVր9tMτtC1`4d2U5S4W `41`4U5S4V ;`4|ut$`S4^_[]Ë (`4S4USWVL $։ύl$ D$?he#W)?SWULn D h VUX $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$ext$4h VWƗ L^_[]Ë ,`4S4V=4t =LS4=4uF 0`4S40`48t!4`48t=_4u x`41BhS4=4u `4S4b=(4t (`4S4H`4=4t!=S4|1Fj 2F;5S4|^Ë |`41B^ x`41B |`41B=`4ug=4t =LS4uN=(4t ,`4S4=4u $`4S4=4u 4`4S4`4Ã=0S4"`4Ë t`41BY `4S4Ht$j5D`4 1B)=4tË l`49tS4 =4jË @`4S4 8`41BV=4|`4tx`41B5`4t-F=_48`4t<`41BV^Ã=_48`4t<`41B^_=%`4t P`41B>`4t h`41B'`4t ``41B`4t X`41B`4WVD$ #=$ 3 lj Ƌ T`4j" \`4j d`4j=@4ttV$ L`4j5`4^_WV|$ 1Ʌ<+u OL$ GW~-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$8&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$ 3 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th=%V\trL$PQV t4uRL$x#e# $x2P #e#T$x )e#$x 4e#w^1Je#^aD$# $ 3  `49uVD$ T$5$ 3! щ щ! ‰ 19^Ã= 3the#Ë p`41BSWV@΃= 3tt`4tVstx1Cj S*VGVSP_GVh%PH. `4=`4!Vh e#j@WWZ@^_[ËD$`4WV9 3t#֍|$RQjWԩ1B$5 3^_Ãwh&ÉfUSWVPt$ P!уtRPtt jh?e#jhSe#l$$\$|$Q t^tY9uE}e4u E<Ճt(ˉ $19u tC ;$u~2KՃujhe#t jhje#jhe#D ^_[]1ۅs IQRP踒fVt$t= 3tjhe#5 3^á 3xy=`4uE `40@#4@u.`4jhe#?t P4t 3Pq 35$S4F$S4V1N=`4t9t/ `4,@wB$@(@1҉,@Ɖ^USWV= 3`4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhe#1@$qQ5 3 9D$}`4럃^_[]USWV-`41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5P4(`4@9@S `41JЅt8=`4u/@u1u0@4@ "'[WV`41t[@t @4v `44@0@{!уt RPF1G)t P4t^_USWV`4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH`49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë `4t$@(@ ,@1HUSWV5`41H(@$@9t#H1ًP1 u,@;Hs DԎ4%D$z9tG1؋O1 D$ ~9 $tG#G=Ѝ4t @t 3x9 @}lh j:tH @1HGG7FGF8~FNOG Fx ~,@;GsN+Ѝ4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@^m!ƒ5`4@@ 3tOD 3Q@u;G  )RQ@w u&`40@4@&OD1@l$1tʼn$yjhf#1=,S4u 3x~OUQP= 5`4@@o<$t0@D$4@=`4tU=Ԏ4u#L$ Qh$ Ԏ4j2=`4t=4u q=P45`49>tOOHO`45`4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhf# `k41H^_[]USWV`4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H 3á`4@u1I4@0@Ë9t1JQQ 9u@o `44@0@1@@(@$@,@PPP@i!ƒtjhe#81PPjt$i!1WV`40@4@!΃t@@9} 0@4@^_SV\$t$ 5S4({`4h8@j`4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVh!ƒt`4 `4@P5S4vz`4@u@^[SV5`4@  ˀuH9tPQP P;dž @vv Hu5`4@uE u@G5`4dž@tV[;1`4P5S4y^[á`4t@1fWV|$t$ t=`4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVIPtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h#jQh%k#lLh b4hb4h$b4h0b4\$ -uF :tjh4k#]jNbt'.t5b4bt0:wtptcu+$b4F&jSh b4 0b4jSQ ,uF b4b4b4b4b4a4b4b4$b4a4(b4a40b4a44b4a4hj#J1tPhj#J1F$ 3Vhj#Wh`4P(hj#dJVhj#Wh`4P ^_[hj#>JPJj3N1B thj#Jƅu&hj#Iƅuhk#Iƅt]h)c$Vבu6h,f#Vőu$h>i#V賑uh9i#V衑t1B,f#w1 3TA ruƀ`4ƀ`4ƀ`4@=u=`4D$`4SVt$ a4M1ۅuDa4;1Cu13(u!=4u3 1ۅÉ^[D$`4ËL$=r!=`4tP5`4j ha4ї'`4u a4a4ua4ESCa4Ãw@`4uQhj#VPt$ u a4ESCuw `4u;Vt V5`4B$a4xPV@,@`4uPhj#V5`4j ha4a4^WVD$L$ =`4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=`4t'~3P19wKS>~-19s2C,9r9v)CK$SUfuF8AU*V*o ɋl$u9tSv jft1|$jjSOF ~.EFE0uE^_[]VTj4t";T3t1FVh.uD$ L$PjQ课 $T$e^_]Ë dj41; Lj4|$(3D$ $X3D$D$ $Uj $Pt$Wփ ShUd SSY1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=,S4o=83u=h3u =4P1TAPY@PjVP?WX|8QZtQL8h5b$W艄É4$pu1ND$PVDx#D$ =uhVhk#a0tPƅdո(3Ex uָX3Fx uhk#h$Ss T$Z]VUhk#S:SW4$VWWVĀ^_[]SWVhk#/P/tt;^_[&h{#VYY1ۅt+hZ%VEYtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(3tX3u%k#+k#Qh$PC tWh(l#v. Y=83t"hk#h$v V(3=h3t%hk#h$v VX3^_[^_[USWVPӋl$D$ $uSPdVSS1tD$ t}t8^_[]StV믉hrjjx j4j4$t,tV#hj:} =P4TeuYÃ=P4e4΃ej4~o6/=j4u #=j4 t t =^=j4;j4Ct}.CЃ jS&ed~hj4 j4j4=j4t j45=j4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=j4ij4ih%jjS\Fc`$X&=,S4 &t>#-l35j4=ES[jUY  xSj4H݃t =<4-j4>!(Ƌ 3ķ>tjVUP t j= 3u J[\ 3jry C$ & 5j4 h8m#9S49pS49S4=j4Sj4C1Ƀ j4j4ῃ5j45j4j4/U]VsWWr!2@*=S4%j4j47`4j4hO$jjj4j4n=,S4 5T3j4 }h5l#j4 _gh &y1PPv`41; j4j4 j4Hj4j4/=,S4 j4%h0m#1PP9S49pS49S4؉ك u. u.S莍ij45l3j4%aih&{jVyj4j4 PZw j4 *j4уBЃ@*? !1҃ ƒ!D$Z=j4,9S4t 9pS4h 9S4W jhm#j#t$(VnOVrlp1BsRtM&=S4=j473j4Щuj4Mj5<3ùe=P4Iv_*-t%+q1҃¹) j4j4S\B D$t1< j4D$ D$ PD$PD$ P萪 j4tjD$D$-<{|Q<`ʃ=j4tR D$HL$@븃@j4|$ ^s 8eBj4emh m#1PPL!ùe9S4e9pS4e9S4e e 1?PS1FP@/j4Ph#5j45j4虤 1;5j4j4|j4j4n蔰VVA 1;j4j4  j4j4|\S4'M1PP5\S4 =4 j4 t|7ػT 1;j4j4|j4j4蛻=4j4u' j4|5j45j4Pj41QQm1;j4j4 j4j4|\S4|C=4u5j45j4P1PP5\S4A j4j41҉3P541;j4 j4|j4j44聺觮5j45j4DT54Jj4NVh$m#h1PP5 ùe9S4e9pS4e9S4e e /йSE*re|褹ʭn4j41n4 4 j44 p4 j4p4hc#Cjjhl#j4݋5j41ɸd9 jhl#=S4t>t5j4n4j44j4p4j)eD$t Pj{@eJr蘬 L$Qh$1;j4j4|j4j4)O=4j4u' j4|5j45j4zMj4jjP1;j4j4|j4j4跷ݫjj蟷ūD$<03D$Ph-l#=,S4jh?l#VR j4j44 j4j44j41ɉ j4|j4j41@Pe(ejhl#e1;j4j4|Yj4j4 諶Ѫ=4u5j45j4Ljj- j4j4ʃEݣ4c j4j44j4  j41; j4j4 j4|j4j4q j5<3?j415j4"5j41;j4 j4j4|j4j4 j5<3RCij41D5j4=4t5j45j4J1=W j4ij4me5S4V?P/V$j41ɉ j4|j4j41@PuGjhl#j41ɉ j4|j4j41@Pk 2V_e!ֹe54RPyJ1A诳է j4j41҉AQPcMn4Nnn4j4>X`hm#r1PP?ùe9S4e9pS4e9S4e e S賁+̲1PP5,4n豲צ1PP5,4jP#'j4j4ؽy蟦=4t5j45j4Gjj5j4d:0ؔj4j4艽*Pjj5j49; eS贔D$D$Phym#{豱ӡj41ɉ j4|j4j41@P"etbt3tFu j11A; j4j4l#|#L$Qhl#11%j41ɉ j4|j4j41@P'"e11A; j4j4l#|#L$Qhl#je5S4<h{#P:5S41=tjhpl#o5l3j4nvh&1SVUh蠻Ag58S4rSPx]4 S4݉j4 j4n49‰}j45j4)‰n4`k4e4 S4j4 j4n4`k4i1j4j4154QPHFjhl#H3D$Pham#d ։u=j4tj4 j4j4e,5j45j4tI~V8JjhUl#bUSWVP趮ܢGVD$1Ƀɉlj щ n4n4`4=P4uH9ljD$u21xUUjn6 9-P4u;=n4n4D$t`4 P42t8teue^_[]USWVPӉơj4uj41 r4$0utV4$#j4j41ESWPO áj4 j4 j4tu1Fx` sKu j]j%u0SW5j4 áj4 j4 j4ujhm#t 4$4$^_[]WV= 3u=4t =LS4u袬׮t DS4@S4!ʃt]5HS4QY`k4u = 3uP54=`44`4u _BLE54=`41jPPB ^_SWVj4߾R%t{#j4/ V+=j4u V@t hn#t u& &P1\k4PP^_[V蛫ơj4"~S.#V$^%=,S4j4VPujhm#  tY>!t j4t P V!j4=,S4Mj4.hm#qF<+t< t S4t Q V菛S4/7E=,S4V蜭hm#Pt% =,S4V^Xj4^(N5j4jF5j4jQP軯^5j4V5j45j4j473j4j4PVS4hm#h#r^SV j4t s7j4Zbj4shm#ij4 shm#Qj4 shm#9j4thm##j4 shm# j4fyhm#j41Ct$‰sShm#jVXVj4CuϹ #t% sm#Q\k4^[fD$=`4t@WV|$ Wjeƅ~WhVt< ^_USWVt$0l$(|$$t U+0,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD `4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t WI WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f j4 j4 j4 j4USWVi $AD$)< u?FP貛^tP@.9~n#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp3hhh3hn#htjPVK jh7n#h&n#h}tjhVn#hGn#hjjhmn#hcn#h}tjh~n#hvn#hj^Vt$ t:j j tL$HΉp j4j4jhn#荞^Vt$ t:j j tL$HΉp j4j4jhn#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]hn# t8tMjQP[ ƅuh#l#t98t4jhn#P/ ǍEjPW W iUUUSWVP1F=,S4jt$&P#19jV^ n1PPPS!ƒJVWS腢 <$S跣11 ?$:81xM'x+xG1O|E(|n|dȃ|$j4tj4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW St1N^_[]4$ |t|uVP11xtɉSWVhj4t$b<ƅui\$hj4e5j4PShk4I5k4P|j4tj4hk45k4p^_[ËT$ j4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=(4ÃB1ۃ=(4ÃCɍH9 S4~Pj#|k`k4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=(4ÃB61ۃ=(4ÃC%|$mu9S4~HPj#j`k4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P$V0ʼnP#D$X9vpG$11Ʌu2~>9sWt$V$ t't1:%31F9r':$3u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW\#V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQs|t1=l4ƃtEuG%t|QhJp#hhM&AVh$6 Eu ?=u Qhp#$ u 覣!ƒtVHQhpp#^Ã=l4t$S4tPP&t5S4ËD$t5S4PF$1PUSWVu195S4OS4t_jP%=S4tJtWg%W"=S4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =܍4uID$xAP t4D$8\$Phdo#FًT$WVt$j 1@t=S4jWd$5S4t$V$t$5S4g$5S4$h@S45S4#XS4t$ t$ ۨ4=h4111P4D$4PD$,$jUuWP@W` U ڃ,$C^_[]SVt$ h{#V%1Ct'hc#Vth o#V 1ۅÉ^[WV$ VtVWVtWt^_USWV 1=4]=,S4Pj\hl#1Ƌ|$ 11@L|uM@-u)Fh{#W? )1%tuQ%t s@AAۃ\$WV' W ؃D$jPtWVt$P72W "S 1tXt^~u1O\$$D$jPW uQD$P4D$(0{#^jh+q#4|1 ^_[]ÉOV"d;t;Vd1|$rɅuŋD$( o#1O;PrS USWV=,S4t^_[]j荈hZq#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhdq#U{PljD$UV| Wq S\$b ,8jUHrS\$SVUP|04$ S \W Vb V|V$ړ#N@ |^WV|$=܍4taPW虓1=܍4#D$=Wu*jP`qWP<hP3LPW8x#D$=@{W'jPqWPM<h@3V词 WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj5S4# QPpt1GL$ T$34k43 0k41@ u,L$3 t'sujjh(4$jw!уtjt$WRPS#^_[]ÅtS4HPjytm=`4tPay1u11FUvUVRPVjv!уu P4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V S4~&111RP!уtF S49| 1 S419^fVt$tsVGF95S4u#1=3tu1Ɂ3tщ S4AF=3tH dk4v v ^ ^ËD$3tQ13tЅtË 13tËD$3t 13tËD$3tI13tádk4USWV\$S@Nj533tv W6W |$j4j'fSeFSF 1HF$F F1FFF0F,3tFq0@@F=3t@dk4VEESËnU9Ë\$sUQ SKeFW< 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t Pg w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=n4jjPWV^_USWV,T$Dl$@ظBӃ=|4t  4t0k4 @1)ʉ|ЉjSUQP虊كQP4v=4tK uu|| t u+| t uP4ttP4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tP4ǃ݃ tkwRPW v=4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N n4 CfN =n4=4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$14l$t$1E1!1M,^_[]Ã=4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy5 3= 3H~y@wr 1N5 3= 3^_[ÐSWVstjhq#c^_[uƉסS4HPLi11 u^_[8iWV!Ӌ S4It*QRP4 S4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhr#bKy1V[hVjRPUo=4jusj'hD$ jhD$T$l$ !Ѓtd9}\S4H94$SW!уRPvlj9Љ $AS4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$S41VVjt$t$PY954^_[]1K16-Xk4-`k4S4H $)QUjSWP(1K[6=4tf"g15`k4SW=gS4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9tk4u#>$4,$tt=t|<9tk4|wC^w \$D$Shu#jW$4,$u#f9tk4u+9tk4}9tk4t9tk4hu_G t t1"~#ut|\tt t tL@?3~|$j=W9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuBv##6$4t$ t t_Gv##$40tUPktuQv#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVlk4^_[]SWV׉Ή5pk45hk4hu#hS =w )WVRQ lk4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl"3 t^xk4xk4yk4JtGtO GO xk4yk4l"3 txk4uxk4^_[]ÍZ w6$"'tEGЃTZ$#'btPeu>fxk4랄tGOm>mS#놃>7U#w>O{&h>%P&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]xk4yk4d   >xk4 xk4 yk4zk4~k4Rhu#jhxk4x #v#xk4_t>#vVhfv#m4P+t m4߲"hwv#蹻m4Pt m4v#jVLm4jVLm45k4h n4hn41$n4PҎ $uHn4^1|$áPn4Tn4Sm41n4m4 m4m4 m4m4@m4;m4|1ۉXn4\n4`n4dn4hn4ln4pn4tn4xn4|n4n4n4n41HTn4Pn4h n4#hn4$n4P $uHn4[USWV\$0l$,1=̍4uSUƉס4 H4SU\*@u6 3 3!ʃt'9݋T$0| 3@9- 3T$0| n4=4tU tn4n4Zn4m4m484 n49}Qn4Ɓm4 m4ك=̍4WV^! tt$j VRP)NV61 44)~$n4r5n4Ƃm4 m4Iu܅~+1ɊT 5n4~=n4m4m4A9uסn4H n4ƀm4 m4n4Xn4^_[]Ë 4t 84=̍4t144@V5m4m49}9 m4<u"m40Ph n4 m4m4F9|Ӌ5m45m4n4Xn4^SWVt$\$u$D$0j?oP/=`4t&v!Ss1҅ SVqt1҃Pn1҅t$Stm4~- m4Vt[um4 m4LV3Zt m4t> m4VtV[t'i=`4tVs1҅ƒK1JFVY# `4#`4#5`4#_4‰^_[QY# `4#`4ʉ# `4#`4ám4n4Xn4n4án4m4n4Xn4ËL$1wQ5m4p1SVt$ 1ۃw)V5m4JuV5m471ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJv#9u!B1@uDA;1A+u%uVt1@^ÃwV5m4Wu߸ع#L$1uj jE1ɉHH闢 SWV=xn4 u|$t$\$t-1 |15n45n4tm1@Z ugx4t 4uU=pn4~+n4 n4\@n4pn4xn45n4=n41xn4=`4 pn4%=uan4Pn4n419Rhn4bmhn4mn45n45n4n4 n4H n4pn4u"n4n4x,1WV=`4t n41At^_[ÉШu-%=tS0lpn4=n45n4뢋n4 n4n4pn4USWVӋl$,|$(hn4=؍4n4uBu>%j jzC1҉PPn4n4hn4hn4twQPl'UWS n4xtn4Phn4蔅1n4hn4u+p4t4A\$l$͉=`41؋5m4m4hn4Rk5m4UWS% 65n4 n4n4PV軄Hn4@$n4VP诅V荄 Hn4AVUUUЍ@@Hn4dn4 n49}oh n4藅ơdn4 n4Y$gQVlu&m4m4PjVPmln4$#5m4n49|m4l$ EVjUek L$ )v %uhn4蚃5n4貝 n4 m4; m4 5m4|tq=m40jf jm49u"_l$\$u4Шx$_l$\$u$5m4 _ ‰$ u*t4t =4uKuG ڃ^_[]`4m_uiud1UWjXn4+n4 t"3k491J$;k4} qɉы4k4)t _m4\$ PjSi 1EL$m4) m4PjS`i ǡm4 m4tW4V)Xn4~Zln4t\ [5x"3)Й)֋$F UWh% N1hn4E1-hn4$_PdtUW ]`4t6=؍4t-QdtQd UWl $UWS t1@1^_[]SWV=n4~4։1n4Pd VW u C;n4|1n4)^_[Ã=pn4~n4 n4pn41WV=pn4~n4 n4mpn4|$t$ =xn4uu 15n45n4itb=4tYdn4S49Xn4|`n4Xn4\n4m4AS4 dn4H9Xn4} 4 j 4 4jf=H4Xn4tLn4tBx dn4 S49}; j,Xn4P dn4 S49}n4ы dn4 S49|L=_4tC_4„u0=؍4t't4|$t- 1j1j 1j5m495k4 um40m4^_V=؍4uajm5m4ڭtMȺj9#e#Fu=n4u"Ⱥjv#Fu^SWV։ˋ=m4Gm49=k4 um48m44D$ Xn4; `n4~~ `n4m4\n4 Xn4^_[SWVm4 m49}1T$5m4ׁtu Ӊ m4@9|^_[ËD$L$ m4m4VD$ L$=tn4u=4ttNI1҉ tK1Gn49~m4m4+5m4)΋ m4 m40 ~^tn4dn4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8P4u/k4H9| Qu@m48GO1H^_[]cS m49t m4Mtۉ>?SUSWV-k4\-jS% jS DžtVtRU5m4VC m4UPW. U覕 5m4蘕 5m4=m4k41t Wu 1Gt Ve ^_[]USWVL$D$ʃQPO1H…t$=k4m4D8OlV tnP4uc~m4>-k4u@m4 (I=k49rHŠIJm49s=k4)\8OVà uQL$ t m4t=k491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vݓ 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15n41Kn4|EtESSP t衴n4@ԋ=m49=k4 uS1Hte1ɺ|"3:tWAuN1|"31I:t?@u21|"31I:t%@u1|"31I:t @u^ËL$H1Ʌx "3USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=؍4u1@$5Xn4+5dn4~1; S4^USWV։L$|$0\$,Ѓtln4!t6tC؃T$RjQPWSQ=H4=n41ۀ=|n4tw4$|n4 Hn4ىȺVUUUЍ@)I(n4~4,I(n41E 8Vt$0j* G;}|Cu4$SG n4tf n4n4!Ƴttt$,9} 5n4=n4|n41ۃtQm4 m4T$ 1ۅ~&L$ PjQ\ m4~m4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1Edn4;n4uXPn4#Tn4uD$,Pn4=Tn4=n4~01 n4 8jG;=n4|h n4tXn4;`n4~<$~`n4 m4 \n4$Xn4~1 ;j_G9udn41;n4uD$Ph n4tm4 m49~~51ɋm44*1 m4444A; m4|١m4) $ dn4m4 dn4; n4~( 4 jdn4Hdn4;n4؉^_[]WV|$t$ =؍4u1WVP PV WVt1@1^_Ðn4H ȁ4r14̇4n4Ї44ԇ4 ؇4 ԇ4܇444444USWVL$0D$,l$$ԇ4$ԇ4ԇ4t-9Br }$r1z3|$( Hԇ4u$$ṙ4t :=̇4Ї4Ї4<$:rBJ jl$(jWԇ4tC:ԇ4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?ԇ4t_ )ϋ,$]}ԇ4tԇ4tV+BJ NF=Ї4uW-ԇ4MEu$9ˉ|-Ї4],$ϋ=ԇ4t sKӋ$JHJ^_[]USWV1=̍4tD|$(T$$!t3|0ԇ4ԇ4=ԇ4t'9PH }=ԇ4u11CŋE1ЋM 1 u ]u,444EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}P4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[P4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt4 11؉^_[]Ã=4xÃ=̍4u `k41̍4Phv#4V4xNH 4d|@4* 4549|jhv#z54^USWV|$ l$1Ƀԇ4ԇ4tKC9ԇ441 41 5؇4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9P4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RP4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=S4~%GW8É!Ѓu O;=S4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhLr#2n41111ۉu WVSU1PPWV+P4u Ɖ!Ѓun4^_[]WVT$D$ =T4t 5L41)|щƉ^_fUSWV t$ >-uF(s7h&+V+hmS#+艣D$1S6]+S)S\^S:S7jy W:h#À8t>tkV聪tmSʼnD$$U $ȃ$jP'袷t$PSh%t$Ut$i  Sa'Ņu>tVh"F'U'HU/ j6W :W61FVJ]V'D$$t*P*hv#y*/j ))3`k4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhv#.1N\$h5b$S4h&Q)SH)hmS#;)3(1S|&S[jj 1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhw#1KtL tGf;t=ËFHN~ ;F~à tQu VS4V1Vj 1GWZWg%e1=`k4VZ^_[]fSWV141K4t 5u'#ar'G__ _Gt P GF6u^_[ËL$ 1ɅV-$t:4'W.t7^uMS441(4$4,4S4 4414 4 44t P~ 4Fu,~1S薺PW豺Fv} ^F~ ^v;S4t PNu VSWh ^_[ËL$t@;S4tjh!w#x)1HËA QUSWVD$T$1ɾ4=S49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J94u (4$4uUSWV\$SκƋ 4t@PPVǸu4 4| Dž 4W| u^_[]USWV=04|$,t$0h$W l$(4$4!ʃtWj UQP" 4u4 h{#Vt4VU,4Ph:w#Wsu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=S49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P{  $FQF^_[]V=,S4tjhmw#&dt$D$tt/uKV$S4;m?u7= 3xCjhw#뵃= 3x%$S4Qhw#l&^jhw#jhw#{Vơ$S4t PBz VޣP$S4V z 5$S4蛙 ^3 S4VD$$L$ t tC8.@L$$Vh&Q #3>jhw##3xxPh$x#j VV辳||P|0tB D$0Ph+x#;D$$Vh&P >t.jhw#14L$Qhx#$^ã4#3V#3x$ S41Vh@BVPRQ_4^VD$$L$ t tC8.@L$$Vh>#Q #3>jhQx##3xxPh$x#j VV腲||P|0tB D$0Phx#;D$$Vh>#P >t.jhix#14L$Qhx##^ã4#3V#3x$ S41Vh@BVPRQ&4^V|$u%t$jVt0Phx#N#^V|$u%t$jV؇t0Phx##^SWVD$L$tP04p=,S4tjhy#"VP>PR Zt V踘)X!ЃtV谕54SW? ^_[VD$L$tt\uoPe003_Pơ003t=(03t P7v VӟP003Vv 003Qhy#!^V|$uJt$ =4tVS4-44h%_V_h@^^WVD$t t0t$4l7=tDMtGhuXF 03P44Qh$5!Emtwt su!FF03F4F4F$037u V^_D$u5ԍ46Ã|$"7VD$Hs^\jh-y#7<03V)h;$&Ph3y#hJy#V葮;03xu'hsy#hy#hy#hz#hCz#hwz#hz#j^^WVD$t$ʃc"y$`#'m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=@4utjhz#$FVPMy0Ph{#^_ÉPhz#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;k4~k4A9s } uE9u9t},u E&| t"3k4+|k4x"3 ^_[]WVD$Pt t*$TV豫PVLD$ps D$ stopD$Tab =t"3|i1Gt$rVifD,VY4k4h#PV G;=t"3|V-D andD theDen t$V5x"3hO{#P?V 0Ph$D^_à D$t t+uyL$tJQtQytWjh_{#Mà$3L$%3AAD$Ph{#!%1%3$3$3%3 $3%3 V D$t t]D$t$jh5$QVP46h{#V趫t5>t 4 $ 484tP94{#L$Qh{#O ^ËD$Hsjh{#/Åu tejhD|#Ot$5P45L4hX$jV0Ph^|##t$D$,VhY$P >tjh,|#9 ^ãP4L4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$#'d~&s wR$ $'s wU$#'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G`41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh|#1QZS`4^[ÍD$Ph{|#҃=4=P4=L4Ë 41 S4+L4t$4Ph}#h84P 84USWVl$,H \4t&AUjQD$}ol$,7F]$4$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}#h84O 84FVEŅ8D$EH$$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=4nAL$,9 ItIT$uWoD$,744j+o2Ph}#84VfN T$jV%D$,|$?+S4t Ph GP S4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt W|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h#3rtP ~031@USWV\$(|$$1E=4uh4?4`49<$l$D$l$ =Ԏ4t=n4t=4u03=4ubPjD$P  D$tD #39PaHD$=`4t=d4tft$,SW 4=`4u"t14@4| j=y!֨8Ȩ8#1Hpt9=`4t4[14D$ D$D$$PD$Pj 9=`4t P4t, P44^_[]øjh4UVV->Ve^]USWV\$0w SV,jUVShW#UP!^_[]Vt$Vw uVh#h4C 4^USWV D$0щL$l$ |$$t$4PWUCƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV!CՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SB׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPQBÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWAi)$l$D$ ׋ $D$ՋD$1PPU\$SqAыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP e^]fSWVPP4t `k4Z1؎4WP(t>1C4$$؎4u V WSCu ^_[S=4t4 \$03=ے4r 03H 03ܒ4[V503܎4t(܎403VP503  9t `k4^Vt$503^Ã=4t4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRV'ي#O u݃|$0xG-Wt$8^ ^_[]USWV\$8T$0t$,11|$GUSRV踑ي#O u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$F#NuxF-VQ^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$PՎ ƃ^_[]WV t$RVQ t|$P3GuVy^_9Hw @sÃtP=USWVPt$|$4V<$=4uԇTh=_4 v#Vt$ P]Eu `448JMp;5S4| `k4^_[]VWj .^_[]ËL$T$#PPh# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu4^_[]WVt$|$ zt!#3Ph̐#PhƐ##PPh# ^_WV|$t$ t%WVra7ft=S4 `k4 j Qu jF^_fUSWV\$l$=ȍ4u<؉%t1U؋1GWP?[PW1WPPUVd[1 jj1=S41Ƀ=H4HPVWm Åt!W"Q |$t8jh#'D$ tPxD$ 0P D$ 89t VP ^_[]Vt$tPvx6P ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQ荑 ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u D$E ʀ[} ȍ4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø ~&fL$tt"u$ S4S4HI S4I4ʋTUSWVD$T$ S454|1Gll\G9uTD^_[]SWVD$L$5S44|F|\\|N B^_[áS4~Ph54 USWV S4; 44th!t 1G31K;)1G1I4:tl!GtˉP#M  S4jQJƣ4S44~PhVJ !t\l^_[]USWVPL$\$As S411H$(uS41@$14<#|tZ44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$41H; t$z|#=S4|O1;Ll |C9u^_[]USWV S4~.411F1l9޻r G9u1@^_[]USWVL$T$9~1@+54A1G1֋l9߻rB9u^_[]ËT$S4!х1A9Hh&'*4=4&'t&'P 4hE''4h%'03h(&' 03hx&'$03USWV \$444|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$t%'=̍4EQ-s4C$ىË $Fw$%'#Fw}$$'X!уj WRPBBtDt L=̍4!15S4h{#P81sTu~-~$PuYQA tLу|=RP螽1 $1=447f1=n4u ÊCCs|,v, l,uȡXS4!ƒtظ:,u5S4资j W5n4QTу S45L4n9|$ V5S45S4蛅PtmƉVG +1+5Q ic+Ɖ!уRPUV4=4H8 4H=4wA5S4kP豄 !уRPaٹ L4 S4VQRPg 4S45S4,Pkyփr9RPٺٹ}"RPOj WRP$ #QD$ tOՉr6UPlٹ}RPVt$!j WP(  #/15S4Mj WP j W1P9;"@|4#9 4t 4# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I54Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^503~V541=4tȉt 0340AXS4^5$03'SWVQ ~Nj4ع49r Ѝ4WVSY ;4;^_[VQ!уu$x S4H9}FV!уtt^^Ð14444WV|$ =Xk4t54tZ=H`4ta=S4|<1W!уtRP虆Ws@GS4H9|vu4覍54^_USWV 3 3D$L$!ȃ 3D$ 3D$ 1H 3 3 3 3=H`4=Xk4t4$=S4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$S4H9|u $u^_[]Ã^_[]鍌^_[]T4K|$th4m=4t1=44j jh#"V΋At PA FVC^h4SWVt$>t_w @ W@ ߅u1F FF1H,4(44404^_[h84SWVQ1u(\$|$84St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-84Vt;xH|p$x Hȅu^_SWV|$t$u;84Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=4uH 35 3!ȃt3 39 3|$|$ !@tp\$9ϋ\$(|$}^4U1tHt$ !t Q9y}1I(t(t$=|4tT$$1=4uȅt^_[]h44=|4tUWVjW7!t"j]jRPWV je^_]Ã= 4u ȍ4H44d 4Vj5<3t24jVx 1F=|4u=4u@11N^USWV(U ]1Nt$ t$tr:tm14PSi( |41 4t)1V54h4 |44ttxq @34 |4t =4tj)|4u=4t494J\$tP1ػ&!Ѓ1ojh#D$Pj@t$>SD$$PL$Qt$Tt$V>L4$u:44 04!ƒt&9L$L$|D$;(4D$,4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d84T$X/ t$4 t$ 4 \$(T$_CtN4$jjD$xP$Pt$4t$54542$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$b3 VY3 T$1H#E t0E t L$PL$THD$$e^_[]Ã=|4u?h4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ n4L$n4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$n4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8n4`k4t$G1 t$ ;1 }tEL$L$H1USWV8=44045,4(4D$$8u=L4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}44 04ȉT$!Ѓtsu!9t$ƄuY,45(4;t$T$$|@Ut$ 9D$ЉʋD$4$k4@Eh4h84}!k4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=,4(4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$44 04!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 04D$44D$$(4D$ ,4e^_[]1JЋ4$|$9ωL$}@D$ k4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=L4 USWVt$h84tH>tC\$1EjU1GGGUSxLL4G=L4-5L4t~'VL, uL4`k4^_[]W$, USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)54jjSt$DPV5454s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9YS3Y\$4$"Y؃jP 4$t$ Vh#PHD$9t P hR#WiW  403=403tT4X41Cwj4''=^_[]ûD$=Х3tP%USWV T4tA I tQPU$b1HU1P1P蔒D$1P4!T$RT$RL$ Qt$ V1L$΃ t݉!Ѓ=̍4tRVUW腐ڃ|$=؍4|$$u|Qt$T$&P&Sj^l$ŸPD$PWt$U&$t$W Ul$ L$L$ ӉWeكÅjh#1H$D$T$$^_[]VL$~4T4A1t2403t5T4X4F1I1^VL$~5T4A1tr403t5T4 X4F1I1^á\4áX4áT4t pV41@USWV׉1EUj SV@UPFSP/D$F~ |$D$Ft$WU@jP躾FWPF^_[]USWVP$ϋ-T4uVUPWV{V 1u1$}t  tut$RƏ T4QA 1@^_[]fj͗tjPyjh!#x`41@SWVP|$jW5`4蛺 t&Ɗ\$y jṵt^_[ÐD$1ɉHHVt$t P5 1FF^ËD$@SWV\$|$OG9}7dtƉr1ɾ9rG!GjPƋtwPV.7 7 7OAG^_[ËT$T$D$D$ s1@ËL$t$t$P 1USWVt$~|$\$1/PS E9u^_[]VL$AtpqD1H^USWVt$D$Fx~1+PVE9u^_[]ËD$WVt$ D$|$tt+19׿r#"tu u x q11@^_USWVPL$$D$(t$ D$D$d$Éljd$ L$(tL$"L$t1@ L$t$0t$0V= 1^_[]SWVp4$D$=ؤ4e Vj_Vj _hd4tW1FVj^Vj^h#胩4t"k33=4TP L@03t%54@03PV4St Oȅu4# =4$8@hR#5t4|Iƍ|$PhW辅 F<$$hE&P0u$$8 E$H $5\33WR$$h`#PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ 454PQ4D$V$8tq$ $9t $9,t$ $9t $Q$ 454PQ4utD$5t4h#gx͑#|VgO|$t4P |$#tX#QVt t tG1҃Єtt>D><>u^_[]'#1@4Ph̛46USWV T$(\$$t$ 1`03PURSF)ˉ<à uVh$Kpt$|$u u)u%u!1ɃtsQl03Ph# pt Dh#^_[]SWV \$ hSh## uP th*#̞ ^_[xEhSh^#o# 4$at t$Qj V膾hl#뙿 hm WS523t$S jWS|$W/[9uR1Vt$4$Ծj Sh#VeWV|$ 533j/Vw4t@jWhq#QVm^_1@4PjRÊD$03J 03;@3~{у ts (3Q(3jPh4h6#" th4hR#Pqt:j523P? f=43u54h(3Qzsh4h#mUSWVt$81GWh~"5 4 1-4h:o SQD$hܡ4SD$U & Wh454 tLtFPFuf=434tjQP辻 Pj虭t$4l$0j7D$T$1D$EHM~EHMU EڃÃ=4uf=|43u0Iڃ% tM 1f=|43@ ЈD$P D$ƒ t|f=|43Qq f=|43uf=33tT$j \$Ct,j Cu\$T$f=|43x댉\$ 넻 $f=33tD$ @D$ Ph#kڃf=4345l43jW54 4 4 u61=d4#$ |339uj75$t h@#jڀ tf=|43u j ttFPFujÉUAt$jOf=33t'+\$|$f=|43#tҒ#WSP jh454輷 h4jj"(^_[]USWVP\$D$jP54 f=431=45l43jD$P54荸 W9=4ttػ1FU Ph#iKtMVh454- =45l43VD$P54 W9=4u^_[]WVjPhT4h#% t ^_h4hT4HrhT# ы 4u 4Q[hR#PktAf=434#t#PQhW@gWh#V \Wh#~hLhMu jL4USWV$03J 03;@3у  (3Q(3t$hVh# 1GWh~"5 4F WS7LWj,Lhܡ4Sj\  Wh454H x>jƉ׉U}~*9u$h(3QmEhl#d11f=33tj|)RPh@# jh454t 1h4VW WVTKWjIK^_[]j54W1SjKSW KVVh.#fS]USWV$03J 03;@3у  (3Q(3t$hVh# 1GWh~"5 4f WSWJWjLJhܡ4Sj| Wh454h x>jƉ׉U{~*9u$h(3Q&kEhl#脔11f=33tj)RPh@# jh454蔲 1h4VW WVtIWjiI^_[]1W54j54SWj$IWSIVVh.#dW[USWVPhy#蛓1GWjHWjH9etDƅtZWbz9uh#L1VjHVjH ^_[]h3WjhL$hV#Z1SjVHSVGH-33j/U)t@SQUb h3WVhL$>hJ#W`WVPjh;m$5 4 f=33t%533>t=4V:PVW輰 1FVhmS#54襰 |$VW54ѱ ?nu533ha# c ^_VPjPVhs# t=(4u.5 43VyVhy#bh#БP^Vt$j5 4ƱVtVh#{bh#莑EjYWV5,43t)>t$=4V9PVW觯 j͢j{VhVh# V23t$23jh$5 4D 33u33$33%33t$33t$33f=33t543t$$543f=<43v#tڞ"Pn43t$4343443t$43j43t$$43f=43v#tڞ"P^WV,|$8V54$hڞ"W9t! $#4 $ 441GVW54> h4Wj.8^_WV,t$8W54!$hڞ"Vs91Ʌ#G OWj548^_V1Vh{t 54) j觠Vhzt 54) ^S\$1uHjP[ESWV|$\$1FtCWPt1^_[fUSWVl$$144l4%PhP13hݕ#t$4U51I~1L$$D$=48O>HЃ sX 4HЉ5l4jhP13hݕ#t$4U߃ufH1K$(('T+=4뷃EFT+=jh #S6 jh#S6 h.9#S7D$QPuVT+=hm&SW7h$SA7zh.9#S+7$_=4T+=p41@D$<$XD$4=4T+=j/S$4k<$$YxD$ P1PhPjPP5T+=H! l4L$ !P5T+=ha#Qsx4ؤ4|4=T+=W>4*Shͦ%h4蚋 1@1H1HD$1@$D$~1HD$$ԟ3)t5|$L$(4hx%Vg5t5p4x4ؤ4|4u Vj@Vju@Vjj@Vj_@45l4hٖ#j VtZV4$jh(3hN.9#w|('P_ D$tu1=4 1A111ɣ<43 433333=4t 43=x4t5l4 uW6uB=x4u5l4 u3^_[]xVh#Hh#Ahޖ#:h #j\5l4h#!hD#h#h# h #h1#j'h3jj@h#jQh3jhh]# jzQfUSWV,|$@h j>W^1ۅ4=x4h4You.j 1=|4ȍPU輨4j4x3=4u?jP 4teQ}4Uh$4WŅ?1GVj==4t1O,^_[]ÉVQ=|4uL$ @Vj54 1Vh t 54" VjU=1@4jh4jnfWVP=P4t 5L4t$uhޙ#oƅh#Xt8/u2323# P Vh23PQ R&1('9uQPt$ ('uڃ=l4u%hl4h[$t$+ u l4%hԤ4hQ=%t$ u Ԥ4=ؤ4j:hj#t$8 1Ʌuǡ4u'>/54jV445Ф4x4ؤ4=l4u l4%Ԥ4Y1ɉ ؤ44t=4u4t =p4lj:h~$t$q 1Ʌ 4=x4u64t=ؤ4tP54/1x45Ф4j:hp&t$ t 33j:hW&t$ t 43j:h^#t$ t 23j:h$t$ t 23j:h%t$ t 33j:hs#t$g t 33j:h#t$F t 33j:hu#t$% t 33j:h%t$ t <43j:h%t$ t <43j:h"t$ t |43j:h~$t$ t 43j:hQ#t$ t|4j:hu$t$b t 43=4u 423=4u 423ܤ4tPh#,4tPhK"4tPh7&4tPh9%h4h#t$[ u 4h4hS#t$6 u 4h4hP#t$ u 4 545L4P4t%j,VVtA1ɉ54 L4^_Vhm# Vh#h#jttu$Vh#^h9#h#^jkJfSWV t$ |$6SqT4! X4\4I`48h#P,d4VW8=|41h4So 44%4%4%4fС4 ܡ44fΡ4ȡ4h4jS  h4h4|h4ohMu j6O#9d4tC#Ph$Q 4 x |AEjj54D xPj54, h,#ju h#j 1h#VW vtHЃ rt+vhʚ#\h4ō HЉl4봡ԟ3)ǃG<13DHu0WM(=r$hhݚ#`hV#jSGhWhp4 ?t GG?up4p45l4h#j VOu Wj4Wj4Wj4Wj4Vtuhޖ#h#jh(3h #23t t4 h.9#=x4t523u,u5=x4523{523h#j)Ph"# WVG5ƿ3Ph#WR Vhϛ#WQ j{F=$4th$4htj j5SWV543t>u+t$4t P# Vƣ443h.9#V'tsd4h$V'tah#V'tShg%V'tehm&V't13Vh#WQ Wjd4$11ɺ230 ߈4Bu^_[ñ1WV,|$8V54WV蚩WV#NF=|4t L$f=43t D$#$d$d$ wfD$ f=<43t $Vj5488^_h4jj$ SVPf=33tjt$R 330utztD$=d4„u330u1f=3333몈D$< t< u>jV54z f=43t|$ 7U#t#P{`u 2 <33tu 33tt A8u1f=33t 3DAt 3DAD$jV54 f=43D$PSK/h4jj USWVt$D$ $1=(4hג jY0D$1CSjG0h4SWv Vh$Kh,4 atWD$ h4jj? t$j/Uj/=(4uD$ 1;$ȃ^_[]Ët$$4$ԥ3H ԥ3~Х3H Х3hХ3w#eȋL$ < U;t$ KD$ V1FVjM/5(4h7U#yVh,4\`SWVP33\$ x03t%\4039u Gt+t' u9tpD$jP54 Yـƀ_r`4^?t@آa4b4 `4a4h`4h$JPW1^_[Pԥ3H ԥ3~Х3H Х3$Х3%"t1Ƀ=d4!YXD$_r`4^?<t@ a4b4 `4a4`4SWVT$L$D$=d4ut1<1h41F9uRQP虖 y]08thߴ%.^_[h#USL$ \$1B1t 9tA8u[VL$`4tSA ^#8t6u(^@\VPt`4)ƃuf^?݈@`4^VD$Phi#^H=x03x03\4Ft33_r`4^?<t@ a4b4 `4a4h`4hn#G_r`4^?<t@ a4b4 `4a4F t*vPh`4hr#G\4~ v 7^ÐWV1F4VW54є VW54 ^_USWVt$jV54ߕ  uD$41؍oD<jV54趕 D$< t r֍,f=33t4t P u33D$y1D$h &PI4tD$y33D$nD$jP54^_[]1f=2323USWV1GWj*Wj* VW*Vj*4fC4CfC 1l$jjS軔 ~}D$tvjh454{ ~]4Bt8StGWuG1GW4U54  WUl$545 1f=2323D$hU54 jHƉ,<=d4  A9rWD$Pjt f=334tyf=23~g|$_r5,33Pt. 4YSQ;Y~ڃ tZG9r QR&Jl$!y-+8u!PWjl$UVGEh@Gjf=33t4t Pj3;fSWV23t323^tPtF tFFu҉5 43h#hWCBhR#WFtRVhWO t4=h4tWh#eCj W* tWVO%%33^_[USWV|$hl%W8j Wj=Wt@C@uShg%Wu S6ÉXj?WIt0tO@t8JS{?!tOYt@t tWh#:B~5=23t,23Ft = @t t~vuك=4~h7U#q4^_[]SWV΋4C!w\C4؋ 03Q03; @3h(3j =G4 (3Q(3 X4#|>Wأ4NI$)'Wh#,A4@4N Q1f~ @403H 03t;@3lh(3j!Fl4v Wh(#@ `Wh#@4@4N tEPP4V(3H (3!6h$T@4#|4h7U#So^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhg%SVuW 1@WljR1^_[SWV231t8ϻ23WP t!CtWPt Cuމ^_[USWV׉A tS^؃H$()'n tWUtjPu U WiF tQfB t th0#bm*N 1?!9~ t~ N 9tF N^_[]h?#fSWV,1f=33t h@#=|$WhY#?+t%th#?|$ D4$ $ 4hW腴 uW$ 4hW#9ō$UhP tʼn-t4=h44hPUq x4uߴ%t#P5t4h#h|4Pu5t4h#p4uG=4typ4Ħ4=Ħ4tVĦ4hh4Qp4u7J$ p4z$u+hh4Pu,p405t4h#Z:u5t4h?#E=l4hj$$ tj 4u$ th#h4Pu$ thޠ##4=$ D4h45t4hF#1p4tpp 0h_#1 h4uG4#tt##4ơ#@t#QPh#}1 4tPhӡ#f1h4uu+ l40Au*h# l4 # l4#9#hh4u Vh!##4=u#5x4Mu5t4h?#5}5x4襀u5t4h^# 4tP}u54hw#j' l4Au$ th*#=@u54+4$ th#h#h"h00USWVt[ׅtf΋*'t#*'tVPt%]uWVhd#'; j&l4^_[]hF#h;#hhS#h;#hhf#3>PPPh#h31l4t@t hh4Ѓj^&D$t@0h#:1h#h#hhf#D$t@0h#Q:1h#hܢ#hhf#D$t@0h#:1h#h#hhf#LUSWVh#91O{&,*'Qh%h30*'t*tu6h3jjh!#h3jjh)#h3jjh/#7#t,#FKrh3j ;^_[]USWV39u1Ht$Vhht@P. V$PPftхu! $h#8*'tc D$O{&*'0tBVؽ ;$ݸ7#D$VPh%h3/D$,#uh3hmS#c^_[]fL$t11f3QBuh<#h-#jTh#x WVD$ tRt$tX|$t3fPhT#,fPhw#l,f1@^_h#hI#j` h<#hI#jah# USWV @$ @F~  ߃| RQhI#%19ս|*Ձ tRQh#7 1 @^_[]û l$ WWSUP9tmv h#耨$ =Ut%tv h#:+hjU 1$ PPQÉ11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPhT$ L$D$19عPh#x5ch Pv tOPSQh#M56$!u$!$!j?PQԌ t$h(#5Q+PQhy#$ "u!$ "$ "hPQ腌 t|hU#$ QRPh#]h#h#h8Bh#h#h91h#h#h: h#h#h;h2#h#h<h# $$j@P$!Pa Pt$$"PG$$ Ѷxl$$ $8v+)t)+8uHJRQP脋 t hO#Í$  tL$(SUP l$ 1rh$ US |4ōPUSb < ߁WjP(  N1\$ PPh; tB=NýjPU  98t u8uxk8u2N1 T$ PPS 9ǃu898u<\$Shmdvl t*hs##Wv h#v h#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSP3z9u!D$=жxt9wwF̓uv h#  v h۪#J1ST$1uD1Gu<jUPSvy9tu&v h#h#01^_[]hPv h#0h#hͪ#h h#hͪ#hh#hͪ#hh#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P^ D$VUPo s DD$st$s 8D$ s <D$tf4$l$4U+'t_uh#/h%h$h3& +'ha'#h3& uh3j 2 +'D$l$4$sf@8tD4$t$xVA@S$PSVIB \$$Vt$SKK1D$0D$,D$(D$$d$sD$4j@HPM st$st$h#?#t$h #.#t$h##t$ h$# #t$th/#"L$9 +'t uQh;# +'hG#"|$4tD$4PhS#"|$ gvVD$PU; 16D$8uT$Bg)QPR蕅 th#-1@^_[]USWVӉ͋t$V߮ 1Htkt$t$VSUvtGUqt$t$VWUv9uVSW t'W   W 1H^_[]W USWV$$$|G8-t ԟ3$D$ 1FD$hM#WS it 1L+'539t9At&9IuJuiu3$tHPh$ AtPqhe#m, 늡T+=A뀃Dtou&t$ mt$dT+=$W$uQ 1t$hWV% jSV $FWPP uhnG&VhiP u h#jW8pT$L+'53l$D$G_HrY7ShjD$*PY ft$fD$CL$fA37SghjD$&P ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$Pf \$ $ sh=#sh^#s h#sh#sh#sh#rs h#bs$h #Rs(hD#BsHh]#2s,h#"s0h#s4h±#s8hܱ#sXf|$rL$I#fw d+'L$T$ t$"VRQPh#h%#h#j臜D$f=73173hjD$$P4 fD$|$<73fD$ $T$73h$uH$8+'L$f|$#t޲#P9D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPhײ#~|$ujejPP觥 jt$t$ V9 VhiW u h#D$(|$ u,$PD$D$,$|$ 1hSW% GG?t$>hSD$$P G$0hSW jl$UWz wh>#:h(3-Wh:it$V uO j.&h(3jY'Wh:iVe u Cw8)|$##PG$rkLPD$$PQ $<1|$VhK#Wt$kL4t4T+'h#1h#$48~1D=P)G9uh$G4 D$4!4"4#4$4%PSWRQt$h#4(h#444,40k<SWPRQPh#g4`hb#Sh#F4\t h#-t h#h$.F4d6|$1A t$t&u/7t$t nu Qh#FL9Mt$ $t$qVfP$t$RVefh}1#3Ph #h3 jy USWV։1hUS jWSO sUPP茡 t'Sh9iP tVeĔ^_[]hnG&h#j蚖USWV׉1hVU, jSU }VPP  tAUh:iP uGPh#耒1FSDeĐ^_[]hnG&jVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phײ#^WVh#f>r1D~Phz&GH9|j]^_WVh#~f>r91D>Ph:#c 9} j:lG9|h$2^_WV$fGjRW; WhiV t Đ^_hȴ#j诔fUSWVu }61h#j h#VW0 Hw$|+'44ԃBu|1PP5T+=l 4불444444너44sjh(3Ӣ_4S3=ԟ3=4u.1L$A AAAQj jUb =444444ޥ31O=t4$3tch{#VXt^=4ukjjVa ƅD$ PVD$(!=<\$yB  ޥ3u1PPV` Ɖx\$463=t454PL$Q` ƅ~E14VPS^ i)u5454t$_ ƿy54h$ 4ޥ31O=\$t$9ȉQ`L$54u ύD$ PSE54r*V 4Vhb#44444V`3h$@ 43V_3hK#]ˋ$B6549Ph#h3N 1@4$;Х3t=h{#Wt1(#=4uR#PWr;? \$Х3\$=4 1$ӋFHN~ HVjƒ =4u u u1G1=4up=4u< u7 =4>h#hF#h(33 43@t>$@$PhA#h(3 ڃ 43@ t_  =403H 03;@3h(3j$  =4x03H 03;@3h(3j^c:=4,03H 03;@3h(3jM ڃ(3H (3$(3H (3^03H 03!;@3h(3jI (3H (3I (3H (3M03H 03%;@3h(3j-Hڃu!(3H (3-3DPuW03H 03;@3~ƒ t(3H (3h(3Rڃ03H 03";@3h(3j^ڃuv(3H (3^?tЃ@Ӌ 03Q03; @3~ ȃ t (3Q(3Vh(3P&=F @t54h$r 4f 43@uiХ3\$t V9(Х3%ܥ3Wh$+ 41;`h(3u 4e^_[]h"j薋h$fUSWV$$0(h#jn 11E1D$D$D$D$$׉jh 83h{#$V Q~Hw@$+'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jT+=$ىY1ɉPXuG ԟ3$T:-u"j9uzuI ԟ3 u ԟ3)t u <$u|$uM1ۋD$Ã<$D$ 01tD$ /$4u9>WZ)uTWh#D$u5t뢍D$PW.ku!Wh۵#Mh#j_$1 |$ $jSVJ u hb&PXT1u8V1CHHf wy$$,'|$uhUTÅu뼋ss 8 PVhW# |$u.jSUI` ss  PVhW#Z 1F $tCPpQ&|$t KP;AmPsT$Z|$Osh$讄1F7h*b&jGBPPh#h3 jfUSWV$$6e%1h#U -4- 4-$4-(41ChZ#VW苏 e'H wu$X,'(4- 4-$4Ńo'fil<4뙃prvD4oa 4044%$4- 4-(47 4-$4-(4,4 44484048444@4u ԟ3)ǃ=@44u-tX1Ƀ=(4=$4tL$H=(4=$4= 4= 4tʉT$4裗H4jL4P t$lVUhH83轓 9rUh#\hH83$H83 @83QT$/u>t$|9A@83A @83I83vy/thg#h#j t$ D83Dh j= 4u$PhH83f$PhH83fu@N8uT\=@4u=4t@$4 (4t3D$ P6%f1#$=@txUhH83D$ P6rfu6h$j\#D$=@u4 @41ۉ  t1ۀ|$/uhH83h#.t9Ur|/u (IHr IH9/touɉt$P#P4USWVT$juQE PND$1t$CHfw?$,'ss 腹 PVt$ hW#  Psh# >|$(5D83C,H83)=|5TShH83h%#  t$VM1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$h8c#QT$CS(L$)ʀ</t ~/t/FD$щT$H83)rPhH83hG#t$PV~ L$@83@83=I83vx/u H@83= 4tD$PhH83cD$PhH83GcT$KP3Qt$31 u@T$(3Qt$$3q u.shH83hh##  CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH83h#  1Gt$#KPqt$1BD$ $,'=4L$ QP T$ 4 @4sHtbffM T4QT4T$ T4t$/D$ !=@8fush·# jSt$ VW 1G)=4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=04t$tjQ\T4H T4/uD$PV)R#X$hSW~ W{t?$ VPh%hW/D$PWQѹ#t VQlD$PW.RÅp5WV]/PVt@\$L$/PWִt@L$ Q\$S u)D$ )=|\$=`5u=d5h(3蓧Wh#h3  ԥ3H ԥ3~Х3H Х3hХ3É؃t9 t4ԥ3H ԥ3~Х3H Х3hХ3nƒ߃Y=X5u#D$=@uW莂W6u8=p5u WV>\5 PWQVQN?tW#1ۀ=t5$u5VPWh#nh3jj h#9D$t$QVPҧ Ƅ fDŽ$.$$PQVO\$4$9|$ t#t$WP$ D$Ƅ fDŽ$.$PQN$3$$3$ $3$$3$  WVhݹ# fD$L$TTPQOËD$L$TTPQ6USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPn^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP<^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP@^_[]USWV |$876h#jל j=t7D$Phht@je uD$tL<3555/{u 5t$41۽h#WV q HσG$,'51515555155555낃wȻ5̻5^Ի5Oܻ5@51x5"55@155555555 5=5t 55Ȼ5̻51V5GĻ5Ȼ51C+515555551551@л5515555ػ5551M55rx5c55J15554515555ԟ3D$=5u=5u =5thzd#.~tPQ-L<3=5u 55 5L$$ ȉD$5 55 x5L$D$ ы5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uhĻ5jKĻ5 Ļ5=5x5tL$t*t,uw] kL$t;t=u^ R K =5u==5 t/ (| !z =5u=5 tF 5)θ =5u/ =5u!3 =5u=5 tN 5t1AT<3U4|5 ^_[]OPh#h3 jUSWV΋\$=5 t1PSR% ~jP;1ɉ=5tW- L݉t$=5D$W.ÉL$ CHHf$.'ks 贙 PUhW#  |5{Dt{T.u =5tw=Ի5uL=5u%shE#W1TSh#L|$|shF#+5VW:ʼnى=5ut jSW6: W-Å0Wc, 08u ^_[]jh*b&jwbWVD$ qH1ftYT$zHftIf t$f tf9t=5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$d5D$ 5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$PN PSl$$hW#t$X 1@F F|5Z|$dt~T.u-=5t"fu=5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=5t-T$$L$(=л5t-shj&j $W$D$\l$t$0Kjs>Džt=л5tshj&j $UjsvŅtщ|$WC‹L$@D$9ʉT$@l$ U"ʼnD$<9L$<=ػ5t/h{#sl D$TPT$ 9щL$ 1|$Pj  à t$P Ct$ P=ػ5t +Cl$TUPU(z ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=Ȼ5tD$|t$ |$ nĻ5ʃQPRWs$RPh"jVVyD$|=̻5t$ |$ tHVUUUȉD$|$D$<$$SWhd$VU^U$t$hj&VU;U$=Ȼ5tDŽ$Mt$4t$ 03J 03;@3~у t (3Q(3Guh(3Q=5tXD>03J 03;@3~!у t (3Q(3Gu7h(3QL$D$ ρÃ5T$95}`;L$}XD>03J 03;@3~!у t (3Q(3Guh(3Q03H 03;@3h(3j (3H (3 1D>03J 03;@3~!у t (3Q(3Guh(3Qi03H 03;@3h(3j >(3H (3 e^_[]SWV΃=ܻ5t vrh%c1TVO^_[SWV΃=ܻ5t vh%1TV^_[Ã=ܻ5tATPqh% ÃTQh$Í` f w5$0.'03H 03;@3h(3j@I/03H 03;@3h(3j*03H 03;@3h(3j=k03H 03;@3h(3j%D03H 03w;@3oh(3j|!03H 03g;@3_h(3j/S1@á(3H (3@(3H (3=֡(3H (3%á(3H (3|밡(3H (3/1á(3H (3*USWVl$(}=5tE G=5t=Ȼ5t(DG51 5Í4^69L<3} ^_[]{E ;\<3~*P55#f tM \<3554FMt%$Q  Qt $ B$Iu$ L<3șƉșD$$t$D$ D$|$1ۋt$=Ȼ5t( 5 U tt$ ;4$}Z;D$}El$)š03H 03;@3h(3j ?(3H (3 MuC;\$r03H 03~(3H (3 h(3j D$@D$;D$ ^_[]j3JLUSWVt$~=5tF G=5t=Ȼ5t(G51 5Í,C L<3-9} ^_[][Gșljș|$$.1E  E;|$|603H 03~(3H (3 h(3j 1V =Ȼ5t(41;$}D$)á03H 03;@3h(3j (3H (3 KuGm=03H 03~(3H (3 h(3j *^_[]USWV|$=5t_ C1ۃ=5t=Ȼ5t(C=571F  F03H 03;@3h(3j,(3H (3, +N,03P03; L<3} 0;@3(h(3j D;~&(3H (3 "(3H (3 h(3j 1W =Ȼ5t(4_ŋv03H 03~(3H (3 h(3j ^_[]fSWV|$5W5t pSPRV t81PWV Vh$Vf ^_[hѻ#Wh#jJUSWV$U誠4(F$$1 |$1 9$)덄$PSUD$Px tXǃt-tat$z ?tL$T$d$.?T$O$E1 $ ;<3r9vL$?T$$$^_[]SWV ΉRQS/x 1t4u t|uHth(3PjS{t V{ lj ^_[fUSWV$$31h#W{ WZ%$ D$D$ hx%SV4P mu05T+=tChPm$Wd 뼃pu D$ 뭃u ԟ3,uk5T+=h#jH#D$=@u.$VtPS 9r*th #jjĺ 5USWV։π=5ujVyZt~VWt9菪8uR\$@SV&t{SW&9Wh$1ۀ=5VWh" VWh## @ w=5u=jWYuWh-#H#D$H=@VSW=5/jVYD$@PV$jWpYuD$1Pt$L; D$2x #t%D$1Pt$\41Pt$`蓗VPSt$D$BPh7#h3#D$H=u}1PPW t$HhV \$D$$5(5VCVhS#>1C؍e^_[]ÉVhr#h3 ԥ3H ԥ3~Х3H Х3hХ3qÃtH tC ԥ3I ԥ3~Х3PХ3hХ32 ԥ3 tuÃ߉1ۃYM@Vh$='$$5S"M (5t$|$SPt$  Å11S5(5t$  9x߉= 5t{\$(t$,l$( &$$L$$D$ l$ |$T$ fT$l$\$l$T$ 5RQPVSt$(t$(h#h3M$5$55(5t$ C Å6|$W\$S/=t$uVh#x<S?D$hL$l$JD$pBD$tB D$xBD$|BRWtVhn##<t$\t$\W "8tVh|#;#D$HD$Ht$\$ \$D$t$Ph$;VtVhc#;t$cSZ1Vz;5$5t$8t$ЋD$HPWtVh#B;$WtF8-t$Vh#; W tV|$W/t Whc#H1ۀ=5DVt$SWVP׉UjWP t$t-h#h׼#h#h˼#s:1@^_[%tPh#h# TjWP t$th#h#%tPh#1돸#=5uƼ##jWVh(&Ph"SSh$9j臢#jVh(&h'#h"W躻WUSWV8`<3t PM `<31054585<5@55@3it$L$\.'hjV  `<3-Vhr#0jG`<3hhV  `<3<5hjVx  `<3賢Vh#0jͳD5u<31`<3D5d<31t~H5ttja`<3D5l<31@5`<3D5l<31@D+Vh#0jE`<3tH5tj`<3 h6tQ`<3hL5P ~xCT5%= ts=`=@5D5hٽ#j許 q5D5hǽ#0j膲5`<3 `<3<51HPhm8@5`<3p 1ɅA @5-555<5ˋ @3ug6g6<3v$p.'=g6=g6>1jSS5`<3!ƒu耠8f@5-555 a1H @3@3=5Gt =}r t~=g6g6q˃u#=g6tPWUV ~jWUV tw߿(=g6u g6~~=<3|<318^_[]111RSWV։ωS;O9<3D$t,t\$W3N4$t$ctjt$]Nq#1@jt$ENP#1PW4N4$It$=jSVVP6x^_[h2# hA#hT#j7VP=`<3x=h6 i6t}=@5ut= i6tDh6HQP~'Q &514585$Pj ]5@i6h #5h64 5h6o=<5uKhL55`<3 zu4#T5=u"5 5u5D5<5=@3w=h6t<3~ jP<5`<3<3~jQPg h6 i6t4=@5u+5h6h5#.& i65h6n`<3=45u 85tP14585h6t<3 h6 i6t'= i6tGh6HQP~Q 5Pj к i6h6tZ5@i6h:#uC5h6 g6g6 u g6g6jhQPRPh?#VS1V5h6m55^USWV=@3(3t3D$W1O+ؼ5 ܼ5 u1@1ɉ$L$=h6@3\$5g65g6hc#hS蝲<$t$W5g65g6$h~#RPWhn#hV_$VSh#hWC}WPW}tf=5t]t$5`55\5hc#hV$Vh5h#hWױW莊PWj @3u_55<$t$WjV7$h$RPWhn#hS}$S]Vh(#hP^h6D$=<3O5D$ c#D$5g65g6VSP$5g65g6VSPg6 g6 g6g64$t$VPQj$h~#RPVhn#hS谰$S]$QL$Qt$Wt$$h9#hP|$t$V(PVj, "$PW5@i6hW#t$8e^_[]V~=@5u(=|<3~h~V5`<3 |<3~^Vȼ51=@5uE1jVV5`<3zxRP5`<3 yIhL#0jd 1N^Ã=@5uhl#jI&1=05u5@i65g6h#j!1HUSWV1|$\$l$WSUC ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|<3=@5t$t$5`<3 ƃu*~345;5g6tc5g6tU05L~ 45?5|<3x5<3h#j, 15<3hܾ#0j^_USWVP5|<3|$l$1ۡ`<3$WUt$ ƅ~)tދD$9uȼ545!|<3@5Hs-M8 uc1h#Vh5|<3:~\%tS1jPP5`<3wxx})RP5`<3螃 yPb8tD֕8t:̕8t0Ty:輕8t 貕8u |<31蜕8Eu |<3xt ȼ5145=ȼ5uhH#j腥`tx>h6Ht)t hֿ#5<3h#jL 1%h#j 5<3h}#0j^_[]USWV1N=̼5=|<3 @3uh#j٤45<u85-@5sg4551jWW5`<3vxXͽuWURP襱)jWU5`<3vyQu t#45@45=|<3:h7#Ff@Phm5`<3*v x|<3hg#j1^_[]USWV \$$|$ l$(1uu5|<3@51jVV5`<3ux\D$ljT$Ӄ=@5D$559L$ujRP5`<3uux+D$T$EU,=@5u#h#0j |<31N ^_[]USWV~=|<3$(~$$~@5t)h#j蔢I1u)1ɍ|$h~W5`<3 0|$fGWhm5`<3^t fD$D$Whm5`<33t \$h~S5`<33 $h~S5`<3 GfD$D$Whm5`<3s |<3t1<$uzfD$D$Whm5`<3s f $ g611F$$~jQUR -ы$ʉD$ ʋ$$~) hm#b1F|?1jPP5`<3"sxg)y11=<3|!h'#11Fs1o{h#RjRP5`<3r1yKWhL#.Khj#"?h#3h# 'h#0jB 1N5|<3~^_[]fD$D$ D$Shm5`<3.r yҏt$h#t$h#0j٠SWV VhDi6j# y臏h#0j袠 jVj y[h#0jv 1N=̼5ȼ5=Լ5=i6u5@i6h#趟=D5hl<3WӀhd<3W轀o @5aX*#tu# <3P#t#QWPA S8 @3#tmS#P5@i6h#h #h3#h[#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5D55D5h#sWh#T5@i6h#Ah #4h3#'h[#<=i6th#j{5<3h #5@i6h(#ҝhO#ŝ|$h Wf|$.|$t+D$5..L$f tW|= r@h# h_#h{#Y5@i6h(#FhO#9sWy\Wh#̼5|<35@i6h~# i6 ^_[h#Мм5t PA W/м5t D51̼5|<3h#j|5@3mtt$11Hfhh5th5{51lh#0j臜 1Ht$=h#0jX 1HVt$V:uVh#0j*^\SWV|$$W.ƃu[ϊ1~tHNtt 9 tu/覊PWt#D$=@t ~1N|^_[USWV1Fh6PH{h6P kj= Ɖ+㡔5Hw> h6SPh5Q@ 5$ 5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PuyPh55PA, h(3WVh5M<43@ub55 5 5QP.t h6P(jhDi6jh xsZ1e^_[]躈h#0jՙ USWV (=3x&,=3kL<39|׋yM1II151PQÅy19}WDu=@3h-#j.hh5OÅy1ۉ9|(=3x(,=3kLSh5<3y݅u=@3teh-#j迗51E$sVh55P`* )؍51EhR#ji1IkFL<3h6Sh5#1ɉ^_[]USWV D$h6xGD$5$1F15SQ291Ch6h5h5P$ h6Qu*D$PUh5Q8 5tu=@3h#j耖t$h5h5=) $W1CttUtB:x9u=@3tFh#j,Wh5Q19uhj#j1H ^_[]h#th5Q<t 51h#USWV1Ch6PHh6P yjPƉ׃=$h6t/5@3uth#0j4 e=h6t Rrx7t$t4h6P(jhDi6j\ lzbV1ۉ؍e^_[]Ít$\$D$5Hw5 h6VPh5Q@ 5D$ 5L$ h5kWeh5duy=h6tSh5t^h6 i6tSh5h5Ujh5Xt@h5Em55 5 5QP=5/u+?<u"5PsPh55PS& i6 i6tSh5 h6tph6|NPWt$h5)6Q=h6i6D$L;85D$P<5Ph58 i65t@t=4i6u Pl=@3t15Hr@tZ tUh5l'9D$X;D5D$\H5?uD$Ph5$Ã|$=4i6ut$h5Åh6VSh5P@ =4i6uSh5/!؃=h6\$C= i66D$h6HQPQ i6=i6D$L;85D$P<555 5 5QPDy h5j=h6\$^= i6Qh6HQPQ D$L;85D$P<5D$X;D5D$\H5OPj  i6D$u5D$ 5L$ QPp5x5@35h6Q55 5 5QPh5ji\$=D$L;85D$P<5Pj  i6USWVj/h5^1Uh5ut>55h5Ukp /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=h601F h6t9t71h#jێmQHbh6P R=h6t i<h6x t `m#h6 i6t#5@i6h #5h6虙  i6ujh5^t(55 5 5QPu1=h6th5hxuth5lyh6P(ljgSW, xah6 i6t&= i6t5h6h5#2 i61G*ƃuejhDi6j ^_[USWV $h6xu d?*1Fh6P,h6@0D$ jD$T$=h6jSh59]jh5Q$=h6th5~gh5+th52d5 w's1PP55 $jh5Pƀ=5/u+4u"5PkPh55P =0i6t4$h5Z' h6t:h6|Pt$t$h5s.Ph50 i65h5T$t8=h6= i6h6HQP~dQ ch6L$Qt$5SPD ƉPS?&=h6tc= i6tZh6HQP~3Q 2Pj  i6Ph5%dPj ˘ i6D$L$ʃ|QP  55ʃ|QPxnh5*1C@TPh5Z%y55h#0jh58ch5)t h6P4 jhDi6j =h6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=h6t cxIxh6PHx11@USWV $$h 58i6Sa  = u$ /,4ŏ4/t EƄ4/FED$P58i6#D$=@`1Gxv%xmlxd=h6t exRh5!(ttjhDi6j Gm'158i6h:#j 1GĐ ^_[]w58i6hX#0j҈58i6h#뻸 )D$ )D$$h5 Xh6 i6tV1=5/5t$PU ;D$vh5h#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơi6 i6tD$Ph5I=h6t5h6h5+ i65=h6tEh5C=h6i6D$D;85D$H<5h5{5Ht 1PP55\ $jh5#Pt$h5 Wh5D$P;D5D$TH57wD$ Ph5;i6tk=i6tbD$D;85D$H<5Nh5h5^^D$D;85D$H<5D$P;D5D$TH5t55h#0j蕅P5WWWh5!Ph5=h6e= i6Xh6HQP~ Q Pj _ i6 D$D;85D$H<5Ufg65g6u h6@g6=~| h~Ph}#thPh#j蜃1Hãg6<35D5y x1g6g6 g6g6ʉg6 g6g65=@3u=g6t4=~| h~Ph#thPh #j1H5D5 y xᡠg6g6g6g61g6g6g65~<3g6USWV=h6th;#j艂1I^_[]Ã=g6g6<3ug61IxՋ=g6+=g6|$\$5<3UVSWb)9|11UV$)݃g6|Jg6 <3g6~H5g6Pg6g6;g6r֋ g6 <3g6g61)ȉQPx[g6Ɖ5g6 <3ȣg6)=g6g6 g61g6g6@31hl#jWV1N=<3=@3uh#jy1g6g65<35g6Z1<3~9} G{u'Ph#j~ xI1=g6=g65<35g6~ g6 g6g6g6 g61^_ËD$L$g6)ʉg6QPR9C USWVu ]1D$ D$ D$g6 g6)ȉ9؉| g6)։ g6QPVSČ)ЍT$RPQ 1ID$L$ )g6 g6|~ g6g6)ЅqxUtX g6g6D$9ؿ|‰g6)ظ|D$L$ 1H1@D$D$e^_[]V1=g65<35g6~# g6 g6g6 g6g6V1xC=h6t/x&5g65g65<35g6~g61 h61H^Vg6;g6v*5g6)QjP j 5g65<3^USWVt$g6 g6ƒ|]; g6g6}O1h.#W}=g6=g6$-g6<3 ( g69)1 -g61ۡ<31PUK;<3tS1g6g6Sg6 <3g69)QP륉g6 g6Nj-g6S5g6U? +g6<3)USg6g6g6 )VQS? g6h6Htth61O1^_[]É-g6USWVP\$1~cl$g6$5g6<$)"5<33x3ǡg6$5g69|WUV ? 5g6)11H^_[]USWVPD$~Z\$ g6 $5g6ŋ<$)Dž~9g6$5g69|WVS> 5g6)D$^_[]ËD$)USWV\$ l$؃|~g6D$=g6t$)#5<34x\ơg6D$=g619|VQWD$ f =g6)Éظ|$1H$$^_[]USWV$  $x$|$D$|= i6t7P$Fy# j$ hǽ#0j.{$|r g61Ng6)ȅ5<3  g69غ|PQ$ ~|)à g6 g6ظ| uXP$E$3D$8$3L$4 $ h+#jUy hx$ h #j5y Lh$ h#0j z'h$ hǽ#0jy111o^_[]USWV$$x$|$$D$x-D$PQDt"Vh4$hW#0jny L$|L$1$p0L$1g6 g6)ȅ\$^ g69|4$ST$ RT$RPQ$P~R|$ =0i6 g6tP;CJ g6)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=0i6t% u!$9$t4$h#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$= i6$4t1PWBy#/u/1N=g6MWh`#js g6.|$tjh W. V $=g6g6_Sh#VPz$lƅE<$8$S x<Sh#P$Mz$ywb0=$i6t5h6}4$h#Vjs15g6$r $bQh#0js1N^_[É^USWV|$?/tGj/P-ƳUWu/Fj/Vh-ƅuhW=,i6t$$W jWy3UW=u%D$ PW)jUPWV/Fj/V,1ۅA4t*PWat1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~`Wh#0j r$tDPy`$h #0jq$ 1$g6^_USWVD$Et$$^߅tPyV`Wh#0jpq=,i6t<$8$W 1 (i6tt)$($u7=g6uj g6P g6g6!UW@3 @3t%1PPL$H$X$T$W$tJSWy!o_SWh#0jpWv$) 1$g6^_[]WVn1uA|$ t$t$W t(5h60^Wh#0jp1N^_Vt$#D$ PVt%5h6y0^Vh#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=@3t =@3D$PVt1^VhE#0jKo_=@3u&D$DL$HL$$Mbl$L‰T$=@3u'D$PL$TL$D$ Mbl$X‰T$WV t6]8Nu} u&WVG u]Vha#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh3#jm 1HjW |^_[USWV׉L$]D$PS3t6St$"th\0wwS tՃ} tL1@_1=h6uTG3D$ 3L$ uKG3D$O 3L$ u9t$hd#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%h%SMtSG 0S} D[Sh#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=h6t1A$$3L$ $3$ u*0$3L$,$3T$ uVhb#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $.'5@i6h#JLuu=i6tlD$PUuZD$ !=uHhWUz ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU}Ut$. 4$UYL$ t uu$UFD$y)Q8=$i6us<$8$U xZL$ A$Yt$Uh#0j3j1H=,i6t2<$8$U Uh#Wji1ɡ(i6tt1Ƀ$ !($t($t$$5@i6h:#GJjU$xN1=(i6=@3=@3Uh#Uh#j7h 1OD$PUx=1$ ?#D$ PU1@=(i6u;L$ ($/Wt$h#0jh$ PU1@Pt$6UK@31 @3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=h6t މ|^_[]ø#D$=@u5h%WH1EtXW/yĉ*#$t W运y5h6M( #VWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5i6i6 i6i6L$T$tI AQP DUVP 9t_L$ xZjPUQ7ҋT$0y@oEP Džt<$\$MQVP D$8+$T$0)+|$$>h#jJe*Ut$8h#Ut$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS47xjhg6S y%##\$TSV0je^_[Vt$ xFP=h6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(Z ~H111Ã1T |A9uV$P$(% ǀ$1111틴$(3x$3|$ uUP$(/xLX$3D$8T$3L$4 uF1VVV$(5xE$($\h#Shǽ#.h)#j%c #R$(hJ#0jc1N|(^_[]V=i6tg6=i6tg6=i6t@g6=g6uh g6t01x&=h6tDyh#jhb1N^WV h6tPp1 h6h61Ng6t h6tqAh6uj1ԥ3H ԥ3~Х3H Х3hХ3BtN;4=3u1tB g69G= |+h6xxg6 PW1t-g68j5g6hg6T h6&1^_SWV|$tR?tMj t tSƋ\$W#AH~ </u>ۉ^F=g6t%g6p!h#j`1Hh#5g65g61^_[áh6t@=h6th6= i6u0=h6t'D$$uh6tjP5 h6M WV=h6tB5g6t;11G~u)uh#jA`6h$h3`k vu^_USWV =h6u%h61N h6u h6}$ $ $L$Ph6t#HHf w=$.'ph##"phK#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p N h6qh#0 phi#p j_e=h6t\@PL$QL$ Qpp p09Bx8h6jjt$t$t$t$ph#p j[_ h61N1 $.'LJ$Ƅ  LJ$LJ$=h6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G h6 VqP  h6VqP 5@i6h:#>1uh6@e^_[]fUSWVT\$tl$h=h6P($fT$L$X$1V8$]9V<$:##t4$tVjQjRD$Ph#Sg $u2@$%  RPh#Uh$^|$x$h#SLgEPD$Ph%S5g$Hs Uh#u# Uh"Sf SVX^_[]Sj FrUSWV@L$E\$CD$PSJ{3jS9I#|?#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($WVSh#t[d^_[SWVt$F=u1H|$P&t6t)G\$QjPS躜VSGu܃^_[Ã^_[USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]Vh6~1F1uh6h#j9W^ÐSWVL$D$t$|$T+=h6th6tt\^_[g}\1KZh6teSPti:tdx:ԟ39}j T+=@ԟ3sPVW hVh6:-u/h6Èh6nh6h6`S6hU#ԟ3=S6hl#h3ha?^_[f1Ã=h6u1áh60h#jV h6t"H h6p0h@#h3 a5@i6h#x7u_sUSWVd|$|j/7$@i6t@l$x@i6h#P^U@i6#1Ch6i6D$ D$1D$$jh=3h#WUHЃJw$P/';t$$@$.'T+=H5묡@3t @3h6@3r@3t c@3P=@3L#\$h6! T+=kg6 g6H5#H5L%<3i65T+=R@3t @3@3\$i6tD5@3eh6h6LD5@3=i6.h6 Pt$a * NL$ T+= h6$LFD5@3D5@3D5@3D5@3h6T+= h6H5K$i6q5T+=[Z @3@K @38T+=8-u xD5D$ =h6u ,i6(i6@3@3H5#h6@3$h65T+=WO h6i6sTi6d@3U,i6h6?D51@D$ )@3 L$ ƒ ʺ3t(3 ԟ3h6ƒu 9u , l$D$kL<3h6 h6 @i6"1$jh8=3hJ#WU+/~HЃJS$0'4=3ƍHw$|0'Ti6뫅!T+=H5@3i6|H5K$mh6@Xh6ˀCh61H5#"h6 T+=@Ƀl~mtKotRpd(i6SatDeJ1A ,i6 (i6 @3 @3 @3"@3,i6 @3@{peT+=D5SHh63 T+= g6g61ɉ5T+="]h6i6T+=L$h1 jLjh<3Q%Oh6bl 5T+=Vh.9#/V袞<34i6 i6@5T+= i@i6Լ5h6H5L%i65T+=9i T+=E g6Ni64i6 $! T+= }h6i65T+= =h6@h6 <3%=@3h6(3 0akG1A11|$<$t4i6D$tGNutNj]]h#S_-1t[h#SK-uE h6h6j5 h6S^ 1AL$y#$]1 h6<$D$h{#S,l$\$thR#SVDžu Х31 ðt5h#S,u3h6So I 1urL$tP؅uAJjh#Sz+ uPh6D$t t P CPىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h{#S+t W|)=h6<$l$S|$; h6,@31ɺ G1Fmفt#u41A 0@3<1A 0@3!5@31ɺ.1!# $ 4u h6<3=rnFr0s9-ԟ3D8i6PMԟ39}j4NxPԟ3@ԟ3<3ԟ39 1VV4b xԟ3@ԟ39| Qh#j?H 1FPh:#V(H VG5T+=h}#h#jHjG5T+=h#hh#5T+=h#jG 3Vh#%5<3WVR 5<3WVR VhC%5T+=h}#0h#jjG!jGmh\#jCGt$h]#jjP$t,(XN8@tUjP$yFD$8Uh#W}(1D$h.D$1$h{#UJ(thR#U(RDžu JХ3tkðtAh#S(tjh#S3' tj1ujSðuh{#U't W%=h6Uh#l$}$l$h#Wa']tjWB\$rt D$W<3|$ td^_[]áD5t8uhY"D5t8uD5^"Uh#j E USWV|$%UWyUV)NJ00ht$跩tAtZ/UVxUW488ht$vua4t$h#0jxE1H1^_[]áh6t H h6h3h+#NjDWV31FWVhh#YWVhh#EWVhhj#1WVhhd#VCUSWVPˉjPQB փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QY$1>tj,VÅtj=Vtmj tdAE0H@h6=h6t h6sh6uh#j6B1O^_[]h#h#h#j B4$ ɋD$L$01#WV5@i6h#h3M t(ο#Ph$h3L !uء3H 3~3H 3 h3j O^_SWVPωPQkt4Ƌ$| tC$Sm t'ǍCPVW[ DG h6 h61^_[USWV$t%t_݊M\tS8uEEh#j@Ej UEƃjSV t3l$hUVPpWUh#j\@S $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=h6tZh6HVV 4$- Wh#ji? 1H^_[]V V h# h6 h61V 4$ WhC#USWV\$tK;tFj# tLNjl$1pSG woD$G95h6t%h6x!hh#j>1Nh}#=h6=h6^_[]WV5h6t;11GFu)uh#j^>6h$h3}I vu^_USWVh61 l$$=h6Kt(=h6t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=h6tGtlD$@1G8D$@1D$\1GEt$ hy#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVh#h3 @Vh#h3? $t+Et$h PV  1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh_#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7WZh63WVVjuD$L$ L$$VjVjuD$L$ L$$VjoVjduD$L$ L$$VjFVj;uD$L$ L$$VjhH#0! WVj*! y|$ujWj! WVj  y|$ujWj  WVj  y|$ujWj  TWVj  y|$ujWj  (D$,WVj r   WVj^  0=@3t3i=)‹1@?9 tR=\i6t3<$/>3i=)‹1@9 tR `i61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=Xi6ujh= Xi6#t\u#uGW tjxGj jWc; U />3i=)Ë Xi6,t 98t#@u $j t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=\i6ujh= \i6#t\u#uGW覺 tjxGj jWf: ߺ />3i=)Ë \i6,t 98t#@u $j t!8h $1(WhZ#j<, h#h'#j$,^_[]USWVt$totij/V`1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjS CS>tKt^?tYڃCKt6C;C C})VWhd#j*SD h#C=`i6t$di6X Vh#jW* 4Vh,#`i6di61WhH#j** S h#}VQh #j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$YÅt>V ,FN4A1R113WV 1J 4$$1'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=hi6u*jh 7 hi6uh#j1(1N^USWV hi61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj讼 Ël$EP $$$KCs{ D$C $C1^_[]Ët$ h 3P}  1$$CHC1FwCE3 S{ Sp h#j&1NwUSWVhi6t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j趵 tx@ LHDh#jY 1^_[]USWVti6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj褴 J1ɉHT$, $$$P HN HF F t$1 H;@u ti6-|i6xi6xi6-|i6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@xi6=|i6l$T$s}ډD$0! umщjt[|i6=xi6 tIj葳 t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=i6u*jh=蘼 i6uh9#j1N^WVi6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$\tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W- ho#jj ^_[]USWV i61Kt$/>3i=)‹/uPVDžj$衰 tWWtN$$QVQ4y8~V Q(y,~VIlNF i6F5i63Wh#!Wh#j V Vh#j ^_WV5i6t~1Fi6=(i6u~ t v6蚫@3 @3tWWvvvv 6踫=@3t v6ά6 V 5i6u^_jhÀ=i6u1WVL$T$t$ i611H<>u5Guu%P=i6ti611@^_V|$ |et$>t\jh#P t A3=A3t#h #j|j A31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1NjhA#Sou3hV#WZu!@3u9i6Džu91FWShK#VohV#hA#hy#V WSh#jL1N^_[USWV\$hSb1N|$1h$UW  O$LJ4$<rD Shi6hi6   Phi6hi6  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQO 7脻 1D$ereRPQ  ^_[USWV $ $Hw.$1' e| RhW#{=i6x1ۃd|Rhu#Q1l$ hVU= $ jdPU$,耬 $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h:#$F1 $F2 jdPVҫ fF0 $j j0PX 4h6 8h6t\h6T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0Ue $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh#WQ t1H^_jh#W7 u(=i6ui6ui6h#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQ  Ǎ A/G<rH )Uhi6hi6o   Phi6hi6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP yEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$ 2'<2ǃ$)$QgtxuJ& $$1$$t$D$]hWPg )D/,$7ti 1ۍD$hSP $$$D$jdWP $I H2375$82'1Wh-#4$MS@$$1$SA19r.$ 0I9ݻÍ$Mr19rD$)Qj0R $  $ % 1$U$[A9r'$ 0I9޻Ér119rD$)Qj0Uy $ hM#L0$p x$|$ف$dž$$A19r.$ 0I9ݻÍ$r19rD$)Qj0R I6$$f@ 0j j0P DK$A jdPQڟ i61$$A9r'$ 0I9޻Ér119rD$)Qj0U $ hU#$B Li6فME1$A9r+$ 0IՉ9޻É׉r119rD$)Qj0Ry $ th^#jF UfDŽ$ rDŽ$usta=i6t fDŽ$  fDŽ$ 00($1l$hL$nA9r'$ 0I9޻Ér119rD$)Qj0U $  thK$8$1l$pL$vA$9r'$ 0I9޻Ér119rD$)Qj0UH $  th/%<$1l$xL$~A9r'$ 0I9޻Ér119rD$)Qj0U t$ h|#4h6 8h6$ t\h6T$HIrm$1$A9r'$ 0I9޻Ér119rD$)yQj0U$ $ t*h#h#j1G^_[]1GWt$oW<$ƍ$ ##tٻ SQPU $-tSUP= 1L@=uL@=u1퍔$$A9r.$ 0I9޻ÉՍ$r119rD$)mQj0R t&$ h#h#jhD$Pf1O$ jj ?i6tT5i6P( i61҉i6i6j%)jPA$  %USWV$׉Ήh$jS $l$h hh2'UD E t u4 i6 Fi6@i6Sĸ$^_[]Wh#j賋WVt$ Vg=rVh#j[ ^_USWV̀| uJt?5311\=.*t?u.L^u\L@\@G9u1D}/tP\$$ShF#h W W1NxtShQ#h WWxS|$$Wh_#h VV~x$Whg#h VV]1N^_[]USWVPt$>-u~t6hR#V Džu'0 PVh#jHХ31FUWD+t5Ë$rt$Vh#j$_Ft1N1Х3t W8^_[]fVjh!#WxKh5b$Pi6t)hR#Vi61u;5i6VX=h6th!#hr#j 1H1^WVPD$$|$t h6t$i6 h6t"= i6th3j R i635@i6h#W  4$VW Wj  ^_Pi6t$L$T$ $RQP 5i6XSWV|$1N|5i6t,\$OPWS t;j SI1t^_[SWVPD$ $|$t h6|$t$i6 h6t"= i6th(3j Q i635@i6h#S  4$WS  ~V PhB$h3  h3j  ^_[fUSWV} u7$h#j蝺 \$1h$WV6 LtPt߃95ԟ3D$h#?ƀ8/h#Vush#Vua$PVwhtKD$Ph%`ht4$3D$ $3L$ u$3D$$3L$ t1PP{ƅu j02V4h(3覾43@ujh"jWRPh#h3 jUSWV$$6y#h#j 11Ch#VU贍 e~%q~3كrtރvt_xi6ŃV.PtrكRtwftAii6i6뒃Wt6duqi6zi6li6i6Wi6Ii6;uԟ39|=i6u 1Ĉ^_[] D$h j$D$,$Sp I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h3#C\$i6EHu]j$8u i6Pji6a$8tӋD$t$ VWf i6tRtD$WS=i6u=8ts38?ti)8t_Wh$Htjӹ PWhW#, +D$@uDi6u;Wh # i6;;=i6uW1ڀ=i6utV/tD$%=@t/==i6u uWc#W訖 i6 i6х ˉ4=i6u Ő=i6t@jPt$C u h#7P]Mu8VLNjGHHf wO$x2'=i6WOwP"{jWVcY GG \=i6uWOwP:GHftIfgft9G =i6u P趷 PW}G  Gw@i68=i6uG ?tow 7 PUhW#  c=i6uO1zuSw\!t)i6t '8t18?t'8ut/wh$|i6V{KDž6=i6u =i6ti6w.wPh*b&j'ww T PVhW#jPhS#h3 jLi6USWV΀=i6uLVh#h3 h3ԥ3H ԥ3Х3H Х301C=i6l$$#E=jR蘕8D$PuR\=i6uvVh# 1ZhХ3Ɖt9 t4ԥ3H ԥ3~Х3H Х3hХ3Zƒ1ۃYÉ؃^_[]ÍD$x #t%1Pu1Pu1VPWSD$Ph#h36USWVAӉ΅:#K1jhV@L $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =x"D$WNL1PPPWx D$$h PQ% KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWI D$L$D$)T$T$ 9D$t;$SV^i6Vh$.y)Di6Vh$ yWK1@e^_[]IW:Ku1PPPWh uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWH D$L$D$)T$T$ 9D$t1ZHWJ1PPPW h j$Po KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWH D$L$D$)T$ T$9D$tGWIj1PPPW  Th j$P CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWH ;D$t$$P$!P\ L$)L$L$L$ |$D$ hFWH|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PWxF 9D$)؋L$D$ظL$|FWH1USWV\$l$UEtMƊAuA)k')j6jɺUGG SGi6tVG t|$u G?j6w0 w% W  j6u=j6t^_WVt$ j61GjB'uGPoj6WVP) j68^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5j6^_ÊVF|uܹո ѹ Ǹ É)B$:@BjB'uVPQh# fUSWV|$,t$(S蜴=j6jLVht:xIuxNt@jLPj VG1tE@j P4)=j65j65j6&1,=j6uƉSS^_[]ù5#V=j6)u ^5j6Qh#*WV#|$ |$wLA3 PA3 r6>t'F r6Qr6jN@>vuڋ7 r6Qr6t> @뭅,+LA3@PI5Xw6VrƉRPh$% 1 ^_USWV8׉ˋ j6j6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jV'jVt$ ( USWV Ջ\$$St$$tƉ׃=j6%up1҉  ډD$$=j6&uU1ۉ D$j6 j6ME \$$L$SPy t D$$ ^_[]ùQ#SWV֍Qȋ\$L$|$$ 3'  u !ڃ SQWV 99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹###wSWVP=Xw6j6Xw6QU+Ɖ=Xw6=A3ttxt>u &1ۉSPV' Ɖ{9u$8t*j8u+$t@jB' t$@u^_[ù#Z&USWVPՋ\$St$gƉ׃=j6uKl$j6 j6MES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաj6HwSjP ljաj6uND$j6 j6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THj6 j6N&ىWP1Eكra$"ى=j6#Éj6݅~hj6 j62É׃'1Hj6 j6NPىWP1 1j6 j6NىWPÉj6Lj6 j6NىWPe$É׍Eكwj6|$4t;~l-j6b1A1Ǎt$WSh"jVsjV5j60't1I1@1l$QPh"jU=jU6#" ؉^_[]ùm#T_#J#@USWV֋] $t$ơj6 j6L$ D$T$uPV֋=j6Ww,|F'8F'}uPW ֋=j6ȃ}tً$VPt$ ֍GwF';E Qȉe^_[]fUSWVbA3$D$ h#=etuD$ jr60hj6GVSl?SiU^@Pȩáj6)QPS| j6)١r6pQ`VPSC$jh#l#%ƅ<.u 1~.D0t/ua$Ph%BtGPVBt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$Mt/h$:ur68Ltjr68j*5j6uj=j65B3{B3f`5j6SB3HQPPB3Q 5B3+B3@u1[h#[~0? Ph#Ah#7SWVWWP赾u2\$V腢,8"u6W赡WP胾tVdj6VI^_[Åu0評 Ph#jj6tjPh# h#ÐUSWVD$ B3fa1Ƀ|$‰tpыLh=$SA$thW#S,u 1t$.4NJ]taM\uNEU\rw$`3'\0u!11ЃwxAunjt$>B3HQPPB3Q t$.PN    ȉšB3HQPP+B3Q<$t*B3HQPPB3Q 5B3wB3Hu 1^_[]ÁfHh#jfj6u:L$ j6jPV=j6t j6K15j60ppp VPj) 95p6t =A3ujVpV^jpPT$=k6u k6D$ $1APVj6j6t1It$aVPL$T$ D$$PD$k6jWVP|$t$D$$4$ WWV׉ΡXB3t LB39ty u hLB3 =j6j6uPh#h`B3 =j6t5j6h#h`B3 t*t$ Wh`B3 x4hW%h`B3xV葑 Ph$h`B3} B3HQPP B3Q h`B3 ^_SWV|$t$\$eSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf3'T$ L$9upu'0fuQhe&j hj6j6@^1j6j6j6j6WV|$ |t|$wLA3 PA3 r6>t'F r6Qr6^N@>vuڋ7 r6Qr6t 2 @j615+LA3@P/ơj6PV j6^_USWV\$0t$,|$W5Xw6jVk j=8B3thƉ؃$1t7=A3u.D$0t fh $uQVi=j6u"Wכj趷=8B3u11EhkW{u j6D$0u^_[]jUSWVL$,|$(A306̓V$4'Uw1ۀ=A3_=j6Mjw1ۀ=A31=j6$=j6jwH1ۀ=A3=j6=j6uQ=`t6ttjw1ۀ=A3=j6=j6t  u8VK1tu j61l=`t6tUW_j\$0SWh a=`t6tWD$,E=`t6tt$,WK_=`t6tt$,WE\$,SW=`t6t`UW=`t6tIUWyPh# hLB3k=`t6twww. j6@jw1=j6j6 jwa=j6t j61VȘV荘L$,=u6t =rA3t j6tu u^_[]PnjUSWV@|$T5j6D$$w=*B3tttnTv65Xw6P$P h#Gtj P5B3{ Kȅuh#5B3rl$jUth5j65j6j<$t&4$h#{5B3|$j6\$Xj6-j6j wD$ j6u=j6tSwj65j6j j6u=j6t]<$t&4$h#5B3X@^_[]j5j64USWV\$;s3=*B3{Tv65Xw6PPGh#:stj V5B3 vh#u h#B3HQPPB3Q 5B3vl$j6ttqu }tF1ۃjUw~Sl$SP1 tuQV}j6Ju j6u=j6tjsUsVj6 j6u=j6ttJ=*B3tA{t;Tv65Xw6PiPh#5B3Y^_[]SWV|$j6jw1=A3t j65j6^_[Ë\$1j6u/? j6ut΅tSw5j6j6t"u8j6H j6Kj6jw=A3tru+j6H j6j61 1@65j6+USWV1=A3t5j6|$0D$P(m[thUS- =j6tiD$j6,$\$4>GXw6=*B3 Tv6PQPh#w B3HQPPB3Q=uB3HQPPB3Q 5B3.juw  Sw5j6=A3uZj6t"u*j6H j69j6m"uj6H j6 j6 j65j6D$P轑 ^_[]USWV|$0t$Vj@O Xw6jPw+ _1=j61{t'GXw6$pW!Yuuޡj6[tZtT1=j6uI=A3u@l$41; u{CXw6Us t=j6u =A3tʋ-j6-j6VŐ ^_[]USWV\$K1t@ j6PSyƋk1OuD$}t 1{PuV'{ uR j6u=j6t~ jW|$x4$jt$jux W<$t$mE{t Vsx1 V}j6 j6u=j6tA^_[]Åx Ww迲0耂 Ph#USWV$$D$1t$ ,v6D$$u6D$Du6D$Ht$05j6$P֎5j6EXw6L$XIEtH1F\$Xljtw(uGXw6hSW( 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGXw6wºtjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=A3t=j6u|$ ~ $@D$@D$ )$=*B3Tv65Xw6PePl$41dz=u)B3HQPPB3Q9}j=W{Ɖt>uCB3HQPPPB3QFP U 1Ո`1t$XtOË$t)B3HQPPB3Qv É΅u$u t(PV5B3# مt ȋN΅uءB3HQPPsB3Q 5B3|$ +t$4~jh<5'W] u|$$ƅuf|$X# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$X# f=`t6t*fsD$=4 t= u ft$}u$D$@f%lu D$j6jUssD$,ED$D$tD$L$` =zA3u f|$t$Ut$4t t@j6|$D$D$`t$dD$,F L$j6=j6tYD$t;=j6uj6=j6t.t$`mjt$hL$D$Hs*|$^# toD$ t$,wj6.u D$ 1@t$,qj6=j6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]@w6D$(@w6j6[<NjD$ j6_ D$(@w6=j6j6Y1PPW 1ɅȉD$PPVr6\$pfr6D$ Hr6$r61r6j6 @w6L$( j6L$L@w6D$D$hP j6u=j6t$jV0j6D$ 5j6|$t&D$1f|$tH u6u6$j6h t$8 j6H j6=t$L$QPy j6j6t$6 D$(@w6D$Du6D$Hu6D$Lj6hr6r6t$pD$ j6|$Pt jk j6u=j6t=j6u 1j6j6D$@z$jW{j6D$ =j6h!t$85j6t$Ut$8qWt$Ut$8nrD$ffD$0fD$8D$L$D$u#xB3B3tB3|B3@L$D$j6D$pUD$lj6D$ 1D$T$PWut+j6D$|$D$k6=j6D$$ ,v69t;D$=* t=7 u)@w6D$(1@w6D$TL$$PQt$u :|$ uD$0ufD$D$4j61f|$ˆQP$j6$r6r61@L+=ԟ3D$j6B3f`4$t$T$$L$tj6D$ j6B3LB3B3`B3t|$TtD$(@w6j6D$tD$pj6D$D$tFD$t D$f|$t$lSj6=j6t|$^# t jD$uB3F tB3)NB3|$@tht$DhR% $P讂^_[]h#5j6t$1=j6ȍPu 3=j6u"D$4thB pȅu5j6t$ t$,Pt$=j6uS詗'h#hr6萗r6t$p|$Pt jt$hID$(@w6D$Du6D$Hu6D$Lj6D$ j6jPQ̤0 j6u=j6tVvt Ph #xj6uj6j5j6tk61WVt$tr|$w$5'j Wv 9 $@Fvu;Ftj WP $jpV ыF @v 빃^_V t$t8>u3Ft,p'tF ,v6QjRp ^SWVQSt1OS jjP  t6 >F1"jjP  tv ^^_[USWV|$41GGG =A3l$0\$Suj6AjUhjUP[j uAj6=j6t 4$M 1CSt$SU\$t$# $w j6u=j6tS^_[]h#VPj6u1PPVPjhA3/u19}-9j$$PM ƅvvD$ PV x3D$(!D$ =u8=k6$Nu$Y8tO8t ED$}o$E$\$|$$t$t'5B3jS\P$h&VfEo$T$pƋ$$j6|$ÍD$ uj$HfxT$ ufBuω7 j6u=j6t ׅt"G GfEG EG fEGE fEEĜ^_[]j6T$ Éuj$fxE$ufBj j6tbiV܀C+LA3P=lVt+fuwW0D ߉?u׃k6r j6t^_[Ã=j6t^_[WV|$D$ j6jP+@ft*fu v fFGF GF GF j6t^_Ã=j6t^_WV t$D$L$ j6fO A3fOPGWVU j6t ^_Ã=j6t ^_jt$itfxupe%1USWVt$4$1E11D$h9#Ёot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;r6:6Br6*1\$ D$}u<$uh#߃<$u U9't']9'8uUP~ujU>ƃ<$tvh$ h#Tj v+Wtih#6vh$r68tcB3HQPPtB3Q 7<$t"Uh$h#Rh#r6H r6(|$t PjD$PU1L$#jUHfL$@D$wS$5'j/UVjUw:~<$舊0IZ Ph_#@<$ulh-#]<$uh#D<$u h#7<$t,Uh$T),v6\$|$tIGh#t$r6H r6(nv<$uhY$O뒡,v6D$ CjUD$PO PeK<$u hY$ Vh$t$vt$1^_[]hO#1#ct#RPhr#Ph=# f1PPt$  5LA3@PdUSWV |$$D$ \$(=A3tk6H k6 LA3 k6 PA3 r61ɉ k6 k6H Xw6@\$$r6tH r6~k6k6fH k6k6+LA3$ck6k6u&4$$cp k6k6qk6l$4$k6-k65k6x=tAk60F$]5k6΅ufk6r6.4$k6k6t Ok6G ^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tu6t D$B3 u6D$k6+LA3D$?~uЃtRWOT$4$ D$1@D$ wy< r6H r6k61=r6 k6; LA31y VT$0>u!y@u=D$D$k6$r6H r6k6=k6utk6+ LA3;L$~axu[r6Hk6kr6H r6Ak6@r6H r6k6$ |$D$ЉD$$ r6H r6 k6 bT$,H k6$t)Ut$ Otk6+LA3jPHP T$,>~y=u|$ D$ _RV/ uXw6r6H r6~#k6%"bT$,H k6 bT$,H k6$Ut$ NT$4k6+LA3jPHPT$8 aT$,H k6>r6H r6~k6 zaT$,H k68 _Xw6T1>uO@t*u t  $! QVT$4aT$,H k6Xw6`T$,H k6$`T$,H k6D$$ |$tu^_[]USWVt$0|$(=k6tu6t$D$B3&j]xNFu6D$1@)D$ D$<$k6_w9gD$(Êxr>jWhE&&T 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tj[ $HT$0JB^_[]WVt$ NȊ@>*u [t?uߋ=k6j6k6u(Qo9PZk6NQPm 5k6=5 k6 j6u=j6t衻k69t31Ʌt AuQP##u=k67v k66^_Vt$t"k60vX5k6΅u^V5k6t1j66Pw4 5k6 j6uۃ=j6tߺ1k6k6^USWVt$(PZk6+LA3PYLA3Gtr}t  KvC#:t /tQ t7=A3tAL$,u8 r6Qr6C\O@랃tPZ^_[]Ã=r6u \r6LA38t!P tx P:Zu$h#l#ljPZGËD$,tÊf@'$< t< s4< w*r6H r6~k6k[H k6r6H r6~k6A[H k6Gw/u}/uE'P USWV,D$DD$L$@9A|$$D$ t1jB'‰T$ D$D%D$ j=L$ QGD$pD$$L$(<$ L$u:|$ L$D$PQ1ڋ\$ L$xv6T$)11Gk6+LA3D$D$<$u \$ l$J n%t$l$UPRaT$NQT$ L$t,1t}u;@ڋL$uk6-k6+-LA3=A3t%1<*t<@t1$ ws1D$1D$L$u!L$ȃ@!ى!:@u =r6t1C L$@11ۋ $?|$t$Ut$T$RV* U`L$()<$ }D$ 1|@u$r6H r6~ k6ՍQk6UXk6MPk6EK1ۋl$$]|$ D$ GEÊf@'$< u.r6H r6~k6 WT$H k6r6H r6~k6 WT$H k6]EuKl$ u% k6LA3)k6 r6\$ \$ L$D$ E< w.r6H r6~k6 WT$H k6r6H r6~k6 VT$H k6]Eu1l$L$sD$ 1l$` $Ik$6'|$tr6H r6~Sk6Q1GAL$u3L$ QV1>t5k6t$>k6ud{.VH k6=k6+=LA3t$ t$(Ut$ WV3uk6=LA3k6)=r6Um1Gk6+LA3t$PU <$t[1@Ftuրut܋ k6 k6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh]#誳]s)Ѓ5Xw6hu#茳׊t!#u(HL$IQWP5Xw6h#bD$ƃHQWP5Xw6h#:USWV5k6+LA3D$j6k6D$ k6D$$k6D$(k6D$,=k6k6l$0UR+LA3PQD$ P$URD$,k6D$(k6D$ L$$ k6k6=k6k6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 j6u=j6t謱hWt$ y)u8tj6HD$EEt< uD$C낉$L$}1A9r6} hSL$ƅ~N$ r6 FK1:r6H r6 S FK1Ƀ=r6 S1ɉƋ$|$tf@'$< t$< s< w r6F$ r6Fj6D$ x PD$t P) D$tP>j6$u+LA3jPt$$ 5k6 j6u=j6t-^_[]USWV D$4L$@-k65LA3l$)hPxD$r6H r6~k6QH k6=LA3UKWD$ POk6+LA3PN5Xw6WljӍD$ POLA3 k6k6) r6 r6 cQk6SWh"jPk6xt$GF9Iu|$"tjVU0 k6A k6r6)r6D$ ^_[]SWVt$1ۃ|$|$ák6t#9xu 9X up2jTM k6k6k6k6xpX ^_[WV=k6t$ 95k6~?=k6j6?P' =k6 j6u׃=j6tk6k6t?9p|j68Pc' k68 j6u=j6tʭ k6u9q~)q$95k6~ k6k6k65k6^_USWVP|$ r Gu;|$vO11FF€xr< USWVt$$2D$,=k6%1=Qt$ =r6tk6zMk6r6=k6L$(D$ T$0-LA3<)l$ʼn,$$@6'19RWP tF,$u@9ru9RWUL Ft%9,$v!~u9uAA9rwƉ,$9sKu9rDRVU Fۉt 9v~u9uAA9rwƉ9s1^_[]Íu9sRWU uVۉt?uGG܈)$H k6) r6Jk61C9tD$ )L$H1ɊA9u댉+k6=k6r6yKǍGk6 k6r61@LiUSWV8\$Pl$L11EEȍQxr>2tc*<) &r6H r6~k6DH k6r6ڃt$$@8)΋=r6$E1 Øt4t/*r6H r6~k6CH k6r6H r6~$H $ k6Qk6 JCk6 $Q$ Pk6$jr6H r6~$D$k6M ȨtD$BD$)r6H r6~k6D$ D$BH k6$k6 LA3T$58'~s18'k6 $Q$ Pk6$eØt2H k6r6H r6~$H $ k6Qk6 0>k6 $Q$ Pk6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-Gr6Pr6=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡴk69tH9u %8/t F%Q D$;5k6tF/}tEEGXـxs@<$uokt$ltdǀx .u.uN jWt$ t8tG@u@/UPWV;5k6=j6tt$tWE/Q k6߀xruX@8tB@9tD$P5k6x5k6,Ą^_[]ËD$1Ʌt AuQPFWV|$ WEL@P7WPoj7p k6k6^_USWV\$D$|nOʼnmIWP)|$SUÉpswMx 7u߅u҉3D$^_[]SWVt$(\$$W7C k6LA3k6PA3r6k6jsr6H r6~k6j9H k6k6+LA3Pz6jVP W7^_[USWVt$FPh#ΩB3HQPPB3|$Q1ۃ|11E4JE9uSh$tB3HQPP%B3Q|=1C4萤B3HQPPB3QC9u1^_[]fh#視h#蜖k6H k6~k6H k6#=~uk6H k6USWVP8A3H k6t+u yk6H k6~xhLB3裤h`B3薤 k618A3~PXk6hSpG {eX8t_8A3xLX8#>WjW !Pjj  h#>8A3pk68A3@1ҋk6  k6@@P t 1+k6k68A3{tXAˋ-k6M k6~ @لtk6أk6=B3t$5k6D$x5B3D$k6H k60~^_[]øk6k61k6k6h#USWV=8A3w j6^t)kU9G~D(< t< u 8B3Hc Fk6Fk6F k6G $9t V  j6t^_[]Ã=j6t^_[]V k61~^Ë8A3r t ~6u1@1zk6 k6SWV\$t$|$j6 8A3y tja1 8A3I  8A3A$A k6H k6H k6H XtK =k65k6 j6t^_[Ã=j6t^_[:WV$j6jWeƍD$PV1uT#D$ =uD1PPPV7 u2jPVټ u <$ELF1PPPV7 uZV9t:$Ph j6u=j6twĀ^_Wh#ӑV襽h^#V蒽WhD#謑V~Wh'#蘑Vt$j6hp VjjV |$ t8A3H~Q 8A3pxuh/ 8A3A1k6k64A3 j6t^Ã=j6t^鎐8A3tL$T$9PuHuák6 8A3A k6Ak6A4A3Aj8. 8A3@1ɉH H$H8A3WVt$|$ j6|$t=k6WCk6k654A3 j6t^_Ã=j6t^_ȏV58A3j6Fx P׊FtP ~ u8A3V 8A3H k6H k6H k6@4A3 j6t^Ã=j6t^=8A3Vt$ 8A39tk6tPu^hv#v=8A3k6t-Ã|$t=8A3k6uk6~P8A3@fWV|$ 9=p6=p6@A3t P誉jh!#躹@A3MPЈ@A3ht PE5@A3rp6B˼9t jj1Vj薕Vj苕Vj耕蓼 p69tQj!1p6P5@A3CQ0! h: p69tQjp6P5@A3;5@A3u@A31Vj”Vj跔Vj謔=p6@1V,tVg@A3Fuh#RA3^_dP0% hPh#"EP0 h/P0 hPh#@A3;D$u D$@A3h#Dr6SWV= p6jQEƋPh$Ϟ|-1GPhbm$訞G;|ۡB3HQPPJB3Q W5@A3stJj6V[V j6u=j6tc^_[h$#Ëh4#蹋N0 hPh#蚋Vt$ h#C^USWVh#vC= p6r61FjPlj+p6i5rO@QPhV#Y |,Phbm$3E;|ۡB3HQPP՘B3Q Wr68tH r6@(1^_[]h4#oh$#eUSWV\$n;%u(sVd8V7HW#KS?8W#dS7 p6M5p6At#~i9:0#I {p6W#4$D$D$=p6C1tQ~H$8?uEt$P\uUt$6t W#tlW#K\$ueZ*t%tS-tU+Eg#DA3x+;p6}#5p6it #\$1|$ t5^_[]áDA3t p6iv#뚽v#SUfUSWVp6)i5rO=DA39u=DA3)p6~9ut Ku ]t]tu`ǁTtCiu3itit0 5DA3^_[]SWVt$j6~X1tttG9uމjQiuLJ19}q~5@tu ƆH j6t^_[Ã=j6t^_[F+5p6i5rO@Ph^#蛆+5p6i5rO@Ph#耆Pj Ph#lWV11Fh#_>kt!Zu忀ރlt puԉпɁur6tg8tbPh$3m=A3u =A3u@r6tA5B3jPvW:r6H r6@ujW5B3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh'S&W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th9#jD$PȖ ] p6)i5rOC-DA3+9tti-;)t RPhT#jl$ Um\$D$P;7$t+,D$0h]#jS8S\$ 7ŋCt:tBuM ,%Phb#jQD,ingD,Runn}=tQ` l$ ,j SP0 D$xxl$ ?Sm6l$ ō,@)QPhk#w0 h%jQZ ݍ,P(6WD$P腐݃FD$ ݋\$GHO W贐H EuݍCWP:$u/1M|t؁Phbm$WH N1MM|FGHO WJH GHOl$  W&H|1GHO WH ~T$KWqD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =A3$tCt>5@A39t%5@A3PV蒶$=p6~y\$t$1=p6tEt*t t.<$u u/S0= p6u WE;-p6| $^_[]C0q hjPh#nUSWVD$4\$,tl$0|$WUS ƃu[C8=u6tj6p6p6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1op6D$ p6$iD$ 9T$tcu tQ=p6t 1=A3uL$,uP9tPtu B3P j6u=j6t}^_[]Vt$j69tP džƆ1z j6t^Ã=j6t^W}WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#5t$ntpur6D$D$D$t r68D$t(1PPSБ EjS== p6u|$1p6-r6~6@ p6D$u}t!AH Et{1jPƅt9u ED$u :u G Eur6t Dt111D$uD$p6L$L$t$D$\$l$|$ p6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$p6C$jU9 L$tc|$tNuJD$1rȋi4h#jD$(PTl$D$D$L$D$u U D$\$l$t0~Ot)D$p6y\$l$D$tUD$tMjPSL ?jVDžtjuS+ =A3u V <Ń퀉0^_[]h#yySh#nySh#cyUSWVP1$1C11h#J1it"gu$ڃjt puЉ̉( r6t yjPƅt,1tp6)i5rO@PhQ#H$t#tH~1i0 tPh'S&Ŋ11G^_[]Ã~1i4h #荊B3HQP~G ;| Z %P&G ;| B3Z;|lh #wh3#wV1= p6ujt$ St1+^V1= p6t. p6~$Ap61F:uI}^V=A3tO=p6tFD$t+ p6i5rOA1ɋB3u0VQh#R^USWV= p6u65p6~%=p6Ft WN p6l$p6~"5p6HI}j6tfiPƋ-p6=p6iPUV  ~ ;uKuU> l$hnƋ=p65p6i 1҉AJw)׉=p6 j6u=j6tUuj6fdž=A31p61B|iP j6u=j6tt^_[]SWV\$|$)ƅtt.VSt$W\$<$D$ #^_[80 Ph#tUSWV|$ p6tWdW~*15p6j6p6V>V}5p6l$t$t%t =A3ttttk0hWj~Wj~t uuhmul1VVhZ%tOhZ%h#sOVjuV5@A3BtTWjzWjzt*=A3t!WjzWjzWjzu p6^_[]60b hPh#_sUSWVt$ l$|$1ۃ=p6t/t*=A3t!ttSVu5f@..@.^_WVt$ |j6NJujVj 瀾tW5@A3v<u%+p6i5rO9DA3t mjVt=tu  ρπtt=ttu j3u VK j6u=j6tp^_n40/ hPh#,qSVD$L$ =A3t1ۅ SPjjz ^[Ët$1҅tހu1=p6u2 p6u) p6~p6:tzt Iuh#~p61@SWVt$$1@= p6|$(1@$*#$x6'Wh##bjvu hv#h%tjjvjv 1~ h#21@^tjs%;th#h<$jvh_%1Wvh#1Wvh#Wvh#jvu hv#xhH{#kjvm~ t+u hv#Gh#:jv <u hv#h##Rjvu hv#h#7h#v h#jvh#jvu hv#hf%;h#kFp]h#P~tF1SwJh2p#.Sw 1> #t#P uh#h$vh #v#'1e#1 ###1#N9tQh#jWWSxuF x%Ph#jVZVjv S h{#51^_[h#h#jvUSWV fD$ p6 p6l$ 1D$U$u1!" $6']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ <# t@#,$$׃߻&!$}D$C#I#} uQ#$_%)4$<$zT$tvӃux<7't ur>u<7'_pE~FЃ r)# ,$t3#\$҉Ӄ9uG8,$"2D$1&<7':7'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I p6p6 ^_[]WVt$ tG|$t jV~t'h%h%jVvu^_USWV$t (p6 =(p6D$P v6t u6v6 $=(p6z1jh8'S\ `P>;Hx@u8/UD$PV菧x D$pL$t 1D$tD$p1ɋ4p690p6k6tH1 8t:tGt89=PA3Z 9=PA3~k65LA3WPV\ >?#<=r6l V: fiDle cDhangD ged߉VvB3HQPP~vB3Q D$pL$t 4p60p6E;-(p61-(p6D$PĔ^_[]'fUSWV<1UjO(D$hhh UPj萑 HQj:9u 9Èp6j U p6jp6h#U= h# A3,$Uhp6Wt$T|$Pj6p6p6p6HhdD$PVWVW~=p6 Àu{=A3n$h#j6ttQu k6 j6<$B=A35=p6(ȃu6p6p6r6$j6u?=j6u7B3HQPPtB3Q h`B3tD$Pj6=j6tKe$$=p6u>h#l#R8't1Ph#QPP[V$=A3uA3 p6t N=p6uEt$(Vh#t8t$PTPV$Xw6=B3t =r6tjd7'kuD$Pr6u/jM=A3tFhmS#rh`B3's*1ɀ=B3ˆQPh=B3u=r6t4A3Xw65j63p$$#uSWVD$8t^j6jPЎƅx jVO j6u=j6t^cx"1=A3t=*B3t*B31G ^_[11=B3t B31j脇V3Vr=A3tt*B3uB3^_[USWV|$(V11C=u6tn1=A3u4t0j5B3ujh`B3qA3P=8B3t.te=A3u\1Ƀ=p6 p6jP8g1;tW1R=A3uIu=A3t7=A3t.h#ppEVu]$u|V#^_[]Vt$j6jVx1jP j6u=j6taj^Vh#at1Ã|$|D$pPmmft$1 th#at$t$ th#zaWV|$ W@P tWPH^_h#BaSWV|$PA39~b9j6؃P tr HA3 LA3PA3HA3 j6u=j6t _`PA3j65LA3>LA3)PA3 j6u=j6t'`^_[h#`D$t LA3) PA3LA3j h#j赉 D$ HA3 LA3H PA3H r6H r6Hr6ËD$j6H r6P j6u =j6~_Vt$j6HA3;t HA3P FLA3FPA3F r6 j6t^Ã=j6t^%_USWVPA3<kj6-LA35HA3p6t|F9uuHA3PV  HA3HA3+ PA3 r6LA3=PA3r6tG90uC HA3 LA3H+HH x@WSUPa 5LA3=PA3 j6t^_[]Ã=j6t^_[];^h#^D$j6LA3)PA3 j6u =j6^V5PA3PA3r65LA3^V5PA3+5r6PA3)r65LA3^ËD$ LA3) PA3 PA3LA3+D$ȣr6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$#t&jQh#Fb USWV1\$@<uPƋtPEu1ۉ]hr6r6=r65r6r6^_[]SWVP\$t$t2uh̄%V1C$"h#fZW%(,B3u*2B3#0B3RQPh#^,#uȡB3HQPP|ZB3Q (,B3t"2B3v#tڞ"QPh#p^ u.$(,B3tPVtu#VPh'#K<$u#1B3t(81B3uƁ2B3u숟2B3h#DY(2B3:3B3t0,B3#t QPh5#0B3QPhK#] uB3HQPPSYB3Q >1 [A3t$YA3t(81B3uƆ2B3u ZA3@uă^_[V(D$ T$0B39tu#RPh=#Jt#1B3t(81B3uƆ2B3u숁2B3^WVt$ ~t)~tPn uvZ ^_USWV jA r6t_y 8-uUD$$r61r6P  r6y8-@P1F Pơr6)j6r6=r6~-r6Ft7 r61Nr61ɋur6 j6=j6H1F5r6P)ƅr699Sj6 r6r6lj4$މt$\$)1*C/5r69rL$ 9v!\$ۋ4$ P; r6w4$ 9vQ9wr6 j6u=j6tGW1 ^_[]hb#HhQ#Hh#Hh#GSWVT$ r6tstm8u'1z:trrD8uAÀ~:u"9u r6Qr6 tf r61ɉ r6D5r6>1t6?-u1t+O^r6-uta5r61^_[Ph#"GPh#G|$u1PjPPoej6jwr68t PI j6u=j6tRF1ËD$Ѓ w#j jP莠 ur6r6ËL$~ND$tH  r6=r6u r6r6r6hr6hr6Qpphx#+FUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh#h#Y J|$:uUD$8@?jPh#Y ^jUh#Y 1|$D$0)@<Ph#h`B3V jh#f1?\$D$01@11T$4*l$Ph#j UVhUh#%Y D$EEjUt$0Y u0^_[]À|$:uD$8@:Ph#K1L$0L$4HUjvCfVD$ 8B31qqA1Ʌ p6$0PQ8B3p ]t u 1%8B38B3@j* 8B3 u^qqh#|CPD$p6/$iQXUSWV'ơ8B3@tu'tƃ 8B3 x,$@D$t.$xH$18uWPtG9'uD$tKjD$p (t6NjpVWPVl E$ht8B3@^_[]USWV8B3@|$u 8B3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8B3@@|$Fu6|$uD8B3@ 8B3Ap8 u|$u8B3@^_[]jjX 8B3ASWVƻt u j pxʡ8B3@^_[USWV8B3kE1͋ 8B3x t*p6,PyN8B3@ C1Ƀ8Qs s j@8B3HOH O oKy K9t?U1CSpt ^Shd?'P= 8B3HO@ G 蝯8B3!^_[]WV@t$P 8B3A uyW wWh#49'h#j"Q Wh#j"PQWuL$Lx49'h#Vh#jPQWUSWV8B3@1u 1=A3tMtݡ8B3@xuUj @jtÉGpj`aC+t8B3@tj,(pƉ^_[]h#8B3t$p0h+#7>USWV8B3@$ u8B3@$EŃCߡ8B3@$ 8'$ 8B3APUj já8B31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt8B3xJjG B u08B3x,u%@jB't@/@jB'uh#jÀ=A3tjjj 8B3H0+H8O U 8B3p0j^@ 8B3QPI H pGu58B3~ h,%vRm|$F8B3xujD$ 8B3Hu 8B3H L$ qx0j@8B3HKH K {@;u.8B3x }8B3x|$ T@0GjG 8B3@t(HS u 8B3@8B3x\$\$j 8B3HK @0Cku8B3x ux,uh,%pjP@u:<$ t=u葞$)jWP萞 |$l$$uS\uNr6H r63\F u%r6H r6  F4A3#ár6H r6ƈF t詚=v4A3菚=t h8:' u4A38B3HH r6H r6r=LA3)FV,8B3x4A3+D$^_[]USWV$$1҉T$ T$$D$(54A38B3r0=d?'t1$|$ fw|$1/fFn D$j8fNLA3 PA3 r6=hA'u ƒ=r6‹nD>  $8'=b>'u f|> r64A3Bס8B3=b>'f|> LD>fT$ T!uhЃ`Ę0N,諘05,/L>=f@'fu r6Bn׍MN|$=@01fD T.fTT.fTT.fTDf@'fD1AL$*(lj ƒ(M r6FD r6BvNO|$s@81ɃfD T7fTDhA'DfDfD> 0 = r6\G_T$ t$>Hff r6T$ Bf|>D>u6t$G nMn r6}f|>  r6BFfL U D$$D$f|>tD>t r6Bf|>u D> r6B r6B3Ã{t jB' r6}E+=LA3 r6E{|$ðD$ #tp#}cD$ 1@Qftf|>u f|>Iu6v $ nMnD.=b>'! r6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDd?'fD r6T$ B1AL$~ R) NjFfL r6B)A 4A38B3@8xt p6 p6 $8 Nf|C\:`1" $}f|  r6T$ BFu6$< Ft$HFfЖD$$D$NP`ſ1۹$8'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDd?'fDu6t $) FHF r6BW赕= t]H\t 'u 4 t =u 4A38B31Ƀxɉ p6$6 r6T$ 'uF|b>' r6F$ f@'$< u r6T$ BT$ r6 cʔ^t$1  4A38B3x5p60jB'ωD$Ѓ K}\$ff@'f|t r6 r6B\f@' u r6BNf|t r6B1@D$o r6 r6B݃"XŃ'D D$0$ݟ nt$T$ Mn r6B1@D$t$p6$4U ۏ` Ń< ?\u豏\ ? \$1RHЃ w&Hw ÃHÃéOu \ r6vNO|$@81BfD T7fTT7fTT7fTDf@'fD\$ B‘L$ uk%=O =r6 D$ wF r6P?ˀ r6@F r6 x?ɀtw r6@ r6W?ˀne r6GQT$ A跐,D$8s69s6D$D$$8s6薐1zjB't.r6H r6;LjG jB'u\KЃ w4r6H r6LjG ÃЃ D$ u t r6׃Zn r6H r6=Gt/ up}tkr6J r6#@ǽh#tE%t@Ń:b D$D$$W:'{¸U1#, 9u.1|$Nf|uf|t Ms@ LA39T$ vNK؃|$`@11fT T3fTT3|3|t3ft1BfTft|b>'fq fq ƋT$ k6H k6~k6H k6 .ËFDD\$D$$W:'1W:')G r6x ?ʀtw r6E r6O?ʀ r6Ga r6x?ʀtw r6E r6O ?ʀtw r6G r6A?ʀtw r6A r6H?ˀ; r6x?ʀtw r6E r6O?ʀtw r6G r6A ?ʀtw r6A r6H?ʀtw r6@ r6A?ˀ[) r6AD$ ??zr6H r6~2G:r6H r6~$_1:B ˆB1b>'nD=hA'G=b>'tf|cf|.3r6H r6腿5LA3Gf|uNT$ ؃t 4$t$eŀ>ts4$]lGT$ )B8B3L$H,L$H $̾8B3pM tΉ$T Nu8B3xĨ^_[]1HE;p6} ;p6~p6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }8B3h$ Ή$ Nu=tuS$z#$#4A3 8B3A0$#l$#Y$#M$#A$#5$#)V 8B3xt@@ ^Ãx t#p6$?)8B3@ @8 4A3H0k6H k6~k6H k60袄ƃ~0:=F $<9'5 t=uv럃F~t\u^ 4A3@4A3 8B3A0ytp6 Kp6$R(*;|u0d|8B3@=t*4$D$D$b>'Buۡ8B3@1v u4A38B3HH @1@Q&8B3@-8B3@8B3@&tQ;ub8B3@ 8B3@υ8B3@8B3@ 螅8B3@u1\u?' u64A38B3@81Ƀxɉ p6P&9jjh^"8 сVȋ 8B3y8~0 r6Qr6׹@ 8B3Q8rq8^USWV\ӉΡ8B3@D$ 1,$j6D$U+LA3D$$UPGj6$~Sʼn$S5LA3P@ l$|$tD$$j6 j6u=j6tw4A3D$-LA3PA3r68B3x t*p6PK%8B3@ 藀ǃ[~!\u9膀ǃ[C tJ$Q u"4A38B3HH s`un=ub\tX`tS4A3 8B3QQ NDt""u$r6H r6~E\E \@ŋ r6Ar6@r6H r6зELA3@|$t~Pߴt$jP脅 D$pŋȅut$ j贴E8B3xtH@1D$4A3D$jEǡ4A3D$Bt5 8B3At$ D$AExB8B3@t$ Ex PA39ًl$诵 PA39~=LA3r6t1SUW詫 )r6j6U $ j6t\$=j6\$tn 8B3T$ Qj6Nf|u%Du r6Qr6-@Vt$+t$ r6Qr6@~.Fr6Br6ȅAJ։ȃՃ\^_[]á8B3L$H0h#Wu<$t 4$ /8B3@D$j6jPjjjjVtQ̌ N^V 8B3#ytA5p6t7t u(@v6v654A3P5p6@#^USWVt$,|$0l$U5PA31BW;LA3u(V`G@s69w&Hs6 jjV1 ;DB3~=DB39t VU1^_Vj 跣tL$ T$5Ps60Ps6PH^áPs6tT$Ps69Pt u0P"~ 0USWV$|$<\$81D$ $D$1F5L+=5ԟ3h#WSNi !1Ɖ\$l$T$ L$+t-T$L$ T$L$ FD&:'V[C9rWUVF t+ u)CL$ ЋL$ !hA &jt=ƅ|$<\$l$ftL$e ԟ3$D$)uN=p61NF1jt$;5p6|dۋL$D$?41ɈL$ D$ L$L$щD$%D$@L$S述NJ<0u ]EuU%;=p6| ;=p6|$t1Bt$ t$1B6ËD$ Ds1d$sЀu tPjW-  D$#D$9tPjW- <$t1BRR5B3 B31Athg#1@$^_[]Vh#UhC#h#0y PWh,#zVh#o0S PWhL#TUSWVƋ\$|$tWhu#5B3 #t &D&:'ut&PWh%5B3E!u,u 17t3Ph}#5B3 u1}thA &5B3E uttVh#5B3q hmS#5B3^^_[]SWV|$1\$t$tFHN V@H@:'>tbhޫ$Wbh{#WLuo1<`s6tEj64`s6#v `s6t jV j6u=j6twF@u`t6>h=$Wıthv"W貱t D$1p@|MD$K}h(&Wzt8D$D$hn# j5B31CKD$D$u}h# v11 t=t8<`s6u.u hs#v VaPh%  GF@uhmS#A F@uu=`t6tk1uu膩ND$E11P@É|$t<`s6tW4`s6h$Ah#<`s6t4`s6 h{#{SfPhZ# Eluh#5B3 Cu|$tE1F-j6D$t P1<`s6D$t4`s6Bs D$`s6t jS< j6u=j6tEt hmS#11<`s6t:`s68u.u h}#aVLPh%   GF@uhmS#/F@ut hmS#1<`s6t?`s68t3h#4`s6VPhZ#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=`t6t61B=p6tbu^1Ƀ~7t@tuH1=A34 `s6t1Ҁ9ƒ (u1=A3B1ɉσu1Bdt61t)9t`tbփub1^։PjS5 $u=A3d1@ָ PS t^udt6u jS 1D$ D$D$$K?r 蛺 1@ jPj ! ^_[À=A3u=r6u =B3=A31@Vj6`s6>t8t6o `t6r`t6 j6t^Ã=j6t^ESWVt$u `t61ۃÿ`s6t6`s68t+j6SP j6u=j6tds6=`t6ru^_[,^_[V1=`t6u#`s61A:t2>u `t6r^WV|$ 0`t6u"t$=j6tg=t6u^j6WuS =hs6tӃ<`s6t>`s68t2t-t6u6=A3tu=j6u蕸0^_WV|$t$ dt6uWVjdt6<rjV莵uƆdt6^_ás6=`t6t1Åt8uUSWVt61Gu6Qu95B3u V^_5B3t$WVt$ Nfuu6FNtF t0fu^~j6 ?NQP F N)Nj6v͏F FF j6u=j6t V N^_Vt$F t-)t'VfxQPR yNFN F^5B3t$USWVP|$t$j'Vqt~th7#VYZ<k>t!h8;'V 1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=B3uUWMGHO W]H"WVGHO W3H"^_[]WVh8;'QPj'Vs}t)19<>^_hLB3oh`B3bUSWVD$~@|$l$1SWU t 褱8tF r)~1H^_[]ËD$)D$j6XB3tP?g 1XB3PB3 j6u =j6PD$L$ T$$RQP XVPt$t$V: tt$ P4$f ^h<#PD$L$ $QP5B3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+Xw6+u6Pqq h#jhDw6Dw6SWVPu6;'C PVw u,$$wSCGσCGCuhv6Vh#8 u*$ v6v6v6v6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv* t61^_[]ËD$t8SV fƋv6`uv6$d v6#t#$>#t&dRv6㟉v6t$D$$# ^[WV<5j61$|$PWt $D$PL$LT$H=j6PQR 5j6$<^_USWVL$T$tHtA|$9t91jB'Írjt/9t+1jB'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U蛝V菈Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#WV<5j6j6$|$jW!u"D$LL$H=j6j6PQ5j6$j6<^_USWVD$ èu|$=ZA3uÍD$PQW Ƌ@j6Nt$݁ uF @SPуF`u vb F~tuF1Ɏ! s%t É^~u6tu6uv6t jw~ j6uk=j6tb[r2j諆XxL$H @ $  $#`uW2a `u W"a fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=r6u0@=r6tc@=j6tf@=A3ti@=A3tl@=p6tp@=B3ts@jPh#,WVt$|$ j6twɅVP? j6t^_Ã=j6t^_WVt$ t|$Wv 6u^_USWVP\$j6j*ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR߄SP}j=StS跄UPu< ؉G@54B3K54B3hTA3Pq| ~ F1gjt$tv6uQG L$<=u5u6Hu62UjS $81F FFu6tv6~@w65@w6 j6u=j6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ j6t8Q12<08uF=u =ut j=RDsF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVv61tr:1҃Љu8w6r׍P趂ƻv6Nj+t7Mȃu%EttUЃuEmŃ8w6r^_[]SWVv6>tLGu% uwy\ Gu#Wi\ @twՁGg;u8w6r^_[2SWV|$tfh)#WLWO9uWh$V't*tUj'Woqt8)WPhD# hA# Gh#Wh֟%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhG{$tUhG{$>=uDB3HQP~ j( P B3j)n~=uGuth|#EUB3HQPPB3Q ^_[]USWVP8w6u)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP-yI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$8<'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$O t$k19{USWVӉϋu`w6fx@$<'$PWo1ۅD$PVWr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW)1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVW蕋1ۅTVW腋1ۅfVWuVWa1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]FQ9-u1tQyt8ytBÄthA$Qi='t1h, jjh='Qh, jjh<'h, jj hx='RCËD$L$  )VL$D$ 2)u AJ)^USWVPj PV> lj8t"ؗځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]VhU$YVhD$NUSWV׉t 9Fup  ^^g9uM1PP/g~ōP8rPUg~ LH;NuSL #~^_[]ÐUSWVt$(h#jic D$,^H $x?-Ok-u)sstdluu~xwGWÅu"3DHt'1Ʌ Sكh$%h3DH\ƃ~ƀtVitVVhf$j1ރ $h &SD1Ʌt:Su+$891V5B3Vj|-$K$8ʉT$h(&W݆1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.5&|" $4Ph%k 1@D$l$t jWHKj D$PUv ljӋD$9t-ف8ur1u 8tQ#6#x#UPh$ 1@D$\$ $4h$1@D$F \$ t$Ph$jj6PPPPh$5B32jWVPΉj WQu 9u=у|=}^_Vh$jQh$Dj5B3j@WV@Hl6k6k65Hp>>t)j=W#^thW>uPh#j@VjVh$ VhB3h" tS$VWh# ̡>#t&VQh# j,h$h#q VWh,#bL^_=j6t 1k6k6L?8B3r61s6s6r69Ls6tj=Ls6uB3LB3B3`B3B3tPrG B3Vj^15j6>CPkAQW1^_[SWV|$t$\E'$|D'Vw vVw d_ t"Vst Vw?w,N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u\E'E$D'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tC Ã|$C USWVPu }dw6hw6B3f`|j%vXm O1@ 0lw6D$,pw6|$@t$(q%v>%L$ h $V=<*u C h#S1N .u{*u{ 1HD$Ch#S1HD$  t$CD$'C`L$&~QF0 $E'. D$׋L$ jj D$tfL$tjWt$QPhw6TFu$E'lw6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Phw6ȋlw6L$ Q0A|$lw6H lw6T$ l$=hw6uM|$L$ jL D$tbL$l$tf|$ L$D$$w6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$w6L$\$L$$X8Glw60lw6E ƋL$ cjl |$D$VPt$wlw6lw6lw6lw61  lw6 lw6Wt$*|$$w6 \$$w6w6t P? VyP. w6҉D$xF\$wZ$F'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~Vw6tw6T$t P[> T$tw6xw6t P;> T$15xw65|w6Љ\$H\tF5|w6X])P0tXM\$u/^t-u#F5|w6벸^tic\$>T$ j5|w6F5|w6{ 31:DYt 7GuF5|w6\$DF5|w6ȋ\$+1L$ jlD$t1L$t5WQgw6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hw6 PRQt$QP  ew6FP+ xw6 VjxP豂 7sxw6T$t t$L$ t PVRQhtw6MT$L$ t1PRQhtw6.VWhw61PQ*t$P PQhtw6 ttw6w6T$z \trB<]*<0tu$XF' ?$,F'."'#Eu uSh$qdw6 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hP$dw6\),ҋ4$u|$ uWhk$dw6 ^_[]WVPlw60tplw691ɉQPV Nj 3$DQt$cC$r& lw6+ pw6VQP dw61^_SVˡw6H w6 u:B3Prp~r0 P{B3Q 밅uw6)B3HQPPDB3Q^[SWVPlw60t"lw6<'t<"u1B^_[11f1ɉQPVb lj+t:<-t6 3DAu)lw6+pw6VPh$ dw6 $ڃ^_[SWVӉQoǃArVh$襾dw6GPVhw6S" D$w6w6Ƈw6^_[USWVP׉1PPP ,>U6o@PUQ x$tG9tClw6+pw6VPh$lw6+pw6VPh$谽 dw6$^_[]WV9t"΀:t9lw6+pw69t\VPh$Zlw6+pw6Phm$蓽DX~8"uD=lw6+=pw6j"N PVWh$^RPh$M dw6^_USWV\$$8l$}h6H j jhF'Uƅu!h6H j jhG'UŎƅH h]$Ert&u+;?UVt$<$PW W19D$@D$<\$SUYu{SU[umSUu_3 $1DHu$jhI$VQZ VWVPWXVWD$<$H $xd|$<tWjt$=: y hS&s|$@t'D$tPhgtt$J y hO$qjwx5T+=h$.1D$@D$#uFj PV諁 c8u$8u؃^_[Vh$jWVh$jUSWV fܝ6w6> ԝ6ƒ ԝ6w6 ԝ6€ш ԝ6w6 ؝6w6w6hw#t h" $ot8ƿQ'F$PVTtG uVh5$j $$1ɉha $SU P6$TL'x6kj j5T+=< ƃu=b8"5w6x6v T+=fw6Wj j5T+= ƃ _%x6j j5T+= ƃua8"G5w6x6 x6x61A5T+=5T+=h^#VRtch $VRKx6x6B x6x6/w6#`8"tD5w6  9uw6rCjh $5T+=h $#Vh $5T+=h $ 5T+=h $ju h $ w6t 1ҁ‰$x6ԝ6փ95w6u<9w6u2ܝ69w6u#؝69 B3t B3x6x6=x6u\1ɅQtoh/ $ ԟ3= x6t)ͅt=x6ut 1jhh(x6P4y $yh(x6h$j=x6u1D$(Pt$G;u#D$0=u x6x61N1$0M' $$h#$."t$h$Qh%hVuV蠘th5b$PJ$Ph$x6}6 $=}6=x6p(|6B=hR#tyt1@$$Phmdt$ hhA $h|tWAWhw$ $=|6u |6 =|6u |6 4$h(|6 T x6 $$1 uWhPh(|60 1@|6D|6H|6L|6tjVh@|6v( h(|6\ $RhS(|6h(x6VW0 5x6VWF5 WKl$t$D$ 1ɉHHD$UD$ Pj Džy#[8#Bj6x߉DžV蚊x9ujUj5 1|$nhR#$PNw<hjh(|6W ^ WKt $h&$sh(3,ԥ3H ԥ3~Х3H Х38hХ3Lljt9 t4ԥ3H ԥ3~Х3H Х3hХ3Kƒ߃NyjUj! hR#d1(|6(3h(x6VW4. 5x6VWj3 h(|6dtd($Ph$$P51@PijUj WP9Phc#f ?$tǍ$PWh%VTD$uh"Z$P貓;%jPhq#QQFƃu W% VMiWVθ $N'PV(Kt uVh $jG w6w6Gw6Gw6O1ĝ6t^_^_WV΃=ĝ6 ȝ6t>w6t49t0 $ $9t^#9t^#QPh<$| 5w6ĝ6ȝ6^_SWV$VR'R'VSh$h3sz[#uj%hVPjj"P thW $@|1Q1|M'$ =uh jj"t$ 1$4诟F"u4$ 1@^WVκʅ u1H3 r1P^_V΀=x6u6=w6tw t41t)Ph(|60h(|6hedAV xk^Ã=w6uw Jt=x6t7x6t.h(|6hedAVp th(|6hrdAVY t=}6ujfh$j:h$jUSWVPύAPjhQ$h(3qGw4XR'hu"$Ph|$h(3q (3w(h$Vq w,h$Vq w0h$Vq w8h$Voq w4h$V^q W4O<W8L$9tQhL$h$h(33q#OHtQPh$h(3q#OJtQPh$h(3p#OLtQPh$h(3p#ONtQPh$h(3p#OPtQPh$h(3p#OTtQPh$h(3jp<$f$1۽a(3PjjhL$(!wVh$(3P pwVh$(3PoGtmÈJ9|6{u;[tVPWhr $zvD$(ffL$(D$ 1ۉa)D$u!)tPt$h $vL$4 <)ǘ΋I<9vt$h $u$N<.”T$9vt$h $u$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h: $ku D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( |6|6t$(L$QhVu  D$ 1hK$VtG<$h`#V”4(1>tYj:WD$AL$\$h`#Sz,1tD$hb{&W Btkh?o$WAh$WA\D$Ph$W( D$q;w6ef|6ujhl&l$!UC l$XR'1tUP\ QFR'r܉1hD$ Pj <$WhO$ssD$ D$t$ <$}trÉD$h?"U t:hJ"U t/hO"U t$UWh$r F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh$rD$ D$|6FʼnD$uf5,|6l$u D$l$l$h%W?h&W?h$W?h$W?h $W? h1$Wr?h"W\?ThA$WF?hO$W0?h\$W?Uhm"W?kh`$W>hj$W>hw$W>h$W><w ~W|$Wh$p T1<$|6jD$<$rt$Whe$p D$f,|6@<$Wh$pw6f|6jUh0|6jUh@|6 <$t$ht$0Vp J21jD$ Pj< D$P|6뜉1jD$ Pj D$T|6q1jD$ Pj uuD$`|6J1jD$ Pj uND$X|6#1jD$ Pj u'D$d|61jD$ Pj^ tt$W|$Wh$ oD$\|61hD$ Pj uD$fp|61hD$ Pj uD$fr|6a1hD$ Pj ^D$ft|611hD$ Pj .D$fv|61jD$ Pjc D$x|61jD$ Pj8 D$||6; w6sr"jW|$Wh$W|$Wh$΍L$$ t$|6|$Н6L$$ L$|6t$Н6rh`#Vpl$}}|M'1ۋ>t.W09Lt t uPUW ÁN'r D$3MDHu D$"91hD$ Pj t4$hO$lD$ \$"r)Ut$h $l h9$lD$1ۋD$|6ND$|6WX84(t$|t%h`#VL L$1Ҁ<tʉT$D$< w'<$$PM'L$ L$|6<$tL$$L$ L$|6|$Н6cL$$t D$|$Н6L$|616FL$<$C fF|$Н6L$! L$|6|$Н6t8L$$ D$|$Н6tL$|611A<$D$ h(|61D$ ȁ(^_[]4$h$jD$ WVPθWEV(|6|6f|6h(|6 f|6=x6u=x6u#$}h(|6hgdV 1h(|6hfdV yF8t F8uv$=x6u(PhmdVn xX5B3hQ {Z1=x6u$h(|6hgdV2 y i$1G^_ùX$hA $ 뙃=B3tt$ t$ t$ ' QE1HVD$ t$=(|6thPh(|6 ^D$L$016VDt,uVh$-t"uVh$Vh$Vhz$Vh<$h^h̝6hmd5B3& USWV8 $RPh h}6Q?6 x6v|Pt$h$uh lj D$T$1D$ XƉ 11 ‹l$T6 6}69}6hWD$P $;D$#=}6t =}t=}uЉD$$$=$x6tȋ $x6=WEVuT$tf9w6rD$Pftt= x6%4$t$UhD$Cg D$t=VEW=$x6$t=VEW4$t$UVh $f= x6|4$t$UVhs$f=}6$D$PSt$Ut$Vh$)[=x6u $h(x6S(3V 5x6SVI SGSt$VhVWm }6D$ L$D$11t4$h$8^_[]USWV T$ $11F1Ń= x6|Uh$e QPWD$Pt$?9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99= x6tUPhv$d Ɖ ^_[]Ã= x6tUh2$= x6tUhS$dċL$T$tPh(|611@Ph$t"j QP6^ u9@8"t1Hw61Yh$jPh$t"j QP] u?8"t1Hw61Yh$jaSWV։ϋ\$+ x6tItEu x61tGtB}6T669w1}6 1tth(|6QA1@^_[Vh$jL$1=w6T$ PG1ɅɉWV6~( WRPh}6Q膫 69u ^_h$uQVh$jLPQVh$j USWVPӉ΋l$|$uj WV}\ Eu{>"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h`#Vs<t#ƍFh`#P'1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Whh$Wh$a1۹Н6؃^_[]ËL$9/up`|6D$\$A/jPU u$D$ T|6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.WhO$`Н6!Wh$`Н61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh$D$$Th$Sut] #lS'W,PWS, '> uۀ$U-$T14PT'D$XP tpC"uD$TPh~$S$T$끹b$PT'j" $eFMu SQЃ {Sh$@Sh$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h$/$PQh$R~$ $Siu jSV U$ W PhQ$S& Nt/Vhj&Sj  tShn$GM$fw(h$S t*Vhj&S  tSh$L뾋$G(w,h$S t*Vhj&S  tSh$L뾋$G,w0h $SI qt*Vhj&S  tSh.$jL뾋$G0w8hM$S )t*Vhj&SE  tSho$"L뾋$G8w4h$S t*Vhj&S  tSh$K뾋$G4wJwTh$S @s$GT^_[]WV$ Vjh$W~ jWV  ^_5x6t$h(3 Á"=6uW"Ph+$Q? ~5$w$S'66 h$vxVh;$P~I$ $u ~ˍ|$@WV!9t"b&J~PH k$S'1OJH w@$8S' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Phl$Eh{$D~USWV|$t$t$h"VuG Gw4U'h]"Ph"VOG GPSh%"V7GGPSh1"V$GVjjhvp&GXtVjj h>"GXtVjjhI"GXtVjjhN"Vj Rw(hW"VF w,hi"VF w0h|"VF w8h"VxF w4h"VgF wu 1<1A71Au01<  $jj@PD$PuD$ Ph$;C9u<$u403H 03~(3H (3 h(3j _A1^_[]h)$jffUSWV $ $ D$-@1666666$666t$ h:$US c~!P$U' 6˃PtdT]=T+=?1AJ5T+=ӂ6뒹 .T+=6h#n 6b 6D$6T$:@=6lT+=D$ Tnt uBxou D$ 1Ɉ 6hA &V>t6h#`ءT+=$j:WC-6tWutm6S c$ \W6t6t 6ԟ39$ 1ɉL$tVh$P߹ tj/Uu Uh<"h%h$ U7V/DžuVPDž7h$Po Ƌoh#Wt(h"WthK$WpV 1QQ$ 4PU7L$9C9$ $ 9tU葦lj?,$u1QhD$PQV h6hzd@Py tq$ PhedAW_ W譇|$ WD8$9",V'uW[6,$h h 56P Ġ ^_[]h$jƷ$Ph$jVhN$j襷h"h"ʍD$ Ph$ D$ Ph $j誷D$ Ph! $롍D$ PhG $땍L$ Q4`V'hp $USWV։ϋl$j< V豽 U覽 CCCOK G^_[]1hxW'Ph $h38jr-USWVP׉΋tAS W 4$4(VS? Wh΍$Vt$ P4 W É^_[]USWV|$1_h#St$h"SthK$Su\6toU3t[u= 6t .= 6t%6toU3dt [u^_[]USWV$D$|$6#tW3t CÅushe$t$ uD$l%D$ 6t L$ mt L$ ^$D$ D$h' $$ t$h%hV3$0|$D$4$L$hA &Q81G@΍K9|,SP> Ŋt><-u(GD$tj=Vt>FD$ GD$thA &D$PD8u|$1F1B,$֋$$$,$D6tP#t"P$hy$H3 xF1Ë$4h%,3C9uj ;2t2ƅ|$t t$ 4$ tA710h$|$t t$ 4$ ^_[]ÍD$jPV` x!L$ȃtuuhϼ#肯묁tlPj PUhW#= 끉 6utD$P$B7uW$P$ ujSVh$& jD$L$ 66á6á6VPD$ L$ $3QPVb7 Vj >j'USWVt$86ut56h#}06l$\$=6t!u56h $P06USyW7 PhB$!06ttj &/6tu^_[]Ë56PVh $/ j&PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j&USWVu6$Ph%~$|hWV} t Ƅ|D$PVC1ۋD$ !=`= بtLV0h$P5 Džu6h6h$1 Vh$PS DžD$PW蛐Vh $Wh !$ue^_[]Ë$3D$($3L$$ u6Vhh6 t9Ǎ$PWx#$= uVhU!${Vh!$pWh7!$eUEM JRtHPQhr!$ t$t$h!$hh6+6]áp6tjЃj WVP01Gj0hW'Wnz =t6jj\$0^_SWV01GWlmWS-jS"0^_[USWV1x6|6x66661@D$ $1u4DžW$ t7h$Pɬ Ɖl$Pŋ$ tUt$h!$+$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU t,ƍD$Phzd@V t$VzSa 3‰D$H9rHDQtD$=6t*wt$SV  u D$<tQ?1Gj= S貱 GL$G 1ɉO GO6G8=66\$w tUvjtt6jر UM Ft$> F t$/ FD$FGF0wVh!$h3|, rUhy"$45_$ }L$ AL$ 156tyvhp"$|)~ twh%e)?j w(6Í$Ph$^؁^_[]h!$h!$4܋6Ћ$ t9‹-6҉T$։鋔$ t$ t $9|ȉ$mNu\$6t 9Ct,Ph!$3$P>u$ȃt1{ $ t#Qw wwh!$5($ȃt*t&t!Pw wwh!$h3* OtHOKt|6G8=|6 t$w w W C6H 6{ t t 6 6I 6;D$\$96MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P<\$tqx6c8#t;m$hH"$Ph "$h3)5x6.>mS#t,#Pv vvhb"$h3(60$SWV։ϋY Wss ss҃ 6t~j fWss ssԅuA 6^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ轜蝜} PQ40I40<8)<8D@ D@LHLHTPɛTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40/40<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7uVw wbV FwwNVFww:VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuu SCu$u S$C EDȉCDu,u(٘S,C(E@ȉC@u4u0轘S4C0EHȉCHudh$$VŋFNФ6tbSQP Ф6x 6~,=X6tffOfGG@ Չn,~$N()ǃ~$N(=69<$D$hP-6>N,ș)N,)n$F(teh$$V$FNФ6tbSQP Ф6HT$<L=X6tAf=X6t4f.<$ ^_[]66F,)F$N($fOt@ 6븋D$L$t$ QPQPUSWV$$$ $$$(hG{$SV\1j [D$SVWUhPD؃r_|695x6rPSV Pt7=X6tf%#=@t#WQhJ%d Wh"$T^_[]USWVP|$\$s s@=X6tf9uRP6t=6t=06tj:D$1PPPs sQs s6O63C 63K u B3&=X6tf%#=@t#Qh"$胣s s/)SUh"$ 6u =06t:yj h"$6thr$$}B=6uh #$u=46X6t7t;f56D$P6jh"$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=X6tf=X6tGf#@t#Ph#$/SVz.=6t)1=46L L h$$SAh#$$p$l tRQf@ 66 1VW B3L$@D$DD$ t$|$ 46pt95X6tʋ 465X6T$Htt tɉL$LL$QPh'#$=6uh?#$515B3PPPj66  5B3RPjjt:6=6h~$$?D$L$ 6656=6 tYjj=46HX6tt,fI=X6tftfI=X6tfIfHVW516696t-j 6 66 djjQP 66 AQP=X6tf%=@56568,$t$R=|6x6 t# Fjj WSʒ9ݹÉrFND$P9|$P$d닔$hjj RS舒 )ˀ0^N9whr#$訞h#$Ntf56615B3WWWj66 CRP5B3jj_hF#$h#$161P^_[]Ë$d#6 6$tҍt$PtV$lSUQP4$SUfH1G@u5656h8c#SUu.$l#$pth8c#5656SUq5656H=46X6fA=X6fhF#$6h#$hmS#`<jj5656D$DD$O t$\$ VS@@PD$PQVSf@5656tfA=X6tfA$l$p!fHG5656qf@5656SU5SUh#$ t$p$ph#$7  =6j @ USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡؤ6@4 1WjPQWWRS 9=X6fB3 6ffB3=X6twfB3 6ffC3=X6tjfB3B3fC3=,6tB3ȃ=X6t]D$ YfB3 6fB3fB3 6fC3fB3B3fC3=,6tB37D$ G UV=46l$$tApQt=X6tRPA(=X6t1ҋ ؤ6I4-Ф6teQRP Ф6xtt$V/11jWpr =6=X6tf=6fB3ؤ6;x4})}jhB3W0 =6E ؤ6A49rE =X6t<$fGj \$l$u6_=X6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=X6tfUVfXW|$$Wf@t$$W=46HX6tt,fA=X6tftfA=X6tfAfH ^_[]UUSWV$$1Q |6x69;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=46pt$ =X6t ɋ=46X6L$xtt tɋ=465X61L$|1ɅDT t$t RP~56UVRP tE{[|$t}SWR~ljUVSW)SW*~lj_{[ |$t]SW ~ljUVSW_)SW}lj?UVSW5)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV 461ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =X6t SW} ؤ6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =46<$\$T$|$(t$,DpLtL|Dx=X6RS|TtDpؤ6D$0X0vv{RP{VFvv{ RS{VFt|tx|$8{D$T$Rl$$D(D,=X6tFB\pTtؤ6B0FN FNDxD$L|׉L$L$؉D(MU =X6t]RQ{ ؤ6I0VP{U EMhɡؤ6@0 ȃ=X6t3ȃ=X6EhD,t($ؤ6@0MU EhEhD,=46L$ tL$D$D$=ؤ6,$\$ 1QOP\$  t19}#8@#pLp0l$$ Ф6ɋD$taVt$P= Ф6x4ƍ$56pS! ؤ6@0fPt$t$ Ф6x56Sp 6=X6tf؋6fB3ؤ6B09}+^jhB3S< 6ؤ6B0N9rF =46tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL Ф6taPt$t$$ Ф6x=46t$,|$(DxL|DpLt1҉TxT|FN=ؤ6<$09X6QPx)RPnxVF^vvWx )RPFxL$(D,D(D,EM =X6\$QP x ؤ6I0)RPwU EEhhȋ5ؤ6N0 )ȃ=X6t^ȋ5ؤ6T)FN^FV )S\$L$4$*5ؤ6V0)EM Ehh )ЋL$Ev8QS 61Ą^_[]ÉjhB3p $PhW$$k=6th$$.hk$$߻F & ؤ6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(FW ^nFD$hF$D$pFD$lF46pt =X6tɡ46=X6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=X6tf)9F=X6\$tAf)=X6t4f=X6t'fL$=X6fVT$Rt)f~T$JR>>fD>=,6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=6=H6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=6t Vt$t$Ut$h"$$1Ƀȃ^_[]1A=6t1=H6<$\$ HfUSWV $8$4}tE1ɉM4M019 46‹DT 9 X6tRPqM$U(E$f M$E$U( u ^_[]%=uLIؤ6(9‰|ǃ=6t<|u=46tFNFh1 t46tD$hVP* |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =X6t RPp ؤ6I0VQRPv|։D$D$ ЉT$t ؤ6=46Q8k=46L$$tL$D$ =X6t QP1p ؤ6#8t@DQL!!IT u‹$8U t#DT tE=X6t!RPoD t(=X6t1҉EU}@U=}@|$6EM QPQPh$3WWh$$聇h$$'uQ{u u ؤ6y0ƃ=46X6t:tMPWn?UUlCD$T$NQt PWn~V ~V h'$F&L6Ԥ6@ 뛋5ؤ6F8E -46T$$tT$D$ =X6t RPInv0 I)؉$ʉT$t*DT tZ=X6t RPm$8D t6=X6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W6E$8I QPQPh$3UUh$$薅h$$<$<t7ؤ6Ht)$|$-46Cq qƃ=46t0FV=X6|$$tJRPl)RPl4FV =X6|$$t&RPl)RPl)FV )FV h'$"$L6Ԥ6@ USWV|$ \$t|69x6a6 6 ‹-ؤ6t9ˉrux9ˉ\$؉jL$QWPwց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סԤ6t`v0WUL Ԥ6ؤ6pxjV|$(WSx)Љ 66=46jVPSP Ԥ6A^_[]WSht%$Ԥ6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$ؤ6p0vv_ $G ؤ6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPu19rÃ=\6$t$ \$ti=46t,ۉ~A1_t4iT\$F9uۉ~1O ɋW @9uG W5H6萲t$ D$x. ؤ6;Xt|$#=46t JًL B tmt$v vh{'$hWWVt=46t$$B1ɉL 6t$ $$Bt$ B Cؤ6;Xt`R5H6踱T$\$1ۃ=46t%JًT tN=X6t#RP+hBt/=X6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb6L$AI QPQPh$7W]Wh$$h$$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=46t+FV=X6tGRPg+D$RPg1FV =X6t*RPf+D$RPf+D$ډFV +D$ډFV h'$^L6Ԥ6@ 1@$5USWV\$41F~3|$0l$,|!l6 h69|)S9у} ȃ^_[]Éދؤ6K89}=6tOI.A!1‰9)=6l$,|$0t!t$4PWUh$$nؤ6PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=6!$l$|$ T|$0tN# $ND$T$RPWUh$$R ؤ6<$\Ttq!qIVPt$ Sh%$$@l$19=6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh6%$ؤ6t$ShO%$t1Al$,|$0USWVD$,\$( 66փσ56=611 J 6966 66696@D$ 6=ؤ6\$jD$ PL$QT$R oց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =ģ6ȣ6tУ68̣6T$tԣ6‹D$ȉ66أ6WUS5أ65D6贬=T6l$$-6+l$(=46|$`5أ61VV=X6tf%=tjvdv`aVdF`vlvhaVlFht4aTCut4iaTCuG9a=6t< ؤ6(1أ6SS=X6tf%=u1=(6u(x$CS =X6t RP`9Ƹs& ɉ @u ɉ @uG9wt$t$t$5أ65H6襬أ61Ƀ=46 6^_[]PSh%$awUSWVl$|$ؤ6jVUW胭 1ƒ 6666=6-6=6-669أ68#{H1ۃ=46(=У6-ԣ61ģ6̣6ډȣ6t@ģ6 -̣6=ȣ6Wh أ6t^_[]UWh%$Tvh%$Jvأ6t PĄ أ6USWV l$ =461ɅDT =X6t RP^ ؤ6Y0މD$ʃQSRVs wÉD$4t,Ps 1ơ6$6QPt$0t$0$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 6; 6u3P56} =6t-66d 66Q64 ^_[]h&$\tSWV|$t$66QPWV|tH 1P1 t^_[WVh"&$ tV6tR 6~%646o ;56s6PV 56H 166^SWV\$t$s sǃuG=X6tfL$%#=@t#RQh%t s s=6tfh'$66{@t1H1PPQQsHsDs su SW=46t6hh 6W -h9&$葠u7=6{놹 6s sԤ6H 6^_[WV|$t$ WVh?&$ C|695x60WVhH&$=6t7=46pt=X6tPn t 0hG{$'=46pt=X6tPhS{&*=X6tfPhP&$ =6tqPh#1Ƀ=46DT =X6t RP6ZRPhY&$ =46tF(F=X6tjP|tPhd&$^_SWVD$H8=X6t3P PP0p4u'11C9}QBRQp<ڜ P0p4^_[USWV|$_8+t]Cw=46RMT$=X6HRPI9L$0ơؤ6@0 T$D$=46D$0T$T$4=X6t$$t RPMIMt$t$$=X6tȋMD(ؤ6@0T$,‹t$(΃=46X6t+tMVRHuVFt$t$ H7KVRHMQ AD$:MQqD$T$AQ!EL$DT=X6t1ҋ ؤ6q0RP耐 ƋL$ jWSQӃ=46D$ t7~SPt$t$$NjT=X6t RP H|$)~SPt$t$$踦=X6tȋ|$1҉\$$ t/f ؤ6q0RPݏ xËD$L$ L$0|áؤ6@0 T$ʋL$ȃ=46L$0T$D$t!D$4=X6t)PQFGD$ T$8=X6t@ɉL$ D$ '$U]t$(t$0h'$C]VΡؤ6p8ŘV t, ؤ6q0RP ơؤ6p0jv 1^fUSWV0̫6M t$VjWuD$ L$$L$D$Vjau ]966166D$ 6D$h'$VS[V T~Hw2$X'6уE~4FtyP6벃U1AL$XtB=T+=h^#Wuh $W_q6N6?6bo&j 5T+=f6Ph'$6=T+=h($Wh($Wץc($j W66Ph($66~mO$j5T+=B3=mPhP($ A 6 6/6$H6T+=D$  6 666666D$ L$uD$t/= 6t= 6D$thp($D$1ԟ3)hD$=6t 6jj{thp jg=6thp jOh j@ |$D$ D$4CD$=6u PZPUDžu6h($%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$(L$9|ȉD$6h($ GWg K;D$=Ы6D$te^_[] Ph=($jQJ|Ph+$h3< jUSWVP׉΋\$t$USxG M9t 9u^_[]WVh($jIUSWV Ӊ56QW=6t=6t h($X1SW[u=6h($XP6=6u<ؤ6Ph(${XCWt h )$eXh)$XXV=6t>=6t hD)$X=06t hb)$Xh)$X/=6u h)$WX=6u h)$W3=6u h)$W6=6u h *$W<= 6t=6u h,*$WT ؤ6|$Y8֋T$  SP56565656hG*$Wd,$kdыؤ6@DWSQP\D$T$iщډWSUR!jj RPRPt$t$t$t$t$VD$Phi*$$=6 ؤ6+x6 |66 66 6 tQPh*$U =6-ؤ6KC)s, 6-6Ջs4HS8\$ ډD$$+h6$T$l6 $ $ډ Љ 66tRQh*$ =6t8h*$56tvvh*$j 6j |=6t8h*$F56tvvh#+$) 6j ;156565695@6tmj@B ؤ6405\6h QV O 56Vʍ=X6t\6PPҞ5\6z`6=L6t 6j ؤ6y,t+61TtRma 6 ؤ6F;q,r6PLa 6=P6t =L6th*+$SЫ61=@6=6u hZ+$S=L6t h+$SGRtgD$Ph%u1D$t)L$ jQPh%hl%aXt-=6u h+$S ^_[]1USWV6D$45ؤ6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B p6l$9؉|5ؤ6|$0G;~,$LHN4H~KT$މ)1@ p69׋T$9|5ؤ61҉t$L1F. 66669S,SދD$4HxL$HD$81ۋjV ؤ6ׁ\Tډ\$tQ!QЃQ SPh6Eؤ656|$D$Xt1NPSWUʼnFظ|߃\$ <$w4F46<$t LX FuWFsT$ 66$@=X6tfL$fAf|$l$$j C hX 66T$ =6t| $=X6t RP.RPh.$l=6gq$ʋT=X6t RP-WURPVh-$Y($DX=X6tPh.$46h5.$Eh,$frT$ '|$@@u' T$t$SUt$A 6t$D$, F=46=(6$@=X6tffu$@=X6tfft}SU{$@=X6t?f=X6t/ȃ=X6 $ApfAAt$f=X6t $ApfAA $AtfA1ɉ 46 06 ,6 (6l$T\$X46pt4$9 X6t ʡ46 X6$tt4$tʡ46 X61ɉ$dtX$t $D$LPt$衹=46=86t=6u,$$@\=X6tȅSUhO.$C hn.$,p~SUؾ19 X6t1ɉH\H`HdHhHl$f!B=86,$(E\=X6tȅƄ$E\=X6tȋ ؤ6I0H111҉,$L$ D$t ߋ ؤ6Y8Om\=X6t͋ ؤ6#8߉@DYL!!ÊIT u,$\$lD`Td t<=X6t RP*D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9ؤ6H4 D$|$׉D$|$=46t݋AQ=X6t-RPo)!Eh=X6tȋt$|$1҉11 ˉl$$WVRPSUh.$uA=6th.$h4$m|$t;SU蕼ƃ=46D$|t1$=X6t RP(FV6=X6tȉFhܽ$|$jj$$$$SU z $A`Id=X6tEQP<( $plph#(1$D=X6tWUPVh-$  $AhQl D\$C5ؤ6;^,T$$L$ $6 6׃ƃ= 65$6 ؤ69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-6t$| ؋T$(tu3D$1 Kl$@؃,Ut$HG ƋD$9\$(s+l$ Uh,$>jSWUt$@h,$h|-$m=j[sUSWV |$ ow@u Xw VUp D$t|VUh5$w w,6 (6ʃǃ(6=,6|$ |:w wh,$= =6h,$qjG $D$|$tjVU¾ p6<)1CVUh2$D$,p p*46 06ʃǃ06=46 j 9 hp 6tH6 69tDy1Y1 t 9u,66$|$ ,66Q1I1 ы|$ t6$G0W4L$Aڃ]D$ p ph,$J< =6t)h.$1C+6h-$;h,$h1Ct ؃ ^_[]6jpjJfUSWVP$T$1B@B 3 686ؤ6x,11=6t>Q:ؤ6x,$kd1PWSQh.$h3>6ؤ61ۃVU聶tzljl$ t$46pt=X6tʡ46 X61ɉT$HtttȉD$LVUz8tD$PWbu(Cؤ6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$86ŅtTM1ًU1 u3VSh2$w w86HPUMpX86 69tmu1 6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $hX'hm/$F9h#$eh0$ejj聴=46X6f@=X6fh$/$8h#$eeU1hPVPVҜ1BhV/$8h#$'et21VWhVWVW莜1 tah;/$+76h,$du<tf@=X6tf @f=,6tjjxfh<= j5656jRT$1B@BO= -66  $6$Wt>E6+56=6kdPWVQh/$h3-6uF$h/$vv 躑 6A1ڍF$h0$cvv 6ǃ=46F$ X6&jPb1 6I F NQPQPhSt=06F$ 6t%QjPShYD$h/$>6#6QjPShYD$h/$36=6thr$${=61F$6 I1)щN$uh #$b-vv *ǃ=46F$ X6$Wt jPS1҉GW1҉GW }hjD$\P6 =46X6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=46$tD$\=X6tL$Lu$D$PD$PD$XPy6;,$/6$W=`6v`656;4$]|$T{$AhjW -46=X6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=46$|$TtD$\=X6tD$L$|$TtD$\D$PD$PW٧;4$=6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h0$ss QPTh0$(^t~s sqf@fNCKK CQPh8c#ss oOCK =6th/$ss QPCKh8c#QPss fN 6;<$=664~^1ۋ/uu q]]8u9rۋ=6/CK tS  StQP HKX9rjj轄`^_[]6j&ej迗Ph/$/L$D$@, +A,USWV $0 n8$=46ui=(6t`E=X6tȅtNE=X6t$;x6|6s&E=X6tjPo@E$F0N4 utEh%Px)$0 F=X6tȍL$A=,6AAhh%QT. ,6 X6tD$D$L$L$D$hc0$v v薉 E=X6tfM9v%}EPh}0$.0$ho0$4[4/E=X6f)=X6f=X6fEtf=X6t΋$0 AI 1 h30$QP辈 h0$Z$0 F=X6tȉE$o0$PpZEL$fAWQU6( $)fEPUV( =X6tfD$fXWPU' $0 G0W4w wmfH$X6$0 =,6t>}t8hL0$v v贇 h0$Yu EB6F0N411G9 v vGD$@=X6tȍL$A=,6AAhh8c#Q+ X6 ,6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=X6t2f)=X6t%ffD$=X6ffX6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=X6tfPjUF D$fEutEh8c#Ptl$L$Aq $0 JR ωtljh0$RQUW݅l$EMك9v%}EPh0$*1$h0$qWD$$0 T$ 3F0V4=6h1$ڃD$=X6t΋D$p@ =,6X}$0 ~h0$v vڄ Eh0$VJ6B0$$0 1GPVtXD$T$ F0V4=6h1$ ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV# D$fXSPU# E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUU# $EtMw\}.uVV4~0|Juh"1$ } .u8h21$v v% Eh0$ U4$F0V4=X6tȋ |69x6s5hC1$juv v݂hR1$T4$=,6E=X6tȃu}uE=X6tȃtb}u\FN U=X6tʋ4$hY1$jRQPX=X6t}Eh0$T1 X6EtjPgC$0 A4y0l1$$0 t=6t1$=06JR u=X6tPjVRQ菁hR1$cSƋE=X6tjP1Ƀ=X6t fX61ہ@€@t f X6fG64$Crv $0 A4y0AI U=X6tʋ4$h//$jRQP褀hR1$xR6zE=X6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=X6l$\$tȋM=X6t1퍜$UQUPhScSh1$$"Ph1$ %9-6th1$Vl$\$ hR1$zQƃl$\$$0 A4y0| AI KC=,6taEO9tU$0 AI U=X6th1$jRQP%GEh0$Pu $ 6fO4$E  ^_[]ËM PSh1$"ȃ=X6tUSWVT 66,=6t>)"=6kdPWVQh2$h3{6}ww cO W $T$ WGO ƀÄ:1=6t4=P6t+=06t"uGO 1F9ƺw1 tbQPc8uS=6xJ1v6KNj@ $GD$wOG tQPb8u E;-6|E;-6=4$h#2$b"h#$ORv6话11|$D$HNL$D$D$D$$D$D$ D D$TD$D46pt =X6t ɡ46-X6L$Ltt tȉ݉D$PD$PRmu hJ2$!D$TPv6t$t$~tyD$  v6ΜL$QPt4t$t$af@jw wt$t$~t 661JQPFafp69)T^_[]fUSWVT1ۍT$1BO ؤ6x,@=6t;ؤ6p,kd1PVSQhr2$h3p6ؤ6 6<\$11ۃVU衛VUm`$t$l$ 46pt<=X6tϋ 46X61҉|$Ltt<8tϋ 46X61҉|$PdtX 8Džtɋ$L$HQ$X'xtCVU誓tV=6VUh2$^1=46L L tOjh2$s6tuQ1y1 t6 u_VUYdtl=6tHVUh2$<7jh2$$PxyQ 6P8, jh"$D$P C6L$;JWD$ P`646tDŽ$@t$`$L$$8t$ٍ؉$<P4$1Yؤ6ph565ܤ6  =X6t5ܤ656\ܤ61\8 u ǀ\T1F565ؤ6K=x6hh4$$PR5ؤ6|$с\TtV!VЃ~ʊNd t1vhRP5\65H6E(5ܤ65ؤ68W9586Kj5ؤ6RD$L$׉D$t$ t$|$$8D$(9ȋ<T$`|\$`L$(=46T$ tH$p$lB$L$(+L$D$$$-xB$D$$L$(+L$$F,H9D$uxD$ H1f$f$DŽ$X$~1v8$T1҉$$$$t$ v(9r1$ t$ v,9r1$L$ I09r1ɉ$t$tL$ Ix9wȉ‰$\$1ɉHHHHH HH$U $8u$8$t$jPc $U D$Xu$@$t$jPb |$11VW'OHw]$X'$$ـ1@$U u$@ CD$;rr |$t$u:1ɲ$U u$@ $uʋD$(9D$D$$D$`Kp6D$ F8D$11L$|$$˃)ً\$ <;r?D$1C$U u$DBD$@8F9|9‹t$t{w$$U u$D\$ ـ(!jj$ QPVRp6D$ $|$NdD$1ǁ$U $8u$8$$U u$<$ȋPNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$VPVh $bp jgPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj jgUSWVuD6$Ph% $|hWV, t Ƅ|D$PV1ۋD$ !=`= بtLVx0h$P Džu6hL6h$1 Vh$P DžD$PW'Vh $Wh !$ue^_[]Ë$3D$($3L$$ uD6VhhL6Z t9Ǎ$PWx#$= uVhU!${Vh!$pWh7!$eUEM JRh&tHPQhr!$ t$t$h!$hhL6flL6]á̫6tjЃj SWVT01Gj0hX'W =Ы6jjQT0^_SWVT01GWWSQjSQvT0^_[USWV$<6H6=6$XPVI=6u6#$`= t#Vh."oh,$)jV藻 D6R= 6<$8H6=6t h|6$Vh6$\lH61@666`61I L6 H6X66 p6 l6|6 US% ƣ\6US % ǣؤ6US$ ã6UP$ ܤ6ZRJB$V$SD 6tdu`jV`  6JR0Y" PVhV6$R0A" PVhi6$*k 1Ĥ^_[]áD6u"$T$TQRjPVDt|$\= 6=61Ae]Džt<$ؤ6\Tu nt1ؤ6!=6H6h7$jV7 H66 H6Vh6$j1=6=6=6$L$ PQj5D6SCuSh>$d$$8ffs1$8j h<$V VSh%?$ BVh#|-u h7$*lؤ6 h P5\6^ 565\62=X6t\6PP"C5\6,`61=6tؤ6Ph)8$hؤ6tZT6u6t2=H6u!=6Z8$t$Ph58$41OB 6uh_8$ؤ68< l6h6B,x6|6J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ 466u@,$\$D$=6h8$?,$\$`L$(l$85\6F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ 6|$T$D$DSh>$h8$"eؤ61XǀPh P5\6 565\6S/95X6t\6PP\@5\6f`6 466 ؤ6=6th8$ ShP?$h8$"ؤ6PP.=ؤ61@L1XP\hhPH h6W76h 5ؤ65\6q 565\6-.95X6t\6PP6?5\6@`6ؤ6 Ph9$uh9&$!udؤ6  h P5\6 565\6-=X6t\6PP>5\6`6ؤ6h29$hW9$ udؤ6ǀh P5\6C 565\6,=X6t\6PP>5\6`6ؤ6@ ؤ6HHщ8<=6thV@$m=6uh0$u_h 5ؤ65\6Y 565\6&=X6t\6PP75\6'`66ؤ6D@RL҉111C QPh:$[ ؤ6HLщ@D=6thV@$芋=6uh0$h 5ؤ65\6r 565\6.%=X6t\6PP665\6@`66*HHPLщ8<҉@D1ۉ,6 466ؤ61Ƀ,=6h:$1L$ ؤ6L9| 9Ph9$ؤ6=6thV@$$=6uhW9$Ih 5ؤ65\6  565\6#=X6t\6PP45\6`66@h:$L$>(6ؤ6ǀ,04ǀ(<HHPLщ8<҉@Dh P5\6A 565\6"=X6t\6PP45\6`66 466G?ؤ6L-=6th:$:h;$7$6ؤ6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5\6 565\6!=X6t\6PP25\6`66=6t}=6uth 5ؤ65\6v 565\62!=X6t\6PP:2ؤ6ph5\656. hd65H6=ؤ6Vh LVjP'; G011D$)9|ËLG8 $HLOd t1SRPV5D66t0|$u)hh;$h,$s1AL$=T6tLSVV36 ؤ6A8$HLId t1SRPV5H6U=X6t SVV5 =ؤ6G0ŋ $A9l6 h6ʃƃVh` p6VjP9 jw,u6y9 |6x669؃s6É66C 6UPƣ6US6 Vh 6Fؤ6 $06=6 61Ƹ1ҽhWV5Ȥ65D6|56=665Ȥ6=LBALtl=6Hh<$Xh0$11IPPQQPV7Ȥ6f@5Ȥ6+6 Ȥ6fA̤6FȃtvFjPh<$ =6th.$I=6uh4$nt1FȤ6f@5Ȥ65 Ȥ6fA̤6Ff=rmh<$=6th_@$ɂ=6uh=$t0fFȤ6f@5Ȥ6,5 Ȥ6fA̤6Fffuzh=$=6thV@$O=6uh0$tt=11IPPQQPV6Ȥ6f@5Ȥ64 Ȥ6fA̤61Ff9D> <:$ uh'>$=X6t hF>$=T6t\6PP'h 5\65ؤ6 =X6t5ؤ65\6& ؤ6\=8 u86ǁ\TT1=T 46U-ؤ6Eh= |]>$1^_[]ÉD$<$ 6D$ t$΋E4Md1C6QPVt$-"L6H6P6 =6h65ؤ6=T6u=6u =6t_h 5ؤ65\6 565\6=X6t\6PP%5\6`66<6M,I\Ttu!MȃMt$VPhd6+ 1=x6=T6t6PP$ؤ6ph565ܤ6 =X6t5ܤ656$ܤ6\8 u ǀ\T565ܤ65ؤ6o=6tVh@@$Lyؤ6{hr;ߋ-ܤ6ދM9t+ؤ6QPRhw>$I9rҋ $>$1Ch=$h=$jXD$ 86 6t(\TtTu 88 \=6t(\8 t 8uTT\ËD$L$=46P;QP ;Q P;QP;QP,;Q,P0;Q0P4;Q4P8;Q8PH;QHu|PL;QLutPP;QPulPT;QTudP`;Q`u\Pd;QduTPh;QhuLPt;QtuDPx;Qxu<;u.;u ;u\1;\1@À L~.PQWV|$t$ FGF G FXGXF$^fVD$=X6tfs r.1=6t&=X6tfPhl@$C1F^WV|$ =6t h@$4h,$Wj Bt= 6,=H6= 6u u= 6tWh@$0C1@ Wh0#Ch(3 ԥ3H ԥ3~Х3H Х30hХ3; t ԥ3I ԥ3~Х3PХ3hХ3 ԥ3 t ܥ3 t^mNt"YAyt n+j iA yWh@$'BP61^_USWV 1Ф6Ԥ6ؤ6$X0Shl661N56566hh-Ȥ6̤65656Ĥ66 6611ƃj$ShfÅ…t|txt$FD$61_G6yG 1HG GG9l$td$X0j$ShÅEtu56rPVQº D>/|)Ot$L$6ܭ62ܭ6$!D$h8Jܭ6$ D$tB?JL$h)PRQTSWVD$t$ |695x6r==6 ؤ6jSPV8)޹C394v t^_[PVhHB$CWV|$ wu$Y'1XD$@uPw w Ph$*=6thC$r^h$B$t ^_Ph,B$趽6USWV$\TM@$ 5uh`dh`VP =6t h'C$]=T61ۃL뀃=X6t\,L$UPQ DPPz$\, X6L$L$UPQ |$u $PP@1LDffLD@9u=X6t8PP\X6L$UQPj t"PP\L$UQPD  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]hkB$(USWV\$t$=6!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]hB$VD$ L$56#p9tыR9u @^USWVt$|$VW/ؤ6!t7^Fu+11 33 1u{ 6tqt$0|$,\$(l$$T$6t9PtjRQ 6(Xxp L$ 6t9HtjQ56 6(Xxp ^_[]WV ؤ61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$['$1Aȋ$sY9UY'<`Y'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$ Y'4  <Qh}C$haC$脹D$P`wZL$ D$$0Y'1B(ɀ!1RhC$haC$SD$H`wPD$T$ $@Y'1C%   [QhC$haC$衸SD$H`wND$T$ $PY'1C%  [QhC$haC$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW!ƅuWh"j{$$<$4D$Phd@U tj1OLVhedAU! F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hG[%t$!" 1 Sh"Uu CPhQ"U C Ph"U CPh!"U CPh5"U CK,C,QhH"U C0Ph]"U $@D$t P;\ 1-Uhzd@$<W t1 VhedAW hjU D$ P$4sD$, 9L$ L$9u0$S11: 8tx$0h"ؠb$11҉ $ƅ*ŰP j PU4 ^_[]$0h"jUSWV81ۍD$4ShPSu謺 1NtAljSPSWuWr uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS_$1NHD$ D$(%=@= j/Sxr)ك$0PSQhC$hR D$jP…ǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS݃1@$D$hh STp ƅ%D$ PVD$3D$ 3|$$  D$uH$0PSL&$8$P$TRPV Vp D$4@D$1$VhC$jSJVjSo ƅxc1GD$ PhFV  8u;VWp WhC$jSjjS9o Gy xD$t PE<$t t$rA1Ox Vo e^_[]D$(%= tn=@u$0ShC$hP^S5AƉ\$1@$D$:\$ D$ PSԁB$D$jSOn }tSJtN$PhF|@V x4D$t P:U$$JhF Vx$USWVP1hUU= ƉRP)9-X6t1@fCM+PUUSF ؤ6;A0u $ytWVC^_[]Ë\$-65X6SUqRPX$@ `ؤ6ؔؐh P5\6O 565\6 =X6t\6PP5\6`6[USWVt$(~OholX6tUQՉ 1=46L$$t| tWV۔Ɖt$$H$áؤ6@05X6QPWVsUC cMhml=X6tUQxՋt$( }ؤ6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=X6tȋ|$ؤ61ɉShD$=6th~$$@Hh?#$lt$" ؤ6QP#T$1RQQD$P1Aáؤ6;X0t$~~1Ƀ=46T$DT =X6|$t RPL$ pL$QSRP趛ǍP6$|$1D$D$t1)ÉعF@jPPD`r9w<$r$l$T1C @<$9uG<$;|$}ؤ6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡؤ6@0)ȃ`T$1ۡ6ـ#h(E$b=6thV@$Eh0$ ع`֋,$L$t1ɉȉD$ օt$ tH ؤ6i0T$,RQUt$> ؤ6;A0l$,} $L$l$l$,ؤ6@0D$Mt$ |1TT1PD$T$ ʃ=X6t RPL$(ωQM D$H 9tet$C9\$t$$h@E$ 64$F4$;t$SD$`160^_[]ËL$ ʋ ؤ6f9u ShD$褤D$`,t$$h E$lj  ؤ6PhD$CUSWVT$L$D$0(D$ X=X6tSUڋʼnӉ OD$$ؤ6@09ʼn} t$t$5D$PSUt$< ؤ6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5X6t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP越$<$G L$;L$t9ta щʼn$;D$t`1hE$辢^_[]USWV 6$ؤ6x0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRŕ 6T$4$1B srl$,$ ȈU1wX=X6t 6!9GX=X6tȋL$,1Ph F$蚡 6L$ $  hE$y=6thV@$@h0$t$D$OPWTP1GTGP^_[]61USWV|$,5$t5$61@$ؤ6sll$ 6t6 L$  ƍD$1PQQVK9 ؤ6;A0-T$zu D$`1]l$z$Ń1EGpD$hB D$ Pt$ u&xMt(T$hB D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh[E$џ=6thhF$?hE$Et3s ss3st$Vn[E;,$u6G%t$6#Ph E$0jUSWV0\$T|$HOX=X6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGX6҉L$D$td$PQlÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ֠C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;hH$K2'hH$huH$h hG$PhTH$O4$V0VhG$hG$h hG$hG$hWVt$ F,t@6th I$1F,P诟1~,>d9~8uv0葟^_h*H$hAH$h hG$D$x,u@Pt P[ShTG$hBG$h hG$WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_hH$hH$h, hG$wh*H$hH$h2 USWVEH1Bx,T$1hM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS!e^_[]hUG$hmG$hF hG$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hH$hH$hK hG$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hUG$hG$h` hG$hG$ha hG$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hUG$hG$hq hG$hG$hs hG$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hH$hH$h~ hG$nfUSWV\$$|$ l$t$6t5H6SWUh$I$|USWV5H6 1^_[]USWV\$$|$ l$t$6t5D6SWUhUI$0USWV5D61^_[]V= 6thI$Œ2j56HtahI$腌h,$+tS6xL~61 6 s"@Pt4hI$ 66F;pL|^56vj6t'x,tP6P6á6t x,tt$t$t$t$P1WVt$|$ VW=46dtX=X6ts,ؤ6`uau33 u1@1^_WV 6t1 6 ؤ61!`u/aʀs2hlpx1PhJ$ԊPh=J$h,$gJh"J$蹊ؤ6 ǀdƀah P5\6 565\6=X6t\6PP5\6Ѱ`6ؤ6!1111QWRPjh6hhYJ$h,$艶lh"J$ۉؤ6 ǀdh P5\6, 565\6=X6t\6PP5\6`6 ؤ6dPs+aʀu Ph=J$PhJ$h,$蟵h{J$ؤ6ǀdƀah P5\6E 565\6=X6t\6PP 5\6`6^_jUSWV1L$ AL$HAL$@AL$<L$  l'L$A l'Al'Al']u }hJ$SVЀ ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uh['jBƉe^_[]Ãu95ԟ3ujhl'D$PZ u1PPD$Pju95ԟ3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQFyRPt$8t$@t$8t$@WT4u2hkK$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Ph#hVnD$@w ww7VPhK$S  1hWK$+hK$W fUSWV1L$(AL$$t$@L$ D$ }] h/L$WS| aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9ԟ3u~]#D1غ$Phzd@ tN|$$tOh['jt$ _t$@S1Oe^_[]h['j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SbljPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALhR$S$qhS$h(S$USWVP\$|$tus$" $?"$jjtQ1@PVSjPt$8t$8W E1u>4$hU$W VpShHU$W4$hcU$W 1H^_[]UWV} uOʃT+=|RQPhJS$VUJPR`x& $T$W1ٹ|$5T+=hfS$ 5T+=h7 #V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhl'Vs5 1OujV5T+=qMuW?,VQ>~IhvS$Qp1$VQ7 t1PhS$Q= 1O^_SWVP|$1N?u\j S5T+= 8u1u/|$ʸ8u 5T+=h7 #W ^_[WV|$1N?t5T+=@\1t^_h.U$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5T+=t у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5T+=]xL$T$$$jST$ RL$Q tXS?$$ىډWT$$jD$ PST$R t)t$h@V$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jhl't$1$ tjVt$1$ jQV$Ѓ $V I iTh j$U$  V tZs0whS$V1t^_[]1;BB ,Fjhl'P0 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0hS$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1PhS$Q= 1HUSWVt$|$ t)l$\$$jWUS[ tWUShS$1hS$VD*l$(\$$jWUS( tWUSh1T$V1H^_[]Ã|jWUSO11USWV\$1s3hA &5T+=) t^1W`'(tuWheT$t$ 1N`'`' ChA &j) Džu^_[]WV|$ `'`'WhT$u^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQRL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh_$P%1D$Bh_$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh_$u51fUSWVPM(,|$8O] D$1h_$uS. sujsWVVuutqD$9ԟ31t$r> E+u(ljށD$D$Mj@$PVw tPJmL$9wȉD$WMj@$PVw tPmL$9wȉD$u|$D$ ?L$>G CVhc$`E$c$PSw71P E$wW$PSw w1P \$WSTitShVb$"Vhc$hS WS$itShc$F0N4 t%$QPhRDPhc$Phb$袏V,hb$臏N1v6v w 03H 03~(3H (3 h(3j Fw*F 8Ph#hV Vhvb$ ^_[]USWVw!Ӌ$ $$i'h/c$Qhc$n $h6c$蜎$1 Gth6c$yhc$j$G oω13$ @uhc$)hFc$hUc$8t$W:hdc$hrc$hc$ύtff8t_r8$jmUj$WѢhM$萍ŀ/"hc$gl$Whc$c$t#PQh% ,$$hM$,$ $1$A AAt$Qh#hVVh@c$蝌GWh#hUvUhAc$tƍD$9t$9t Uu)^_[]ÉŅu1USWVDt$XL$ $ΉT$ʉT$ ы\$\ك D$VD$dL$`DD$"tD$c$HD$D$t$|$ j@u%$jhWVYP$c$tډ 4$ut$tƋ$SVt$j D$4PԉƉ|$,$D$`l$|$9\$\)ǍD$$PW葖$c$>|$tD> 1@D$,$t$|$@u  jhWVƉE ك@T$dt$`wQj h#|$Wt$PV蹽 x'D$`D$t$ \$\,$c$t$ tn"tc$Vt$ P|$pWl$pU襈l$9~?r1D$Db$t=b$Vt$ L$( PȉD$D$D^_[]WVtfy8tH8|$jmWj$QÞh#c$jb=ƉjWP t VjC=$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj h#UPjS9 yD$4$T$dWRVhd$跈;tShB$褈j 躇P^_[]fUSWVDt$`l$\\$XT$1 l'A l'Al'Al'B0d$` hd$VU k)Hw]r$uStJPSTu7HsutPD$PSH uhLi'jXD^_[]1Hu߅tjhl'D$P t9-ԟ3uPhOVD$PS觷벃luhO{&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh e$SW a~bt)iuRt7D$PV""uUt$D$PV螺tD$PV蟳uh`i'j<e^_[]ÃluhO{&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=ԟ3d1t$t$PPt$VqUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ A]tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]Ë l'D$ l'D$l'D$l'$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$h`l'D$l'D$ l'D$l'D$l'$l' l'!l'"l'#l'PQRVUt$t$t$$t$,t$4l'he$j@\$HSX8(l'$l'Sփ UT^_[]WV`|$ (l'$l'Whe$ku^_USWVL$ l$t$T$<~i'__^_f^1ۊD CutRQU4ňi'8 ^_[]USWV|$$t  h@hh$ ƻSUVe  9)uV T$@fT$D$,$L$\$ $? 04€S؉΃9Ӻiɀ8F8@,$fL$fT$1t$ 1ۉt$t$(.fNfVF^ D$ F D$fF1Ihg$W6hg$W hg$W2SPh h$W V^ 1H^_[]USWVL|$`\$hl$dT$1 1ɉB0mh$D$`$0L$hzh$SU HwsPVt$hQ u|tLt/D$P5T+=L$uSh$l'j6TTu=9-ԟ3u5Whl^Vt$lV誯u(|$t)Wh^SV軱h$l'jL^_[]1Vt$|$u>L$ At$H 6H 6@6 6h616F6F6F6F^Vt$|$uD$ h606FD6F@6F<6F8^fUSWV$$${#hJ"WV ou-T+=95ԟ3zv 1O$Qhh$D$PQ! $~ƋFHt$ $8l'v ^ hSh$&PD$0) xþ1${u Whd$P Ph#VW$ CPhi$V<$ CPhi$V!$ uCPh&i$V$ ZCPhb{&V# ?CPh5i$V# $CPh>i$V#  CPhIi$V# CPhVi$V# C Phdi$Vd# C Phsi$VI# CPhi$V.# <$u $lVt$* WGU $ɿt$ D$tQhh$P; D$PhM$t$ rp~ s whi$P" fG8Ph#h\$SfShi$Vc% 4GPZPhOK$V Vhh$ $Fs D$$$Fo~ 1Cs OƉShd$V )Wh#hD$PD$Phb{&V$ Wh#hD$PaD$Phi$VZ$ wwhn%V# wwhW%Vr# w$w h)#VV# l(jm$Pj$W$t$Ph$V# ,Vt$ C$$L$ AA H94$hi$t$  t$hh$t$ t$ v8t$ t$ư h{#U(Rh5b$U|PVN(3tkSO`hXl'j<V[ hi$$@1ORt$6 1O4$( 6h(3VV1*UhM$$衔 Vat$ ^_[]ÅtVʯ hh$hcj$h hi$hi$hhi$hi$hhh$XfUSWV]} {#D$D$ hj$SW4 iu5T+=tFumD$ D$9=ԟ3uUj]$,(MǃD$T$ЃD$,jS腺t%D$t6hj$hll'j葞jSQ D$ tjS9tD$t hX]$w@h{#VOj$tQK "hh$Ps )j$PZW hh$VTs hi$D$ P:s jhPW D$0PhOK$t$ D$0$L$ 11t$ L$ D$Phi$t$| bD$\Pt$ tpt$hj$SF 1O1PV6 0h'j$hHj$SV hjj$St$ ֋D$+D$ L$,D$D$@L$$L$i$S} `$PhIi$S\ ?$PhVi$Sk $Phdi$SJ >u$L$4fL$fB$Phsi$S  $Phi$S t$(ī Åt$( $fǀU1PPPEl9!ƒ[u$t$ ;$4t$8N D$t$6 fËt$01 |$lD$Phb{&S D$lPt$SD$Phi$S D$|Pt$$Phn%S  `$PhW%S B$Ph)#S $D$Ph$S& tj$$Pt$ 菄 D$DPhd$S9 D$D9M$ $ȃhL$pQP( t$ҩ Åt$ U$61QQP}7!ƒ~t$ M$$VP 9U]$|$$D$jRP7!ƒ=M$$VP踺 9E$1SP|$WP GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$%ghl$gL$(D$, t )|1hl$fWh>%f$;|$tv vSj e6D$1Pg@ ^_[]h,l$hl$ h~$hnG&j= USWV $Shm'U  Ǿn'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHTD3qL1ATAPAXkiA\l$A`i Adl$Ah!i All$Ap^xQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph5#V |$V V ̹(C 1Љًй(L$I$1 sD$PΜD$D$ t2t$ ^ {uWv=u{u C $ VhAl$P`l$ yT_31w) 4PjQC VSD$P D$PhWn$_$\$Gt@GS1RRhVQP#'thh#V Vhdn$_jwhrn$h\$ SShl$_\$tw wjLj ^?D$1P^_[]hDn$hl$h~$j USWVD$X$\$l$@EM}M UMUMT$ U M$U(M,T$0U0M4}8E<@E@MD1҉UHULUPUTEXi@E\n$E`iEdn$Eh!iEln$UpQRPA 1USVP^_[]ËL$1B L$SWV։ωhjSA jwS G PKSHK@ CjDt%Sh'iPg' t#t$Đ^_[hn$hm$hn$jv fUSWV l$4UttQ"DGU@Ë|$\$uoh)o$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hEo$ MHtU4uL9rRQP{ t$|$t%u@uhVQ$ tIA81tSul|$tDEM9rQWP* u@u`V $ u@yu@u`V# teEptUt$8ЃtEu8uXV# t, ^_[]hn$hm$Ahn$hl$5hn$hn$)u\u\h[o$udSh o$j wlh$j fUSWVt$S 1tvt$SU t[St tCPu_ Vt$W tPUWX uW Sq 1Sd WS ^_[]USWVu]Pho$S^ t$f1j?1Nt}ǍD$ PhH$S td\$ t\hjD$PE< jS\$S5 ShiW6" t$E L$Uf jQho$P je^_[]PPhH$t$ u1$YVPt$ t$t$V tPhH$V u1$^USWVt$t$T t Nj\$ Po 9v!?? ?1N*Ƌl$Wo VPUR )SjU"; ^_[]USWVt$t$wT t?Nj\$ Pdo 9s9Ƌl$Wo VPU )SjU: |> o>?1N^_[]UPh F&uf t$5>1H]USWV@uPhbo$V+ ] ho$VS tPn |$ P\$$ShiV\@ |$ jS m Pho$u U V ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPl t!Pho$S-U V袍 1He^_[]h9%ho$hhko$6WV|$$ho$WR t;Pm u1Vm jPV' VhiWQ? t^_ho$ho$jVhko$6ho$j V6hD3V V Ȯ6hV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh"p$hVy>tVhXp$TV+FߋD$t$j7QPh"p$hV4>tVhmp$QTV+F߁^UVuPhuw$Vz t3$L$ AQhiV= u h|w$ 1e^]h9%hpw$hhq$4UVuPhw$V t3$L$ AQhiVe= u hw$1e^]h9%hw$hhq$4UWV}W#ƉPh$W tZt4$P<tW@PVi tGPh?w$u R t>V1e^_]h9%hw$hhq$u3h(w$hw$hw$ hw$hw$ja h[w$t$sO tPh?w$t$Q Hh|b&h:w$hhq$ 3WVPt$|$D$PVW tKD$tUhn$W O tPhn$V8Q H^_h|b&hGw$hhq$2hGw$hn$j ho$je SWV$hDs$SN t]Pi GAsdW*t^WPhDs$StNpxPhiS3; u?Vn181HĐ^_[h0x$hEx$h^x$j hs$j USWV 1CCj7Shxi Pm uhv$?,$P^uhv$#Ɖl$D$Shxi W, u hv$jX $L$9~D$~*1t j OSh$VPG;|$|j bOVZj_GUSWVHy'D$@y'D$<|y'D$85X6u#D$1D$11D$=\6D$(Pj%u hv$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=\6u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$Pu h~$j t$ D$D$t$$1|$\$F =I3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ u Whs$j: P@D$L$AËD$L$AËD$L$AËD$L$AËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$H@I3 I31SV\$ ShI35uCЃ r"CrCr /01H^[hI3H?r / ؈I31ыL$t 61ÍAЃ r)Aw AwÉ//1HUSWV1t$ D$hVPE+ I3x6t8u^6ǁ666 6$6(6,6064686<6@6D6@whI3R&uh*v$0hI39&uhMv$htI3 &u hev$j $5I3tvhD3%61N6O6P6H3ttI3$hI3$U ƃV B~>CNP6F v/FwD$,p'U6Au"hq$Q$o'Q6xu>Wu4D$P1VhVVj V5T+=  \69t$:*ƀ6l `C LvmsI3H3u$F3S6T6rR6W6D$P1VhVVj V5T+=  X69t$taYN6>O6OV6CatTl5$F3+wtzH39tI3 F3$ÿE3؉$H3ԟ3 T6$u =W6uB=&6=O6=N6u|t =W6u =6uftu^W6uS$ttH)ŋ$L$ T$ RQL$QWPU%u; u&h"hq$,5T+=he&j. t$PD$P & u hq$D$t,DtVPyDžuh"hq$JW WtS)uh"hm$Wuh"hl$I3t H9t@h"hq$$@ t%VWЃ$Wj9hLr$h"h*hq$4#USWV;(: uhux$hq$j ƸI3jmP##t#y$jLI3Pt)y$USWh{x$h3DI3t VSm##y$u#WWWWWQWh/y$h3YD$V`y j8V I31tT$q9t Iu^WVΉhjW$ D$Phw$VT tZhK#%V2> tQPUY L$PyRPQ WhiV* u hw$Ĕ^_h|b&hw$hhq$!WV ht$Q= t;PX  u1WX j PW4 Whui V^* t ^_hv$h~v$hihq$!hv$j" hWs$ho1ÃD$ 1ɉJJJ JJ BRhiP) t1hs$j $1ɉJJRhiP) u 1Đhs$j QhI3OUSWV΅t R9 7 7 0($D$Pbw!\$D$1t$$tsVPsD$tVP3VhH$W trC=Q6D$uCt\=R6uCuM=V6uCt>=U6uLhj$V$" VhiWn( t!$uۋt$$4u=T6t ~ j u=h(3s赮Wt& I3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhs$h$V VUhot$= jl$U$V Vhit$ t$,$t!Pht$D=Vh|t$T,$jt$V Vh~it$ t$tPht$<j <ꍄ$P$$ j:QPht$h$Pe$t'$Uh4u$v<UE}uj:$$ht$h$P $t'$UhFu$<UrE}u-I34$tVWUmuj|$W$VT $$ DŽ$@Vhit$V8 u$ hSu$;1@Pl$U%jWl$0U 1@D$81D$ WhiV tD$Ĕ^_ÐSWV$h:=%V]2 u6h{$VK2 u$hz$V92 uh|$V'2 tDd6 `6=h6!lj=d6hjS {Sh7iV t Đ^_[hz$j覵 Vt$V˭Ph$4tV<tPhz$4t$V}t%L$ PQh%v4 V]A &uߋD$=rPhz$H4^USWV$WW1ɃtQÉ1 jVUc Uh8i(Sd D$ sjPQƉD$$Uh8i(S' :t$"Ph?{$t3h%t$D$;D$t(h;$L3h%t$ ej)Q2j G2\$#|$h|$31A8{'9xu H uhl&2t$(hjV> Vhi$ St$<\$8h|$2z$y'Qt8u 9A uVh|$K2 Vh{$=1#X4h#h%2 j 21jmtz D$ ~[11ۋ!9uIuUxPhK{$1ha{$1hj{$4j 0D$ 1AC9|M rVļ^_[]P`h"l$$h{$hm$h"h2{$ h{$h{$j Vjmul6hVV2^hu{$jб h3jjHh|$UVuU OPh{$V$ t!#d6 $ d61e^]h9%h{$hh{$CUSWV(ӉQtoh|$UN- td6H1 Rh8i(U u j8uIjh|$S( t)D$d6t(^_[]h"l$Vh@|$j舰 h-|$h|$h2{$j蠰 SWVt$T$;h:=%V, t\Ƌd6PG VG PWt+Ɖ߁PWt2 Éd611H^_[h%hR|$hh{$h[|$WV֋|$ Q軧VWPhc|$j詯 WVPt$T$th{$V+ tkPF VF PW8t>ƉPV5d6p ǣ`6V1u d6$hU$Z1H^_h%h{|$hh{$!WVPt$T$hz$V4+ tbPUF VF PW萸tIƉPV5d6ȩ ǣh6V1u! d6$hU$1H^_USWVt$T$1h|$V* thƋ-d6PE VyE PWt6ƉPWGt>Vx ݉-d611H^_[]h%h|$h2h{$ hO$fSWV|$ tA1H>t$|$\$jN PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VC tE$$PwCt/$F ~G F1k ^ 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1W USWVuD$ tV} ]CtP7' tEC tP7' u/D$ Ph F&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V4t|$,$hA &W.D$ &tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$ORD$4D$4D$ PD$8Pt$ t$ ;ÅuD$ xO1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP? t9t1ۉD$=r_"11HD$$P&|$1OL$L$D$L$T$PQRh|$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P³NjD$fVSP sD$ t P4$W= W<4$uM S]s {te|$t^t$Vt$t_@PW= WtNVsE0% ߉Vu] ۉt3EF ^C F1Vt$h&}$h}$h&}$hw$ h&}$hw$jŦ WVt$tVEr 1H^_V& t3t$L$|$ Pwt΋D$F ~G F1  USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u' <$t@1@> .1-t P[ 1GG GGQ 1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7U t+{0t>-uUsjt>VsZt)uh  [ 1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1${'4v6 !6 PC  v6 tMtk $t$ 4$UQ$t^hJ$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh$j= 1Hx^_[]h.$h$j WV0t$<|$jWh$V萴t8W t7HfJBRhiV t!10^_h$h$Wh$jo h$j蓌 SWV6hK3VS6hK3W@VgW^6hV36hWȴ6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW* Whi$ U $!h$m $HQPۍ\$4|$fGWhiU t$$f|$*u$=O6t P fD$(WhiU t$„$f|$*ū$=O6t P |$fG WhiU t2D$*=) Phׄ$ =O6t h߄${ fD$(IWhiU> t2D$*=) Ph$F =O6t h$. 1Shi8U |$Dh$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh9$ҙ uVh$`11t j,nDLxPtT h9$*v<u hC$ j "$PhiU tDh$$t$h $ hv#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR Ph'$;$=tPh1$j 4$=tPh$^_[]Ph~$jz h3jhh:$cÃD$1ɉJJ JJ fBRhiPm t1h$jJ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h$j USWV,$@$PhiV tr$A jjj"b xgljj2 xi$-hSWaT xB$/uE$0uf$Ciu.h$蟂1H h5$节hO$~WEU 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$h߼%h$h$hk$h$h$QL$4Qh$(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q д6t д6EѴ6tIAtcAtCAtPA tSA@tBAyAAT$hд6UWt$PVt$D$VPRRh$,l$ }"E!Ê<)\<$ }'=O6`Cs|$[VPWl$Ph$h0$#<*<0<2=O6<$$<t$sQh$We#1L;#y$QRPh\#"GA &9u<]K%C=Ph$h$=O6S<$CPhT$KPhY$K s k t?L$D$F`$PWh%j N &܋L$D$(Mu} L$D$D$Fe$PtPtPu$v$ $ #QPh% N &D$ŋL$D$(ȉ</=O6%<C<$T}'9$=O6CPh$=O6CKSRQPh$h9$1C~@sFNuQPhM$ IRQPhC$Muj>l$ L=O6?CPh$(sh+$h$=O6<$CPhT$lKPhY$VCk tAt$D$x`$\PVh%" O &܋D$t$)E}twt$D$pe$ttu$v$ $ #QPh% N &D$<t$)ƃl$ rPhj$hj>~<$€$$@}' $rQ=PuJC<u;h!$h$=O6yCKQPh$ ]=O6Pȹ&$6<"<$)$ .$D$N$V$^$f$p$u$~$$$h!$h$=O6<$CPhҁ$1D3 #t $T3 ׃l3 URWPQ'h$uj>l$ <$$CPCHÃ)gj ~EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h $hi$j9| WVD$(1www ww7fWfGfGwWhiQ6 uh^$kx1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ։ ;l$D$tD...P;^_[]Wh,$Q觉 1<$tɍGrD$X1.Ph:#SH} E;,$sGwUSWV։ϋ\$Qh$iW)Ǎ 9~)j^_[]ø wā'ø #øSw܁'ø #VPt$ D$Ph$VO tD$P^h9%h$hh$(VPt$ D$PhÄ$V tD$P^h9%h$hh$WVt$(|$WhiV tgD$Ph>$V蚖 t7D$D$WhiV 1uhH$u1H^_h9%h9$hh$Sh)$jWy fUSWV8 y h$uh%^ y h$lujh1$M t\AzL$jQP% D$tPh$ujh1$  DM31 VPh  VPUSWQRPh`$1EVRQUhGBVWhR. 1H\$(C CCVWPPUPP P P PPPPS8VSjD |$www wwVWj VWj VF SF WF D$ @ )T$VVQRWPت1I9u 8tމ56 DM3tщ1@8^_[]h1$Ssj jj h$ u8$jV t $jh$h$Vh"h;% j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjPکut$Vh$< 1t$HFFF FF1G>\$SVju l$ UVWf .wƅZDM31OjUjr" t:9uB$=h$jVC  8uh DM39tttn1VSj VD$$Pj DM3vh$@jjj! 1VSj VU6h$1=DM3u$=|$ u'1VSjK VWj? `^_[]Ét҃t̓ u1Ht$8F FFVvA Ph5$u1$$WV賊 t1$D$8x xx8WPVDA "{jh>$hI#5 ;%SW&r Wh$j3VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á6H 6t$Vt$V辩Ph$ij"3ViDM3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjv GXWV1N=6tED$@ L$1҉RRQWjP,t4$ hc$^_VQB jh'@ jVs@ tPit^Vh$>jFVhЇ$)j1PD$L$ $QPj蔨 eXPD$L$ $QPju Fj1XÐUSWV$$D$D$D$,1H$11D$hG$WS6y f~/P w`1A$'5T+= D$u[FtR=5T+=D$,D$낃gT+=8#u(@j L$ QPn $D$8LT+=PNu@$)T+=8#u)@j L$ QPm D$D$8T+=L$QP j D$ P5T+=m D$D$8c1Fj D$ P5T+=Im $D$85T+=hf$8ԟ3<=6u-6~q561ۋtVPuJVh$FtPh!$FtPh5$j -6C 9|?,u)É\$(k <D$jX D$PK Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u 8tz`Xt$76u 6-6CPV:t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPX jl |$tt$ VUWV  UW= j8C|$$8D$@PWNtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW t!t$ VUW輀 #|$$tS9u$UW = RW> $D$utSPW> uWh$ph1ļ^_[]Ë 3DQut@^hG%V|^WVPt$jWV 2 9t9u x^_Vh"j4 WVt$|$ VWǐ t$?/tWh|"0Vh""^_Whg"jo4 fWV1t$|$ ɉ @4u*ȉXȉX\ȉ\ȉ*i*I* PQ40*40<8)<8D@)D@LH)LHTP)TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40(40<8(<8D@(D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7A(Vw w.(V Fww(VFww(VF^_USWV\$l$EffEffCEffCEffCu u'S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu&SCuu&SCu$u &S$C EDȉCDu,u(&S,C(E@ȉC@u4u0&S4C0EHȉCHuf tD$f@1ɺ,$uwщfPʅtL$SʉQS ʉQ SffQ@f;CuUfҸtP=r fAf‹ $DS"u|$1^_[]USWVM ]ED$ \$"$t!؃ut$V'T$}RɁƸ9rGhjPƍ LABLGˉ_ ffGGVt$PI] uu{!12wȉfOe^_[]ËL$”19v f39rËL$D$”19v f39rfUSWV\$t$pD$0@6hP$P芠uCt hO$PAuOD6=D6D$x$tD$T$1MD$,D$(D$$1D$D$<$\$t$SWB1 P4E1A$'=T+=h^#W訁h $W蒁<$t=T+=W2@,T+=12$PPhPPV 6Yjj5T+= & D$,9T+=1$PPhPj(6 =D6=T+=jh,6h$N3W&PB& T+=1X$PPhPj\6T+=1$PPhPho6rT+=06a1@D$(ST+=1GP%PPhPj%6(T+=17$PPjcPPhO3=T+=hG%Wh$6#W <6P6=@6@6=D6=T+=yW+@T+=1$PPhPj?`6BT+=1 $PPhPjpO31Gh3Wj>h$aY=L6<$=T+=hP%W~uT6G=T+=1y$PPjPPdO31@D$$T+=1G#PPjPPj@6mT+=1y$PPhPh<X6P9T+=1*$PPhPjd6 =T+==46j:WTWAj/WAW.?y86T+=#$l$0UU݋\$UW|$Pv l6h6s3DH,WD$hH%W"}hw&W }$6W <6N1$PPhPj lO3,H6 3DHWD$<$$6h$ԟ3=dO3_=<6tVh$z5T+=h$j5T+=h$ZhȖ$Ph"j# Wht$9Whn$.D$ =@6u1=D6@@6$1󫍄$B,6Al$$+D$ -D6t1$ 1D$$$MljL$$ PWc?t$hY$X6l$Ul$RQPu $׉ȉ h6=l61| h$$t/$$T$9‰sQt$t$WPh4$tFtA X6WPUt u5l65h6t$hw$|$(F=$PUD uRt$h$ A#$=`hp6h$1=P6 $VhWu Vh$al$VjD$PՁ h6-X6-l6݃=@6~VUWt$h$|>9|Pt$t$ W )̓ }4$:\$l$ 66ɋ|$  6=86 l65h6σ|,@σ|1ҿ9  X69|щ 6|$ D=P6Ejjhp6 .hp6h$6=86t686t&hQh$ 866t=|hPhX$ԧ =(6u1=61@(6=`6u 6`6=hO3,=$6t#jhϙ$h$h$q$6=\6u=dO36\6t$t$ t$4Ut$$Vt$t 9t V t U =D69$PtE~tƃhP$Nj {&Ph$jd$ Pљ. j j j h%1 t6$X6h6ApQt,6@jxQP$PhP$/ g0ّVh$jd$ P4$\ $|$8jH&U$P藟 $PSnsu/jZ$P$dPr u$<mfsjWV 9uD$8%PPP$Ph$h $|$D$D$4jPk $u/hp6h$$Ph$jXN hϼ#j B /dev3p6 t6/ D$ u6tD$ p6<$~~l$4 $jWh<"q u ƃrl$Wl$$U rMGWU r:l$ ʼn\$4Ë$H$|$06\$L$ u D06$dT$dž,<tx(=86dž dž,dž(Ɔ lO3pO3u(jh$=L6-5|6u"jh$Ȓ=L6,5|6 6N06F4Qt$QhC$菒=L6w,5|6F4Ht$Phl$d=L6S,5|6F4 X69}"QPh$5 =L6+,5|6F0=)hPhƟ$ =L6+5|6F0=|)hPh$Ց =L6+5|6F0N49}QPh$詑 =L6+ 6|6;6|QUUUU)ʹ3333!!сis{09\~\{0\\5(6sXș9}%CX=@6~QhW$|6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$ho$ =L6**|6{4$=X611F9tA uPhâ$j_ $Kd=l65h6 u։<8=dO3[ WVh$` =L6)|6<$C4$8=X6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPNdNjs8ƒPVRW蚒)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh$=L6'd6tm |6yxH1҉$q1ҋ8$$)$<$$1C$I8$ `6=|6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W)b1C1 t׉Ë$$QPV$$V9s($$$VaÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP ƒ$$$$$$׋$$$RPVQ $9wȃr$9‹$֋$r‰$$$$$B1WRQP^Ë$Ë$ʃQPRS=)ÍC4$$W$$P$Q @$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ]j$P$$ @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh$v =L6 |6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=dO3$_|HL!ʉG41SSjhjPSY6N |6I4QSPg |6H 6 6 6P44Q56щ 6`@#HL 9| Hh hO3H< (6HX \6H\ $6PTXH fǀ$ %=|6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=dO35O _(HLJ$<6$$$t!LJ^F=@6$$߬$$ڌ$&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$-$ |6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$h$貀=|6O0 9| IУ66=D6u\Tu))У61VVjhjPV 6u696656jPc =P6Gl6 h61ظ|(RQh$ =L6l6 h6565X6~ ș)dہ|4('GuȹC=86tL1$PP$$546V1=X6VhZN X61u;1$VhjVu  =65|6h`VWJ9 =H6tWV5|6x\6hhPa 1@$=@6h$f=@6|o5|6N,I\Tt~!NȃN׊Nd1 t1WPhd$RRu|$639u1H$Whht@P5G PPftu!ѡ@6t $ Q$=P6u$|&|6H,$$DŽ$%$ |6I,$1$ DŽ$1h(35|6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hF$Ҫ=L6Y |6j56 _ 56FU $F +$^|6$~J`^p=dO3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=86uFh$ NlK`ڍOȃ$ډFd;v&h($=L6|656F $11ہ~U uv`щSA|6$~!ـ1@ 6Il |656F=dO3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\56N uҋ|6B8H!tk)D4|6B8)Nj56$9sE)ȉـ1B~U uv`56F$CHu͋|6B8$؋N9ȉ$J`~U uv`щS|6$~!ـ1@ 6Il |656F=dO3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD456;Vs2р1@~U uv`56F$Bɋ|6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$6H 6V$P V PV~x; 6up=H6t6s4PP |66@6Kd156s466 |6q4jPW |656{0 9 6PVQ. =H6t65|6P56g |6y06$ryxtG$\%TuCl$AP$ |6Ou$ց\TtQ!QЃyId t156563 5|6\TG~8^xN`1?9'6+$~0lj$Ɖ$)ى$=6$%Gl669wߋ$9w$|6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=@6} $H$$$~A=P62$=|j.]p扄$#t% |6ׁ\TtQ!QЃYId t1RP$Vh$p$$;$$|W=@69|6H,t =P6 $$ DŽ$j _oDŽ$C|6;X,/$~ j 1o=P6 $hjPmS dO3 D6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$ADf$h&$ldO3fDŽ$Q3ttO3$_ lj$DŽ$|6H4$ $ H5|6D@VL!! $`Nd8e%fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$tO3@ lj$DŽ$ |6H4$ $l$h  5|6D@~L!! $߉$Nd t1$Sv4$j2|6@0p9w Au1H$$DŽ$1$$tc$ǡ<6|6@05H6V$SQP$h$l H6ɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=H6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$PN |6\T$$i$$ $$$$DŽ$H0$$_$ |6@$D$@L!! $`Oa$h!$l$  |6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h |6@$D$ @L!! $$/`$s $$h$l|6Hd t1$S6j$$V |6$ȔȐG$11F$t =D6$$=|640=dO30w4w+_16$`SWP" $PjSK =H6t$W\=T6t6ǀ\8 |6=6x\hhP2K X6QP=WV=H6t6 |6q4PP׸ 5|6HLNd t156v4t56956vG=H6t|6p4VVx 566@6=|6Od1Vw456566|6@4P56e^_[]ÿWjVJ 1=X6VW\h6c#lfBh$zj&]j%y]j(r]t6j a]jZ]j'S]jL]há$Lhۡ$Bj1]j*]j#]j]j]j]j]j]j\j\j \USWV=P6ua΋\$=D6tX6t6St$P 4׋ X6UPSt$$564 9u^_[]L0DPWVh$,ej$R\USWV"=P6΅ 6u|6H4H 6 6 =X6;h6l6|6;}FWh 8'1I!;HtG#P;Pt;H uV9R_1ڍ_56P=X6Wh De^_[]USWV΋L$l$=D6t=P6teUjQKGp׋ X6SPUt$$56謷 9t?J0PWVhv$ycj"ZX6t6UPQ ^_[]SI`wD$$'1C:Qh$h3e .  [SWV1ۃ=86։ SjQDF =dO3@fF F)f ^_[USWV Ӊϋ5|6F Nd t156G=H6t65|6PP跳 6yU +y/\$|$y1U =|61=U L$D$uq`|$ G`Ӊ $u щw*l$$'р4l$skPh$h3c =|66D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah$ h$h$11҉ ^_[]ÉՁ|$U u L$I` L$w$'ʉـ1@BPh.$h3c 8ʍ 6ʍ   1$5|6$~3%)1@ 6Il 5|66K=6Od$sC=dO3CNdЋT$ t1҉t$VQPR5{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPR|cL$|$ щT$ՉD$ȋL$D$VW|$RP2cыt$ʋL$Vt$QRP4$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45|6;F8|$}X1Bσ) 6yU uI`1@5|6;F8|$|=H6t6VPP 5|6F Nd t156USWV$΋=|6G Od t156=H6t65|6PP胮 6xU t)h$=L6(6xU ‹l$(H $t@\$=H6t65|6PP =|6G Od t156w|66HC, $9r%UQhL$[ =L6V|6 $\D$jT$RPQ D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$56W|6\Tud6jpxt$0t$ $<=H6WV1L(ɉL(@ u1LXɉLX@ul$6jpxt$0t$ <$,;=H6trUV胪1tttpTtDpC u1zCu) u% $D l$hVUk S% $D9Pl$|6T$56p0^_[]jPj PWV։σ=dO3ȃ@PQR =H6t'ȉGffF=dO3u GffF^_fUSWV$8tW9 ƅuWh"j $$<$4D$Phd@U( tj1OLVhedAU9" F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hG[%t$9U 1 Sh"U CPhQ"U+ C Ph"U CPh!"U CPh5"U CK,C,QhH"U C0Ph]"U $@D$t PS 1-Uhzd@$<W! t1 VhedAW  hjU: D$ P$4苹D$, 9L$L$9u0$S11:&>8tx$0h"b$11҉ $ƅ*ŰPj PUL ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW2 t$?/tWh|"aVh"a^_Whg"jS fUSWV|$$\$(SWt$(t$(A)jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPwE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVF8 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj$u Vh$ Ļ6Ի6%л6ʼn߃=6~VWUt$h$/K|>9|Pt$t$s )σ}4$ 6-6uU-6uY5Ի6=л6Ļ6@19lj| 19ǃ| 6u 6͋5Ի6=л6Ļ6ˉjURPw =̻6l$ Ȼ6uA@19lj$ $t$u hػ6h$jPVW v|$wext23$2fs3$ Wh`"hػ6h'Vhػ6hȗ$} 19ǃ} h $ ̻6t$VUt$  U* t 9t V jN@USWVӉ $M0|$j W\$ SP Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ p/8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h " QPWUt$t$h:" t$t$h"j? WVh-3Phj$V'J 1GVWjh"Vh'շW>USWVu} D$8jPK=ؿ65ܿ656%UUUU)3333!!щ%i6BĻ699S3S3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=Ի6л6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1̻6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ̻6566S3t$ƺQ=6D$6D$ 66D$661 65 6D$8666S6 6$6N5(6,6<6@6[D6b:f06 f2646 S3f86\$H$SWX 93rWhH6蒍 56|$t"VYjVhX6 1h6666,6D$<6 6+ 6 1҃r1I156~σRVPW56H19w+56|$OL$)9r΅u <6f565656V6YVjP% GD$AD$ 11L$\$66tnD6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@<6t 6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ,6|$11t$66=6~i 6 i{56Q5Ի65л6PRuh]$@ 6 656PQWh$_@6@661QQjhjPQ6I 56jP# =6ukԻ6 л61! V5Ļ6 1N1Ƀ *&Fu  1@D$$=6|>h$n=6|(L$ 6 61PQhd$PP=D$$639u1H|$LWhht@P PPftu!ыt$6tL$QT$=6uL$L$D$ 1D$L$ 11T$h(3=,6t$tXD6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5:6616 56D$ hh6P 566P56Vt$ =6=6 615Ļ6ǡ6)؉1t$ P =6Wjh6! 6H9|$u_656 6)ʍZ9s1Gр6B9r)6VhP  t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P 6 6L$)QhP u16@ u6L$ D 61Ҿ6Vt$# 56jV{ =6tb1=6t 1S3ca6F;56r6L$ D 61h656 G;=6r=6t$|\tX=,6teD6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=6|$T$T$|ʉj.9t$몸#|$|$t% 6 6jQt$,Ph$:T$;D$_=6* 6t=6u&D$ D$D$j a91h6c#+:~ j ;9=6d=,61<6$hjV] fF쀁0fFD$8FFF fF56 ׉؉t$ ֍$fBt D6$,F܉VDF81 L$ F4D$4z 61CL$ =6WD$(\WD$S56tPjt$0P 6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ D6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP* L$ D$1t$V 61CL$ \$6 6=6t$,9sD$()QjP t$ML$ D$41ҋt$(VW'V($Yj=,6t@6t V3W3V3@1=6à r t$hhjV fFAF-fF6ÉFD$8FFFu 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h65656f5X3|$D$1ۉt$ X3x1ɉt$)r6RQP  WhX36V X36D$ f 6 61Vt$ \9\$t56X3D$ CiL$T 1VhVD$pP 95,6t@6tS3T3U3fD$TA+fD$VS3ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h656iL$Tj f:61ۃ=6 56<hh6W 566P56V 56 615Ļ6ơ6)؉1WP5656e^_[]h$h$ <$h5$P3há$Ph$h$Vh$Rh$PRh$hVh$hVh<$RVhf$Wh$VPh۩$h$vjVWt$hߥ$gh $`h;$Yh$Rh#$KRQhѦ$B $1f$'h$h$"h$h$h$hJ$ h$h$j USWV6=,6trD6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ<6t 6 6Ѓ^_[]SWV=6u0׉΋ Ļ6\$QPSt$ 5ܿ6蔅 9u^_[WVh$h$jf USWV=6΁ 7u=61 6 7Ļ611;л6-Ի6ǡ669v@1Sh'8!;HtH#P;Pt$‹} ]70F 1HD$D$ 1D$؉hE$WSb H41B$'؍|$W5T+=878&} r؍|$W5T+=h7} 8!M ؍|$jW5T+= 9D$=} ؍|$jW5T+=, D$} 8e؉|$L؀ (7 T+=1Z$PPhX7؀ (7؍|$jW5T+=] 9 ,77؀ 07k؍|$jW5T+= 9=D$؀ )7؀ (7؀ )7ء(7@ (7؀ )7؀ )7؀ )7T+=1#PPhH74 ء(7@(7T+=D7|؀ )7@q؍|$jW5T+=! 9@7} ؀ (7-؀ (7"ءԟ3HD$ ؀ 07 ؀ (7h$ 87(7uz&t87t T87v ۶ =@7~ Ŷ 87|$D$ fD$"l$"|$0l$L$0T$48 8T$,L$(l$( &|$D$ fD$ l$ \$$l$D$$8 h$ 5T+=h$t\$D$$$ 5T+=h$Lh$C5T+=h3$45T+=hj$'5T+=hE$5T+=hª$ 5T+=h]$j諣 hz$(7Щu h$\.,7t@7 ,7D$ Ku9ԟ3t-h$hū$9}#hh7hp7P t7%(7=u (7L$ u(|7d7x7`7t7\7p7X7f778tω=7u ~ 1ۃ| ‰T$ (7T$ 757VW7u Vh0$WD$ @ux=9}b7C9uUD7zh(3l5D7h$G9}%8i-@=B'7C9u8F807t.D$jPjh5 7 u hH$07t.D$jPjh5 7Z u hg$؝07t.D$jPjh5$7# u hH$衝07t.D$jPjh5$7 u hg$j (7 t+f88t78888t'ƀ8'(8ƀ88((7) 87)Ph8Q` D$jPjj5 77 y ht$K8 8@L$H (7@fP\$1ҀڈP@ L7P \7P ; jhL7j j5 7 h$31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh$P Hơ7 79}1Ҋ\<7B9|1@9u(7h#$.~"177Ph:# G9uj s*D$<jPj j5 7g y h${t'D$jPj j5 7< y h$P)7t'jhL7j j5 7 y hҬ$ 5t7 57Ph7h$GjhY3hh5 7 y"Y3 Y3=h7$jhY3hh5 7s hWjD1585858585858588D$<8@ppp pVPj Wj<95@7~h8jm CF;5@7|/USWV։ϋ\$l$1EE EEfEURDt tM)7u6jjUkN u##VNt)xu:H Mt0t$VS蔪 ^_[]5X+=ѳ PVh/$WhH$j( SPhb$h3 j=$8u-=<8t$hat$89,7~,7j1jh8jh th$jқ USWVX78ff7 838 83 8 78f7f717Ѓuȉf 71t$<jVjP5$7 4jh7jjh75$7$h y(7t h`$:D$<jVjj5$7 h8j 78f7(7 r&sK878787+ 8ɸMb-8ʉ 77 7yf7|$qD117C9ut 7‰f78T$1A xVWh7h$0$ h}$ѕh381B 8$8@88088488888 8 uCء8888 8 88 8 8 ؉+88D$HT$Ll$H 8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88&wh87 88 888 8ʚ; 886eĉ 811ۋ88D$T$ ؋88D$8D$8D$5 8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v 885 8=8|$(t$(|$D$ fD$ l$ \$,l$|$,= 8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8= 8(7t 1A(7y77 79}(8i-@=B'7@9u8e^_[]h?$ht$jؕ USWVh8j h7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$D8;,7D$D8 8 t]+ 88$$߬$ 8+8D$\D$\5&&s=$8uZ(7tQ8 8 t5+ 88L$xD$|l$x 8+8D$XD$X5&wD$DD$D(887 &w١8 8 t>+ 0848$$߬$8+88D$`D$`5&D$Dw\$8 7$fDŽ$jh8jH` D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$Pa SD$lD$lPD$,Pj57575 7c` <h8j 7D$8<BC97)؉D$D$8 T$'\$A98I؉L$A 8Iff9u$88888888 8u888888<8(7 1D$18 8l1A hZ$訍h3A(7<1A t$, PVh~$J ΍T$(jt$>Phb$D$ (7t$؉T$΍T$(jt$F$'h$΍T$(jt$Jh$n΍T$(jt$bF$'h$΍T$(jt$$Fft$NfQPhL$ ΍T$(jt$؉t$hg$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h $΍T$(jt$؉t$h$΍T$(jt$d؉t$h&$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h:$)΍T$(jt$-؉t$hO$ h$ Ph̲$ L$lL$AQ D$iPh $ h˱$ hٱ$h$ Nh8h7$m t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ$L$dT$C;\8u#Ph`8QD$XnL$$ D$L\8PQh`89 T$Ҹ$u1G$T$Pn L$r |$ rI03H 03~(3H (3 h(3j (  }T$A{^N2D$ˀ) h$ uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$I h$3 9 |$ sS03H 03~(3H (3 h(3j   }KF߉Ήs(T$h$ L$T$؅t%03H 03~(3H (3 1I h(3j h(35ء<8;,7*؅tء(7!^L$AQ T$Q=8 8 t+)|$L$p|$tl$p8)ЉD$PD$P5&8888Y3vY3(8v(8\$CfK%8f!t8 <8T$ .KfKf8D$ 8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J8@)t2(uK 8(7t1 8h$ 8 (7 PVh$ Ph$h$h2$hS$AfPhp$h$h$h$hڰ$h$h $h!$h1$hB$wh[$mhu$c 8hέ$F1BD$D$pfY3@)f~\(7tSωL$!ȹT$V!RPt$ h$T$ D$,(7t1RT$D$fxf5Y3(7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B7C9D$=(7 ؉T$57|$77)RQPh GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E57)7t$>RQPhS$S7;7}0u h$3Ph5$!Cы\$1B\$D$\$D$T$jhc$j謄 1AhM"WV8@8~bD8H8 03Q03; @3h(3j.3 @8 (3Q(3.H @8by`)D8H8 03Q03; @3h(3j@8 (3Q(3H @8|tN=D8t403H 03~(3H (3 h(3j eD8H8h(3藻h3芻8P88T88X88^_jj1A1=<8PgUSWV׉E\$1AM(7]E uWVh$t hݮ$Sh$(7t5@D$ &\$D$$$(7fyuh3j|e^_[]UVh1AtD$7$$E8D$$$0<8D$$/$8tD$$E$8t9+ <8} $V$!L$LD$L &D$Ht$H\$$y$$  <8(7 8L$DD$D=8@|-8& Y3 (8\$,D$(\$ D$\$D$\$D$$$(78 8 t5+ 88L$XD$\l$X8+8D$@D$@5&48 08 t7+ 88L$PD$Tl$P88+8D$L> QPh$l(7tkD>L> QPh$F|>uGD>(7ufPh޳$"L> ffPQhɳ$ ^_[WV)7u8jjV. t'86 PWh$hh8"6 Ph$hh8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h$*$t$t$ t$SPh$ UPh${ t$t$t$ h$bt$ Ph0$Ht$ PhF{$.r0G9s'GPh:#| KG9r߃$^_[]fUSWVƀ8-uFh"T#Vu 8hS#V1u 8T$,11CD$D$hE$Rt$0 Hw؉$P'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 ԟ31;L$(ujy1L$ 1ɉT$Љ $P L$Au $AP+D$t2ڋL$ PWxV Wf uމ$DuY|$uj] Džu襋 P_$t8=8uIj Vh"T#& WhN$T1FVگPh$Vcy SU,J hT#=8Mj VhS#Я Wh[$Vɯ \$#3"$VWSo jjVWSa\$utE 1GWWWjWjWjWVzWj oVW%G u h$jx jjG u $8jV8 uD jC8 j jF t)qtOQ8 j jF u$8t1Aj jhT#臮 ukWh$jhʶ$t$UH $Q.tF0WW-F $t#VPSh%Wuw SWhm$jAVΕ&=8u#vVPh$h35jfD$tPhҷ$=h'Ph$h3j~USWVPu } h'WV~ cR~5StET $8͍Hw4$'8벃L88둃ftTdL 8t8e(8V 8G,88 8) ԟ3踀08=(8tjjhZ%D 48ND$ jjj"荀 48jL$$Qh@hP~ u h%q48i )ލ<S H $'= 8t1Aj D$<1CPS͊D$D$ PS越D$D$$PS蟊D$D$(PS舊D$ D$,PSqD$D$0PSZD$D$4PSCD$8|$ |$z |$o |$ d |$Y |$N F D8D$8gtj548eD rD$ D$#D$D$#_;-88S;t.H$1ۃ=8uWhg$hK$hռ%\ >h &Sg =8uh6$h$hռ% 1CH8FLCSS H3 VT$W$ؘ' \$@1ɍP$'`81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12h8#H8L$L$# 1AD$ PD$@PD$ D$<+<8R D$ Pj$D8[3D8[3D8[3 P8T8׋t$#D$ Pj@8d$zT$ ED$ L$TL$@JL$CD8"[3-L$#d$d$d$L$׋t$p8:8@.8"x88 8\$ 8P8T8 t X8t P81SSPz L$Y\= 8j$)/jD$D$ D$#D$#88L$9a|$u q<8 @8ta|$  ‰4 D$=H8T$tD$1@D$ 1ۉD$0hxSh8 atgcuL$8 88X8@X888888X8 8 8tJt$(~A|t188t|$ ObT88(8tPt$ tH@WVh(8w (8=,8t= 8uR$88tMD$tH@Vt$ W0w =,8t= 8uL$_$88tDD$(tIAVPWv =,8t= 8uL$(m${88tDD$,tIAVPWv =,8t= 8uL$,{$.88tDD$4tIAVPWGv =,8t= 8uL$4$88 tDD$0tIAVPWu =,8t= 8uL$0$8)f=8=,8tP= 8uG=88t403H 03~(3H (3 h(3j 81=8IWh8548|8 u+?87t5t)7|$t+u-$/9|$Ph$!$|$$ P赡Ph$83u=D8t"1ۃ8=D81ۀ?D$PSVhѾ$h(3r^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV莋+D$  Pc1PPWSjVV|$dt$ \$hڿ$D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9[3tE[3P{y$L$t h>$hc$QQh{&PPh($  C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP{#PPhɿ$\ 03H 03~(3H (3 h(3j T$h9t$,r hڿ$L^_[]h$ jh$jU D$t'T$tt h>$hc$QQh{&PPh($ ËD$t%u]$%tuM$Phg$D$W$PhE#BUSWV|$<\$8D$4t$0~u/jUp u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR"Ph$PWh# ^_[]USWV|$4t$0=`8uM`8hha8v_t a8'j.ha8ʅt@hPha8a t"^tCt0Wv`rhh̄%hh8a ^_[]1w)ȉPjQ! SVU4 fEu jUn WUu&Vhh8Sh$hhh8h8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhh8Sh$hhh8|h8[SWV$L$4D$1GL't$"tZ@:t9rD$Ph}$,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vt@ha8P`u7ut$w ̄%hVhh8_ h8^_[VD$L$ 1Ҁ0QRRhhh8VP thh%hh8 h8^Au yuyt$Qtu ȃPߥ Qף APhҿ$hhh8h8SWVD$h8Q4$Rc84$Rd8ƄRe8.r|I1AFL$ tWWVWh'$ u;D$ D$ POWWVD$Ph'|$ tt$`Ĩ ^_[]h%t$ tԉ1|$l$Vh$PVSXZHt$t$Wh|dD$P$ \$tN1D$;D$ 2i9t$sVt$Yt!ʼnD$t$Wh|dt$ҋ ul$$WhedAP跋 f$a$>ukSt$h<"h&h$W{Ƅ$tt85u$ $ts$QPW $Kà9Éu|$$PY 1h%j Å~A1ۉh "PIujVh<"h%h$W西Ƅ$|$tt8\u$ $t蚦$QPW C;\$ mU]|$l$|$$PUSWV ) uj藷D$$D$<$sh$V]th %VK3hU@ Ƅ$h %sut s h %Vtt s h$Vt PJ t8D$ h$VնtHáx8th'$P舘(j,SqtZ S@J,PD$PU{!xD$!=`ÉUh$< SIDž?tG<$tSWUh$h%h$VUV tEUh$ Zh$?Uh $h%h$P15x8t$h5$h"Wh1$Wh"|$hWVQh*$Ph $4D$<D$PL$,5AD$dD$hD$D$D$D$ 1߃}t u9wNL$,@D$(_ wt$|$p \$D$؋\$T$ \$t$Tt$|$l|$d$L$h|$3D$}L$ jj h#RQjD$sPk eD$L$T jj h#QPjD$[P9 3L$<ȋt$l拼$t$Pjj h#VPj$P T$vD$\$)؉ jj h#QPjR |$pGL$[Qt$(Pt$Dhr$0$ۄ$D$$ڴ$ &G(D$$\$$D$D$tD$$L$D$ L$kL$D$$|$迷(D$(L$,\L$,D$(|$pK\$p{L$ D$$D$` t$PVRQ認Pt$dWt$DhG$[D$T$T L$L$T|$`WQRPe$L$<ȋt$l拜$t$Pt$`t$XVP-D$lt$\$)؉ t$`t$XQP$ۄ$$ڴ$ &O(L$$\$L$tL$L$ L$D$$D$$D$$R$^(L$,D$(ǠI\$ }t$D$L$ |$HT$Cjj h#PQjR` ZD$  |$[jj h#PVjW2 ,WD$GPh$趵 }(|$HD$ L$ T$[jj h#PQjR D$L$ T$Cjj h#PQjR \$d؋L$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$Sb\$ =8uD$$D$ P$P設 Е8\$t$Ph$+8PU uUh$n+1@$~#Qhr$虹1@$\$$$Ĕ ^_[]$Ph$j. 跓Ph$h3w jUSWV L$8$T$t-8*jh8^ 8š8$T$1i E$48t!u6$t$P^T$ uF$t$PBT$ tEM<ǃ h$*1 ^_[]ËD$ t 08$4$݋D$ t 08$$ؾ8Phh8F- uh8h$j^- fVD$t.})zhʑ9h$59 9T%%%О'PQh%59Ϯ#u59h@n$~9^ËD$ H^WVθ%О'PVt)uVhk$59_ 9SGt8tPwh$j wh $Xuj whʑ9M: G99^_WVD$ t;59D$=`8 9u `8О';pt8@uVh$j+ @u=`9th`9Ph$赀 Ph $襀u59=`8^_Ã|$t $y9Ã|$t %X9Ã|$t $r79Ã|$uh<9h $59۬ 9Ã|$uh9hA$59説 ձ9Ã|$uh9hd$59y 褱9SWV$$DŽ$HH$pyƋ$ ƒtS!=9$t$$atσ=9 =9 PSj $;rtr1Auu($$h$PQ te$P$$h$PQm t8$(1;BQPVW7VE>9^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hh9trʄt<$1ۊ9t8tCu 9s9B+$=FFu4$D$|$ 1 ʉ9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ ʍ9<$؉D$ʍ9$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$59h~$f<$?uhVW2 x^_[]USWV0$Du%$H$Dh$PQT y1E-9h)>j(Uh8Է t$H4$=9I1VV$P Í|$0;=<9=9$H595959s =9$t$9ƒ=L8RPSQGy=9uE=9t<L8L8$Hct9L8 9VV$P Å 4$j990^_[]Ã$D|Ã=<9t=H8;1 T$󫋄$HRjh4 |$D$=<9ʉǃ=9$H[L$05959j =9$t$9Ã=L8VPRQw=9u9=9t05L8L8$H1t95L8G=<9-=9$H$HL$05959j ƃ=9$t$$H9=L8PVRQv=9u_=9tV=L8L8$H1t9=L8$$H4h$*D$P- E;$Dnj=9t#9@=u1HjhmS#P jh8 WV=9t@=9t75L8=PI9L8PI915L8=PI9u 9^_USWV1@=L8S=PI9Fϻ$ͅtUSh$59S59Wt$PhVhХ3xd3L$DH?ujjh8覮 t$t$j59$r 1;=<9=9h9S$tY$5959598 ʼnǃ<$t{D$PWtVWh !$Y9j59$ Å9Sh$$59轛 ċD$`L$d |9x9x9 |95b$t$995L8jQPSWh $V5|95x9959\=9O=L8L8$t9=L8>9t$j9Ą^_[]59jj/h$KUSWV $ u{$$hR#w trƉj h%S& x9 |95b$t$l$ jhUVx!|$ toSjWj@b!Vn whI$59  9 ^_[]Ã|$v#tڞ"Ã|$t!h$ht$hd$59™11H9WVt$D$ tu51>#t5D8RPh$Qh8#59jj6hk$Fh819^_h$hH8t$t$ 9h$h\8t$t$9WVD$ tZ}UuZt$~hڞ"WFtOhv#WFtBWy7vh$59/ Z1H_1=91@19 91Ҿv#tڞ" щ 9PVh$59Д1=99^_ËD$uD$L$h$PQ tvD$phZ$gu<=9u0=`8t59h/$D$phY$fgu+999>9VD$ L$9t u]H 9HQ"tsP( t8[=99t5h9hr$P蓓 9(^鳘Vha$ Pjj$h$_DV-^ËD$tIDuD$L$h$PQK t$D$ph$Gfu909SWVD$-uD$L$h$PQ  1G=9h)>j輴Wh8h t D$1VVt$@ ǀ?tx=9tyD$thWh$teu 9=9uB=9t9=L8L8D$bt9=L8 9VVt$ DžaSj׳99^_[ËD$uD$L$h$PQ tmD$_D$L$h$PQx tI|$BD$ph$mdu8D$ph$Tdu9Ãt89USWVt$ |$.E1ۈ$59jj,h$@% u v1.贔9^_[]9USWV D$ #D$$L$ h$PQS L$ ȃ#D$$L$ h$PQ) D$ L$$|<$Dh{#t$Yet3$8|t+4$$H$$ 3D$$h3$0eD$1E-9h)>j臰Uh83 t D$$\t$=91D$ H9=<95b$t &$9t$t;E$T$$VVP4t$Q܀9u?=9t6L8L8D$$" 9tA 9L8E_t$j覯9$9t4$'衒9 ^_[]SWV$tKjjQ tK~S裠 9uWj(1uhJ$+1H9^_[þV) Fujjۮh#" ;%tj/VO t@hQW =9t859VB 9HQP~ Q Pj Y|j5d9hq#WV͈  jWV迈 Vh7$9j荀SWVPD$D$t&D$t$hq$PV r9^_[ËD$phz$^u|$h$$ tD$x|$Wh$^W`PjW#l uP|$h$ t D$x |$Wh$;^W_PjWk 1ۃuM|$ Àu*D$p Vh$]V|_PjVk <959h$Y D$9=9t =9u&=9t#h9h$595 959jj%h$;ËD$9-=9u=9t#h9h$59̉ 959jj$h$:ËD$uD$L$h$PQ蘺 teD$phA$\u<=9u0=`8t59h$ D$ph@$S\u9<9ËD$uD$L$h$PQ teD$phs$[u<=9u0=`8t59hH$Y D$phr$[u9蒍9ËD$t8uD$L$hz$PQQ tD$L$QPh# B9USWVh$V$ $|F$$h1Gh4V 9}hh%V G9$uVh$Zu jLT9^_[]ËD$t8uD$L$h$PQ\ tD$L$QPh$ M9ËD$thuD$L$hO$PQ tHD$:D$L$h$PQ t$|$D$pph$Y Ãt͋9VD$t$5`8`8u h$Y%萋9D$ ph$rY5`8^VD$HrV9>5`8`8uh$*YD$ ph$Y5`8^VD$t$5`8`8u h$X%؊9D$ ph$X5`8^Ã|$u|$t蝊9Ã=<9t 1PP)jg=<9t 1PP jy|$u|$tD9Ã=<9th$%X釽V1VVcVeyVPD$ D$t}uD$p*9h>$W't+h|%W&t hE$W&u7 1Cvݻtt9u9hz1H!9P59hM$59u19^_[VD$ L$9ʃuCuDhD$P(t$DhN$$t$褵 $t|$@t$t$@ЃD$;p8t|$tt$D$L$dC.$`7.$s.$tg.|$Htt$HMD$H|$Ptt$P2D$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=p8t;P襡D$HL$H+p8tD$Ej/t$L** t@Pt$Dhu$t$HYD$t$Ip8L$D|$D$81|9x9t9p9$$9t8t1$Pt$u$\$` |9x9|$py9$hR#t$L蒸D$|$t$A$QP&u5$8$<$$$\$` t9p9x9 |9t+t$޷j5|95x9P,Y=`8tPt$Hh$59ee |9x9 tQPh$59?e59hmS# 1O$=9Y91O$8|$pu5 D$TQh$mD8ht$hW =9|$Lu:|$LD$puuh$t$HhM$[uh$}D$L9$|$LD$L8|$dD$t$h$}8P莞$$W8$<h@ &Ve1A$<$ǀ?tvj:W& t=@j $QP%f ~޻t?$9u3;$u*W*89$<r$)PWR t/h@ &V+eDžm1Ft$Hh$1$t P$$u |$p$$x9 |9t$Lt Vh'$t$dKt|$dj%Wt WhT$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1h%W8tVh$j$7(2WjDŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB 8JBB D$$PRW$86 t ]E0~RtD$$Z$$Pf-j j WhSvv|% t%h #PS j #PW =`8t+D$$xt!~$t$WSP59o`v jv? Åx`=`8u~PvvS-x)$P$P$Ph# ykSN 1KW$Ph$c Nȉޅɍ$P4 PW$4h$yhh1N=P8tJ$t$uP$$t$uPљ$@9~R9Wh$5tNu1h@h$hL 9H t905LI9ދ$tPYDŽ$$t4Wy3PjW? $tPDŽ$$t4W:3PjWN? $tPDŽ$D$$t P>3 |$D$$hۥj($9<tQh$$芰D$$\t$ Bj9tV=`8tWha$59] t$$tI=`8 D$tPt$hh:$h>$59O]1@t$ht$hhH$t |$dwh\$Vĭ #hn$V譭h|$V蟭9xt'1ɉϋ4h|#V} G9Љ;zrۡx9 |959h:$u 5|95x9h$V/5|95x9h$59l\1F&1t$lhJ$V $`#=9t"D$$$t$QP躬|$h$5 tPh$W薬 h$ht$h$W|D$$0$|$Pt1$t:$t,#tD=`8$tPh+$59~[ FWha$$8W $$0t-=`8tPh@$596[ FSh[$Wʫ t=`8t59hQ,$ hL$t$ 虫t$21V|\$D$Lt$P5b3DƉ$$ىD$ډ׋$$|$8‹$4$8$ 8ˉƉ$D$@1S$P$+$$$$+$ى|g@By)QTj$P$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5858" hL$58"M|$`=$@$Dt$h#Kh{#t$"D$8|jjj m$D$@h5b$Pu D$@|$@DŽ$%|9 x9 m!ڃt9}M#$H5t9p9$$!;$$=`8t59jj h$D$TLD$@(3x=9=d8|8 x8ƒ89}%9HQP ;HQ#9HQP<Q 8tB$ڋ$!t p95t91ϋ$H1 D$h &P h5b$t$JD$@|$@tDŽ$д t$oD$@Ph7$h$Vh$Oo."8)PSh$6h$%Pt$Hh$jykh($hJ$PRbh$DRL$D$ D$8t$4D$ D$0D$D$,T$1@މPj ILt$nthj$Wjbt$@a$=д $#$1V$W5$$$$$$t$@Ѓt$@Wt$ u.59$PP艊Phw$VNH |8=x8| jjt9x& x9 x8|9|8; p9D1|8x81\$  x9 |9PL$T$ T$8t$4\$0r\$ `81tt$h$59{G L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Wh$OD$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#I7tt$h$59F T$d|$?D$TD$L$ L$8t$4\$0ËD$D$,T$1@hs$6OD$L$ L$8t$4\$0h#$OD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h$$BN$D$8$D$4$D$0t$,$$1@މt$$h$$MD$L$ L$8\$4q$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$%USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q& t}D$V~ƉD$j@P@t%L$L$49@P~ƉD$j:V @Px~D$ t$D$0|$$jPW4 D$4t 8D$t{8tvD$ t8tj;P tht$Ph|$Wh$WVWh$K Vh$K1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh%V @L$ǃuC=H8taD$t$uI$t>th$V1Ʌ $t}th$U1ɉL$<=9=<9t 1PPѼ=9%|$DhPW |$L$D$L$D$ tD$ D$$=P8P8L$QPp=P8<9t=ut$8t$8t$ D$Pj3D$T$ #tQPh$I "D$Pj觓<$l$,|$u'j/VtG1|$t>tFhhp&l$LU l$t$1l$ -9D$Pj9-9*x1l$,1Kd}Z<$t3$DSVWk Sh%W SUW <$hh%t$LV1 t$l$D$ D$<4uT5L8L8=t8$t$hP|$LW |$D$Pj5L8p8uj/U t@ʼnD$ D$$=t8tAD$Pj?>uP=9uDh3jhh.$)1D$PjT891ۃcÍL$%L$0d؁D^_[]1Eh$GPh$$h$j薼 USWV օ\$ |$$jh$Q l$t=jh$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CS:yS\$$UP { uG<$WxC Uxj@Vr|$$tZ{ u 9w@PwƋ_j:S:t@PwG_Ot[uUnj]U$tYÊ@t<:uL)SUVz Vf,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PU> }t $9ut=s fCt$t$Uh7$ECC tWt_uk<8KUVh$D t$t$Vh$D\$ n1HJ3@8(u#U8vC{u{ %t%PvC1 ^_[]h$jy WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj_\=9t<Ph $jdVY6~ 9Iu1IPVQ jh 8FL Vd88j[=9t<0PhZ$jdV5~ 9Iu1IPVQ蜄 jh 8K V΋tP/FtPFFtPF^WV΋AtPF~t,W PjW! FtPF^_SWV׉΋j:StDSsP蔄tj%StSh$Vz SNSh$V` G tu)GfPu G=tPhF$V+ hL$V^_[USWVP։ϋ\$l$ 9<tP/ZPUVWjZ x.1tETw4s,I  $8 u@$PhA$@1@^_[]USWVPӉR lj4$6Mw sEWSUV 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ D8 H8 L8 P8 T8 X8 \8 `8 d8 h8 l8 p8 t8 x8T$(JJJJ58rBJ PRSW t u )0$@t0hP.P8 PSWh3$(?9hWhD8v 9D8<$l$\$HWj j UhSww t h #VS j VU =`8t*$xt!$t$USP595w jwp x6ư=`8uPwwV^yWV訂 USh$ǯ #$d$dhH$= 94$ xwwhD8 GD84$ $D8D$HSh`8Vs] D$H`8=E8uD$jUjjV hR#V9h5b$Vo9=9=`8t59h$5934 j}^\$WSjUV WShUV 9c$d$dhL$U 1h$<9t P$9t P9V߀ 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4|88hƲjUD$(D$ h2jTD$,D$D$8D$D$$$911L$8L$\$0D$t$$ 9<tPjTW59v=W59\r&wW598tPhW59tPhhh<$59159GCà u $E`8uw|$5uprk=9ub=9t&t uu59hu"$59p1 9HQP;H\˃ PQ $w3DXt9CУ99uss)5 $ ȸdtȃru3DXu 1@OuJ t$ tB$T$у)l$t=8s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t 9D$ $؅t荌$79L$`L$AL$PPS2=`8\$0l$uE5u@=9u79HQP~ Q Pj 259D$x u@uhD$ WVP=9|$|8hƲjNƍD$$PW590 59hL$F 599h$W1ɅQǃ=|8t @w3t.Vj1Nh$491^_jփUSWVu} 1D$(D$ 8T$L$9"D$|8x81Kt9p9 d8L$,9`8t7}t1?-tWh$59g+ tVhc$59O+ =9tVu u ~999t jP }D$ \$\$jh8< hjLh#jLD$h{#} W@ ?|jj LD$_hR#SS D$|$4d8D$ j3=9u9D$tt$jHLD$tt$j 1Ll8xP[w l8|$ t|$t D$ t$Ѓ|$t t$CD$,d81|9x9|8x8e^_[]D$Х3d8} 5jh8K; Ct$jyKD$=9l8xPv l8|$tt$D$j9|8=x8jTKhR#WC)D$|$D$ д D$fxtD$XD$0PS}x.#D$8=u$$ t9p9u h$59P( Sh7$WhM$赢|9 x95b$ t^L$$h$Wth$Wu5b$u39H D$fxL$$D$@щ˅tVWh% Wh$@9SvD$|$ 89t9tP 8tQ99|ʉ׺9օt 8Qb8j@D$ujj HD$=9tD8=d8t t9!ȉ'D$$jSPt$f19HsoL$1HfytL$IT$fztD$PW585858E:u h#蝠%\$(St$tƃ t0ti|8 x8;L$D$|T9HQP;H~0Q#598L$D$L$Pj#(͍D$ Pt$ j t D$@ @x8|8D$ Pt$ Vt ttD$@ @ujx8|81HjSQPЅx,5|95x9h $ $u h$>n} tc|8 x8;L$D$}%9HQP ;HQ#9HQP~ Q Pj _'D$@ @tt$(0Wh#謞D$@ @t/t$ 08 t h$耞1H|8x8j=|$ tD$ t$ЃD$t$11t$V|8=x8NPj#&SWV |$$D$h $Wt D$ $=9$t$D$9ƅu=9=9 4F959t jVuh<$)j$=<9959t jVth8hQ$t$ jh8d4 jh8M4 hjzD8h $W 9|t1@v59h$ M59h9$Տ j!#9!h&jC$ |9x9 tQPh $ \$$SWh% j_ j"D$ |9x9 tQPh $ Vt$h%v 81WWE"W4$jCj%"=8SVhY$59 4$jBj! ^_[Åu1t P!=9t jI  |$1=9P!=9t j  |$1=9Pi!=9tV 91j J$,y ho$蓚=48t 9j`YVV=9t j j =48t 94$jAVt$h% t)Vt$h% u=9 j =9{jlWVd881V A595|89rt suY$$dWPV* Wh$V۫ 9Iu1IPVQi jh80 Ph$j蟜 USWVD$=T8p8`8 8jjP> l89tL$jQjhP!  8<<=8w=8j=`8=9u `8h$Ɖ=`8~&t =<9u!h9h$59 =<9tC9=$ 59h$@ h$ޗ1A =8=8=`8=9u `8h$JƉ=`8~&t =<9u%h9h$59 =<9y9=tT$ wJ59h$~ ?$tg8h<$=<9 <$3$t28hA$=<9A$PASV3Q LPSV3Q QEPSV3I1  $9=t$$ <$$T$$$VRQPWh$h8 $$:$:$:$8D8D$ff 8k=X85l8wh l8T8=918`8u f 8l8t P$h  8jjP蠣 l8=9u(QT$ RQhP l8 8Qh8P 9tjD$ Pjh5l8/ D$18 88888 8D$Ph85l8B OD$8j5l8hy h$G=9" 8$t#/=8=8=8=81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =`8=9u `8$P$Pt$h7$Ɖ=`8~&t =<9u.h9h$59 =<9+8 8tPV 8 8858= 8 8SWVRQPhG$T8$8$8D$|8D$x8D$t8D$p8D$l8D$h8D$d8D$`8D$\-88=8588 8 8PQjRVWSUt$|$$$$$$$$$$jjh^$;X=<9[=9N91ۉh$=1A#h$h$u 91ɀ= 8D$jD$ Pjj5l8I 1Ƀ59hF$ 1E= 89=$ w59h$h$v5l88c l81AJ9;9=t+$ w!59h$W59Q_ 뗠 8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhR$h8 , |$ |$|$1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ fD$ L$$T$(t$\$VWRQPSh[$h8 1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ f 8f 8;H88jPh85l8_1ɀ= 8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph.$h8s \|$ |$|$18 88888 8f8L8@uD$ $ ff 8jhL8h8r 59h$59h]$59h$59hm$59h$=X8USWVX=T8l8tuPjjP^ ƃPj5l8^ t$l8D$fD$D$jP9<D$T$ |$ Mbt$1PW¡T$L$+T$ +L$(x@Biy1PjV_ u8t8#th$uh$`8t$4\$8VS5l8&^ ǃu+G8t =8#uoVS5l8] t׉5l8] =l8t$jWQ] ut:|$9uD$0jPjjW( V5l8Eh$蟊5l8a] l81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ th#P|1ޥ31N9tl$Q}99(3639tVXt!`8t:t d8G91ɉ׉h$$H$HB} p̃DW<$$0'8H8D$j P5T+=dr 9D$8$rV5T+=h8 $9ET+=<8?t801X 999 T+=L85T+=0$1C1@`8d881X8T8595T+=x0PVjFt$j h_g#V t$,5T+=C0D$1CD$hA &P t8sD,@ÃuӻD$,jPSv Zt$9D$jP5T+=p b3 D$8$P85T+=y/p8h{#Pe$e93gT8X8QL8ED$j P5T+=o 9nD$8$U9$4$5T+=:9O95T+=h*$ D$PPPhO$h31@,^_[]Ãl$\$ 11FSVS59許 ԟ3)$@$D99599t?D$,XXXXX  8H1AHh9PSW 99h#l#j t8tP-9;U tPzDžu P{Džt=9?7a-9=89uetahPh8~ =wVh$h8 9r&59j?PVh$D 89uh%,9 V-Vh$Ps~ VhY$W" h$E t1WQh$z} $S ##tWQSQ} $S tWQS0} $Sԇ tWQS} $S資 tWQS| h$蓇 "tWQh$| h$l $\$ tWQh#| h$A tWQh$x| h$ tWUh$V| VPWz6VjVjz&VjVjh&j9$@w$Dj:0Yt$D0;jh9 h~j*hj $D8j@W1t @Ǎt$,ht$V | \$3|${$D@CC 1=P8t 595P8$@@SP=P8 <9tȃujUt$=! <9ȉ9t=u9@9Ph $59& 59- =<9a9\$ 5P+=hl$P+=?u D$PPPhO$h(31PhX$G 8P)9$D$Djh9' h~j\hj M5T+=h$Y5T+=h$L5T+=h$?Ph$75T+=j?[PVhW#5T+=hB$j?;PWh8$jk uRX0Jt$$H$H ƃ=88tjWWtVP5 PVh$WV =9t>59hH9[ K=L9thL9hG{$59 59`jh@hL 9hХ3'tEt W=LI9k90t&ƅu' $j$59PYZ / $~ tL$=<9tPI9j 6Wx 98905LI9V =TI9t'~t!9HQP;H~Q~  Pjh~j hj ^_Ã=9t9HQP~Q fPj fV5D9u<FA\t"uAt""tFAQt FAAtF5\9 XI9;$\9 XI91tu `9`9d9^_[]WVt$ t8v ;{{{ {{|$$PS\$j"U$1ۉ___ __$PWj 1@G ____SW|$ S\$u =d8fDŽ$ 9t$Ph$hQ1Ft9 p9ƒ\$x|$|l$x&ݜ$݄$ &L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)WhI$QP7h99|ӡ9tPL$ ȷL$ )΅~DQ4))h#ShD'RhP$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4,'QPhZ$SW?L$(+ 9T$,9\$0+9x@BD$ډL$hT$ll$h|$@|8 x81G؃D$@5&vqL$`\$dl$`&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4,'RSt$Dhg$QP t9p9ȃ|8x8D$u݄$|9s0;T$ D$r$|$\$|?؍<)h$؍<)h|$QP+ N+x9 |9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh9; VD$ B J1rrJVRVo $^Ã0D$4L$8T$ 1ɉJJJ JJQRP` x$1H0VG0j60^USWVh=`8u=d8u }t$XjVm+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5&|8 x8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и#t$|$d59PRQh$hWy|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ#r$+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ ,9HQP~ Q PNʍHr̃t"1,9HQP~ Q P\t"u5,9HQP~ QPƧ09Gdu091G ,9HQP~ Q Px[~#\uE,9HQP~%Q'H wr? t:,u3P.t%09Gdzh;$ 1N09=09ī%`'h09P薧tu :v2USWVՉh09QUtDj.VҀ1ۅt6UP4u&)Wh09Vk_ u1ۀ091C^_[]SWVD$=<9t59hT$59^ nD$t$h$PV` uA h8<8tD8t$~Vt. 99PQ 9^_[Pv蔘t=h8t"=`8t59h$59 1G=<9 Sh%hʑ9[ =9=9Sh$h9[ =89Sh$&h<9[ =\9Sh;"h9s[ =9ShZ&h`9Z[ 9=P81PPv h$jL WVPhL 9蓣ơ9?snt$h$P ƆL 9 M 9?)PRQhХ35 x?t$|$ LI91; 9 ^_Ph$< ^h$t$h$59' =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=9tDt W;hh$.$t Vhh$PD$D$ L$PQRSm:4$uu|$l$ 99tQShg$P7Shv$P& D$WjPUhХ3tU59sƉ$t=h8t`V藡S茡<WFWt$PX WhY$VY WSVY $t Pg4$Vhz$覟uD$uqh$, t66hR#t$h$59+9kt$VD$V PjV֬ D$Ph$Ƌ|$W蕠PjW詬 u{D$ u?h$O, tt$VD$ VMPjVa D$ 8Ph$蚞Ƌ|$ WPjW+ 1ۃD$  ˀuPh$Vu_4$91F=9uR<9,=@99Sh$QOuh$ 1$tP e$|$t.WGPjW[ D$tPdD$|$ t&WPjW% D$ t Pdd^_[]h@h$hL 9SV 905LI9Whh9 u999V5`8=9u `8h($Ӝt>h$h9T r1ɀ9.)h9Ph$59Tjh$h9X tfjhd$h9W tN=99t9j h$h9o) uh59h$6 S=99t99j h$hʑ9T thʑ9h$59 1H9999998Wh$1Ƀu 1A9u ǀ9u 985`8^Vt$t3DH@tNFuh$VPytQjh$VV tDh$V*yt9h&Vyt.h$Vyu'999 99^á9t PÛ19<999=9u 9l8889t Pa9=9t@988j=9t#9@=u1HjhmS#Pu jh9 WV/0jk=<9tp9t1@=u1HjP 59轚9l8x#jP 5l8q l8<9|$ j%=<9tD9t1@=u1HjP$ 5969<919P8u 10^_WhM$jC D$tPMt hV$j]C h|$jC USWVt$ \$l$|$WSU tU| u;HDO 1 t#$ t$fO gK9uX ԥ3I ԥ3~Х3PХ3hХ3n ԥ3 tuÅt5$g t^_[]Vt$VjNt^Vh$jB hh9W t9USWV=9H8t`=<9tW$tw9Phh9^ j h9s9tJ91P99tNjwt99t$h59VO |0/thh%V3P hh$V P V5$$PO  `8L$`89$-d819d8$ t1=9PGt*5b$1SSQPVh$y &u89d$$r t9$ t1=9PfD$`8$9-d8hR#V9V9t2$759V9Vh$L< h$ 1^_[]USWV,=H8t8l$@11 SjhU tUh$8 ",^_[]<$tދD$0S ,^_[]WVP5`8=9u `8|$=9tft$hH$+uqj h9p@j WP  =3LO@1 59jj(h$qru=9u=9u 91HtJ=9uA59h9. 9HQP~ Q Pj 1H‰5`8^_USWV45`8=9u `8\$L=9=9!t$Hhy$+j h9ot|$j.h9oth9094$uY9519 91f u>h9h$590 f920h9h$59 9t$1 U貓Vh$U:U D$(V!у $ `859jj(hP$ou=9u=9u 9tj=9ua59h9, 9HQP~ Q 0Pj %# 9tUh$59 4$|$5`8=91Hƒ4^_[]t$h$j2h9?ft9h$j; USWV\$l$jWnh#WnUhA$SS Džu&Uh[$SS DžuUhu$SS Vjwn^_[]SWV95`8=9u `8=9h#+9u_j h9ltL8tGx"uAHt.1Ҁ"ux"u"@9ZHt@r1Ӎ95`8=9^_[SWV$h$VH VE h%P轒1Fta\$SWx t?|$/uH$V͐PVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh &P藉 ƅu 4$ 1$^USWVHu\$ $Cj j ShWuu |x t #hVW? j VS? 9]t/M I9Nt vuvvSl jjSP ƃPjS6 \$fD$=9~%|$@jWC9O$Cuu S% VjP 1D$ PWhp" D$ PWhC$h_$,-?81\$@jPPhSvv2w thh #S> 8ShL$,-D$ PWh$ٖ8$\$=9~N1PD$PBT$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,S8tI8#tj}ud38AuZku<FD$ t:D$L$ PQhhuht t\$ ۋEu Y ֕D$ PWhH$+ 1He^_[]A t$e SWV|$GHO~H0^_[Ë\$1NW菆u4G `f@uU8t K8#ug GHO~막뭅t&USWV|$\$GHO~H^_[]1M;G~ uWSPu4G `f@u<Ɣ8t 輔8#ug GHO~렉륋t$t 蓔WV|$htS$WZt.h &WHt!t$?tt$ h$**1F1^_4 th $j- Vt$ Vt$ 蔬 t^Vh5$j- USWVHE ML$8t$QPV DUt$F|$?T$(L$0+T$+L$ x@Biy1PjWs u8t8#tqtajD$ Pt$ ttyޒ8UВ8#G+T$‹L$ )~MT$L$ D$&<蜒01Nt$oH脒 1Ne^_[]þ ɉϋD$ËD$@(PD$x$t1A jRQjPp 1YWVjt$ 1x!j0j*At8 W ^_SWVP1G<$j0W@t1Ƌ\$x$WjS jPhhSo 1^_[Vt$t2V966 v\GvQGVHG1^USWV0]u =9~|$jW =9OEދu~ t#9rWvPgd )~ ~)E 81m<$SL$Q6H ƃrGt\)L$<$u袐8u}莐8#}1D$11BtfT$ <$=9~M1PD$$P<T$D$+T$ +D$(хy@BMbiy1VjD$P4 uݏ8wϏ8#iMtuL$E59259Ph$V舏<< rMA(1e^_[]ËE@,$LG(B8<$t319#u‹F9~sWPe?tF~WuPdb ~ FUSWVP|$ Guh94GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUw>tGo1F u$8 G(1@1(u8,t<_tGO T$t$)9|JSPVQa _ ^_[]hUSWVPt$$\$ l$|$WSU tU}| u2HDeO,1t#$t$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV蠋h"P~t+h"V~th"V~uԴ9д9u }h$VW. Hσ s Уb3߃c u1Դ9σdt ltntHд9뵈ش9д9맃t Vu'ԟ39u=д9q1z4$9-u yt$$PQ1ۅtw<$uaд9tX8uNW{ƃP+1VWP_ 3.gz$PS߉ޅu4$ht$\1$tE=@Vh$t$$=д9159=д9jV DžD$PWTg$$P Vh$D$V=д9$=Դ90Ɂ==11BWjV $=Դ9$uXh$Vh%PW9r DŽ$.gz=Դ9uhh W |<$D$D$P_D$ T$Wh =Դ9D$ #D$H=`t= ujV2 xLVVh$;Vh#*$Vh#Vh$t$ u h $VD$ !=t D$D$pD$59hVWZ0 Wx|<ǍWh$uztI=Դ9uCش9u:Vh$$Wh$-hХ3xjD$P|$W t $Vh$1PPPWnj=Դ9$uL=ش9uLhh W} ƒu 1@P D$ 1@PZ T$1=ش9uW4$T$WjVh$$P t$t S1=N| $T$ V1PPPD$T$4$ t h$D$ tP t h $L$#L$Դ9tKfjjWj tT$PQL$btDWh[$b4$u WVh $Wh#KWh6$*$l$pT$ 3T$ϋD$1 u VK4$ $Qt$Pt$h$s4$ $W|h"$1B1PW 5ܴ9裕h'h$h3 j腕V3h'h$Vߠ Ph$Vˠ jQUSWV΍D$PQax#L$D$xt$hb"1L$h $tSR*ǀ=ش9u$h$jى\$9r<$SWV t*t)u1ۋD$)؃tǃwh$ h$@<$D$1Bh$PW|$ WW :e^_[]h"+PD$L$ $QP"=ܴ9u ܴ9XPD$L$ $QPl"jғUSWV׉ˀ=9u h $ t$9jjjSf!ƒt7jPS tuh1$Tl$h1$11PUVWhK$؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ PhZ$jV L0L0D0.Vha$h(3 WhZ#R^_[]PD$L$ $QPר =ܴ9u ܴ9XUSWVpT$hL$lh'}h'D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0Ri$T$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$'1@ɽ9jD$0PńŃ|$<T$1D$ D$,8@D$,O|$01PPD$(P T$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0C<\  Cj$j&Gٍ$'j  1$'t$'1T$JAjD$ $$ _E@9ED$$hUD$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PV;Ǎ$$ D$ VVD$PV;94$=<31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhPN 911 |$ 1 $R:t1BuڋD$8L$ Qj Pe:  Ǎ$Pj t$D: ŃuuD$ L$ }D$HPQ4xWt$ PPD $(4$hUt$P.D L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$&E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[oj $( PS蟍 o8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =9 hh V EKpCDH@uٺd$&G=9 GK4CDH@uٺn$KfCDH@uٺ{$GQC t _DH@u&ƋD$pW]@1҉ϊ@usFCDH@u\.tDH@*BhL jh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVb ƍ$ jhU uG1,9t!9}uEpV]mje  9xt$p@ 9>GWV t$F1Ejhh9 Å%|$څ,h$|$th=$z9 911<9t* uGph$W ߅uFu¡9t@P= 99P$ 9(^_[]Rhy$hh$hR$VQRh$$Ph$$Ph $jjUj h$Vhh$wPh$lhT$bh$XQh$Mh&$Ch$9jj h$&h$hD$hi$h$h$h$$Ph$Sh$h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u9_NSFJ1<9tJ9ouwvSZt?G $pS|$698^_[]Ë$@Sh$SWV׉HЃ s%j SVT G3^_[Ã.$tJ+ueFɃ/t\uRFjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ V7 uF99s9^_[]VP Ph$' USWVP׉΋$1m~ w]$D' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x b3b3[>u)jH1҉P5b3 b35ojH@b38 b3>u+ j59h(3Pu  9Pph"ji d_PPh$h3#|jpUSWV\$|$t$ 91EtB59WVV <9<9594P1<9@9Ht8hR#p{9 <9I D9Kphav#jh9Owrf89"49 ...D99<9@9 9 =@9u98#uxnu 9  9W1 t,E-9@J}9<9R)ʉ1ɉ<99‹\$k@91m1 @9Q@9u>#u~nu 9t91B C1ɾ8f @9@91ɋ\$u@9\$t1A ^_[]ÉZQh$j USWV|T9uN X919u:=9uT9Х3Х3D9$\9(3`9"P91NHQPPNT9=Х3PsM=d9tCd9S謗S5D9 thd95D9v od9=d9tM\9t=(3tPMV\95D9hd9 d9`9=P9tP9X9 X9@X9D9=9QP;rf|$98t0W5D9d9V W59V =<W5D9$V W5D9$U V JU" PWVh$Whd9Ws9hd9\9޻t=(3t PKh5b$hd9w\9rH9tt$t$P \9H9tȋL$!QP `9d9=9u@9D9\9(3`9"hR#PvT95D9h$  9T9$@1Q5T9PF 5T9hL9hH9 ƅttbH9|0 uNt$@ $@ $QV5H9P@91@|^_[]5D9h$j 5D9h#hn$hX$5D9hN$jS h<$h<$ =d9uhE$ hd9ݓjih$벡T9@ u:HQP~ QPJt5T9P 1=9t 9t SWVX9X1t^hR#3tt&Nj@HOW,JuWH[뾋HWPu WH1F^_[V$ $ $t$QPhVoV5D95@9h$j V$ $ $t$QPhVoV5D95@9h$x| ^SWVP\$|$d9t PD$jPSWD Pid9VPSW( d9^_[ÐUSWV@9jhh9n91FD$p999JBtOz T$R uW|$+;A h9l99ыR L$y th|$ @9)щ;HT$7D$t{T$A h9l9+9. @9;H@ h9l9|$to9u1ۉ@91;A@91;AT$t1jT$ 9=91ۉ__ WjWSQPM|$t4JT$B8 @9;H`9T$9591~>~ VjVWQP{L1FT$19=91ۉ__ WjWSQP,LT$t tCsBtt$u @9;Hr9xt$t@91BtȉÅQJA7$'=p95l9$=h9FPj W' @) l9QPW- 9Ҿ5=9 9R҉Y = 5@9h("5\9(o u 1PjhmS#h9S1P5959)1PjhmS#9S1P5l95h9S!1PjhmS#h9S1PS =p9 T$h9=l9GPj S& ƅ t9D$4)أl9t9 5999a9j5959hh9j5l95h9h9 4 5\9r  T$h9l9D$<=\9(3=b311 |$@L$ɿ1D$@PL$ QSD$,P\tǃrT$ 1 |$@1GT$ uGF;5b3r5\9jjh%5\9j$_x 5\9j Ox 1-R=L$ tKQ7D$ ;b3r5\9jjh%15\9WjSt$ tsQtejPhܥ'$ tQF;b3r5\9jjh%@1ܥ')`$Ph\$5\9l Z;b3r5\9jjh%1t$ D$13Phh$5\9k F9ut$ t$L$)4b3F9r5\9jjh%5\9j$v 5\9j v \9@ @9  ֡9 p9u55\95l9j5h9'=t9t5\9j nv j jhh9E p95 =p9( 5\95l9j5h9=t9t5\9j u 볋59999+h9T$JQ9T$ut Q;P l9T$I9D=p9yBu%hh rV F 5l95h9P豴 ;l9} jhmS#r葴  [ T$=9ujjh#h9 p9D$0l9D$,h9D$(t9x9|9h99t9L$(t$, 959L$0 9999=p9_ l9QZ=<39h9 @ h9 l99r 9֍9@PQ1959 F@+6vFt PN uF6^_ËFp vh$j USWV ՉL$99щT$Љ$ 39E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 99r7 9P59999$90D$SPt$V it}ŋ4$L$]\4$L$t&uE\99r+9P59)ƣ9959F1C4$99\$D$ 99ȋ$r+ 9Q59999 ^_[]USWV`}$111D$hn$u W uu5T+=>ut0GtgT+=;uT+=$8u ԟ3ȉL$91t*VXt@T$?D$D$t Vlj|$\$ |$t?1hA &S] t+8ttDGhu$j 1E L$36 th%d u3h$j tD$PW_ uh$ۃ|$ tt$ uh$뼅tt$D uh>$렋Cu/h# ;%tjh$VV VeSPV QVh$ ==Ph$h3Y jNUVQt@t $e^]Vh$j WVP։E>1ɉQPW臵 V?t$8t>1H^_ >8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKP F tvPv F vvbF^USWVP1k<jp3~4jp3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<jp3jp3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph3jjCh$djJV1=9%ZSaNt*jjj VlV賌5<u95<肱9j5< @9jPs9t#1ɺXp3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$dtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAh3jF\ W@$$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$4'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuL_=m$ 5<5<1QQPSUCt$V5<S5<%m1U)19}1ۋ$p$)ŊEt9}1< ˊEE5<Fh$1VV5<蟎UVj5<荎Vj5<  5<n5<<= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3jEY bxu+=9 9σqt$VkV4V5< Ih3jX ,$,$fUuE 9|)BfUh3jX ,$T$4xut EfEuGza|1x(| E9}ED ufMh3j!X !}Eu)u'E t uPuf;}]D; jt[D; tt$4UЃF4; ~ttt$4WZuE tuP'u }E uju}E9,Et)u*E t uPuEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃu-}EE tP}E ^_[]oZt$59t$t$h$h3JZDZ$@ t$St$t$ t$UPh.$'Z $A It$U59t$SQPh$h3rJ$j>USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$pPtS;tNt$Cj S)؃ QSVWD$pt G}uo $ $l$Atl$|$qҤKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufthp$VSwڇ|$Gu1PPw|$ GL$G)VQw0 w ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59#Ǎ PjQ' =9ۉ9t @tFj3Wj 91^_[WVt$ w?=3t-t)959r!Puj t;9slj4\{3^_59i9 959w59]xVt$59)9 9VLPh$^PT$D$ $1APYXWVPt$|$599 9D$$WVP1A4$^_USWVt$R5959>-9E3\Jك@to@uwt uDZ@t< ty< =9u =9tI59~tj 590"=9uj 59"9 999?=9u"59,~tj 59!j 59!1999 99 9f) 91ۈD$u9C59}t$L$4 59 ~9Ƌt$|259}VUUU9}j 59!|$uCj 59 KVW59d E߃ @ Ȣ9 9=9uW59|t7j 59~ %59598`999 959[ ^_[]t$Ph$VPt$D$ L$ $PVP1A4$^h#t$t$t$t$USWVP|$ \$$l$(t$59T9 9D$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWFj59v1ɉV,$E|$@t[D$@8tRD$u:hix%59^t$@59^h$59s^Wt$Dt$ hW%59M^4$b59zD$ 59z59{‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59:^59zth &US59^/)PS59 59`59r Ã~0L$ZD$  -= L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ¤ KOuLuH|$@tAt$t$D|$W3 Wh3j2( D$z19Dzf tN;L$$} 3DXuh3j'  $9A)RPQ $8GED$t+)j Pt$59L$9 9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P. 4$d0^_[]h#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59/w59v$tKۋ|$,;S |$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P[tC@j PEuL$$)݃} 9WUQS59賏ƅ|$ VƅtV5<4$59?PWC59TPWP1PPWN WuD$E|$ GWUPS59Pŋ=9VPW=9V0TPWVP599 9#WUt$ Sh:x%59ε1$|$<\$HD$LD$t$(SP/T$t$t$Ht$HWtIV4$tWV贏VJWUPpJWgJ^_[]h#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUPn1B4$SWV]^_[]h#t$t$t$t$USWVP|$ \$$l$(t$59%9 9D$,$VAUP14$SWt$(^_[]h#t$VPt$D$ L$ $PVP1ɉ4$ ^V59 r59=r^fUSWV $$$ ,:151:583::%52:W觠0":WVPy 8'Ft(=h,:tvvP跢 vhh,:&B>vuɸx9:P):1:2: 2:h%X D$|$ hx%SU e~o~1pKrtCGDT*:붃fg5T+=hR#VPhW \$h`#WJ> D jPhK$ t \$Sh|$W u4 y%8'WPWVu t }u몋}tE$th`#S= <=u͍4@h`#P= Fh|%V轟 04$VW H,:h 2:h2:hx%5T+= bS$$$ FmT+=D$/J1Wh|%su#D$=uD$h|$d}:h|%#s t61Wœ t@ < uFrWFk 1W9k jhtS$h$ AR5<oǃ5<o1FVVPWs\+:$kt52:5 2:W5\+:haf WVjVjhj5<0覌hh:rD$D$@V觜ljD$ V蘜D$1Åj2PϚL$t|$ o u*t$ %n ut$ {%n j|rjUĥtc1L$ <:B F@9u1PPPPPjPPj jUVPb4t(jt$W-WA11V|$ t$~144C9uWVݫj tPjjVhj#q ![,:j2:j"X*:$u誸t`=,:t jǡ jjGȜ/ 91 ^_[]Ét$ hT1GQWP Ph$h3u VW=h3jj,hlx%KjŹh3Vjhx%*VV1Fh3VhEh/{%VUWVV蜊 h#l# P& 6|[?= :t>V萙Phu|%W 5 :5 : :=`,:t>VHPh|%WX 5`,:5`,:`,:= 9uh3jjh|%e^_]Ã=d,:tá1:tt$P蜜 jqjjh#l# tP t h% Zjh.w hjUSWVB L$Qm  P Ń j h"{%Un ~ uF t$|$ W WfD/UWPh Wjŋ>7P6tn,$n ;nu:FUW}t^FPvetFljFn ~D$P轕4$试UV S ŅSd ^_[]ËD$L$I41@fUSWV1t$,:j%Vt$t$ t$t$4$jjVP;=,:P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15,:<Dž|9:VPX~Bjhy|9:jPWyjhx=T*:V/Vbu%|9:ǀ$jhxup菹|9:Ph$jX jtO|9:)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jPhtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVfVfSWV1t$t$t$ t$t$4$5,:jV#jr4PVf8 |9:$*tKuKt!Pуt|9:$P|9:L$$Q3 tXD$t$VSVx)VOu|%u|%t*VB^_[À)ujhbsu Vt5<1WW5< 5<u5<ׁSj X9;xhj_jZjC]jVkJ|%|%!}E'USWVο$WQS螓 Wh|%SO WSU肓 Whʢ%U3 S1tGUt0VVVVVVVVVVVh #h41PP/t US^_[]SWV$SQV Sh|%V術 SVWԒ Shʢ%W腓 Wit VW^_[WV1t$t$t$ t$t$4$5,:jxVtkjo4PV[5xG|9:*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PVf \$ 9tOL(tu(D, $ $ rt04܎ Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW| 5 :t@WPhu|%V 5 :Y5 :[ :sh &h}%= :t*W蚋Ph0}%V 5 :.5\+:,0tPhw#h%j[1e^_]PhD}%h3P j UWVV{ =`,:t>V1Ph|%V݄ 5`,:b5`,:d5`,:wh5b$h}%J`,:t81h}%W莄V虊Ph}%Wv 5`,:$10Ph}%h%j[1e^_]V1hhPh|PjjPj jjh3hи4xjP訪V輹^h3jjh}%  :tPjjh}%jt SWVD$x1|$ :t`,:Ps1; P]PVhW#Ws^_[USWV$$$L$$QPhV% $hR#V( $D$W1K4$ 1G9r6|$  WU豓ŋ$(\5F4$蔒 ÃugD$ PV=^uH|$dhR#V $t:|$G= :tVh}%hi}%PA 1KS1D5$$t 4$, 4$vu :tVh}%h}%P 1ۉ؁Ĉ^_[]UN$$$1K\ USWVu ED$l|$(PVWP)  ED$8D$1ۉΊ<'t  j Fj'VCu Vljt$ t$PS D$ t$ )VPh"L$Q,) h ~%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W貿 tW[ É@/ W[ É|$PD$S ND$+D$D$ .t Vt$W tSڄ Džu]D$T$L$;ȉD$Pt$ 諐SD$L$Wt$t$ h~%P' 뒋D$L$T$;t RSR |$\$$h%S,$ G|$\$1\$L$<t$0Vhht@W fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=<jP|$ W. 5<t:5<j5< f5<:t<D$D$(D$$1WSiD$ L$VWSPQ>1N|$p$ d,:hd,:hptt$$ =ȅ3\$hȅ3hbtt$( us=ȅ3ujjh$P&jD hȅ3hf@t$$ =ȅ3t0ȅ3hȅ3hbtt$(b B~%\$ȅ3 :t P覯`,:t P華x£1:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5d,:L$@EL$D$D$9}GD$hP25HPn|$u9Mx{;5<tVOjP|$ۋ|$t hmS#j2hPT2nԥ3H ԥ3~Х3#hХ39Nj|$tmj2 : ;5<t V &|$ t E%u15<]5<j5<__mt$(/twPuW D$td$8u-e^_[]D$t$ h}%jq Vh}%P 1S@ 1FV@ SjhZ%q? VSG t$V@ $ D$pL$|PSt$( t$ `h :t*t$ha~%P 5 : :`,:t*t$h$P 5`,:`,:hp&D$ 0u.hp~%D$ put$vm t$e s h :REtt8tjPB u%t$V6O 6h~%Pl j3L$1Phs~%0l USWV։5<1@P5<&]5<@kh 1PSU0 ,DhP9/DhPS1CSI0 CWh$nDhC%.FPU覎j5<K@)VUPRQ5<gftcjPv辰t05<PV5<w+PV'1PPV VGj^_[]h3Sj+h~%;S fUSWV-1@=$9$h%Pjq hyD$1D$ $ $?$Vz90[%VWz PWt$ S VWz G|$P%'3D$W#PWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P8{ FD$ |$$ ))Ƅt$8$)8 }? jSD ƃ $NfFlMJu1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p $9 )) hPh(9y 14'jVh(9` t1GuD$(Vh)%j@$Sj 1PPD$0PD$XPS#L t|$Lub4'h(9h%h-jSj"D$L1QD$PPQQSK Sh;%s1=(9su=)9lu3 *9DH$D$$Ph%0 u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV j!W|$0W iW&]hh%QCh9PPji=9 h9PPhh &h% Ph%j+o h!%Woh%Woh"%Woh%%Wnh9h0%Wn =9t!h9h<%Wn $9hG%WnhW%Wnhe%WnW&h%jtnh(9hh%h DŽ$h9VVj~j h%VJ 9defa1ȋ 9ult1 j hކ%h9J 9manu1ȋ 9ual1 91 9none1 9 tlf=9 tb=9t`h9h(9h%jtCh(9h %Sj~$$Ӄ9(9hhņ%HOh"Ifh(9hņ%h҆%hL [ 8 (9h~%D$ Pj3 ~ht$ h,9t t$j h,9芘th:%D$ Pj ~ht$ h9:t t$ʂj h9::t=9:t (9h%D$ Pj ~ht$ h+95t t$j=+9u:hD%D$ Pj@ ~ht$ h+9s t$'j h+9藗t=+9t (9hh*9pu=*9t (9D$1@$" h9S$Wls V*9PPjxV+9PPjw SWtt%(9|$$|$ t |$uj)9PPjye|$t jG9PPjz^h)9+ =e9u=ƀ%=r!ƒр%t܀%=ujQhe9r je9PPj{h,9PPj}(9u4D$D$Pj|$uh9:PPj|=9:q$q$t9:=9%t9=)9t)9|$ti=G9q$q$tG9=e9q$te9=,9t,9SVWQRh(9Ph*9h+9h#h,$L=e9q$q$te9=,9t,9WVQRh(9Ph*9h+9h#h(jjjm xP2 9%Ph$hb ha}<h(9h}%hS~ S"jrjQ$H1WWV$Pho%C t( ;$P$Tsh%jPbt^DŽ$ 1WWV$Ph%B ? ;$0$4&h%jPh`uq52: 1H t$t$}1t$t$}h%j<$t$j胙$91@$F=9:h5b$h%Z h/%jft$(Vt] VlPhi%hL%Wtf=+9th+9h%WXf =9:th9:h%Wt<3:1ɀ= :/ :QPh%hh`+:n 1^ËL$1Bh\4:WVt$=$9u jG7Wj 螄u1@l3:51:o1ɀ= :/ :%QPVWh2: =1ɀ= :/ :QPVWhT): 1^_Vt$V dЉh,:$^WV D$Ph4": u:$nfsu-Vh4":h2:~e Vh!:hT):ke tWj 蔃1F?t[h:hZ3:h%jPu>83:Ԃ%h4":VWh2: h!:VWhT): 1 ^_SWV=$9hU(9u(h%Q\u9h9h݂%U=9:t h%˵=9t h%赵|$h(9h%hW h5b$WƅVWPh%j[h<$V[=9th9h%Vy[ h%jj[(9uGWPh%jK[=9tDh9he9h)9h %V%[=(9tChy%Th(9h%he9h)9h%%VZh%jZh &h4%XPh?%jZ "%SWZh%WZSWZ=+9th+9hą%WcZ h)9h܅%WPZ =+9tPh9hG{$W/Z h*9h$WZ W趪h%jZhY%Zuh,9hf%nS=9th%XSh(9h%FSt VOj5^_[USWV։ϸjPP^ tCËl$hjWw ojh(9Wa WVSi S" 1H^_[]USWV$΋$Phu%踫u tW#V ^l$PSU ":<$u3:PVUWh%hC1Ʌȁ^_[]ÿ%fT$L$t$"u/ÁtuP$Ãt6u8h6h/u uh%!w'hhV D$L$FFh V~ ȃ ^SWVP1ۉSSWSjh'踅t{4$]1ۅtjSSWPjh'荅tEh%V. t&|$\$PS׃th%j. uVn Vm1ۉ؃^_[USWVm%'\$|$jSP@ ƅt Eu$wS7i_ wh &7` G^_[]WV'|$u't%|$ jWQm@ t u1^_ËL$̅34USWV1td։σSVPSWI t u6P1PhPPj D$PU9 D$t΀8uɃ<$uð1^_[]ËL$؅3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'Ey%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQh $V1VPT 95,:D$40$X@h7P@tt$45<FIhХ3tb 5<+9r ,:ɉt$ =1MD$Ni8D$$11t=i8,42:tǍXUS N݉|$|$l$$0":|9:ƀyH1ۉLPTXVUQ[ |9:" .hQPj[ VUh,:[[ ,|9:L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP|9:$()1HD,048Ƃ(1 ,:<50":6W2:|$c[ 0":P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً ,:ɋD$L$ӾV W#QSPSl$GU |9:$H@ VW#RPQSD$BP  :t% |9:QUHDRhԇ%P =|9:$0@ơ|9:$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-,:L$QP5|9: u<5|9:h_R$Pdž$l$|9:()8 0": 2:VyU0":VjPJ L$ D$@D$9 ,:yuƇy$u4P4 44S*$똋D$|9:$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$lMD$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4lMEl$L$),$|4xfDŽ4DŽ4lMT4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽlMD4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽlMD4B1hPPPPjPPjjR$Pjz4$1K|$$8h$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh23T |9:31@멃=,:yu,:,:s19dL$w BsÁt1USWVD$$|9:*t1G.$ )$Ph%hV l%jt(hfMVh%h% j$ i%W踢|9:$Phͦ%hV WVhL%蜥 ]h%Vjj\Q1PP3Ah jl1qm$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$̩'h%D$P[ %D$%X3|$0tPh1%hW Wh7%D$P l%D$F%zh%D$P %D$%i3|$0tPhU%hWP D3t#Ph\%j\$S3 S\$W D3t#Phc%j\$S S\$Wj L3"ttS$P%tWRhj%D$ P D3@F%t%D$l%D3|$0tL3tQh%hW{ Wh%D$P %D$%Q|3%t%PD$Px #%D$*%!hɈ%D$PU Ո%D$݈%D3 $t!t$PQh%h7t)$j4$2]tQ ]d3U$ :=,:t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh|%U EtjP.V t4$0\؁ ^_[]Ê$ hl%W $D$jV ù D$jQQPS S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh%SSVUh%SC$ Pu1Vt$h%P4$7[$ l$Sh#U@ h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ荖^_[9rwًz89y8rw19HUSWV |9:1G*ZƄ$h3%进h5b$h!$菞Ph8%jVC 5 :t |9:QPhQ%Va 5h%SC|9:)\$J$WPZx$L$@PQ $d$ PV D$@Phщ%SB D$0PV`Y"D$0L$8L$D$h "Pw\$D$H$194$h "WFuށǐW$WC SX;t$$ *h^ :tPjjhl%n1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t#$%\$t7ȉL$7 T$wX%D$ l%D$$'#$uht$$P*I %Pt$h%t=uD7L7qQPhR%u$$#d%D#t $D$ % $T$h%RT$ D$L$ 1@D$hw%RT$Ո%D$L$ h%R袒uD7#t$$D7#@t%#y%#t%T$(#t%T$ |$$#tÊ%L$,#tʊ%#t֊% #tފ%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h~%t$D?@غRPh)%t$>ClE;F{Pp\$CPW SUt$0|$4hh褕L$0QjP7. P8WCUtVh%t$y> S"U=h,:u#D$@h,:@@h Pih%\$ S0>h%S">h%S>=h,:thh,:h2%S= $ 1|$@VVPWho% ;w#r>#t>#QhT%S= h%ٕh%̕h%迕=h,:t h%評h%蜕1h%WL=SWoe^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ Ԫ'h%U-9 UeuhՈ%h%U9 U>FjVL1Ktljt$<"h%AG$Gl%G g+w<"GhNj%@G ${$l%C(s4C8Ԫ'hً%@C<{@l%CDsP$sTԪ'Sh%U;8 UstlSh%U8 <"U`@F$F^ g+FSh%U7 FԪ'U+@F $F$^(g+F48ihՈ%h%U7 UtlՈ%Wh%U7 <"U?F$F~ ~+^Wh%UQ7 FԪ'U?F $F$~(^48+4$iƷm۶|$9U:1Kh3%賙tzh!$臙tiD$h!$Pj記 XWl$UVt$t$ Q6POu4$P|9:Ph$h 1PP}#|9:)t5Phͦ%hU 鋔$ 1$ 91APuDFl9Ɖr:|9:Ph$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhf%hZ%hh%L$T$jt$oËL$T$jt$XWV׉κl%jujWZh#VhR#蘔 ^_V91ɾ 9r^^VD$9tU@8xtlIuAH1FVVjjhh90QRx tjh9jD t9^À=9tjh9jD 9USWV 1WWjbD &iP=SPj 3D t$ Má3D$x1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tE`R|$$t.jVjC t 3L$Nj4$D$/devG4$D$M[1O4$1O1V%M ^_[]USWVPD$tPpP11OFtFh%Pt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T%w%Phu"h%V5 ^_[]Vt$D$QPbLt(D$t%t!h.hPQgYD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$52:.@ujPDD$1҅D$t 9tL$BuT$ЋT$P]1hPPh5h5jjAPjQQh3w i4WPZw JM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h7PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPCD$1҅ӅtwU輅t\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$.IЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WFAŅjW1A{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ CD$$@$;E tL$ A;L$tI1۸hSShCShj t$pT$,ȉ04jj h#RPjV VSh$ht$ }G8@É؍e^_[]9=}t'fy"9 9NuEt FuXt1€1ɾ9( Ӏu A'w'9 ' Àu A&r  uȃsƄ\$,04t$jj h#RPjV $PVShT%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h#RPjS) W$mPSVh`%ht$ H -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h%q Y|$h%u wDžtohԪ'6wtkDŽ$v/rDŽ$/dev,$$VuP- D$/devf@/VuP- Q踃낋E\tu xt@@AED$52:$ttt$PуuN|9:덬$WPU- t$/devfF/|9:WPV, [St\as!a9aO$CQPU, {PWV|9:$t(tt$Pуt Nj5|9:,$1D$0$h@h7P5tt$G|9:PUutTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS+ $WD$pVG* l$ UhA &Va ǰD$h"WQthK$W;ttyh#W)ttgh$WttUh %WttCh4"Wst1A &D$t%tD$VPSI* VWS>* UhA &j` DžED$4$v PS} t"vh$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=,:SWt$t$o$1PWt$t$o|$u1@G3:uHs :%VPWSh2: wsVPWShT): 1^_[USWV |$ faa@D$$1C#=83:th%j83:VrPWh%h:vD$PUAD$h,:5:hg%j訙x83:rW!":u3:QWh :Vt$D$PWh%SR$'D$D$ =mdt2Vh4":h2:! Vh!:hT):! 1$hVSAv t$t$t$D$ 9jVV1 ~;Ƹ PV(D$i jQP e9]D$|$hqWwf/o ~#u4h9hh,:ǝ 21jioh,:ލ$9Hf@lMtJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Phh,: u`~*=83:t!h%jU183:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]h“%h%h'h%qUSWV|1ۀ=h,:t}hh,:h%jŕ ue83:%%2:h4":VWSU7 h!:VWShT):" VU#N@1 É؃|^_[]ËD$L$I1@Ã=83:th%j(83:Vt$ D$t PmVj=m5\+:~ ^USWVPWj<1F?tih,:h<3:h%j讔uL83::%Ҏ%h4":VWSUh2: h!:VWSUhT): 1^_[]SWVPVj`<>u1@;:Ԏ%h4":VWSh2:贍 h!:VWShT):蟍 1^_[ù1@t 9It1ùtA9t 1ùD$9Au9ËD$9SWVhflhy1$hWVq 㹔3WSChWWhTPWj659WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW9tI1r rr2t0u&1q1ur1ۃ0݃ctr @뜃|$tB tBB$u^_[]USWV|$D$L$BJ 0uQ=91۾l&-9B0t#1urF9tu99u'Cϸ99t099t90 59|$Q-jVPhS%WC,^_[]WV|$t$ Nt tuhێ%Ckێ%%2t%jjPWV^_USWV|$=3:t h :j;WWG":u3:l$}QWVh%hU詊 1PPk ơ3:t3Ѓ<PU'uu#D$=ueߋ$$$t::P{jۉt{uh%jz$t]PUh%h[Z$t::hhSjP2 jP W@(V7(jUh;%h V! V(tP$t::Uh$hi jj7ah5\+::1@|^_[]Ã=3:t=1:tUh_%ju C91$t::Vt$hI%VictV2:t T):`+:^t$-":u3:USWVt$,VRaD$j$t$V<to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44`L$|$)L$OGj$W<DžuD$@PDžj$t$0;|$1<$t$]D$PVhVVj D$PSo NjD$VtuK;|$0sED$ )UPt$VC 1D$44Uq D$44"`$D$D$ j$SJ;Ņm<$t$ >tV\$S$ V_$|$);\$u ^_[]h<%h.%h h%hSV531/t.T$ 39u9t 9t q/u^[V1ɍt$QQPVhe%O y1t1^USWV|$(1$PPWVhe% $D$(1PPWVhe% Z$LF1d$Pj%J4$>$ܪ'h}dC%Ueh~.hh %ehhUdWE5\+:WD$h(jU5\+:Y B'PPqhVjU5\+:0V]t PVW, WD$ PISt$5\+:VY 5\+:55\+:Sjh$% j D$ PU` Uh%c D$(SSWVhe%' $j1 h%fMuQ1AtCjVv u4VhA%"1ɉtjVR uVh%j) D$(SSWVhe% u$~hy%jTȁĐ^_[]1USWVhh%N`,:tPjjh%C81::::::::::::3/u D$83ڃ9t9u@::Q/uD$/u.::::19haj 31@|$>Z9M ::L$ ::L$j5<5<\5<.=83:th%j聈83:::::6P5::h%jaa3:Wj b0D$ttRN1ҋ0t1t /u oBrg9uƃ9::19uAuVD$u,D$ ::D$::1@9::^/ ::F::::QR5::5::5::Ph%h` jj\/_5\+:]19tvh%hu>h,_t$FVj.~th%j軆h,%j謆hX%j蝆1G99tht%jfh%_L$QPu{h%_$QP~uYD$3$L$3$ t?h%h%Mft!h%jޅh%h%a迪1=83:th%j訅83:]$1L$VVPQhe% }t|$ thy%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h &hI%{at@Ƌ|$]1Ph%S9 4$WV VVh%S^_[USWV-3ta1F3t&U7Jd1tUh$h] 111Fo u1tjh1@1^_[]Vh%]t$hPV hh9V x(9ƀ9h%Q#v j/Ph1@%::^SWVh%&]9hPVi VU9K5::h 9 9PVh%hW| jWhT#: haVbj<7 1hh%WWh1ajHj j j jVWW$94ƣl3WP*l3V9W jjbt$59h%WV0| h% \$WPSQ SȞSV.ju jja1@^_[UWVjt WW$7 W |$ hPW j W/tZ:: 9tV( #RWQPh %hhe^_]1PPj< USWV=,9uj53ǣ,9509u3Pƣ09^V=(9~Gt?O(99W WUS;9t109h-Y ,9A y(9$9$V y))L$H 9Jx .@ SPt$8 D$Ph9=(9-39|uP5,9,9QjPy^ P509m09 QjP@^ -3D$%=@t=ut-,9D 2y1,9D8 zt$h%t$ =(9-,999PB 09D G=(9V V/ $$,9B (9fJhezjQP?$Ą^_[]VPt$D$ L$ $tt$VPQ `,:t 4$VP; ^PD$L$ T$$RQP XUSWV$01D$$hI%WL$Ph$Q h%WL$Ph$Q h/%WPh$Qѧ 4$^Ph$t$ { D$ t$$h5b$P,LD$\$t$ hSz tt1h`#S 4$0POP$4VP u <.=tSh$t$t t$ hS ut$ Nt$N4$t$ t3h0Ut$FVj$~t$t$t$t$1Ʌ2jQ#D$t PMD$t P<Wh$h3CU jj$T5\+:y1N^_[]t$ Mt$ MV11N4$t$t$t$4$VD$FVjw#F^SWVPD$$h &hG%Wt@Ƌ|$4T1PhX%S 4$WV6 VMh%S]^_[hx%hI%S%)1ۅtH"t]" 1ۅÉ[USWVhI#Y PxD$1Ʌ$l$hO$Uy ti\$WPS 9s?hh%S =w%hVS =wjS t@hO$U|y u4$1jV 1Ʌȁ^_[]4$1AVt$VK1|TsrLc1f ^Vt$hI%VMtV4":t !:\*:^WVt$ D$wǃr9t\6tSPQj< V5<;V5\+: ;V5<蜭V5\+:荭5<_5\+:Q5<#5\+:^_WVt$ V+ u.>vZ0c*PVWh%h3u ϒ%^_WVt$ 0PprPGt$>FFVj F^_SWV=3/t/t$3GtPVKt /u?É^_[USWVj$t$ 5%1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$V$ƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jU\tMƅtPt$V, S3OVUP tP׃SV^_[]VPT$ D$t$4$VPv ^À= 9ua 9g"::S%>:]%::cf$>:i$::&">:SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWUD uD5<w |5L Ku1PPD$P )ƍD$Phd@Vg5 |$D$|PhedAV?5 V蔻f$1 GaD$P$,hӓ%t$V 1PPV $C]su PUhh(9t$t.)9CD001 -91 u=(9tZF9|4$襺ja$,ht%$0u6 EPPv jOhP9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$ t$$,ht%u EVPh$P EtE @E w-G$9@  V謹؁^_[]1D$L$I@P9wʀu9Au9 91USWV$$1$hWVL E jShWWhTPWh59Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur9A1ËD$1ɋ0t1ur9A1USWV ։D$ $E1$  D$$ ,$D$N% $Eh%u%D$$]%w%u%F\$$::qs \$\$$&HD$\$$)|$=,:=<3:=::$ <$D$D$Д%!<$Lq|$4$D$ ::D$% |$D$ ,:D$<3:D$%=$9u$ByD$1Ƀ 3\$p3C|$D$$$C%D\$$({|$!<$D$::D$p3{=3#|$l$ D$D$%$kljl$4$q K=$9u $fxD$|$D$$.$C%C\$$'|$u1=Z3:=:=::$ <$D$D$Д% <$~t|$4$D$ ::D$% |$D$ :D$Z3:D$%$juLl$ t$<$D$t%i$ \$<$D$%i$ l$4$fp > ^_[]Á=m3ftp]%=3PFSWV|$ty9GO4VS=tRV\ t{Sn59 9Vh959h~%hSb jShT# fGl3~"PptV薄Vm1^_[ËD$ 9Ɓ9 49fH 89fH1SWVt$99V~)S4:Q] F49F89F1^_[ËD$L$01j<fSWV1ۉShPS$ tD$$P, t V+J8VӲJ81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3Vy CI81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=,:1SWt$ t$L$ T$6D$T$SWt$ t$6D$ ׋X*:t$ t$(2%L$\PSWt$t$,t$RPPQ^ $,:1WSt$t$P6D$T$WSVt$96É֋=X*:t$Ht$H迍$PWVSt$t$%PPPQ]^ $VD$`Pjhq1@USWV u C(D$|$8hjWB wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QRJ<$L$ PP@ǾX'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$ tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)h{#SD$ b0L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDhj&WSrU 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$v0D$F@ F52:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPwGX FPvt~C $i)ىQRPg 1D7D77qfD7 D7 4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A #~Ou\$ @9fA |$tAqfAA 1AA tAfAA' A AufAA) 91jEVVhٟhhrjJVjVQPh94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch%P!"uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$4C$10s$C$s(!C(1ۅÉ؃^_[]h%hw%hlh0%r(USWVt$ kFllPv!Nj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ ? 1/D/D/D/ #~{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV|9:t$ 1$V[/} Vٞ$T$GD$ pjV<D$D$ 1ɺ<t$6t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vh%D$DPa D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P  |$YtZVRz MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV5 )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ,:}] aVt$ nt$b؉e^_[]USWV D$ 8t$8L$j QP荖 $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋,:1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hd$jV}, C `L$rL$DPhԕ%uL$DPhٕ%jQ@, D$D---D$D$sX*:CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh%P[ SVh%P[ VW S,:D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hd$j$P* t"?tt$ Wh%D$LP[ D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD $uR1jPPPhѷhPj jjj%VjMF4x!t$PW0V 1@^_[]h"%h%hh0%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ x'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh$jSW# t$]E}fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=:t@u.1}hGju tEx %rt՘%tØ%M u@=Uu,>t'D$ L$|9:;\M`|ˀuK(Ѓt tu tPjbjWi^ƍD$(PV$1 $$QPV] $V_9$ul$`=u]tP$PSv $5fǃU'V^Wh$h% uQe^_[]SWV0\$@1҉1 F FFF =:tjP4D$VjRRS0<^_[USWV|9:(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h%jkt1e^]USWV8=:EM 0~klP1踤ËE E8؃lklQSPG ߾$'|9:$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C u |==l$UhV uU t$V|$WhJ%蒄 :VWhC%P 5 :mhI%0RPVh%j[t1PPtvVD0$ t$t$Vh5%hW t$  :tWhQ%Pv 5 :ȼWh$hI%m 1 ^_[]SWVt$|$Fpc1Vv%tl%:)ȉB :tSh%P 5 :ASh%h%m WV1^_[WV1|$hVW hWVhc{?t[hd诂43:$jj43:A%t%WPQhWh_%h 1^_z1h~$xc1h?h%hAUSWV\$p|$LhjW t [13D$D$tt;un::03+txh%D$ Pj :t Pʞh֛%h:j FPG9f_PSh5%D$PjN :t#D$$PPt$hj%S \$S`$S<$s X3=0X38$Ph̛%h:j:D3E:h3#:h4$:h?:& 1 31Ctu 0ext"L$o oo/C G FL$5<|1WW5<< 5<.5<|D$LhKWWhUhGj&jFWjWVPW 4ƍD$PVV\^_[],:h5jP1xVHumhJVSWV|$D$L$pƋSVPh%W豞^_[fL$1SWVPӉh%h5b$P tǃuOWjj1h%M= :th%[PhƜ%Wc h%?PhƜ%{ *Wjj(h%4Vh?%W% W lth%h%Pjpdh%Ph%QjQh%P :t 4$Vh%P 5 :4$jh|"VK 1ۅV؃^_[ËL$1Bf@:"Vt$=:u!w v:1;5@:s @:k4ȃ(^Vt$=:ueN1w'P^ËL$1WVt$|$L$ ȉ1<ɉ^_WVPt$j Wt$0 9tthtB1^_1B^_M=:u<:ËL$USWV|$=:u1t$USWV D$ =:u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hܝ%hĝ%hehy%~USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW` L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$@:u z@:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQP苃 T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(@:u x@:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$̭'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ蕁 |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut(%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV~ >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDz l$(Ph&%Uq h5b$U [Ɖ$Uh8%jYu D$PhG%VFu wXw\w`hk%V/uPwdh%VuwTh%Vu f1ۍ{aE4'WuWuWh%Vt E< t<uEMPWQWh%Vt$<I%9|mS#PVwtC9z1h%WTtV D$PD$Pt$\$4Sh۟%hş%WS 1(^_[]h%h%hBh%h%h1hО%h%h h%h%hh%h%hhy%USWVhj~{1O1ۍD$ShPS$4荄9+ōF,PhedAUa l$$4$0$($<$8у|1҉$$tw F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Qyz D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$;$$h%jP r=t31>t9>u 9>t0uk9uVڇV҇OVʇU:1@19$,|;ЃV荇t$P:؁^_[]USWVHD$1PuهRhju;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'uot FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h%h%jg6h%h%jh(hО%h%jih%h%jj h%h%jkhy%D$T$ L$DrRQPv ËD$Djt$ P USWVl$j/U莭 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=:ui"sv<: @:@:tx(9w4Ju1AQP}ã@:@:H @:k4+$1 4+Vhj&jRw 1D+ <+ hsVPhX%jWJ 1D+'<+(D+($D+,t+0^_[]V΃=:un:) 1t(@"u@:t @:9t 4Hu1^USWV|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=@:u Zf@:~V19|(1@@89|~@w1A^_[USWVP=@:|$(L$111='"\$uӀt0t u@tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh'h\:V \:k :11Kj1lƃwDݸ'DtGCuޅtH=@:Pk@:t)1ɀ<t ʹ'AuVD|^_[1V @:t(@:1t ҡ@: @:F9r@:P{^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h%jQQWRjjh<%(,1^_[]USWVhu}WWPHD$T$|9:L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$hRjFjjS7PhD:貖4D$>vjhv|9:@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  #1ۺL$#PWVSh0RQO t$kPW#PShPV) |9:VL$'Qt$t$t$ t$PPh`g$hC%Ǻ|9:$0Ͷ$|9:$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC ffC C CfCC =@:rC fC*C, G1ۍD$(huSSSSSSSjjWPh貓48P胓@, t$VWrW膔FuQ1K5@:Eut P3ut$A5@:u1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h5%h%hyhC%BUSWV$(E]0輬ƋEp謬ljl$E@ t P蓬#PWVSjh\1U5,:|$ ww<B%t$R5X*:RPSQV U5,:w$w l$45X*:RPSPUR G\$skhSjPD P迹Vk:j!hi%V V踥h裫w%L$5X*:PRUQ hv$5X*:Pw%PUS hKPSD$Ph%hhD:s 1҃9Q:A \߉$4PWh8b$j$W. hWhD:] Nw@EƆ: Ft3N$t.1@Ƅ:-H9s Nr,:$EBL$ ;QUD:Vh%W\ Vh:W\ hC%&İ^_[]USWVX] E81h#PPPPh%PPM 9_ vSL$QSWPL t@D$ tWD$8uN T:uhƩ T:D$9H*h#Vh9b$Epk+D$8u RPt QPVW҃,:1VSt$t$2D$$VSt$t$L$8QRPt$ t$h%Ep?kD$V9p1h$YQVu WPTtY$UtOwGD$VPҢ)vVQj Pۮ W@ )Q$YQPZ H LCF;puD$VPh$Epj e^_[]USWVLt$`T$d\$1*kvs0C41GPjht3  9u vEL$QVUPL 1hPPhh}hj6Pjjt$(SP衅4ōt$ VPqwU腆Sbg~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5@:g|$.@:L$`ʉAfAD$ 1Ƀx fJ1O Sf1L^_[]USWVpU t$01^F4jj_1AǾܯ'D$ǃ@,'SPHD$ $|9:L1OًP|T$|$`1 |$0jP4D$DD$ ,:|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ h%jt$ TW $ ^_[]USWVՉfD$/D$jh%D$5謔t&裔8t虔SPh%hU VSUCE 991j/U| t5ÍD$9tK9vH8/t@PM CߍD$ PWD$%= h$PWY FƄ$/u&踓$QPh%hU- /h$PURD hh%U:D e=@uW5L x*|$VW$PD 9r>Z?O0|$W W201Ĉ^_[]hU膔 t}/u }$$tcD$UWƁ`|$tVh%UD 9=VWUC 9%|$W: x(W7`>1F1SF0jh*#j SWVύD$ PQ#1xVD$)tOjWx@ljj PWW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@j| \$hjS裖 jh%D$ƍD$ PhW@V| t$1hUSV ,$T'tWP܋u-X:D$C +E,$ !u1L$PPPPh+jPPjjj!Qhm4t$t%j=t$VWf_Wzn6V$ ^_[]VD$@t(L$ 4@L'VhW1{ F\:1@^ËD$ X:fH \:tPPQQQh)%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺B$L$~D$<P t3#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$#t$DRQPh%jV D$ T$Bj5,:QP膅#t &t$DQRPh%jVȭ D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5X*:t$h%jt$hVD$XP1WWjjj0賕,,:|$4D$0|9:L$QW<W,D$DPV[~ljӍD$DPV蛇|$߉څu D$$H؋Pٸ"D$<h%t$Z|$,] {t+[1h%S.t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$h%jt$hVD$XP1PPjjj0?,j D$DPV D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5,:PQu.|$ RPhd$jW蟩 ;X*:CVDSjP jPPh_:9 VG(^_[WVt$ 5<[5<-'~$uFjP@F$1O~(1h_:QQh&6h4hRjFj WjPv$h`:{e4F(x;F,VPOWv(afv$tlIut5t.j+ȅj,輅L$PVhռ%jPQ 'u tEj,j+荅L$jPPQ7 hmS#7j*fL$QjPT6 hC%j-?t$R5X*:Ph$jFVj j.h'PVh%hh`:B İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5,:RQw}L$RPh$jQɥ G<(\(|(Pu#]j#]L$>PSWhB%j&Q%j5,:SW}L$t$>QRPh%j&Ve $F|(,u)|$hgPh%j(W2 <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh$j(Vͤ 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhȥ%vZEt 4$B|$|$upd^_[]1؍L$>PWh%j&Q4  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V责 4$h^VjP lj|$D(dph-PVh%j(Wa *USWV|9:$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá|9:H1WjHDWWQZơ|9:$1$ |9:@u <@TX uDHXT=,:tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W#WRPPQ61ҍD$*W Q#QRhQP D$$W Q#Q1Qh0QP&)ߋ|9:0D$pL$$QL$.QL$QPt$SPW/ |9:0uNjpfL$$QL$.QL$QPWSSj'B0 hC%0+|$pG$DŽ$$T$0<$tT$@BfBBEffJ B EBfJBEB fJ*B,E=@:r~(uB0fB:B|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh%D$ Pnt5h%t$ nu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0,:)ދ,:\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$# L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(肏 L$)։t$ t$A52: 1Fh^%hM%h]hץ%HkL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4ZS0 tt<1^_[USWVGD$52:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1@:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDXlMAL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}:k<4LE1UЍe^_[]USWV1@:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=::t*=xM:11M<t9\@u 9DDMHEr=::tOTM:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=>:L:J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@xM:D WV:tGjhq"P8L 1N=::Gjh7f$P L O1TM:|t 9Lp=CuSW15xM:1Ƀ|t9TtPH= u#Oи0M:8zt9JtCu)Ή7xM:r4)΃؍L$tu)y8u.q$t"y8uqxu Hu^h$h%hm hC%@RD$x8u@h$h%hm hC%RV 0":; |9:tD2:t99t‹9u€2:2t 2:^WV΋$tRtt:t"h8jQM:u >:=::t!jHj)xM:u::=>:t$hjL:u>: lL:5TM:<^8M::\$1ɡL:L$iɐ $|1 $kt 8e 8 8M$Ѓ 8QPh%h$Pf =2:tAt*GL$xQP$AtuƇy1u0":y1LPTX) L: $ف80":ǀ,ǀ<j\$|SPN 0":"hSP7 9=2:t 0": 0":ǀ2:W0":WjPJ Ft L:rL$AE\$ 2:t>yu)2:9tЋ9u2:0u1H|$52:,1C1҉T TTCD ەk<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D ە$k:tPD$< @@L:x L$(AAXM:y yHًT$PD$P%t$ =::t0D$@@8M:1ɉH HًT$PVKT$ B1ttD ĘKttD € :xIfKe^_[]VD$:Hօ19fH^USWV4k$L<$PT8J^$H|$x'|uxP?"PWh%uD4\@xt 1ɍ$4jQjQhRVSЃ u fDŽ$4-L$QVSPL tt t 9uP ?t$$t$$wƋD$&$4WVPh!%hS` M$4jt$t$8u"DH $4jj h#QPjS胔SW"?D$5$4whw%P w01k,Cy uC,1uSPQD$=P_ Ph%D$=PG 10u?x@t$5w:^@111 $D$iL:P@L: 081tsuL089\04t$1Ɉ$$|$ |8tkPh%jPe\ L:Ph0%hK\ PhK%$U L:QPU L:8NuL$L(ɍ$~,QhS%h|$%WU hWVq L:L$L,ɋ|$ ~,QhZ%hl$%UDU hUV5 L:L$L0~,Qha%hl$%U U hUV L:l$$QPVhh%h.[l1L:D$ $ 88Ƅ$48ntyPh~%Ut$%VhT PV$ PQ L:$d8ntyPh%Ut$%V!T PV$ P L:$08"tR#Ph %Ut$%VS PV$ P L:$t8ntyPh%Ut$%VS PV$ P| 5L:$,8U,t4Uh׆%ht$%VCS hV$ P- 5L:$,88U+t4Uhe%ht$%VR hV$ P 5L: $X8l$~4Ph%hUR hU$ P L$ 5L:\8~~Ph%ht$%ViR hV$ PS L$ 5L:`8~8Ph%ht$%V#R hV$ P L$ 5L:h8~8Ph%ht$%VQ hV$ P L$ 5L:l8$~pPh%ht$%VQ hVU L$ 5L:p8~1Ph%ht$%VQQ hVUB L$ 5L:7 878hª%ht$)VQ hVU L:t$PUh̪%h;WD$L:ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=>:@D$1HD$$D$1i8M:$P52:\$ "$x 1ۋWSPQL $($0}U$W\ W;(|8/tW+(fDŽ/M: $< R(P$PW( t $L|$$t0|$t)$P't$'9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4=M:,$V5' PVh%hD$)PUN 5M:.#tR#PS1[ >tiD$Pt>ShC%hfT$\$ M:$DL$4L$0M:0|]t$V!Ph%WS M:( ( PQVhߪ%WSt$\$ CCa5M:.> >,>(>$> D$)Pt>Sh!%hTS$$(t$,t$(r  :t P:1` :tWWhl%C`WhШ%h3P :t8WhШ%PiP :1Ntjh%PMP ^_[]1N =>:tt$h/%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ |9:V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx:0^_[]h$h%hm hC%,USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4 'jP8 D$$tIV$WajWS W1O~ 1HD$11ۋL$QSVPL t#D$ uD$$;D$du؋L$tGD$CF 9rƒrt\$D$t_1O1ۋL$QSVPL t4D$ D$u-D$$;D$duD$3D$TL$3L$P u ؃tNjD$C;^ r\$u 1O1|$\$71HPPS ƃx:e^_[]h$h%hm h$h%h hC%)SWV։ˉׅt#GC@CD GjPS u/$j 5:h6oh71PPWVh_%U4du31PL$Ph$jQ= 5:h8t)u D$ h#jP= 5:h9t)u D$$h#jPJ= 5:h:zt)u D$(h#jP = 5:h;<t)u D$,h#jP< 5:h<pL$QPVh_%W ^_[]USWV$@1K $ $('_ 1hSSVVjjh=p$  /t$l$ WSUq Uhق%WS!< S|/D1l1_|9:, 1>WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h#US: 1USSVVjjt$" S xL$1^_[]WV|$ 1uOG Pt/1; }Oq"hL:x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h^2t$hPV $$$P'D$@{tUh%V USV 8Ouڋ$xhLuhMSPhܧ%V}C(~Ph#hV8 }hNHC,~Ph#hV8 }hO#C0~Ph%hVy8 }hP#VPhܧ%W9^_[]USWV$3u*11IhuPPPPjj PQQjh3P43Nw'$R($d'WP\1N1jWWVVjjhQ lS, T0D$4h#QP7 1PD$PPVVjjU D$P踀 x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jPp 蕧Qkd)Qh%Vq ^_USWV$h^|$hPWm $$$|'{hV VPhܧ%{hWvvPh%W[hXp1~,t[hYS1~0W[hZ6ǃ4V.uh^V0FT~Ph~#hW:5 sh[[h^1~`{h\vXPh%WF\~Ph%hW4 sh]mFd~Ph#hW4 sh_HFh~Ph#hW4 sh`#Fl~Ph~#hWg4 shaWPhܧ%V/[hb1~pPPWhܧ%S^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol|9:,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h#QP2 1PD$PPVVjjU D$P| x1pGp1^_[]1wwVt$F~|F P$ t1@1FF^SWVT$1ۉZBr 1Bl@Zp,Qkd)Qh%V ^_[V: á:th}(:Vt$:uh}(:9w1 k<:^Vt$=:u h}S(1t*u: :t:92tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h֫%h%hhc%| SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FL'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$:uh:s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$'@21^_[Ã!t*Wp1@<QKWPVƵ rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ Z |$0u$S8C4K,k0UQRPVh"%hW" $jhPjV蹻wƍl$ UhydP VsjUP踲 |$ $$$tVtw S@$A=3Do@u\u\FFCu$RàShB%àShͦ%I 8`1|$$GWh|dt$ Vn t$;t$tji9t$s#Vt$<$$D$t$Wh|dt$ Sh%QSP] Sh "QP! 1D$i,$$x,t)9ttUP? tAhj$V| jUVа Vh{dЀt$ n t$D$@9v4$l$ Uhydt$ V; Vq1^_[]h %h%hh %h%hhc% SWVL$ D$$|$(11CWPWPVVVSS$9t1t$T$ ^_[ËL$T$t$,t$,t$,t$,t$,t$,t$,t$,t$,$USWVT$l$M,1΅tt1Gt9r19|$G u (t9tu닆tlO3N03V, uO 3N8W3V4 tMBhj膶tXhVP M0jt$$mt8F4+GN8O E M$^_[]ËL$ t2:1USWVDD$`l$\|$ t1N11GT$\$XVVuuPWPWW $C ;C4D$ ;D$L$T$ }D$L$ hj苵ǍT$\$X,ىPt$dkt^E T$Xu_B G4O8)B J$4$&|$`th |$`th{D^_[]ËD$`ta%W谻ۀt9tSWVt$1^ tWWV u^_[USWV|$W D$\$w,tt 1E9t9sEuu&1ɅtttL%DO,u VO0jPtO F4N8G O$1^_[]USWV$1ۉ\$$ShPjuƍD$Phd@V VmE,1Ʌ1J$D$D$ ރu)0t!6u߃t Ӏ\$ <$tAu2uӀ\$׉ $މ׉$1OD$ D$<$}@|$u0t-uv0v,h-%jZ!VquE0],ۋ|$ut-us8s4s0s,hF%j Huhj|$ WV S,Ws0aD$H3C0L$D3K, KD$P3C8L$L3K4 5CL$QP ' ;D$t" VPs0s,h%jY {@D$XPWe tVWs0s,hԭ%j% {E4tL$Ph%Q. D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=::$Wh%jP 1t t^_[]Ë :! ÍD$XWh%Pj1~jDjtD$$mS#Vt$\avVjVvD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h`#W] ƀ8tt1tCuVL$ D$ j jV/{ É$qj jV{ t#D$Zj jV{ D$T$C\$ \$D$|$u\$uthh%Sʦ hVS軦 \$E61ۉSt$,j SVz É$ tbD$ ʉ $tQD$ D$tGjhdc$t$}Vy tOjhrc$Vy tdjhUc$Vy te|$ushmS#j:tD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}U"y hjL$tJ@j`PQT$觤 T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<W߅uv^_[h%hٮ%hhc%m D$ph%j iSWV=:5:t^s蕭3苭t{#$t$j(PV 4$I_u9hsj|$0VPh$jxW WVV &t Ĩ^_hO&h%hhc% USWVσ=:u h} 1t0?t+:t!-:E WP tt/|$thhA &Sٗ !hvSė u4$$$$$St$h%j ^_[]SWVD$Qt$Rh%Pj hmS#t$ke$jh'P uWhmS#jBe$tAt$h`#W 8tjt$2hmS#je$ut$O1ۉ؃^_[USWVӉ΋|$|$tBh?%S hF%S hL%S hR%S hZ%S h`%S hg%S \$h,#S ǀ?t(K$`'WP_ uE F@j`WV赔 -j(Wh tj)PW t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVUW |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h#WU WUUjUDH H>wѻPD$x0h#SU SUUjiU H H=wˉ|9:DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á:tq.:Vt$ :u W. :19vFt=NM:wu1wM:pz:^ËD$Hs-s 4'.h$h%hh%E Vt$ =:u-(t;u2L$ rȃsT'$tuXp:1 pz::^WVP|$t$=:uI-j PV+ =v1t-h;t M:t4ƌM:^_Ë $9u։^_-=f:tf:ù^-D$1ËL$T$t$ hG5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUhN-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh|,^_USWVP} uD$PhGf,D$PhH,1\$}UM;t;Gs} Shͦ%q} ~ShB%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh"%h$P $L1QhPjV辑x`WhydP D$VI|$t;jWSɈ \$;MU}h%h %h h%w 1e^_[]RSQ腈 Sh%RQ3 ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSr )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋HM:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SUj @$\Cǃ1:k0hWVy D$4WhPW$X~wD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(y3tÉ|$Uk#D$0jPUQt$(A31 Ⱦu#\$,hPt$ 觙 W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,Ph P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjArtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x P6+tn{ C K$;}sL$4QjSPL t_D$HtWM:)1ɉAw Puu2S"j@jP@ fdžUSw1ۉ؁4^_[]h%hg%hh%C USWV4D$L D$PhjpƋl$X\$T|$H'W=e F|11Kn^؃N$F Fdž?džjh>US! @džPWtwt%D$ D$D$D$F114^_[]h%h%hh%0 USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWY D$vP6Y 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%hz%hxh% USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715:5:5:D$D$ D$1D$hƲ%WUI pu T+=:e~ft$lt*zD$ƒbtCeubD$벡T+=D$ ChjVV5T+=hѲ%e,::zVhVV5T+=hN$:,D$Vu=ԟ39}4D$$D$l$ t%1PPUR D$yUh$IL$ tHt$(Uhܲ%V hR#6uRh%fD$0Pt$臃 #D$8=$$ ::jÍt$0ShV u UPVe UjD$0T ::Sy h%t$(g\1|$PyVy h*%#A y h4%vuWjt$U1St$U4$t$L%ShP#PP=t1hB%t$t$mU4$t$v5:5::(3|$t3:63t3=l$u1HL$(Qhht@P躇 PtL$* :t$JuhQ%lʼnPAUyh%T? D$ yhg%@$uBL$$4jPT4$ t$ V6詼6h|%jX>Pr h!j j|$WUt$  x>tq1.SPt$  yp 19u2::)uM 8t1FVh%1FVSh%V=t$ D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u 裣 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj 莠 U6YL$ɋD$tP. Vȡ PP h#PVh%h3w j V jV/ jRG VP ^Ð= 3u  3:@=u1HPT1; 3USWV}uCjhȑ:RN ȑ:ؑ:̑:ܑ:Б::: : đ::|$(jWN 5:5:::?X+=ؑ:ܑ:@1;:)ω|$$\$ đ:95:T$s;D$0:D$(L$, ܑ:ؑ::D$đ:D$$D$ =:EtQ1$w ww7wwVWVVN 7www ww$PWjB M$)1~~~ ~~$PVj 1@F ~~~~WVWM =:B5fDŽ$ :t$Ph$hQ 1F: :ƒ\$\$xT$T$|l$x&ݜ$݄$ &L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)WhI$QPY :9|ӡ:tPL$ L$)΅~DQ4))h#Sh'RhP$QPܶ Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4t'QPhZ$SWc L$(+ ȑ:T$,̑:NjD$0+Б:x@B‰L$hT$ll$h\$@: :1F؃D$@5&|$vqL$`\$dl$`&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4t'RSt$Dhg$QP  ::ȃ||=::݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h|$QPQ ƃ}u 4)hmS#QP+ ơ:@=u1H$VQP e^_[]+: :T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppu%h+%Wf 8t\ 8#u$SjVi tGtV $1E48FB$)Ex t$7@[h+%hN%, h+%h%˕ 7h+%h<%FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh1jPGuh`%hZ%\VÉhPKt4Vh1jP5Guh`%hZ%V1H^_[USWVp $$$!19L$PVW1Hl$U[ ƃUM VD$PWh tb$U9tM$Ttp $TPU t$jWc tu)$j4'W^U 1Hp^_[]Ë$j-UP&; D$L$PjD$L$PjSVt$ t P닆t>PvGdžW1ۃ1ۋt9P+Gndž t^[V蒒 V 1uu 19^SWVlT$|$$VPC1Nt/ǍD$PK PSW t Wl^_[USWVӉjh0jU ǃt{jjjV L$ Fi#t#i#tŃ%##t %؉껔#t%|$u#SQRPh%jhVǨ ^_[]USWV$=~@ 71Ha~B11ۋ$4V= <(Gs@ ,PVQbd C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)荐 jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$Pc ^GNON1wOWhA5Pw cBvEVE1H^_[SWV$uShǴ%hn%&Q $%~GuG$O1@G$GD$GD$ JPRv H tOt;HO6 8  89h%h۴%hPNF G8~ ~u3FVhA5jv ;Auh%hZ%Pt6hWv  t%uh%OPWVu  s V^_[WVp׉$ftPh%hn%O jL$PQW jjP@ PjW( tnjjW t\PjW tHD$|PWV t2PhA5jp @u6h%hZ%N"h%NW h%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jW;jW:5^_WVPt$4%@5@u^t8tW%V$%8Vh1;j%B#45@ubV,>jjP,. u h?%K,dž,sh(%[KjB3 t1t3u5$0_$ $1Ph%J _$ $1PWh%J^_WVt$ hu5#OK8r4@84^_6t8t uhP%W蟲j;A^_WVD$  uzuq0x t-@ hP%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uhX%ID$n D$SPU6Yt,Ǎۉ,$t1j@SP/ SUh%JI SUhm%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pu w_ǍCWt$P$Y ;)QjP h%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQh*%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYhU%Q{~PtVFDtt NLt}#t%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h]%@jjAVB u h]%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC Ph%>G$C$G>C>>l$ tك**PWQP IWtsDtZƃx t@ WhW%A>Whv%k>1Bj FNt*HN+}  hn%t>1KtJV @1| 1KGOWtQWVl$ GT$tIO9tA tBSh%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhhZ t$h%h%<$1PhҶ%<1F\$ MbihS$( EuVh%o<u { 87t { 8 uF띃tVh%@<D$$ \XPWoB5Ƌt8t* SVAuSj$(= ҋ>$ 1GOtHONG PtFAKuUGGtIO9tA tBG|tOxD@UUP# KWQjj0>[V/t?t$VtS? t@VS@ h%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/x 7 Vh)%hW#B:T$1|$`F(f9t(~ tωӍV QPRh=%9ڋL$tf~(^>8u(F*4$QPωF ~ tcF D$F*|$ <UWSPωT$IP\$Shm%:9 <PUt$W"PSh%9T$ V>t*4$QV:K H^_[]USWV(|$H\$@?h%Wi )h%W}i t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkbԟ3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtUDf t|$>@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp 3 D$VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4S` tE9uD$ 9t9~ ux<$h%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uh%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/Xh%SX_ h%SB_ l$$hWUi j-Dž0%$31K$ 8@DjW9u1,1@PPu1Ajj uD$$l$ D$D$ $\ %t%UhH'P$V?u$\uYM'4tQ6uD$럍Hv H w?$'T+=$Tw$'D$ %D$[D$PxGD$ %D$2 $\ $$$$`"!5T+= $`D$ %D$D$ %1@D$x ˀFD$9ԟ3t$ZSX-$`q-$$h$dԟ3)$|$t$$V|1UUUV;Å$U$SjVFދ$h% D$9ԟ3Vt$(VCԟ31UU4V^;/$$Pjl$4UAF@h%蓱 1h%$\u($\uh%V $XL$9 ԟ3%ދ$HSSY 6i#|$t#i#|$l$$th%QShn%j+UK $\$h 'h%脁 hƾ%藰 1#PPPhn%j+l$8U  $X$\$X ԟ3|$tD$$9tD$tnU% C$X$\ڃt@  u% 艌$\$X@l$$$h%uh"h%0)k"$jj d Uhjjh'$o!$!|$tYU?Hr?Pt$hҸ%S( |$WVmg 8$U $X$\$X$\ԟ3T$QR$4A $$Xh"h%l$$4D$t<t.<unh%< D@U uDh% LHU[T h% TPU5{ $Ke (Sh#N' h"h% h"h%,'$l$$$Zu UMuh"hf%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t PT $$Uw$U(UH$;$3t P$\P@1uhw%%$\t3$Pt'jjQP uh"h%%$H'$`h(35 $$\$S ^_[]Ë$r,u'ԟ3Qj$4J $u*$X1PQQ$ $$[@u h %$$VU h,%&$$X0 $\$X$\Uhqjj$t'Uhqj$$[h"hE%h"h4%Vh%#U Uh>mj2j$rh$Wb 8th"hY%#$X4b L${oZ b 8 L$X$\$\l$$hh% u!a 8th%h"h%# hh% u!a 8th%h"h%" UtUh"h%Uh%^"1$Xr;$\@ щ$X$\UEtePh"hH%b"KD$Pjh0j1@ B|hR#%UPh¹%1" 贪$X$\҃ ׁ u$X$\r>1rԟ3$L$QPU $X$\n%r ԟ3$##tx% t%WQRhN&֖UY#0t$$1:D$OhPVu h%!Vhonj$$uh"hZ% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x uͺ%%$4P; C$$|$9|-h`H&D$L$$PP # ƅUQh%1$\D$L$$PQl$$Uh}mj$\$puh"hZ%I$$h"hV%hj%&h"h%h"h%h"h\%l$$t׃z Ruh$\h%PHD$$P$Zh%? tRj$tKl$$Uh}mj$\$9t3'$\h"h%h"h %h"hZ%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$R Ph&%V$X8uDu4$\@h9%PED$$Pl$$+ɍl$$t#%@tD$$Ph1;Qj$t$D$(P4$01ۅ~ tVhEjj$vPBY WVjhZ%2t*VP uVh%WhZ%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQV u!h%h%S j^_[]Ã~+ajjj ˃ph%h%h̼% 1m>h&%h%h̼%W <Ph4%>h%h%h̼% 111dh%h%h̼% @+X1BWDP h%hܼ%h̼% 11G18 4 ى48rPyWeh%h %h̼%L t0LvPh<%-Vt$VtVhmjdjQ^jQ^Vt$V觺tQPhq% 1@1Pd^WVPt$D$uPhӽ%hn% jP, tuIhӽ%h8uM,z ,轿dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS4# F>)^_[USWV$lt pvh%PW; t=wM$lDoO 8th%h$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ U> =wfD @PUhh%Wudh%h_%htI{>tA,$fEC(ffEEK*S>RQP! C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht h3%8~>t$fF(ffCCN*V>RQP! F>4)mC Ph %$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0"M 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@kNt3yu%ytzy~ ~yNхuFiPv`v\1PPvX6D$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR u$03Wh$t$ 03= (1ND^_[]á(3ËD$(3@PW )3F SVt$ i hjh(3h3c(3 s1fà ; jSP  t< V1H1@^[ fVt$tYVV8VgV1jVB VzQ6v|`^W^SVt$ V葆1Kt=jhj t!jhjs 1ۃۉ^[V Vt$t'PY蜤džtP~dž^D$t$t$t$ SWV$hjW7 C jPW Whi 1NtF$$T$ !fD$f9t hWhia t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv : 7 : V1H11Ʌtx $BD<IG9uލ|$$ ^ F>L$jPWV uF>*PWVz 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0s VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV}4 Fjŋ$@VɈ $1WT$ȍD$l$C txuD$ Psot uAutF L$0QPl) tًv\$~;1$D$0PtA) tF9u19D$$"$8ЃD$P1~11TjT$4R4 t GP9|PX~11\jT$4R4訿 t FX9|XD$ 9D$H$~11LjT$4R4S t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVh%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV! CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$] l$D$m@t$ FGF<<y<$l$D$0P$0v& R`~/1djT$4R4T F;`|ӰD$|$0WQt$\yWh% $_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh%oW$7t)|$ jVW w_ jVS r2 1N^_[]j:SG t/@1UQhQQj QP G8mt1 (G8GjSP9 O t 3DPu:pKCu1l$PVhVVj US% G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS- F jPSm WSh~i tD$Đ^_[USWVP !D : : ::hO%F: : $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD h%j,jHt ǃL h%j,jgPt ǃT h%t$$Wh'V D$9rh%h%[H$|$ 7D$PWݒD$t$h`#D$PI ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$Sb J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0h%hW# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h`#D$PF ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U h?%U h#U $D1)hV%U 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS9 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$ `Dd<t A`Nh%<$Dt&u"t$ $<& 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U'J tu;uHUh^%'D$uuUh/$t$$t$$P$'t$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(ԟ3|$$t)`#L$# $ 1CƋl$ \$18 %s%ShH'Pt$t$Xh%j|$XYt$1VWjWWWWt$t虣 L$P9>t$Xh%%|$Xt$1VWjWWWWt$tT L$P9>ut$Xh%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$tF L$P9>gt$Xh%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\W  j,D$Pt$X=h%V. h%V Nh$V Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh.9#W t$P^h8t&Wf -h%WP h%W: Wh%D$PD$PzD$Xt$P jP#h%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\W Ê@tC< t< u CCu1j h%W j h%W 0jh)%W ojhP%W ejhI%W Mjh?%W 5jh<%W| jhr%Wd Kjh{%WL jh%W4 j h%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjP 'L$ r L$rL$ T$t$XV%1I $j/Vw uD$|$P jP= L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;$3t P 11j|$\WtdƉD$"V[ jWt>thZ%V  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb h6%b|$XD$Pn<a't$X轹 <PD$P/|$Xh/#|$\W  t$1VWjWWWWP辗 L$P9>t$Xh%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/P 1|$Pt@j/P tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 ha%|$Xmj,|$\W 9ƀx-9l$Ps%ƅ |$1WShSjSSt$t ,9ho%{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP Z  L$ j / % < t< nGG|$X{t$P$t$XW $ h%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU  8ut$Xh%t$Xh^%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vh%pD$PR |$XG D$P2 D$P" |$X6t$Ph7%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV躐 9+aVh%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t赏 L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$tw L$P9>t$Xh%Rh% %Pb|$Xh/%T Ct$Xh%W à \$S ƅ|$PPh%SV$  j Vflj/t$\ G1|$P# 1 t NOGN|$XC1j:WC t4A|$1WVhVVVVQݍ 97Xh% j=W FD$, h% @1 t  H@WhU%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQz HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh^%ZT$P   Vhq%)D$,h% hp%aƆ }h% D$Pǀ`h%f 1H$Ta Vh\%rN D1DDD DD.u h%  12D$,1h}$W>h%W(1h%W(hd$Whk #Whd%Wh%Wh%Wh#W7 h%Wvb h3#W`X l$h%|$WBX h%|$W(l$ h%W f h%t$W h%t$k h%t$ h%t$ h#t$ h%t$s h%t$Z h#%t$A h%t$( h%t$t h%t$b h%t$P h%t$> h%t$, hU$t$ t$h~%t  t KC  t KCWh%Ɔ  gt$Pq1pƅhiho%ottC< t< Cuh%GDžh%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉h%W" t-h%W thz%W t h%W t@ChF&V th%V D$P@ tsFH t t@@1 t  H@ttC< t< Cuh8%ƅhhx%sF< < F1$SUjQ tUh%t1C CC"$f8l$1USjxSjSSWń $D9]$ƃWh%- # t KCƆ L$P1SnF D$ PVC   7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hv[#1E1؄t  H@h%%1H$$<^_[]ËD$PǀǍ0PVj-N Zh%F -{L< < ChX%11_Ho@@V ыD$ * * h%2 C]{/< t< tCCB؄t  H@hN% yt$1VWjWjDWWS. L$P9>OSh%L$ 1SK 1I $K u7tc\$1SUhUUUUWk~ L$P9+tRVh%tGSh%謽1E EEEt kD$PƀE@TG5D=6 @/@(!  |$l$ D$%|$,tuWh%1D$, l$t%@uh%菼su h%rt1tCC< t< uCu11rWWh%{t< t< t Cl$Chg$WtWp Åu 1ۉ%@@=@u h%|$0t D$ $ {D$D$ $ tb\$0l$1ҋ|$498D$t/ǃ,1ۋl$4BST$ $ 9sx,C9(u܉9ʋl$\$0D$t W@1Aj,QP9 L$<$Qk,1҉T(T$T TD$4oD$,G_ tnV ǃ rVh'%ٺD$CWVP ݍ;)QjP "h%谺S1C݉CL$TrT$`t$\_s.NE*>ԉljUSWVL$D$ T$114É GE9u1D$P$tj~>$ 1W4L$ Q 9s: $T$э A@)E9uы,$t&hB%h%h h% 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P+ T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$PՌ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋR2 j=P ,$|$D$ V^ 1ۉ\$t?t9D$ 1j=S{ )9uWVS* D$\EuVͪ4$衘 t5ƍEjPt$  4DL$h'%Uh'%h3% |$$t#4$/ tzSAD$ tMŋ@jPW tJƋH ,h,#D$P u4$V7h|%蠲0h|%蔲4$h|%育4$Uۦ^_[]USWVPӉω1UVjVVVVRr 9ut2jS~"1GtGG ȉ1N^_[]ÐUSWVh% D$tHTNPRh%h,%hh% WVt$ t)1WWVn tL$@Tt8QVW ^_Vt$t$Ƙ^hJ%h%hdh%T SWV1SSQ t&WVW荢SSV Džu^_[WV|$ t^ǘ1PPW躬 tPWʩh蹑ƅthjV ^_h%觭1hJ%h%huh% D$t L$tHTh%h%hh%h%hh%U Vt$t61tpT^h%h%hh% WVt$D$ L$zVP9tVa 1^_ËD$HTt1Pt$ h%h %hh% USWV\$tF+1PPUC t.jVU1 9^TuVU@VWu^_[]SWV D$4toHTty9|$0uPLjPW֣t<Ƌ\$8PWShV%j W VNV ^_[h%h4%h h%h4%hh>%h4%hh% USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t Etu%t$ah%h%hh%h%hh% USWVHt4t uxjhh'Pg\ y /1hK%hs%hh% D$tEHt;tu&xÃxu x uxux /1hK%h%hh%q USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+c /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uP:މ^_[]Åt 1u19[:Rt1hK%h%hh%' h%h%h'USWVP|$G<t<$ $ l$W)Ã|WhVp ۋ|$t(ٸF\$$)؃|PjV; 1=:u+:W9u!: /1N^_[]h%h%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQY ^_[h%h%hh%h%hh% USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQg0 ^_[CPhҿ$WV 1t߉h:&h%h{h%h%h|h%e D$tL$tf HhK%h%hhvF&h%hh% VD$t&L$ t/fqPp QPI H^hK%h%hhvF&h%hh% fV$|'Ph%% u^USWVD$t$V1Ij0V1|$/ooo WVV5't-1C 'I?r   DE9u֋-'t/11C 'I?r {   DF9uWt$VP 1ɉt$\T$\RVQ2PwV|t 81I $ȃD^_[]WVP|$D$L$ $QPWR tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP豯 tbL$1tHh%hq%hM8| /IG?uWG9rD$^_[]h%hq%hh-%X USWVl$t$|$t1ۅu>t7NL%t}&}#tÉS1ۃ1Ct:tVtXtSh%t؉8txt@HtPt؉CjVat.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t' 1NA~0jh%W+ uW W G9rh(3螨 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%;S$t^DžtnjSWk  8thP%h˼#z9h%k1HzSlt$hP%hW#? tG11CGt0WD ؃uh%h%?Ņu1 ^_[]Ë$t|$u%tPWhr%h[% =mQPWhr%h%論KUSWV֊B D$L$$t W *QPDyNjD$$4$7@uMhI#5-%tQh%%W x PhK%Wb |$t$hR%W= $D$ D$h\%$U t$h%U  U |(6h%U 1,hU%S h}#Sz 'h%Sb hܻ%UL h}&U6 ha%U hP%U 1ED$D$AtG~DtAD$D$D$D$D$D$sjSȉD$4D$, ED$D$KD$D$D$D$$1D$D$D$1D$|$t<$ Phj%W u4'hw%W W$7$@|$L$ uPD$@tEL$qPt$h%WA%D$ |$t4$h%W詰 |$tJ$t=8t44$t%D$pHpDt$h%Wj|$t4$WND$ t7t1Ph$W D$ 0uWm WDǀ|$WD$(P D$ $t4%Ph%W; $HL%t$l&tRh%W Y$pHh%W <$@PPh%W $p$h%W 4$覞Ph%W ${Pt;CQt$(stPhhV tVh%WC t$Ph%W tt$7@#ǀ\$(h8'S$t0ti~ tVt"PSo9uvh9%!h9%1OĨ^_[]1D$D$h%W t1VVS虎 t]VVS舎 9th%h$W {ET Ph$Ws ]jUS> ŅuVSWV .hP%$V覿 (h\%V萿 hU%Vz h}#Vd h$VN h}&$2 h%$ hܻ%$ 4%tt|$"D$<u D$xuZ|$t4$euD|$"D$<u D$xDu*|$tjt$u4%$($$D$ $$t4%Uh%W_ Vh%WG 4$?%tPh %W u$0?%t@ $ t1tV>%u vuPh%W #V@th'%W|$"D$<uPD$@tEL$q Pt$hˢ%W;ˢ%D$ W|$"D$<PD$@LAL$qPPt$hˢ%WXUSWVl$t2E1Ft/׉˃PWhJ%StEu11N^_[]fUSWV\$l$|$ttUPW-r 1tk<.tgh#WS tUhD$WA tCj h%Wm t/tj.W蕕 tUWo 1t^_[]D=|Vt$ 'Bء03H 03;@3h(3j C (3H (3 Fut$03H 03;@3h(3j (3H (3 Fsh%' Fsh% Fshd$ F shj # F%%%%% %@uwxn%rh#r]%rR#% rG%r<%r1%r&f#r%r%Q F sh% F sh% Fth|$ Fsh% Fs hc% 03H 03~(3H (3 h(3j ( h(3k ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVh%h%h %US` 1N@t+9w');@MQP'At9w :)߉h%h%h%US ^_[]USWVD$<PFj t$ $h,#V ]NjD$@HD$?1jhM%Wc ujhI%WL u|$D$4Njt$0tNF tA.t;\$SPط D$P1U1HPUUUUSG 9l$u9t[,OuD$,Njt$(\$Sv 胷 t-D$P1U1HPUUUUSG 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h,#Vd Dž4$z14$z 1H^_[]4$z USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ苖 t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ V "1H|$0t1rЃ^_[]k ^ 7Q USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DH \\$ $2f\\ $$$T$$$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1x T$$t4<$t s%|$$u1F? 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElT 1 ^_[]ÿ: 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3VYf 18譾 1H(D$ /%tI%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjSG C@G jPS[ fC $4CCD V$4P( UShip C O*W>RQP UShipǕ m 1N^_[]WV%h%hh3%w Vt1t>PRQA ~u~uF $uG*SVP tu蘜 1^_[]fD$fx(t1ËL$ D$fx(uD$I V1ËL$ D$fx(u D$ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjJ`Ƌ$(@h@hD%"ljFuJ1ۍl$ShM%j U豲 h@UFuC2 8tǍ\$($PhqB@W]} f<$f|$ jUS~B ShlBW} txD$PhpBW} tZ$$VЃuBD$PhfB@v| t(D$FP?F u+ hX%[Ft PVP1ĸ^_[]USWVt$fFtV)vv vp AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ l FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPp{ ^USWV L$@T$*@h t$ Vh%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PSPVh%S'1I/ދ$0$4Wj$@U t|$r $,84$HPP$0Vh%W说SyGPVh%W芴$0$4|$WjU $,t|$w1Ћ $ QYPVh%$4'$4#]S'PVh%$4T$ }ltE$u?ClhPhhWzWVh%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Phj<Vt$$@$@$L0 >}k|$`$0PJDL$L$QWhj<Pt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Phj<St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V\ t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$  V1(^_[]ËL$DtD$L$tPVQ\ D$ƅu螈 SWVD$ L$tT$$wy .11t$|$X+9sI "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`5F`^SWVjh0jJK 1NǍ\$PSPhWetrjSjjWret]jSh@hWWetBD$$1ɉ $L$ L$L$D$fD$DtD$jPWY[ t Wg^_[USWVt$+VjU=Chu,$t#tVh?PjJ=^  r%sJ%PSh0%PSh%G 1Bh? ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%F ^_ËD$$PL$1Bh?: SWVt$tgw]Vh?ja<^ w$~PSh%E GLhl ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%?E _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%D w$}w(3<PSVhP%pDG0GHo% w$?}PVhv%@D G0GH%c1HG8G4 w$}PVh%D 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( |&|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ |&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P{w0PVh]%B w${w0PVh]%Bt$6u$HujGtGht:?%tP%I\%GHPu萪j19c@O;Au<t ~%?uz%GH0ts]Sh?w4Q 8ShFw8P7Sh|Gw0P7C w8w4Ph%A 1HG8G4]@uPD$u>C wiVPh%]A wwhV3uVh%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;th(%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h %h%hhG%w SWVt$^ Sh%L?G0+G8PSh>%> Vhlj%51Gh%WFiP7 WhW%>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3VhmjP"/uh%hZ%=^_[]h%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(h%h%h hG%3u PPV&5 tSE EdP $PEt]U$uu hUJ]CF Ph%c<6u%EHPVQ Vh %< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$hUJVD$tF9tAtIdtI;u D$ th%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V><'C'C'n w$sPUh%: y1WVVWU0VhYSU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLih薾 D$ɀwȈGGV*QRPI T$  |$t t?t`t[\$XSjeD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @G D$ǃT$L$ |$,t26u'Ct!CZuD$)$fPT$ |$D$xShP诨 D$88jP耮*wX¹ sK t@L$)9 T$G+ AQRPJF D$ǃT$u1D$,t8D$)>f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$Poa PL$|$)9 OGPSQD ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSPzB \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Ph%/t$=$]tVSt$Dj`%e^_[]Á G AQSPzA ǃL$G)ˁ+),PjW%j ,1OD$0@hX|$ 1|$CD$PjwǃSt$P@ G D$G D$ GGDCff_f_1ۉT$SfGEh; fGG@D$ffGScf f_ t$WhD$wK*PQt$B u)C Pt$hF%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Px(džx|tP dž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`hK ƍG 4$D$,$5&D$\$$2%&Wh`Vj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GHU%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWh|jPhi%hZ%$sY EX>@P UB( A J*R>RQPJ6  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%O# Pj0Q1wLw !w wL$u]rruG XixiF SPh%" D$h$PS61Rhi%*#@uB3EpCP t: @ NH M plYhy%"u Vhu%"h%"ޥ3=u1HL$h$QPe t=w:F h%Ph%c" w` 1Ƀ8tmF SPhW#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQP3 h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$:XPVh6%; M+1Cjjv؃^_[]ËL$hlYWVP֋T$D$WPt$K 1Ht<$u 1t ɉ^_ËL$hlSWV1{\t^_[Éjh~,Q C\t4Whmjp4 uh%hZ% W 8u"543h%  Wh%hW# 1NcD$T$ PUSWV$$($$$$_\ftPh%hn% ch$US迼 t'sPUVZt3_\t,Ct$?tF Ph%hW# V$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%hn% t `xjW0 tD$ WV h%6`(^_[]WVD$ t01r9wu f΅t0^_USWVӉ΋$$D$~ #5;L$GTK9u@F>$wGKV*PRQ T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9wPjA GPB%t$t$t$ VT$4$L$ T$D$t)F t$Ph% t$'L$ T$|$tSh%ViW6跙VjWfVhU>t$WIGPuD$xgD$@ @w"D$@@wϹкQ%WPNjt$$V t@uxt:?G@L$AG$GD!T$D$$Pj6t$O |$$L$ A<Źh%t$t$t$ V9tHhj1WUkVWSVhU>jS%?EtT$jjPt$ ur%|$u%%D$ @<6|$uZEtTjjPt$ t>D$ %t$t$t$ VI%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$P 6Vh?j|$XtVh|Pjh|j|$ GPG $9OsP4$L$ A t=|$ $OQt$P G@Vjj*h% D$ @\$ sCCCC C KCK1{ {\%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$h%Ru= \$ t$t;ED$PEP( $,uzh% $,tKPL; Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$TD4$teSPh#Vt$Wh%t$(C #ۋD$t$0B>% PD4$L$ t/PUVt$Wh%QSPh#t$Wh%t$$$PUt$ Wh%Q h% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$BPVh,% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Ph % v 1F FFL^rL$h|ËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F PhP%lOhGL^_D$ȅtȰ (1SWV\$C rG 1H4t${GPhVC ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh8'|$,WEdx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVPl VVPL ƍF8Pauv3TV[hVP/ SWVG| WD$,P\WjVP ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0S tzVS,~xF| uF|EhtF|FXMdQPeV$-9tVTVGS1PP\$0S ƅu\$ C$t$|h8'D$P]1PPVp ƍC D$~gV_Vn8U_B1PP$ 9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j 81t7> 8t- > 8t#> 8tG h%PhW#\ GtO9KuS ;W t u^_[ËK StQSP Svt9_duGhGdhvF&h%hh%6 Vt$u.jt @h %1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGh.%1lj$gL$$\$ G Gw uU6 Ʌt ѹ )QPhl%jVS D$h @$n$tt"D$$0 6PSVUh;%WjtGt $AG8y-; 8th.%hZ%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQhl% 2C(K,QPVWutAhAd ~: 8u0t0t 9Ft!6u Wh%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&8 G8 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u&2L$( Ʌt ѹ )QPhl%jWNO ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]h%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yr6 t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU( i6 8th%h%t$@s"j@{Dž@7gt D>tSPjjS> t'O N ONWVHHN@LF |0 VUSWVD$1tW8tQ\$l$G@tjUP萬 u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y 0 V1H^[ÍQF*v.q Au41USWVL$,Afw\l$t o*Sh'U Sh'U TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUf{ V n 1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPS t=m<$hj.PSj*q 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p 4$Ul 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPU4 tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$ 1H1^_[]SWV\${C KhQPWƋD$dž^uC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h/% GdD$ D$1xG O4SQPl t $tsOdtYG %tK#%OhQRPhF%"Wjz[u! 81t 8t hX% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPhh%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhQj苹D$ t;t$(h}%j6h%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  sh%V*^_[USWV] D$@Cxt$rj.VL$0QjU |$,wVh%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPhF%h%9e^_[]T$rRQPh%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPh% RQhg% \Rh%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVP{ L$  uhj议ËD$CNC KFCF CCj.L$vQP Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$hZ%|$$HL$Xxp jP$P/ D$<t$h%|$rst$hq%$p΁Vt$ h%t$$蚻$x|$D$ƀt$h%B1|$t +D$(t$( 4XPjQS Vt$D$`Pa \$Zt$h%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h %e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h\%t$TD$u%D$6jϬD$@`L@O|$ut$hZ%誵몋sLߋD$,9CPut$,t$Vp VqGPD$$t$,әGLtbt$,Vt$P wPD$(À|$$*"D$$ h%s|$$/W̩!t$4q t$h%Etk,΋D$9t ,JutVt$4q t$hB%U|$u/j |$u$jt$ut$hJ%Դt$[t$4t$t$hd%葴|$$tL$11BL$jOD$(D$$UWV}u WYh8 ƍG 4$D$,$5&D$\$$.%脳WhVj覩e^_]WVt$ VhW辩VhW觩VhW萩^_SWV|$G Phf%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWP tF F^_[h%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%RL$jQW u h%許$BHJAWhjj G Ph%۰WhWh iSh%,Yjt7UhqjP*@h%hZ%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%ï t#@uUhz%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%賮j봋4$VUh%Ю Wj`Du! 81t 8t h%L$o@G WQSRPUitDD$GdՃGdD$ j.PUj_A t'OQPhl%j.Vu h%z)h2  WhbPj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWah uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuh%Ph%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%hn%藬 jSW R tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh'%2 PUb D$C,9r|$t"w 7h'% PW, ,Nu^_[]WVt$ tqwgVhjW1GGG G XGt0^_# Vhq%hW# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUj< \$wWh/%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVc t0 D$ PSh]%̨ ^_[]hO%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PSh}%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%觧$ WSh%8 F PSh%y t){4t#D$} t*tu Vh% Vh%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]Ep%f4'9t Qf9Au<< <\$H $0'|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p Vh@% D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPh%D$`$T$B%y<$tD$xa%U$l$ |$$ PD$$PVh%D$w 1L$ T$t$QPR!SWVPjh0j蟤 1NtKljjSj hPt $jSjj)Wɾt WI^_[WV jh0j- ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW־D$jPVj t?jWj$j)V t"$jWh@hVu%h'%V0H h'%1N ^_SWV\$|$1tD$d'1ۃ ʾrft1ۋhDjH(H,| t1ۉfǀ<fǀ?WjhPajjW蔭 t W G Ph5%>WhW˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Shh%P o1@GGG,G o$ t?t/Sh%hW#Vhj jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPShjPAh%hZ%$1ۋ6<$tD$D$$t;F SPh% D$$hPS6$Ch%舜Jh%ޥ3=u1HL$$hQPNB Ã37@$:VL$QRP,$ \$\$TSjbjp D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%КT$E|$wD贏S(GDtL$$SQP _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u2< 8tn2 8tdD$ Ph%hW#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh'%讙t/Vhj j`1WhI%hW#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$ J4$h%hW#_ %1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 t%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5x>dž ^_[]É2 ^_[]L$1jSWV|$Whj׌txWhS豌WhS蚌WhS背WhSlws^_[SWVt${Du ?~ Wh%P͓ 1@1ɉKCCS(C|S KtHd sHdit x@t^_[Wh%hW#諕 ^_[ønL$x@tBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O WhjPuhX%hZ%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vhh%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hhWt$$t$$t$PD$\0 t0L$ D$ PQhhVt$$t$$t$PD$\0g D$ L$)1H t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s L 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$'   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ Ph%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N й(H ̹(H ȹ(H Ĺ(|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%S D$P4 uOt$ pffBfBpɋ<$tXQlRӝ ڃ p7t$ffBfB<$tD$WVPR葝 ڃ L$t3D$fffBt$tVWRωX ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPٜ |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$%h.%虁 L$A@A|$tG 9rʋL$Q0ʋIV9NJ$tVQE PVhP%$ e^_[]USWVL$T$ft/t$ |$v/_f9rGf9t')ux  k 1^_[]ÅtfUSWV0΋D$H|$Dt?|$Wj PRуt!f|$w/ Vhx%薀1Hkfǃ< hʼn\$ fft>D$ǃL$tJHPdtKWUP D=l$_D$ fǀ<胾 1fw ')h%R|$Qh%j W D$l$ f9<t1}~ QWh%P(}t$sf< fu.Wh%~й(Ex̹(Etȹ(EpĹ(El6tjsuD$0^_[]USWV΃|$$w VhS%~1H׋R 1ۉt$$S1ItU- $]h]d]`\$,Džu\$Sjƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vhn%&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh %f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%%t|},WVh?%} ^_[]V΋Qhjr1ɉHH@@ @ @$zt ^D VhY%hW#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VP6'uVjjq-wx9Dth%Vku Vh%|{^_É1j9VދL$t1Bh%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1%8WjjpD$$Pj<$w$'8uJ5%=ǃ8%8u+%8u%8u <%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ hD%y ؋?ut$u {`<$uhs`t$ hf%y 1CdC`<$t%t$~sR)BKh<$G Ph%t$Ts t$$Kd<$t$W shQPRh%t$$*sj7D$uEG \$VPh%t sHsDhV7-uVh%u~|t7OdШ u( uG@jPw蘂 Odt Od tD?8|$W|7'6tjke^_[]Ë<$G PhA%sOChwPh%t$r USWVd|$xwӲ 1HD$8L$D$ @|tHdxHdD$,D$`D$ D$D$D$,Bf9A)fftftf  $9v% t$h%sT$BUD$PD$(P1 L$8,t (1f9Zu2;t$ t A9u19uAuD$7@u.j D$\PjD$,PPt$ h%Jr T$Qfua1D$(D$$t$$)L$1UVT$u D$ ƀ>1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%q:fD$D$D$PjUVD$0T$4)̓w!F t$h(%qfjPD$DP} D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$hH%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%o0 t$h%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Phm%Ent}u^_[]8Vf6!^_[]SWV΋y Wh%0n 1CCCC CC$Ktl^_[Wh%hW#0n ^_[Vt$F Ph%2n1B^L$lVt$?N Qhl%Pk 1B^_L$}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀL/艈L/f$HC;,T^_[]SWVt$Vh0jvb1CC C XCC~ ;u Wh%5l Wh%ktk^_[Wh %hW#l ^_[ËL$kVt$VhkjaF Ph%k1B^]Vt$?N Qh%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hn% k tjS0j tD$ WSVn h%j`^_[]ËL$VVt$?N Qh\%Ph Vhj?`1^L$2L$@ <3 T+=B99T$:,=Z(D$j P5T+=#> 83 T+=9T$:@=cwRED$j P5T+== T+=D$0؀:؋L$9Φ 18D$8j P5T+= D$誦 98} TءT+=8B؋D$8Z,# <  <T+=X*|$W5T+=ZP<} 8yeT+=D$# < 7 !<# < D$# <  <D$j P5T+=\< T+=K9BT$:5(<I1L$xA AAL$hAAA :h,<QP5T+==,<wwh0<hx GL<W} T !<@0PT <1Wh(3DM=T3=P3} <T+=D$ !< Ck "<_ <T+=t 3xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQh$P|HH=w$)11Ҋ0:B9u9~ <u7h#$> ~10:Ph:## C9uj 4 \$$} # "<  "< <@ <%"<D$P5T+=T+=8L$9v\$$ND$$&9|$D$ fD$ l$ |$Pl$D$PL$T T3P3L$LD$Hl$H &|$ T$ fT$l$\$4l$ T$4< uh%@< <@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f $<@xEh&j:QhK%Rh%h%Qh%QhT%P ԟ3)΃\$$ <j.SPl u S )1?$QSPl Ƅ<t- 3CҀ|Qy 3LQH 3@u܍$1RBD$#jPW VSW D$8WPU|$XWh&j D$8D$dh$VWj(VC ՟ 1Ah%TQhh%Z5T+=h%H5T+=h]$6PPh0%" 1Ah4%Q85T+=h%5T+=h%hhg%1FVnPh%V81uS á <t=<3 h%)1t$hFFFFFFF :h,<VPS茏u&=,<GtÉ`<Guh%-P蹎Ph$wPhd<q w wwB <y hnG&j7!<@t5L<h0<Pr L$!<tG$jVj'j)5<;|jVj(j)5<|IPJIPI <Шh%)$PVjQHud$xt!<th%$ppj0j)5<{uc$h%P7PVh% u2=<3<r-0*hR%}h9%s<<30 WBD$u h%Bu r(:@9u <1<< < <DŽ$ <@t$jPjh5<fzD$8@=l<u2D$8jPj j)5<h%P1|$L$8jQj*j)5<yu h% <rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5<xy h%Q!<t+DŽ$j$Pj&j)5<xuK1ۃ|$$83D$,tD$t3S?<uhG%h,%ƣ: :|$$tF1FFFFF  F)F.N,: :9rF t$ƃ|$t.t$)L$Aut$hd%+83D$,|$,tF)F/83F !<@;DŽ$jjj~= y h%1<l<8<p<<<t<@<x<D<f2<'u|<H<|$tjt$ j.j)V"w=83ujh0<VA yPh%UPh83Pj)VvuY=83tjh83j j)Vvth%$Ph0<VW yh%h%h%VD$ <3 | h%%$jPhh5<vt$8jVj$j)5<uy h\%}- jVj%j)5<uy hy%W-  <H H r8r <30 s~|9~ h%<t$jVhh5<=uy h0%jVhh5<uhF%d8<3PQh%R <Ѓ1۹<PSSQVRh0<qv<t #Qh%  <ЃPSSPVPhd<+vt #Vt$0tWNu^3Vj Vj 1<<L$?V1Fh3Vhh & b V蒥 USWVX (<<t91ɉ $: :1GH < <Ē<f < r+rm ]1sq!:$:Y!:$:l<0:p<4:t<8:x<<: !:$: t1 : <<(: ,:f(:<3Uf : <ff $:f&:=<u"t$@jV @ ȣ(:Fȣ,:<3:d<:1L$@A A :Y ::Ph:5< ƅx9t&y h6%) VS5`<h&a  <uWhI3W <ؒ<<Ԓ<<В<<< u2ء<<<<<< P؉+<5<D$8t$8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5<t$PV;hD$$HL$L$ 1x1PPPWR jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$<D$PVP輒L$@D$D$ 1 G|$<$D$=X3$TD$j=hp&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hp&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=hp&P Ņt$,]zl 04$Q"hl 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H 5e dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=<u t11jNt<10<<t Pm1@hR#h& <1USWV1=0<MT$ l$(L$DžD$5<hh1<蟈  |$t$f:#j h1< / D$1<hf:#Vۀ<tUPXU uTWV躀 <WV諀t7j L$QP7 x#L$9u$<;D$ D$uL$us <8 <APQ~ PQT  < tuQhh1<蝇  |$u0<1^_[](<4<4<1Ҋ+~,u"1t$L$t' t" t΅tAL$=P<uP< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=,<u#0<<tP{Q <t <1^0<<tPGQ <VtJT$1Aj<ƃ=,<u#0<<tPP <t <1^t ,<t D$,<1@1USWV D$,L$(l$$~ )$1H$`t ,<1A\$9|ωL$ tgp9tX tt$ PLR t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$0<<tPO <D$,L$$ ^_[]f11f11Ã=T<u /t(X<11hh<PjNtX<1<T<t P赆1@hR#h&?{ T<1USWVT$1=<+\$0L$ D$D$|$(D$5T<t$8S l$,D$ D$D$t$j SN* \$1 hf:#V|E|$tt$(PP u~f:#WV{EWV{t^j L$QPn| xJL$9uAE;D$ D$<u/hf:#V{tj L$QP-| x L$9t[ T<8 T<APQ~ PQ O  T< tuQt$8S貂 E hO$V{EthO$VzwhO$Vzahf:#VzEHhf:#VzE /hf:#VzE$j:t$ ( 1@|$ u<1^_[]WV=T<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh<hX<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=<u+<T<tPL$L L$T<D$$tˉ01C؃^_[<T<tPK T<PPhh<hX<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=<u+<T<tPL$=K L$T<D$$tˉ01C؃^_[t <t D$<1@1fUSWV\$l$t$VK PVW UK PUW SJ PSW t$ VJ PVW ^_[]WV t$uRt>DžtA=<t ^_Épxj Ph" ؀=<u1F1=<t0Z 1맋5\3X #QQh&PփV USWV1ۀ=<t ؁^_[]Y D$ |$GSSPh<jW&u <' < <r1H<#1ۃt2u3hWh& D5<~ȍQ2w$'<PAu <?$D$-\3mW h?`#L$Qh&PՃ<`3@<d3 <I9@h3 <I9@<<<<<y<p<g`3 <A9~WH`3O<Fd3|R  <<1h{~j v1$D$D$j D$Ph"ؾ +V9 <s^3<t^USWV$l$@]ub\$<ro%UUUU)3333!!щ%is8u=<1E+H!9s,=<1 Q=<1;<9v <9r?9w;<ƅtD$801=< $^_[]Ë=<!!׉D$9_|$T44$9r)Ɖt$9vA5<9^=<!9ً $r <<< <T$ D$T$1Ƌ <!C! $)މ)ʉȋ <|$ T$t"Ѓ 1ɋT$ T A9u <T$)…t0|$L$ɍ<)<$ 1Dt%ƍC!t2)É$)t*<L$ <$)PD$p xPh<? =<=<WjD$hpj Ph"荺 5\3O #QQh&5\3O #QQh)&PփM 111{PZDWhV-M ESWV 1L$ |$ ru\95<s(>tGǀ=<u.;=<rN;=<rD< DžtVjWL =<t^=P 1ހ=<t& ^_[À=<u1Ffu]pxj Ph" 뺋5\3iN #QQh^&PփRL NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95<95<H_ŋ <!9r؅ <9s9s_< 8!9t.M9wI9rE<8! d3!9u!=<=<<Rf ʼn9rPVU>!  8!!ōD$p <PVL$D$PVt$8 <Pt$jUVnthŋ$L$Ai Qh<=<=<u=<)M 1=<tM^_[]t$h<O=<1GDu3t몍D$0xhj Ph" 5\3&K #QQh&PփI 9U7)SjZP)MPjSH :9/ $)QjZP)PjSdH tƉ111USWVˡ<!9ta)‹ <h t u9=,$)<l u=<OE$)ÍFu\wl3'xD$X <PWPW=<N V<5<w(' w3'1É;GsG1B TGHO;Mu9}tAtDEWP'5u%E9tt9sMxt MPQ?}-E $ut=<tGV^_[]ÃWU VjZSF vjZv uF VjZSdF V t$=<tt ^É01ɉHHj Ph" ҋL$SWVȋ<!9t+)֋ <| u 9t%)D @A Qh<@D^_[USWV=<t^_[]þ#VVVh&\3VhmS#h"h0&\3 &=<u &G&=<u&X#=<u&RQPh<&\3V&=<uU&"=<u(T#|%=<ubn$X&=<u$VRQP\3\3$ <|$gfff̉ҍ4މ劄1#GO wһ#mS#SUWh[&T$t$|$f4SUWhb&\3\3$ <Ggfff̉ҍ<߉劄9#FN wh#hmS#Vhq&T$\3$ <|$gfff̉ҍ4މ劄1#GO wh#hmS#Wh&T$\3$ <|$gfff̉ҍ4މ劄1#GO wҸ#PPWh&T$\3$ `3|$gfff̉ҍ4މ劄1#GO wҾ#VhQ,$Wh&T$VVVh&\3USWV΃=<tPt <3!1Pcǡ< <!)ȉ9r1Uc<9tEuótP-<!1PPjhjUPm t( <t$<= <=$<-(<1ۉ^_[]V΃?$< ; (<v$1u$<Ɖ $<^USWVP<<< 0trƃh'PTF,=<=<4$t|n011FEEh'PـEEC<(9r:5\3WC #QQh&Pփ=<<11<9s[ $,0EEh'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEh'P$< <s <)ÉE;ǡ<<<(9r$^_[]=@ L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9<s$5<!։Ņ9<v6J Љ  ȉ  F1r{@p9<sBJ Љ  ȉ  F<< h3u%1I#5<!֡< d3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPUZ tPUj$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=<t=<uVj1^_[]VhU; USWV5<1!-<t E<1-$<E@;(<v@uW-$<E@$<tE3t,ÉE uUh<=<t"=<t!<E-<^_[]VhVjS: USWVΊ <T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S2~VSeSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ <^_[]1USWVȋ5<!) <L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh < Åk jS <W SW<<;-<r ;-<1WWjhj\$SU t\tV9tRSPO uE< j@\$S0d -\3: hmS#Sh&PՃ=<1lj1<4$9v(< 1QQjPjVQ( @wg1=<jYŋ5<!Ɖ)tPX<9tut݉<$/<u1]4$D$x Ph <tA<$ <C 9r09$v+jSV+ SV?<<uɉD^_[]J7 V< <r!1F<u. <<F9r^USWVP $1N=<1!׉) <D$)ot +t=<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWV>DGWVm;_s_u.G WP=<u.M,t <-},^_[]jPRm 5<^_[]USWV@׉9 <95<jV;<u >9uPV;<FjWV *1ۡ<t  <8$<H@; (<v@j$<H@ $< 3H <HPh <4<9rWV諳 u=n8 j@S0 -\36 hmS#Sh&PՃ=<9=<u]<t  <6$<H@; (<v@u,$<H@ $<t=<p xPh <t@^_[]9<u)<<>4 fl3øl3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á<3oD$t$P\WVL$T$ ‹q~y ;q~ t 1~9 QPFT ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'W& tF u1^_ËD$t w$Ÿ'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V1 ^D$ 3DAD$ 3DAWVD$ ##tƀ>tW%3 0DPWVh&h3N ^_Ð1|$w L$t9tø3f|$3Ui#t#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PSm `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P- t F;'tm'D$'D$'1FthPt$$V Vi! Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-0 01H^_[]Ë' r ,$'t u‰,$''<$t9rPQt$ 1t/<$t9vE0 |fL$l&9 \(v3fL$&9 (vx3føÃD$L$L$ L$D$Vt$ t$Vh3$O h޲"V?t"/ 0kPhB$h3J 3Vj @VV7 ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t- 0 - 1$^ÐWV|$ W4' tFu1 ^_D$ftL$Qp'1USWV$п$$ u V`  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#R4$Y(Ş111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$,<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$ ' j F H @(N]_?[\;^r~uFF,<,<C><% ^q{t|~F~F ;^r~uF,<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF,<F^9րրw t$rI{i9s <$=3]D_\,<$t~uF F,<,<Au~uF ,<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF ,<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF ,<F"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF ,<FЉL<$USWV t$ ^h.\u/;nr~uFF,<,<EMŁ'$~]$L'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF,<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF,<FωωD$$xt~uF ,<.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF ,<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF ,<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF,<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=<3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u,<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA ,<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F,<FUSWV\$1=<39v1@(ϋF,@jPv(^ t|F(N,QV,fH~<t}3Dh <31҃9v1B <33Dh1҃9v)1BuG ,<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF,<,<-<^_Ã~uF,<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF,<F1^_[]É؉D$&'t$t$U u U{ t/uՃt~uFG롋$USWV 1=<39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytSp'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQO o^_[]SWV1G9Qs7ӉjRq tF^~uF ,<F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=<3|$ r3GtD$WT$ou]t$Sd |$Qo ]GtD$wt$wt$wS! |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4% L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ %s ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ N ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V% @wj/VU 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh( &jPh8<8<ø%Vt$1Ʌ1t э^fffffVYT$ws^ÐUSWV[l$,D$(u1T$|$;D$ T$$75]1PW EX PW V1PWޥ ` PWƥ th PW貥 |$D$ tH=1PWy s PWa 61PWI i{ PW1 t PW |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1$9r 胼$ t+$ $$ FhPW)X D$D$D$j1҉$ xfD$4D$d; /$$ AfAfI?QPRhWOt$VPj $D$$P&1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ VxhPWV j:Wz D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP賎t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.qPh$P$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R RQPUh$P]$$,$ 9sL$4qPh$P$j$,$o9sD$l6$,$/9s狄$ @PQh$PR$$,$9s狄$ @<h,$9suF9snF9siF9x|$B$ y ,$9s%NM9D?<$ @<L$|I} t$xjhQPRt$Ph$P$$,$9sL$tWQPh$P$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ ,$$ |$jj Rjjt$,$ q$,$$$49s獃 ,$$ g ,$QPh$P$$9s獃 ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP pRQt$Uh$PuD$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@ l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P`$,$$_9sjjjhRt$,$ ;$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F PQhW迹1ɃD$D$ D$1 ƞ fffUSWV`[t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r蝡  l$8D$UPj tCL$HD$ QPVW t2V詟 t+jPj 1ɃىK' (jD$LPV (l$8 0jUjn ֠ 0`^_[]fffffUSWV< [åD$yXXD$/Xty$/dev8 jP5t=ƍD$4PhFtHV軂 V t|$4l$8$<D$ oD$ $<T$$!PhQRV=D$ t@D$D$D$TKD$A pR L$T$ t$FP 9t$D$0l$WJE?tD$pD$ jjR# tkD$tJt$PD$P`  ut$D$Pk uP ujjD$P k6 8[ iŋ$\ $X $T $P :)tt$ P$` tVjQo 1tWhgtQ轀 < ^_[]ÐSV[:L$t$ t$ t$ PQft+8 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[ìt> A 9u8jj5 t P 1 4^ 0ǃ ǃƃ t* 01^_[ÐUSWV[$01 uut!j/V8h uS tƅuJ ƍ|$ VPQhW=r艜 ?h@V#ǍD$ jPW I D$$WtLD, L$Pjhjjj QD$(Px Ƌ<$t'Vu D$8 t 8 L$^_[]ÐSWV[æ u*PF6ƃ $tj/Vf uA Ɖ獃 VPQhW褲=r3 ?t" VP tEFu7hh%@V  hVPiB > jj\ t=jjj} !ƒt"e PAJ 1ub 0V 0^_[> 8#uVt׉ ƐS[>[ÐS[t$[ÐUSWV[ðu }誙 D$<$蜙 t$u$$D$P/ut=k<T$JL$|D$x$L$x$PQm$$$Pt$mlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PW- 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։轎 D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ\b|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRnѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6 W8G4jjdv6l jjdRPWPGLjh'v6ul W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[;L$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[û|$GtB#l$%t$Pj9t!G t7t9uӾ^_[]ÐUSWV[KtC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[ۦtC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[ht$0t$,  ǍM VP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP7tG t@/t;L$uЃt'D$ t$j2…<$uNt$0t><$9tRZ PUW >&t1<$W1 ^_[]fUSWV[+t$D$hEt'1PV6t%D=u1 u VPj=D$@ 8^_[]ÐUSWV[è|$ D$hEt$1PW]6t%D5u ^_[]ËD$@ 40tMGi D$jPt$V ŋD$18txi r"u## uIB"tt$ a]4$WPjуH WPjSV[}t$ vWv LVC^[ÐUSWV[8D$,8tD$,1퐐8@ujl HƋ|$(W F$"jUF D$ D$,F>M D$Pt$/1}nu1ɀ}ouL$D$j=U2 tǃ|$D$,t1PU4tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jgŅ8 t 4$V1^_[]Í UPjUSWV[Å$4$,wf 0vjPU uj:U1 jPU] tKt$}/3t$UhV jVPUV P4 t$UD$P,R|$ jjWjjV2mt$ jjWPjV2t$/D$PVǍ+D$t$jDžjt$W,V uj$4$4jWMtƍD$Phzd@V#G VqD$(Pt$V uP$0>H$0VPW  FD$ GL$ jjQPjR|1tqVUW  R8d 0s$0X"d 0kd 8uj/UBŃt$ $0UW  c 0|QPWh  111c 0s$0P$49  11,$j$4V$4WjUP\PW^st$t8HPQ薇&,c 0$0P$4  1,$D$PUb 0^_[]Í,$UPVW,z1b (JWP$8$8yVCfffffffS[kD$D$ $L$T$jjPQjRe/yD$[fffffS[ D$D$ >$L$T$jjPQjR/yD$[ÐS[ëD$D$ ?$L$T$jjPQjR.yD$[ÐS[K$L$jjPQRayD$[fffffYT$u,dÐS[Λt$pSWV[ì|$Wt$t$? 9r` ?WVPj^_[ÐSWV[\|$Wt$t$ 9rA` ?WVPj^_[ÐSV[ t$  ƅuNPj^[ÐSV[͚t$t$ ƅuNPj^[ÐSWV[Ì|$WƅtuaWPj ^_[ÐUSWV[Kl$|$UW\ƅttu{UWPj^_[]ÐSWV[|$Wt$=ƅtuWPj ^_[ÐUSWV[ël$|$UWt$- t^ 0UWPj^_[]ÐSWV[\|$t$W#zƅuWPj ^_[ÐSVP[D$L$T$$RQP: ƃuPj^[ÐSV[͘t$t$t$ ƃuPj^[USWVP[ÊPt$0t$0t$0t$0t$0jt$4=: Ɖ׋,$t1Z] (t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ Pt$0t$0t$0t$0t$0jt$4  Ɖ׋,$t1\ (Xt$,t$,t$,t$,t$,t$,Pj ^_[]fXL$"wÍffffffUSWVHXXD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjr~D$ |$4R|$D$811|$<,L$4L$0 GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjjk\$Pʅ~D$ |$\$0VRD$ PjjkT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjjj1҅l$D\$0WRD$ PjjjT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjhD$ u|$,L$ t@;L$s3$ >"\$0P L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[þjt$t$t$t$t$8[fS[ÎL$T$ Pt$t$t$[ÐUSWV[H|$$t$|$0t$(aD$ j/Uj ,$t| UPt$ WVt$8IuUN 8uFt$ t$Pt$t$@t$ǃX <ǃ\ ^ǃ` vǃh #ǃ, :ǃ@ 'ǃD #ǃH #ǃL #ǃl -ǃd -ǃt _ǃ |ǃ oǃh -ǃp -ǃ <ǃ >ǃ *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW{ 1 QTpQTtQTxT|=u^_[]ÐVYnN1 T$tpqttqtxqt|1=u^ÐUSWVP[N l$j+GG(ujjQP uPj`j3v5cQPzej>\h j 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!QI jS[þ<t$j[ffS[Þ<0t$ [ÐUSWV$[h<|$u@2t PP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(P萱tjjP诖 ,GT PftjjP腖 GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V P辣D$$<$$u$Ps HuǐuU PED$$鐐<$$u$}P Huǐul$Ut$V VPUG$|$~"14胮;>|nVe^_[ÐUSWV[U3fǃ h襝u$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$j T<TV$2@4tV} =wlj<$hVt$ Vݞ VT 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍPjS[Þ10[ÐUSWV [x1|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4\10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ\10vL$Eǀ3뤐SV[].0t$t$V, t V^[ÐSV[.t$ t$t$V t Vr^[ÐSWVP[-$t&T$t$2PWj $^_[ÐUSWVP[x-1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[û,T$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[+1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[H+D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RWŃuRG @tG 8u=D$3t.\10IrD$ǀ3G @|$tmG  f Hȃ  fftVW=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)\10oǀ3g 룸Pjj Q jSWV[Ì'|$WכƃuOG @tDm 8u:3t)\102oǀ3^_[ÐUSWV[ 'tt$339}3AP3t' 333343;33PQRP聎 33t331^_[]ÐUSWV[;&tt$339}3AP3Et' 333343;33PQRP豍 33t331^_[]ÐSP[m%$tT$ 2Pjj $[ÐX% tT$QT1øUSWV[$TAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhPto DHDHDHDH uǀD$ FF^_[]ø9Pjj,PjjQ踴 j>WP蚴j(ffffS[#0[ÐUSWV["|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQhuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW"W1^_[]ÐSV[}!0t$t$VL t VN^[ÐSV[=!t$ t$t$V t V^[ffSWV([ 0Wt$<2WV0^_[ÐSWV([ù t$8Wt$@2WVd0^_[ÐSWV([y 0t$ t0D$ NV$~,$VjPRQWVD^_[fffffS[3u1[`3P3X[ÐSV[ý65tHl` @m41^[ÐUSWV[kl$Dž2EHtȍ43VP迾 tGEHtVP蛾 t#Dž3`41`3 󥋍d3ʃd3ElEm2 ׉󥁥2fDž22 󥁥24223MQtPjQò ^_[]ÐSV[-3t,ǁ22313t%HtRjP3 ^[ÐSV[Ý3t,ǁ213t1`33 QtPjQ裱 ^[ÐSV[ 3tl13tB2t223 QtPjQ ^[ÐUSWV[{3t13MA:te3t3tLfǀ2fǀ2fǀ3Qt3jQR uNMa82t2`33PtQjP ^_[]ÐSV[m3t 13tEfǁ2fǁ2fǁ3Pt3jP聯 ^[ÐSWV[|$G=3t4 3tG2t223PtQjPݮ uxD$t3t PV[ø[ÐS[t3tPUtJ^[ø[ÐUSWV[û0Ɔ43t)2FttrPVPV|a3tR3~>11;3}:tt3PpT^_[]ÐS[T$t$t$ [ÐUSWV[93|$0t$,T$ $uXMDH@utl$4D$ Ug 鐐t$ D$PL$ QD$ P舆x)t$ԈtL$9D$)<9u AT$)RUat( $4T$4R7D$0D71^_[]ÐS[Ît3t P[ø[ÐUSWV[H8D$ $4VjPj袆tSʼnt$UebƅtMD$ $t$UD$PVftT$t$$V Vr^_[]ÐUSWV[Ë|$3t P 3~/11퐐4403r0;3|4r3ǃwwLJ3j0jk4tW2Ht<@xX3~3P<72@HX3@$4Ƈ31^_[]ÐUSWV[kt$3t P3~/11퐐448q0;3|4p^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([Ø4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wa 1Ґ$t$V|$(WD$0Pyt$$̃ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V讳 $4D$)Džu |$ $tR1VT$ 蚊 4$)tWj Ve T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVPV蘳hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WY PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PJD$T$3;4}D$PRjQD$PRjQ踦Nj$D(PD$$L$ ;47&ffffUSWV[|$$D$hjjU輀 t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ Uv D^_[]USWV[;|$$2t$Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$Uc 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[|t$V~~tyы9uv0/hv,$h9p9p 9pt PݡgVg1^_[v4g9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P"gffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[Î|$ uT${[ø[ÐS[^|$uT$ L$O[ø[ÐS[.|$ uT$[ø[ÐS[|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[l|$u8t$D$|$% Ɖ81^_[øVX|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$uL$T$ 6[ÐS[T$[S[L$T$ [ÐSWV[t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[\t$|$tCGX2@TtgAW6W-@x8tg@ 1^_[ÐUSWV[΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt VTt"G8tt V 1t$׋NX2#N@N@Rz8t N@^_[]øSWV[<΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXoHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXoHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[Ìt$8V蟖 PVW ^_[ÐSWV[LL$|$t$x"1t%<t9u W9 PWVN ^_[ÐSWV[t$|$W PWV ^_[ÐSWV[üL$|$0x1t!<t9u W評 PWV ^_[ÐSWV[\0t$t$V+ t|$WY PWVn ^_[SWV[ t$t$t$Vߐ t(L$ |$x#1t&<t9uW PWV ^_[SWV[Üt$t$t$Vo t|$W蝔 PWV ^_[ÐSWV[L0t$t$V t$L$|$x1t"<t9uW" PWV7 ^_[USWV[$AL$I,D$$|$@1 $D$HL$D$ $cUT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$PhkxNjT$u$^_[]ÐUSWV[$$AI,D$$|$<1 $$HL$ D$$pUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$ML$\L pE 9|$uӋD$HD$X|$ |hD$ p}$$@D$\@GE!ȉGGfGFfD$X~GtPCdG맋|$LG9ɋ$Ql$ l$9}]G,L$T 4p$f~y5GDfFVw|ctLGHFGLfF;o|ăG(L$P I ;~$Ut$ D$\0WL$T ;OT$u7G8 $48u D$X|$LWhGO(T$PR ; ~ GPt$ t$\6WdD$X;GTt$O,L$POW(у@ W2D$X()$W D$Tl$PD$XE 18^_[]ÃO, T$P O,L$X 4pUSWV[E$F$$$$AX11ɉFXhXș)Չl$$;FTu0F8 u*$1D$F9|ȉD$|$FD$FD$1|$HL$ D$FN,D$1 $l$ ^UT$1 |$HT$(D$$D$ jD$$Pt$t$$D$,P$$)~"D$HPVUD$P5]xNjT$u<$D$;D$$|$H.V $͋tp $E;FTu;F8 HV`$E$σEN,1 $n@ƉׁuQ_$H($$P; } $P ; ~ $$xD$ t$H$ u$$fd $xHt |$$B9u$R%1^_[]øfffffffYt0 I8t u tHAøÐYD$t0 I8t u tHAøÐX/ tPtaAøÐXL$tPtaAøffffXt1HX2I(t u tHAøÐD$t1HX2I(t u tHAøÐXt @@øÐD$t @@øffS[jt$ [ÐUSWV[è|$tyG8 tsl$ 1tiWD$W$jwPWL| UW4$t$W0| 98uj Lz48uG^_[]ÐS[t$02[ÐVXtT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVX^tL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐXHt t1ÐXHt t1ÐS[Ît$0[ÐUSWVZX|$(QL$,C@D$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prq` _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|WHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqpk_ ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|VtG9|델Kwl$9\$}!GPjVWp9uGt PW 1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[0[ÐUSWV[è|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ>L$1~t$ ~9J$u9r ^ÐUSWV[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[zt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ýT$L$ Aq D$t$jVPt$ ^[ÐUSWVXx$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQFDE;~} K(t$몉SV[ÝT$L$ Aq D$t$jVPt$ ^[ÐUSWV[[l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[t$D1Sl$HGL$ED@8t EHmE(ED$D$~$L$ ~jjjjQP2 [1[ÐUSWV [1|$4׉L$h6dǀǀǀPF, $jW!F0|$|$@F4T$l$DL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Yh|$4t}\$\$0$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p` F\ fFVh !k\ l fNl 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp0QjP-ɋ$Rd0PjQQ f~$~gD$@u]D$$t$Fh2u&@9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $0jQ Btdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9p p p $Pq|\$I BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;p ut D$PD$1r.1p $Ph V\$ ǀw p $PQRX\$ D$@p L$Pt D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 0UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄p $h QP \$ ŀ=rv4l$Gp $h WP E$h Wl$ Py \$ w荋p $PQw? D$PGD$H$Qjt$HVP\$l$,KD$@, /D$H$QjVPƂ\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $0$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 0UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a0QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$0WjPA D$l$|$ l$ t$L$$0VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$0t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$0$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$0QjP%? L$$jQVjU\$bHD$ $jjt$RVh$0t$@$WjH>\$ uL$L$ T$9Q|$0$VjP_>\$ |$4l$l$,@$VjL->\$ ut$PQhrR9 $< USWV [H{D$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [äh D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$Hlt htðuu냹tt u1ÐX^@ xÐUSWV [^AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21CdD$L$ /jt$5[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[ ZL$9 ft$9|$ 9l2uCUw$-4$t$skwp|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXX2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYV|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[KVL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZŒUL$x?9J\~2D$t$|$ Irftf>vf1^_[S[.Uǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[ëTT$L$l2uI~w-ssw!ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXSh2ÐUSWVP[ÚSt$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[lQl2tu6@t!|$0QjP (!G@f@d^_[ÐXPf@dffSWV[PD$ yOQW~ ;O~ t Q WP4WV^_[ÐSWV[lP|$D$OQW~ ;O~ t Q WP3W^_[ÐSWV[ PxWt$W^_[ÐSWV[O|$Wt$Wx^_[fffffffUSWVXOtLT$xDt$xIjt$ 0p [ÐS[Ijt$t$D [ÐS[Ht$ t$ 0 [ÐUSWVX[èH|$lt$p1 6VxŅt$t$lFPD$]L$tvt$ D$p@L$F>ʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j [xL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vjx;l$tl$l)"P>x‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KЙ~ ƃQWT$H ^_[]ÐSWV[=|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[n=  jt$t$t$P1[ÐSV[-=  jVjt$PJ1^[fSWVP[<|$t t9t QD$P"L$QjPWq^L$N|$kK)l$kK) #;#i)PUpt;y t0q$t~fuUv9u1 q  ^_[]ÐUSWV[;D$$L$t@1D$D$>D$PL$QjPWN]L$kL|$kC)l$kC) #;#i? )DPUNt7q tAy$t+nuUwu AHy^_[]USWV[9D$(L$1҄t@1D$D$8>D$D$PL$QjPV-\l$-?L|$ ) i)ʼn) i)k*${*$lj*SiŠ)ǍLPD$Pt1D$HP<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WP "uVEЃ^_[]ÐS[n8t$ t$t$ [ÐUSWVH[88t$\TlD$P耢ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UZL$QjPUYL$ȿNt$kK)kK) #3#i)PU$D$$ ED$j=UtƉH$$D$<$|$W\L$QjPWXL$Ƚ-?Lt$) i)) i)K*$s*$Ɖ*SiŠ)ƍLPWD$5tcL$f <$|$WL$QjPWWL$ȽkLt$kC)kC) #3#i? )DPWtD$EPE!D$HDY $$D$VPUCPUuKPU]PUEnbPU-t@PUtrDPUteJPUtXr6PUu^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$臨L$uD$ 9D$ tf, UQc,$t'UWP|$BU軭4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQVv $4D$ H^_[]1|$t4$ 1USWV[2h_WT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$H_ 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV],2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[;+1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[}*L$ T$D$$Pj [ÐUSWVXE*$1h ։ͅu4$ u'$hy 5 @0t$E4}0u"$hAE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $T*ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $+$t"A$|t+H$D+$1$uՋ$1ڃV$0-!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,~RE,}0M4T$$V$0PRQg1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PqP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$d1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,螕rE,u0M4tڍqu4 $ 1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,ztRE,}0M4$V$0Pt$QhE4E,M4},$1^_[]ÐSP[íT$ D$$1Pj= [ÐS[~t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[=T$ D$$1Pj [ffffXL$ÐUSWV[|$(t$ l$uPaƅ>l$$uj軾hj謑L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4w9Pk1D$tGuP|$(x |$(tF|$(mV|$(Phht@U t$t$tL$t RB(JtR{dP蹒tjjPw IA(dP萒tjjPw IA1t^_[]ÍUPj zVSVP[ÜT$L$D$tRQPVƋ$t P.^[fUSWV[Kt$|$t$jt0ʼnVU|$T$VŸ0Pt$t~Pt$tk5Pt$t[;Pt$rtKAPt$[t;HPt$DuA1 @VK^_[]ÐUSWV T$L$[ǃ OPlŅt'}/u{L$$ t$  YP0/P<PV?uU DžjWWW tpL$v u\D$ VP$tIT$ L$$ Pt$ 躓V`'uN1V='aP.$|$ $~:s1퐐Nt:t됐tÍMwUPW艰 D, L$$ t$ [tu/lP~tGoT$ PQhR0~)T$ L$$ t$ $|t$ $:uw1퐐Ot:t됐tÍMwUPV良 D, L$$ t$ [tu$ $ȁ ^_[]ÍX USWV[øl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%Z\$L$ A ZAthhPP+jj! G(hhP'|$ Gt\$h(jP|$ "\$jhʉ|$ G9ouG)o\$UD$pƊ|$ Go\$UVP踭 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$P;F$ދ\$P ~ F$D$\$jW?F$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|VMt.)9uUt$VO t6u0,1(V9ſuUt$V{O ^_[]fffUSWV [hD$48H L$@ 1퐐/t <,tEPxUWP聦 .,v3l$4uWEED$\$cD$D$|$j|W(tD$4@ T$L$ t17t<,t\$RT$rD$PwtDl$VWQ膥 Ut$Pt 1<$W Njt$D$Pl$8uEW|$WV  W脇D$D$D$ Džt$b\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$Uu\$8C k$K($fC K(K(|$T$ t$4P f>p1\$91\$-4$K\$PeD$P贅D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q莄 ^_[]USWV[È D$t uy|$ 1퐐/t <,tQL$e$Pst2ƃ$UWP 4$t$Pk 1^_[]ÐUSWV[|$ t$FN,9vtU6}uCu;Urt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[*|$ l$YPWuLt}D$x@ȃǃtVot$ U贾)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$WuPt$D/WaprWuPt$D1TL$4xT$$s$tntfuσ1} t WPVo l$ E|$f>t WPVM }t0EfEfF}WuV! f},t&E(fE,fF}(Wu Vߚ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[|$ t$FN,9vtU6&vu]uUU#ktHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[Lt$FNy9vtW6~uuCu;W{jt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|UɢD$tL$j|Uqt L$U=rUPt$P 10^_[]ËD$tPL$ =r"D$t+P辳L$=r$QUPt$T^jjPrtt$ $@ 1D5t <,tFPhD$4 VUPx D5$(L$tSD$HtJ11t <,tFP4h Vt$P D5$h|$t+D$Ht"t$Wf $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0k$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p k$D$t$HjjjPjfWjQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[z|$ $ ftGt @1@WG(f hwUX =wb, Ƅ |)ƋtVPUX 9vD|ŃƋGtVPU[X 9s D|ŃE$^_[]ÐSV[}t$ tavSfvHfv=fv 2fv$'fv,fVf19 uǃ ^[ÐX @ÐY @uUSWV[õ$(E$$4D$$0j:WztHjQP萠 t0V$0W  NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UP2V <:t$EF<:uEl$4$D$D$OtuP0^(P^Hǃ,rD$Od1$$,PQhW t" ǃtm,Oj j,(,)XPY+XPPF^tj/V-t|$u1$jPRQVp'1T$$jPRWUQVG VPjESV[t$ j:VvwtHjQP tt$V[1^[ÐVYT$փ1u t^1(^USWVH[Èt$dl$`L$\D$Dȃ= u(<$yL$VPj@QT$tLT 9 $ƅtID$\WU(R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\(Q BDŽ(DŽ t $;D$Du ЃH^_[]/LUSWVT[(|$pL$ll$hD$P= u( $t$ uL$WPj@Q/t$t$ T$Ijj צD$Wt$  $t$j 讦9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ ;D$Pu T^_[]JUSWVD[L$`T$dt$X}|$@uM u (t9ƀ%RQt$dPj@W tRQt$dVΊ M;L$@uD^_[]JSWV[|$=uj u (tVwl1}tL!( tDŽ(DŽ WQ^_[ÐUSWVP[xD$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=m1T$ vPQj@Rjx. VPR4 bGm<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1胥E;D$Lu^P^_[]Ët$d( DŽ(DŽ (,$1,$FS[D$u& u (tɤ-[P[ÐS[ÞD$u& u (ty-[t$ P€[ÐSV[=t$ j:VotHjQP= tt$V-^[ÐSWV[|$t$j:V1otHjQPؔ tWhVU  WhV ^_[SP[}D$ L$ $L$ƒu& u (tM-Qt$P  [ÐS[D$u u (t1[P~[ÐSV[ýt$ j:VntHjQP轓 tt$V肢-^[ÐUSWV׉[TRsjj uD$UWt$ \ t$j L19tG4$(  DŽ(DŽ ס^_[]ÐUSWVL[æD$D$H1,<jU( u} t @u D<@u^(  DŽ(DŽ D$;D$HL^_[]Íl$ E< us{Uɠ8|$jW(! u|$ u}Fu(;  , DŽ(DŽ Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:# D$t$DRL$D# A @`? Q19<$# D$D@ @`ƒ?Q91# D$D@ @`Ń?+Q9# D$D@ D$@|$`D$?Q;|$  ՋL$#  <$‹D$Dp# D$L$ D1 <@4$T$<`Ń?|$_u+Q19QL$ T$D $L @`ʃ?|$_uQ19 l$ D$L(D$<_D$$D @`Ń?+Q19 ՋL$ T$D |$_$D @`ƒ?Q9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t2/;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3Q|$D/? QD/ ?QD/D$Q/T$T$L$ t$ ?3QD/? QD/ ?QD/D$QD/D$L$ < QL/ ?QL/ QD/D/ # <$<$:USWV[$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# f3Df4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# f|$| t!qtAD>1tBD>׹@# fD,|t.tkŷ< s݃1@tt# tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# f|$| t!qtAD>1tBD>׸@# fD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ; 1ttD~t# f  fAB{f w~4AB{f w~4AB{f w~4AB{f w~4AB{f w~4A{f wʼn41 @tt# tlj瀍 ; 1ttD~tf$Q{f$A# {f$B# $u1 @tt# tlj瀍 ; 1ttD~t⍃f# 0p'QP'QP'Q'u# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف,gр3ʉрUɀʈǃ$ ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځ  $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ $ F/ 4$l$T$ L$ Ń4Ơ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[])USWV(]ňD$<X%UUUUʁUUUՍ4P᪪Š Ť x   $ x   x  $ x   x  $ x   UUUU $ $؃Š Ť x   $ x   x  $ x   x  $ x   T$H l$ $ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x   $ x   $x   $ x   $x   $ x = = $x   $ x   ȃx  $ x   x  ! $! x ! ! x  " $" x 5" 5" x # $# D$@P1(^_[]ÐS[ۼD$1ɐȊt tT Tt t t4 uP1[ÐSV[ZD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[PMD$$D$DD$@D$9\$6D$L$T$@jjPQjR"MqD$HPj M"ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPԿD$0Pjm\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjmt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]'USWVd[%$|D$<$` $ hjD$@P DŽ$@D$V $@8$u H$@D$ $@UVljD$Plt;uHAWPcnIWPKnuD$8WP-nD$UV艙ljD$8#jPWAm D$,u:|$$@PW#x$@L$,UV/D$l$0M t$\$UVD$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V.1$xUh$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-PQRÓ_h$DUt$@VK j jW hjU hj$P D$@hjP D$<;$`u`d^_[]D$RWD$t T$@PQhR l$ $kfffffSV[mD$ h`rƉPW)Ɖ^[ÐUSWV[(l$0jD$PU6h thh`) $)D$j PU֔ $l$1}$K1D=t<$t h`tt$,fō4& 4$t$L$QWPjbVԍ & L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(Vf4&  & !&  "& jQPR ;8& #& $&  %& jQP ;<& && '&  (& jQP ;@& )& *&  +& jQP ;D& ,& -&  .& jQP ;H& /& 0&  1& jQPS ;L& 2& 3&   & jQP  Ƅ;P& jjt$8 ^_[]fffffUSWVD[X|$\w Qt2t$`tD$@jPV$ NjD$@9t8ttD^_[]t8"u tr7D$)D$ D$D$ D$<D$8wD$X$2a$WQjP0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$D$ tKWV(tD(1t$Wt$ KUBT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[ht$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Îjt$t$t$@[ÐS[^jt$t$t$[ÐS[.jt$t$t$[ÐS[jt$ [ÐS[ވjt$ h[ÐS[þjt$ H[ÐUSWV[Øt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[øt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[؆t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wÍ$#ÐUSWV [ȅ|$(l$$t$ D$4:D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[.D$ hPt$`F [ÐS[ht$t$Q [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[mD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[ÈXD$pML$LjPt$lv D$h|$df$D$VP L$)L$D$PVWkD$ |$$v=D$Jt$.D$lp8L$ QjjV* V |$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V Vu |$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VO V |$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>V V |$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7ZL$R)уtuÐWVt$  r!̐cw^_fffffSWV[Qt$|$G@hjP zj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[O$$N$@r8hUtE\EXETEP$t$tAsE@hjPt Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V{QhVU< hV1;$u Ą^_[]USWV [Nl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPD 1 ^_[]ÐUSWV_ǮL$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$zL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ Wc hj$P, g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVT D$hWD$$hPD$;$xu D$e^_[]|ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[:|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[9D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*|E E(}$uM$뉾1^_[]ÐUSWV[;8D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*|E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]6$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$K$4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$&$$FQ? T$‰ً$|$D$G<uD$ $r# $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? n# T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E}BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍#FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N g$FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Qc l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj #&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B G#Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?}ፅ}GPGX GTG\GG?$L$u aD?#FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  $FL$Q? $FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$$$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't$D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$}$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $= $$FL$Q?P$^#$NL$Q?D$T$ ߋ t$ $$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $xUSWV[ÖiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP薩 )t]D$)WPu8 }43M(U,E4E09w)RVPN E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Ìt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU, F4n0)Pv8U 1tN0^_[]ÐUSWV[Ët$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[hL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RrT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXuD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$(}$L$($É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+ T$D$tq01t ^_Átփ*tUSWV _hL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[Hl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wH̎l$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw | o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw z o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw x o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQw F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw w o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQvL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw t o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw t o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw s o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq q $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq o $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv ^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv d] n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv \ n on)n)ouGGD$8xt1$^_[]ÐUSWVX8$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu X } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu 7X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu W } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu V } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X,ÐUSWV^ƘL$4t;T$8\$0Ӄs3I͉у1&Ӊi913,ƒT$4zR13,ƒT$4zR13,ƒl$4M1ʉ3,xT$  1ϋL$ 3,Ã1ؐ\=13,\=13,9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3,3,3.,3, $3Q,3,3,3, $3A,3,3,3,D$ $3A ,3,3,3,|$D$ $3A,3,3,Љ3,|$|$ $L$l$11D$D$33,3,3,3,3W13,3,3,3,3G13,3,3,ȋT$3,3W 1‰3,3,3,\$3,3_1ˋT$ )3,3,3,É3,ϐÉ13,W13,W13,W13,W13,W13,W1Љ3,O13,RЃ^_[]ÐS[Nt$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX8$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXZ$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐUSWVPXʳ$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Ît$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX߭ÐUÐXT$J r ,ù)ы,ÐS[nD$D$ P[ÐS[>t$ ([ffXL$ T $ h, | 0 |8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_NjT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXhD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$,PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$ܰ~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +d)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[\t$xƅt|$7Vc@G 3P ^_[ÐSV[ t$ )tt$P@F1O O^[ÐUSWV[øt$ԯtLƋ|$$l$ $P?D$PWU1 1urO(VKu WO(^_[]ÐUSWV[+|$GtE/D(U8]wU:t#V譡=yarau D$0VSN1^_[]ÐUSWV[ë|$GtE/D(U\wUt#V-=tcidu D$0VӞ[N1^_[]ÐUSWV[+L$A1t3)D(U6\NjD$pU4t D$8M0^_[]ÐUSWV[ˈl$M1tMuD1V[uVt(WJ=yarauD$8M W1^_[]ÐUSWV[[l$M1tMuD1Ve[uVgt(Wڟ=tciduD$8M W{1^_[]ÐSWV[Pt$ t$ ./ t6D$t7<$D8WZt$WtD$ 01LL^_[SWV[iPt$ t$ . tFD$tP<$D8W`Zt$Wat,VԞ=yarauD$ 01" LVqK^_[ÐSWV[ɆPt$ t$ . tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"kKVћYK^_[ÐS[.L$T$ jt$t$ [ÐUSWV[QƋl$$P:D$PUW- tgVD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6eJ 4SJ8V,u 댅t D$ 01/J^_[]ÐS[L$T$ htcidt$t$ [ffSV[̈́t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[{t$t$#_P=loobul$VEloob^_[]ÐSVP[D$Pt&Pt$t$` D$VbD$1^[ÐSVP[̃t$t$Vt$t$` D$VD$1^[ÐSV[}t$t$t$!^VP8^[ÐSV[Mt$t$t$]VP9^[ÐSV[t$t$t$]VPg9^[ÐSV[t$t$t$]VP9^[ÐSV[ýt$t$t$a]VP':^[ÐSV[Ít$t$t$1]VP7:^[ÐSV[]t$t$t$]VP:^[ÐSV[-t$t$t$\VP:^[ÐSV[t$t$t$\VPW;^[ÐSV[́t$t$t$q\VP;^[ÐSV[Ýt$t$t$A\VP;^[ÐSV[mt$t$t$\VP<^[ÐSV[=t$t$t$[VPw<^[ÐSV[ t$t$t$[VP<^[ÐSV[݀t$t$t$[VP<^[ÐSV[ít$t$t$Q[VP<^[ÐSV[}t$t$t$![VP=^[ÐSV[Mt$t$t$ZVPg=^[ÐSV[t$t$t$ZVP=^[ÐSV[t$t$t$ZVP=^[ÐSVP[üD$QP0t&Pt$t$\ D$VD$1^[ÐSVP[\D$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[~D$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[Ü~D$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[<~t$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[}D$QP.t&Pt$t$Z D$VD$1^[ÐSVP[|}D$QP.t&Pt$t$IZ D$V輒D$1^[ÐSVP[}D$QP0.t&Pt$t$Y D$V\D$1^[ÐSVP[ü|D$QP-t&Pt$t$Y D$VD$1^[ÐSVP[\|t$t$t-t&Pt$t$-Y D$V蠑D$1^[ÐSVP[{D$jP.t&Pt$t$X D$V@D$1^[ÐSVP[Ü{D$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[<{jt$.t&Pt$t$X D$V肐D$1^[ÐSVP[zjt$-t&Pt$t$W D$V2D$1^[ÐSVP[Üzt$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[SL$t 9t1[ËD$ IuPQ [ÐSV[RD$ t9u L$t9tf^[ËpЅtItRP אS[ÎRL$t 9tf[ËD$ IuPQB [ÐUSWV [8Rl$(|$$}(t[Í&&`%PQjtRSWV[PD$0Fu9' W~tW 6' VPJWFuFt PV1^_[ÐUSWV[ÛOD$t$x t4hjWV m tUVjt WV$n1PVo^_[]ÐSV[-OL$T$ 9t9r 1;q u4rЅtItRP1^[ffUS[NEM L$$D$e[]ÐUSWV [ÆNlPQh' Wy' l$UVtPvcWM ^_[]Ét$W6j zthʼnPUc|$GEOM,$EVW|$Wt(PbV̀4$p1l,$UW<9uVME'2'&PQhMR US[UMEM L$$D$e[]ÐUS[MEM L$$D$^e[]ÐUS[LEM L$$D$e[]ÐSV[ÝLt$ 1t9u Va^[ËD$@$ÐWVY]LT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ®KL$1t91t^1^ËAQ^ÐVZnKL$1t91t^1^ËAQ^ÐVZ.KL$1t91t^1^ËAQ^ÐVZJL$1t91t^1^ËAQ^ÐSVPYJD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYJD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYID$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYHD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YoHD$t9u@H@ty1ËT$ BÐSVPY,HD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYGD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY GD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY|FD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YED$t9u@H@ty1ËT$ BÐSVPYED$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY,ED$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYDD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY=DD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXCT$t9uBJBuy1ËT$JÐSVYCD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYtGjPVl tu L$e^_[]ÐS[^>' jP5q' PQ_1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[==D$0' VP菿V1^[ÐUSWV [<t$4NswD$8t'@t!d@uppQj WjUVEZ tWVWWt UVI[1 ^_[]Íh'O'&PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[;lPQq' Pn[ÐS[î;' Pn[fD$w sÐS[^;D$ ;D$uPt$t$+| [1[ÐUSWV[;D$ t$tP+D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋ܱL$qD$ tL$9QWPz 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋزH vHN1 =tP w싔\Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í(''PQhRUSWV ]X8D$ \$$p1}<"$N<\u< $1ۃރST$$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ@(%('PQhRUSWV0[%4$Du wtj0^11<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p(D$(D$Ews 搐<<}jt$W tfjt$W tS(jPW E $AEtLt@<-Eu<-u}>u$h\t u94$10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U膪D$m$hō(D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[,jt$ [ÐUSWV[å,$j܁$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPj諓UYtjVU_^ |$t'jjjhjt$Pg|$t-$U~jWU^ WUkTVUkCS[n+jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[)j@YƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[É)t3Pj薝tjj@ɓDžuU=Oj@讓1t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[(t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[Ê&|$oU[1tIp9u?$jj~t, HWs;~$9uGt1t$$%U. ^_[]Í,,(PQhRS[Pt$ [ÐS[þjt$t$T; [ÐS[ÎPt$ [ÐUSWV[[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(@)*)(PQhjR7Q蒒GP5LW}1^_[]É.(*)(PQhhRG/*)(PQhyR)*)(PQhRS[L$A4tPQ4I,Dt*Pa,[Í))(PQhRM))(PQhR.USWV,[ÈD$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jjtt$ At$DVL$*L$ql$$9.|$FWUP juDžt!PW> Gwo 1^_[]ÐUSWV[ l$19}EuBM1tDm $t: $Uut^Ut$D$P  U;1$D$jtt"WPt$ED$E E^_[]ÐZ? L$1t 9tËA ÐZ L$1t 9tËAÐSV[ T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[z D$1t 9t ^_[]ËHh t( $tDUst؉Ut$P薡 ąt:-+-,PQhRa-+-,PQhRmZL$1t 9tËAÐS[ÞD$t9u L$ t9t1[QP: [ÐSV[]L$ t 9t1^[ËT$19Q ut$tRVqI ֐USWV [t$(>t~(t  ^_[]ËFPjQvPgt҃~$tD$jPv  ʼn$u 8"tD$N N$9u8"t=--,PQhR1jPj N,$Uq7ǍFPD$PU tcD$;$uZsgjPV tD|$u W΁1,$jjP2F,F0F4F8F<^_[ÐUSWVP[t3Pjqtrj@hDžuUxWj@g1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tvP9uloU1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[*։ $|$?uwG8]u<GcjjWr tCw jPwwt,t1jjPUt$t1U^_[]Í1y1.PQhRR蠱S[pPt$ þ[ÐS[jt$t$t [ÐS[îpPt$ [ÐUSWV[{t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%/k/.PQjmRQlGP}&Wl1^_[]É.|/k/.PQjkR3G/k/.PQj|RS[~D$H4tH4[Í&0 0.PQhRѯUSWV[8D$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jjdt|AD$0t$PL$T$rL$9Al$ F9(u:G@D$PP[ÐSV[t$ vV`^[fffSWV[t$NtFt\V9wqu QP[tFVL$z~ ^_[1$3 32PQj9R<3 32PQj:RY3 32PQj;ṚSWV[,t$t$|$PWtu^_[ÐUSWV [t$ F|$$3$/wзbg\tbwtRt$jD$PD$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðh'}32PQhR腡SWV[t$~ t 1j Vt ;~ r^_[ÐSWV[ì|$t$t0t*PVtuj Vm^_[1SWV[Lt$F|$uLPVujVm1^_[Íh'32PQh$RßSWV[,t$F|$uEPVtiu]jV}1^_[Íh'32PQhERӞUSWV[;t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Íh'32PQhdRcUSWVP[D$1ɅQh Dt$7jH1Ƀ#hH$GGG wtHt$WՃj W=tjW$$<4PWtiu千4PQWq tDj Wt5D$h VPW`tj WZ7`XWWX $ȃ^_[]ÐUSWV [E$($$WtEPHx=ŋ$$t$t`?t[W%t.H|/t+1]ߡ$,9/;9sfD$ .t$ V近H r茡?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ à8t$h t U裠8蜠8VuV茠8$ ^_[]É,$9tG9t iy/t)rD$ UWPs D, ,$S[jt$t$ [ÐS[jt$ [ÐfffffD$ǀǀÐUSWV[{T$$L$ |$l$t$u2jDtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1544PQjAR^!544PQjBRBUSWV[ëT$t]D$ |$L$tKutUtMtM L$$tEU-TL1Ht t L t L |$$t L2 ^_[]Íd5T54PQjZRXffffUSWV[øD$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PH+el$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Èt$@|$[fffffS[Nt$t$jt$t$t$8>[fS[t$t$jt$t$t$(>[fYXZQ̀QQrS[t[fffffffS[þt$t$t$t$ޒ[ffffS[Ît$t$t$r= [ffffffS[^1;D$[ÐS[.1;D$I[S[88t ja1[ÐS[88t j11[ÐS[î88t j1[ÐS[~88t jя1[ÐS[N88t j衏1[ÐS[88t jq1[ÐS[88t jA1[ÐS[þ88t j1[ÐS[Î88t j1[ÐS[^88t j豎1[ÐUSWVX+L( ?) R4X( ѐ>t1 @u~1ɍX( >t 9u#;T$t$RpwffffUSWV[$ÑL$(qL$,(L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í QPjS[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[ôt3T$8tOl$@to:VPt$DR999PQhRt멍:9Ս9PQhRmt뉍:99PQhRGtT$HkXODH@uyD$ j PW $T$y8"u,y"y0gIWPVQt$HT$ 9L$<lȸD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)::WVPQt$H[11҃^_[]Ë$T$|$(9ыl$,}R:|$09Njl$4}m:UWRPVQt$Tt$T 맋L$8fffYi̟mNA90̟%ÐXOL$̟ffffUSWV0X($t$DL$H|$PL$%1|$L$WID$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$VH T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ '1$#q0^_[]Ë$:::PQhRk$:::PQhRjL$XUSWV0X$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPUA T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U 1$j0^_[]Ë$:::PQhRdL$XffUSWV<[Hl$X|$Tb D$\}  |$T  D$u D$4tǃԟǃ؟T$PT$$9L$$T$,T$0\$|$ <$D$(\$؟ǃԟ|$ l$XL$1L$uПHD$4;L$$D$T4П>-u FD$,Пt$0E<+<-~؟L$ ԟXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő؟<Пԟ؟ȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$؟+ԟ|$ /V؟tԟuԟП<-u ~П4$<:tkE$<4$P61L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P芉 $? t/ǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^WПD8t}:tjWPWx:L$T$,ПL$ $_D$p7П:t%j=R/@)D$Cԟȉ $؟|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$V'SD$\(pD$D$ 1T$ $ $.T$tf\$QURS uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8: RQPR \$؟+ԟL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:t9RQPЅ 1L$\|1uD1 <-t<+::BtD8tD$X8:tRPq?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:taRP辄1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8ПD8t}:t4$PF $E<-t<+u:}:1<: :L;?;;PQh_RYw_;?;;PQh`RYD$l]Z;?;;PQhaRY|$T;L;o;;PQhRkY_;o;;PQhRAYL;;;PQhRYnL;;;PQhRXfffffUSWV[ÛT$t$X+ ǃX+ ;D$}? 9-u7yI\+ t8--?^_[]Íj-RX)tǃ\+ --L;;׍;PQjRRW(;;׍;PQjSRWX+ \+ ::tlQR(tXx:?u'1x:tH;L$|鉻`+ T$?u?ܟ::N[;UPQRxǃ`+ ?tqc:D$8:E?ܟ3Z1^_[]ÍI==PQj4R RŐSV[ýt$ tjjjV0^[ÍS==PQjARQfffSWV[l|$t$t1hPWV0^_[Í=^=PQj6R\QfffSV[ t$ tjjjjV蜑t^[Í===PQj0RQfffffffS[ît$j t$t$[fffffUSWV[{t$|$tBjW/~G0t ujW1^_[]Í>=PQj/RFP띐USWV[t$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H U1^_[]ÐUSWV[xj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$pt qtڍlpuft?$L$ut: $fH f@xp$L$H,h(@D֍">PQj;R*Mua>Y>֍">PQjm>PQj>PQj8RKya>>>PQj9RJUSWV[Ü|$t@jW*GHO~ H0 WAjW+^_[Í?>PQj7RmJffffSP[D$ L$T$$RQP([ÐSVP[D$L$T$t$4$VRQP&^[fffffffSV [êD$,t+8t&$P?D$cD$D$ t$ex9~??Ph?FFySNF )PQj,,^[ÐXL$x9~Í?Í?fffffffUSWV8[øL$Xl$Pt$LD$4ut |$Tu\@VPJ@@VP2@@VP@@VP@@VP?@VP?'AVP?NAVP?rAVP?tAVPr?fAVPZ?XAVPB?JAVP*?9BVP?4BVP>qaBVP>`BVP>O` t9uuh/l$t'j2pU0 S@QP { t @@?PQhRFL$h@F0@@?PQhRE l$PQj2UbU;ƋD$XtPUt$\ ;D$4u 8^_[]ffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[,|$t$t2F)F31uF FF^_[ÍCCBPQjYRD뭐SWV[ü|$t$tg~uP\$wGN Qt2C?CBPQhRB~uр~|$^[ÐSV[}t$ t ~t/F2CTCBPQhR~B~uN .wu^[ÐSV[ t$ t41~t^[ÊV u.wL$~9|ԍ2CjCBPQhRA먐SV[Ýt$ t~t0^[Í2CCBPQhRA~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[|$t$t@1u6T$L$9w"QjVC FfFF^_[ÍCCBPQh.R@뜐SWV[|t$t>~u/L$Fy |y|9IL |F1^_[ÍCCBPQhMRL@랐USWV[t$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍCCBPQhhR?CCBPQhiR>SV[Ít$ t"~uDNu;V9r1-CCBPQhRy>~t^[ÐSV[t$ t31~u(NuV9rT$x 9v ^[ÍCCBPQhR=fSV[í~t$ 9y ^[ÍMD9DDPQjTR=אUSWV[[~t$|$t.l$tGMϸwG)o >1^_[]ÍCaDDPQjbR:=뱍tDaDDPQjcR=또USWV X}$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQW>D$0 28t p׾$VPUH 7+D$p)t5u+VQA$RjP= 7D$)smH1 ^_[]Ë$2CD֍DPQhR;D$4$DD֍DPQhRO;g$D΍DDPQhR!;D$a$EL$~EՍDPQhR:L$USWV[È{l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQ9< D$ }+$x)t6u,WQARjP; l$}<$)s8O^_[]Í2CD֍DPQhR9D͍DDPQhRb9렍EL$~EՍDPQhR69L$;SWV[yt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú92CDDPQhR:86DDDPQhR8)뒐SWV[üxt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[12CDDPQhWR6DDDPQhXR6VL$t"T$ tփuQ^ÐUSWVP[:w|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP7 D$$L$(l$0O}^_[]Í#EE$DPQhRl5T$L$8D$4VUHEEՍDPQhR/5\SWV[u|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[\ut$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Ht|$$D$(t9D$ L$,ň̍rEL$hEL$D $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[tbōD$ PVAx\#D$=uXUTL$ QPxED$$t $;Au=D$F0=OF1CFFFh- UWBt$Vl$E;$ļ^_[]$$$$U똍FuFEPQhRƍYFuFEPQhRqgFuFEPQhRxYUSWV[\D$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[Õ[$D$$D$hP1$S$k$$UhhWDD$ D$$GƄ4$$$UhhWCj Wt$X8D$1$0Uj t u뜐44 w$ |Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&PL$@|$L$ t$֋$^D$PjL$Q$&PڽD$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP+JtD$Hɋ$@tD$$L$Q$jP؅$U$Z1$$׋$$Pu\~$P$ 1u7Yu,N$P$ t/t u $Uhh$$Wq?11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύ3G#GEPQhRgF#GEPQhRnYF#GEPQhRVsUSWV[xUD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]USWV4Չ[TD$$0qƃl- l- Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/ul- HPRQj14$D$;$0u4ȁ4^_[]ÍFHEPQhR{hUSWV0։[S$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1P;E;$,ue0^_[]ÍFHEPQhR$THHEPQhRxBfUSWV[HQ|$,D$(/D$wl$GQjP[ G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#FI΍L$:$u m1 uL$>͍ >T$1ҍ1 -9si$:FU;L$s>t 9sE.9r9s34$Fh9s맋 $1 9s$m1 ^_[]fffffUSWV[kMt$|$lUl8PPWVEUL^_[]fSWV[Mt$ W!PPV W^_[ffffUSWV[Lt$tLD$F$V~nF1 PUWRt$t$QjV($^_[]ÍIIPQj3R 듐USWV[8L|$,L$T$ |$l$捃IUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]ÍIIPQjBR [USWVH[hKl$`D$ D$D|$\SrE$MUu}m1JUWVRQt$PjD$JPo'$$\uCJPQ+jjjjPVpƍ,0VjjjjWpƅQUVjL$\غQL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$ uj!ƅtXD$XUPF1LXĿF ĿLFuF ;D$hu2l^_[]1ꍃJJJPQjhRnJS[At$ t$ [ÐS[@t$ t$ v[ÐSV[@J1 jPVm D$ jVPjY^[fD$ȉty!fUSWV[h@t$0l$,D$tjuj)訪ƅtRUP1 ĿF ĿLFuF(;D$u6^_[]1ꍃJBKKPQjFRur螦USWV[Õ?$ $$P'h@Vl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ i|=P$Pt$k ƅ~.V$P$P |) us84$la8|$$uj)蚨ƅ~$$QP1ĿF ĿLFuF(4$Wk|$;$u^_[]1蘥胤S[Î=jjjjt$t$[ÐUSWVt[X=$D$p$U$$U= uj)mƅtXD$\UPk1L\ĿF ĿLFuF(;D$pu5t^_[]1ꍃJKKKPQhRG^fffffffUSWV\[X<|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍKKUKPQhRKKUKPQhRh$ffffUSWV[)t$0l$,D$tjuj)HƅtRUP1 ĿF ĿLFuF(;D$u6^_[]1ꍃJDLLPQjFRur>USWV[5($ $$Ph@VT1$|$$ $ u#D$P|$W2P|$`l$d$$ʃ|&jQPt$ |=P$Pt$S ƅ~.V$P$P` |) u84$T8|$$uj):ƅ~$$QP1ĿF ĿLFuF(4$W T|$;$u^_[]18#S[.&jjjjt$t$[ÐUSWVt[%$D$p$U$$U uj) ƅtXD$\UP1L\ĿF ĿLFuF(;D$pu5t^_[]1ꍃJOLLPQhR[GfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[ú$t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPȼ 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPl ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW2 ;D$u ^_[]tfffffL$$Yai qyD$A(tQS[Ø Rjj#9 [1ÐT$D$ Zbj rz $z(t RPS[H jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ó Rjj>8 [1ÐT$D$ Zbj rz $RPS[n jRj7 [Xt@ffffffSP[= D$ L$T$$RQPo[fffS[ jjt$jT7[fffffffS[ jt$t$jb|[ÐS[î ht$t$j/|[fffffUSWV [x t$ D$D$$|$jjUVjWj1D$D$ $jjUPjW3D$D$$jjUPjWD$D$$jjUWjPÜu8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR91u ^_[]ÃtOw OsҍHNmL[LPQjw ^ffffSWV[Ùt$(WjV xqN|$,t?r$td$D?r']- d$!L$jWV ^_[fffffffSWVP[t$wtB+5 PQhR*x>L$ $5 )QVWR 5 PQhR5 = t@= ^_[fffUSWV[;t$D$D$I@t NQw 4ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]ÍQMHMMPQjbRCUSWVX[D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ÍeM^MMPQhtRطSWV[É|$t$t5$D$ WVjjjP臊1Ƀىȃ^_[ÍNmMMPQj:RaffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[8t$(l$$.PT$(18D$8tP) skt4)psD$(8rl$ ugPt$ŋ$t$b覺0?sD$8tP(Wbp4$&#t$#b01UPt$貦ŋD$G6"oD$ G = = D$8tP(G^_[]ÍMMPQhR(MMPQhRT$(#(qÑ;jUPQRVj%USWV׉L$[R2jeV譄j+V蠄t-1|$WjPj%eyFu<$|$1jrV聗tRAb $UW`ft1j^u%赸07\!wQ!虸01^_[]ÐUSWV׉[g= tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$賣ŋ$t$]@0D$8tP9%Wm4$t$01UPt$QŋD$G6oD$ G = = D$8tP$G^_[]ÍMMPQhR诰(MMPQhR腰t$,|$(T$0VWU jشUSWV[t$8$8tP#= t9ut>mt9uu+$8tP#褵h1V_Eu= $8tPy#|$jWu ƃu F8tUktt$^_[]ÍNNMPQhR6fffffffUSWVH[D$`|$\t$$UVPWStUVt$aǃu.薴8ujD~;$} VPaǍD$9tLV@jA$jD$Pfct&UPt$hWTS{D$$oH^_[]Éƍ_NSNNPQj>R!fffUSWV4[D$\l$HSt$XoL$`utu&u t덻tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ tL$ V" 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$艠Ń|$jt$ RUl|$tUjt$ RPU|$t>jt$ RP>l$t%jt$ RP%tjt$ RPT$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQGщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPƉр|$ul$эN4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0w0腟L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$IwL$,T$$ QN4$Qt$(V0WRUt$h-$[4$|$2jjdQU衝ыT$,t$$rN4$Rt$(QPVt$dVt$d 9wijt$ QRDщ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRޜщ9}T$ 4$T$\jt$ QR譜щ9}T$ 4$T$\ijt$ QR|D$ ы4$T$\B:^mNPQj8R~D$lN^mNPQj9RVmfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]ÍOύNNPQhR=>USWV։[$$F t%G HO =r贪,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ} D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÍOONPQhRl[OONPQhRB4O&ONPQhRUSWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVIuD$t @ t$?D$ h |$t$($/lPVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPI)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtP\Vt$FPJVF^_[]ÍOONPQhReUSWVYT$tht$1BtBظkw+4tրztЃːt *u1^_[]ÐUSWV։[Ä]F,F tvZFUPOl$~D$uNtQjPQD$ L$$t$ F1퐐f$t=tsAuE @u1$P-$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu觔$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YOkONPQhER詋M lt$10TD$/ Njt$$E @D$uPPUu 8t E u;$6Ĥ^_[]ÉNjt$몍KOONPQhR[OONPQhR躊|OONPQhR蓊$cOONPQhReOOONPQhR>7OkONPQhERL$ OONPQh/RL$1USWV[ÆT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍Nm΍NPQhR萇O΍NPQhReT$8O΍NPQhR3T$8ffUSWV[$$c$$tu裌1D$$tŋD$3l$ !h@PD$(D$$D$ iL$L$\QPhtYD$|$D$0t$\ d$<0fD$PPjup] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPh{PWuk uh0D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$/PjPv u|$1D$Wt$8Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$3PjPD$p =jPD$p D$ |$t$ztG$`L$tZ/PjPq@ jPD$p /1ҋ$t3PjPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8蝅< 肅Y1D$ D$l$t)`D$D$\PjuV |$>8|$ $%|$tySjPu> |$t&D$u|$8|$ $tt$Dtu V贄t$jl$ Uހ 1$u Uj:;$uEČ^_[]Ë|$|$[| PPOPQj_Rn~y&S[jhjt$t$t$[ÐSWV[= t-= jhjVPt$$t8= 0jF= = tP(= u^_[ffUSWV[k|$= jjj蠠 = l$> tUQ= s = t]1i = 9> wHt Q8 > W;(= t$UWP = u 1T$ Ɖ^_[]ÍyPmP5PPQj u> jP[0xƃ> 1> t > 1W2^_[ÐUSWV[ W> u> jP/x5ƃ> > Uq";D$wUt$1虁0W^_[]ÐS[nt$:.ƃ> [fffffffUSWV8[3u }D$D$L$$jjPQjR"NtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍPPPPQjERz*PPPPQjFR`zffffUSWV [PP1t\ƀ8tUT$D$j PV tŋT$t|zt)PVPգ1ɿkP&wAB6@ʹ &_u@9~ $QjPE,$"QVP%T$t$$D$ t ?Q> RUPjQ!L$ t>> ^_[]ffSV[Í,> u*ǃL> \u!PV<,> tt0> VP!1^[ÐSV[ǃL> ,> tP89\u!PV軙,> uVP1^[ÐUSWV [å$ǃ0> ǃ4> ǃ8> ǃ<> ǃ@> ǃD> ǃH> P> ,> hhU)D$ 1Ʌ$t$lL$T $t$ @> L$l$<ǃ0> ,> hhUD$ L> t$P.Wj\WVO t8t剃0> 8#tj\WVwO t8t뉃4> j\WVWO t8t뉃8> j\WV7O 68t牃<> ǃD> ǃH> j\WVN tD8tPD> j\WVN t8tPeH> h<> |$$W'# |$M j\PD$ P}N ǀ8tWuku͍UW mthWUW mtTUWlt@UWlt,UWlt@UWlQ@> E5xxMf l$<$j\WVM 8t牃0> 8#j\t$VdM t8t艃4> j\t$VDM tOǀ8t扻@> @PWk"<> PWktbe`<> D$!QL> PQ @> l$tэ@QPxku8> <$j\WVwL t8<$tPD> j\WVGL X8<$tPH> t$t$1ɋ;$u ȁ ^_[]SWV[̳t$ǃL> ,> t P۟&\u!PWc,> t*t+V0> Kju䍃0> WP/1^_[ÍNmQLQPQhRWrZSWV[t$ǃL> ,> t P &\u!PW蓓,> t*t+V4> {iu䍃0> WP_ 1^_[ÍNmQLQPQhRqZS[.,> tPfǃ,> [ffS[L$T$ j@t$[ÐUSWV8[Ʊt$PT$$t$,ZT$LXD$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$  Ѓ L$R|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V"2D$Pt$V ID$ V1D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$hQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|ET,TSPQjIR&USWV[fl$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[Hft$$|$(9jVPƿwLjVt$,3 t$( D$l$,L$ t-|$,RUT$T$t .l$(RRl$(T$tX$|$  tQT$ <$EFt PF tT~tE1t(0F t((F t( ;~s F @ƋF PF,t P~F4tPiF8t PYVP^_[]Í#@pU9UPQjKR{?eyUpU9UPQjMRP?efffffffSWV[[t$HWDL PVAnW؎^_[ÐSV[í[HV趎DL PgmV螎^[ÐSWV[l[HWuDL LL PQmWT^_[fffffUSWV[[t$l$VvZVt$[1u<$Vt$r[DžtpU7t]wtуUPyt u막t$~utQ=^_[]É1ԍNmUUPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xs+ViV6VPQhRoViV֍6VPQhRUSWV [hPL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2~V6VPQhRG ^_[]Ël$ u렍΍~V6VPQhR7΍~V6VPQhR S[îNt$t$jt$ [ÐS[~Njt$jt$[ÐS[NNjt$t$t$[fffffUSWV[NL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉL uj( ƉDl$Utwn$Nj 0Q 1L utjh=pʼnL 0ƃL LtMjуL @1t*n$FJUQj Pa)|$z^_[]ËL )USWV[ëLL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(蝶ƉDl$Utwn$Nj 0Q謸 1L utjhʼnL 0ƃL LtMjуL @1t*n$FJUQj P'|$z^_[]ËL )USWVP[:Kl$UHNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$ t0L tuR:t!jуL tiE$SL uj(.ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[JIl$UXNjL $tOs;1҉vL ljh L $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(>ŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[[Gt$|$ tЋL t61=tDtPǃL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃL D$ 1^_[]ÐUSWV[KFt$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[5E$tA$1uhvƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[{Bt$tD$tdPV$xaa1ɐ΍,?UQ获t&UP$y.w 8"tV 1^_[]ffffUSWV[At$VL PL ƃL X tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1 ^_[]ÐUSWV[û@|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í:\[PQhR@] \\[PQhR6USWVP[ú?|$t$t#l$ t?tajUjW^_[]Í:,\[PQhR빍5\,\[PQhR}uNm,\[PQhRWxUSWVP[>$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lhg$p $L$1xjjjU@|$ `\PQhl$XU jjjh@Ujh@6,j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$NmF\[PQhR6$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP辰T$ )ʼnl$‰$L$\$(l$$|$ t t$ht$,D$l$ tEF4$ѵhD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$p؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUi5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPޠ Wt$DUР t$$t$ t$0蝳/L$0\$|$8T$L$ D$ɋ,$tt$T$,fT$Ћt$ 9v8)PU褭|$u(U*A|$ |$L$1|$ 04$0rL P?KL P(!L L$ <$14$y$lyD$0P|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$V(D$xWVt_WVP UUx~1L$ ȉŋD$8L$D$8B\$W蔱 |$ t$GdUU |$;$LP^_[]V0WH \L$.\Ս[PQhRYL$,8\L$.\Ս[PQhR&ꋴ$tL$,5\L$|$.\Ս[PQh R|$L$,NmL$|$.\Ս[PQh R$|$L$,Ń|$ \$t t$b4$!NmF\[PQhRL$|Nm\[PQhR$|Y\$U趯|$ t\$t$nb\$t$0華脛X4L$ÐSWV[l4t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í:F\[PQhR}NmF\[PQhRVSWV[Ü3|$t$tGtiL tPQǃL ǃL ƃL ƃL WV^_[Í:Q\[PQhR_u5\Q\[PQhR9pS[2L tPǃL ǃL ƃL ƃL 1[ÐUSWV[Õ2$,E$$$(L uL ȋL u!\uQ0 L L t%1L L PQ1t $D$uz1L VMVvǃL L HL @M\uQPBL u<X1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$V`tfVSǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$VǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPYǃL ǃL ƃL ƃL GV)ǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL C\\[PQhR$<E5\\\[PQhR$<XUSWV _X.T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u6 (FPUntL$(U$W ^_[]Í:f\֍[$PQhR|$ \f\֍[$PQhR|$|$(Sf\֍[$PQhR|$&:\֍[$PQhRa$ \\֍[PQhR0USWVY*T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd|t]ƃdNJD$$ƹdEt#<:tu)FdPWu`)nu N$UWt1L$$8$o\\[PQh`R$WC^_[]Í:\֋$[$PQh"RYL$V \\֋$[$PQh#R!L$|$$&\֋$[$PQh$RL$:\֋$[$PQhR$ \\֍[PQhR}USWV[+(l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuP F(N8D} '~wF^ FPB^ uWv$Q ItƒN ~?:V|@uH)ƒVԋ^ ;FF$BBQWP uvvQ K~?:uFV;~t^  ^ q8u^ dF,;8u e^_[]Ë^ S[#0t$t$ [ffUSWV ["} F FEFUVzRu)ʃԉF:FJFx9u0RuO N ;Nue^_[]3fUSWV0[3"D$(},PQXL t$M L$ML$f|$ L$T$|$QRj WPGBuOt$ rF|$j WPb u0O L$FD$D$ PjL$Q2 79_t$} urP tgM9uWM % )]QPR}Wu19r"y";L$(L |jjP@ PVJD$t$L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V| uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPuf 1ɋt$;D$(u ȍe^_[]ƆS[]jP;L h P>P [SV[ÍL hVt$t$t$%t1^[fffSV0[Jt$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[\t$|$jWj VW) jW踠^_[fffffffSWV[ t$|$t P-\u;^PQ ~^_[ÐSV[ýt$ tP肴FtP}zFFFtP_zFF^[ÐUSWV[H|$(?u \u;^PQt$$olD$t Uyjjjj|$87p$Gʼnt$Put< t< tt$Wut Ń1WO$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ PI D$ L$ 8ukD$ $FD$,t$UtmŃzAA jj t$t .$ tEt@u%$``J^PQjJRE@NT$RQjjjuЃ>T$u-``_PQj[R蟶T$,$ t|$ tEtHHu0h`O`׍J^PQhRH|$0EHHPVt$0t$0WRUуt 0$^_[]Í`__PQj}RS[ÞhPt$t$t$t$t$S[ÐUSWVP[Zl$t$D$ $ t t@8u'``J^PQhRG@8QUVwЃt 0$^_[]ÐUSWVP[l$t$h$ t t@8u'``J^PQhR赴@8QUVwЃt e0$^_[]ffffUSWV[;t$l$ø+PQWz t"t$ VWh cWjjPTU賉PQW: t$fffffffS[îjt$t$t$[fffffUSWV[xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]ZUSWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr膸 :T$$EjPgD$tk|$jWcgD$,D$ tND$1ɅujW@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ ‹D$$t $uCr.0|$1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V | DžL$~9t/;$WVQ袆L$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j}|$l$t$D$PBgt$ 6gU-gV$gl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$ft$ ft$f넍aGaaPQhR!aGaaPQhRaGaaPQhRSaGaՍaPQhRr`baGaՍaPQhRGꋌ$hRaGaՍaPQhR2aGaaPQhR<aGaaPQhRxQUSWV[xD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]PUSWV[l$ |$t$t V 1L$1jUWPV^_[]ÐUSWV[ël$$|$ t$t V躞1L$T$jUWPVp^_[]ÐS[^L$1jt$t$t$t$6[ÐS[.L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[èL$(T$ 7t$T$L$D$L$11jUt$,jP`xD$Ƌ;D$u ^_[],OUSWV[(D$(L$,T$$>|$T$L$l$L$T$ jWPjU1xL$ȋ;L$u^_[]NUSWV[ë|$t$t V辜1L$1jUWPVp^_[]ÐUSWV[[|$ t$t Vn1L$T$jUWPV^_[]ÐUSWV[ |$t$t W11jUt$$PW^_[]ÐS[þL$1jPt$t$t$[ÐS[~L$T$ jPt$ t$ t$ Q[ÐS[>L$T$ t$Pt$ t$ t$ [ÐSWV[|$t$W#uuGكs^_[!t_t$t%<FF ^_[ÐUSWV[{|$ u ^_[]l$ t$WHut t- t(W1utLWP u뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVrt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉr$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWqu#XDxuGws>4$$^_[]ËD$4  !rfUS [ÅE$D$D$D$PQ7D$e[]fffffS[>t$ t$ [ÐUSWV[$$%= uRl$`]4$6Kƅt9w ‰ щ ȉ  σWl$u+TƉE}M(tXPIZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$ QD$112fOH|$4D$,$t$Wl*t$$UƋD$H(L$tXP$HǍHTD$t17YGPPUQu w,L$AGG GJG GGGDD$ GoD$PfGt L$y|$1l$9l$^|$4l$trV$$M(tXPFt<$tM1QE<$twWHWut$ 6WuV*WU!WYHP@T@,MH@ @J@@ @Exf@H u"jh@P EuM(L$ uEQV8M; baPQjRÚ1^_[]ÍM;baPQhR耚USWV։[!G(u/nPFJt0fD$9j|jU, Exl$FJuЃN $t6UQt^负8Uv9u&蝟f )UQt(~8~ j|jU诛 f Ą^_[]E%===@EM $NRGtpP(RuGt PRwRG(unw1u(wWQtC(5PQ~DXpupWQ1^_[]Í+*baPQh R讕USWV[X|$7mG(_NLfFLftfuwjfFH4NHʃf uojfFHf G(jh@Pt F$NJf~HnHf@u!fu|nH@tN<3OV83W Ok6vj9F NJGQqRQu𐐐pPO~D'FLfui9t̍?b5baPQhR-FJt v$OGt!,$hPhOuG,$fEfVjfFHf4G(*jh@P F$NJpPN~D*GN(~DFFJVVDcPj(G(uwgHF,F(nTPUw; j/l$Uwt5;$u~Ut(UzD$HQUt$E; D$F,GFFF8N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u 豔G OJ裔D$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P8ōG UTD$t1 .YMPNQPT$ Rf u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRC4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$H1+[baPQh1RLD$u‹.1F)EHftf },$FtpPCu|$t$u N)$xDuW@8/tOF(uIjh@P( tFFU$U<$u~yljF^_[]FUSWV[ t$tf8}t v$>V }t!v$v$v$BVBWZ^_[]ÍbbbPQjBR趆vfffffffS [[hPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[L$T$ hP[ÐUSWV ׉[ôT$4xtb=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWV#2=u$"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[ÞL$T$ t$[ffffff̀rS[dt[̀rS[Dt[ ̀rS[$t[SWV[ |$t$t-9t!t F9u1^_[Í$cbPQj*RfffSWV[Ü|$t$tt1WVj{^_[ÍScc+cPQjBR藃uύScc+cPQjCRt뮐SWV[|$t$tt1WVz^_[ÍScc+cPQjBRuύScc+cPQjCRfffffffS[ÞL$T$ hPt$ [ÐUSWV(T$ [bL$<\$%t$@|$t;D$<|$"v+61t$ \$VP-t\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXD$|$tt$ht&L$ptCwm\$|\$dKdPQjxRv뵋\$؄dKdPQjyRv$vl$l1 D$͉L$4A\$P!gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$؄HKdPQh&RtV\$dHKdPQh'VtdPQhrVt$xbt$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP \$R#1T^_[]Ë\$؄dKdPQhsRg$\$؄dKdPQhsRg$LUSWVTX8D$ L$pT$htwL\$ m ֋\$ dKdPQjxRg$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ dHKdPQh'VOedPQhrVt$x/e$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Q1T^_[]fffUSWVP[ |$88tqw$G$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;WuUEuu u EtctUxFUM u9yu)փ9|)U1 qu |$ly u%E \[ [ $1ɉȃ^_[]ÐSWV[ì|$88t'w$jWw$ jW^_[ÐUSWVP[J|$l$B[$8[88t>u$/jUTƅtF PVWY. u$*jU!t@ PVW&. 1Z8t uZZ $tD$ 81^_[]fff̀rS[dt[ḃ̀rS[Dt[SWV [)t$ |$t[D$D$4$ Z0L$jjPWjQ'1uY9 u Y01 ^_[ÍNm,edPQj񐐐9t uD$))t8t)Pt u+D$ P%G^_[]ÍeePQj@RQD$(SeePQjARPD$(7fffffSV[ÍL$D$T$ y9eRVQPU6Q4P 1^[ÐS[.D$y%9eP PQj@R;U P j@4R P [fUSWV[ːt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JSLfePQj?RO눍SLfePQj@RaOq1^_[]fffffffK̀rS[t[USWV [؏t$ РD$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV](|$0||$4РD$Pt)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$轾^_[]ÍffYfPQhYRJ[USWV[Xt$D$.̉)ōР$P3t)1ҋP<Pt14$譽D$^_[]ÍffYfPQhRIUSWVP[JРWStI010$9r$9r$i0mNA900W޼^_[]ÐS[ît$t$t$b [ÐS[~t$[ffSWV[\|$t5jWt ctVW(1^_[ÍNmgfPQjAR8H몐USWV[l$t{jUt=ǾtUWUt1l$UPt$ L "19s#MM8^_[]ÍNm gfPQjVRGaffffSWV[,|$1t,|PWzt |$t=t=tƉ^_[ÐSWV[܇t$t-VW tPW V^_[ÍWgJggPQhRF믐SWV[l|$GPtƉx @VP1^_[ÐSV[t$ t%VPMt L$9H 1^[ÍWgfggPQhRF뷐USWV[øD$01t:>t41 |t$t$ t$ W< uD$ <=u.|$$ 0Q 9ttD$00Q M9u;4Q s|9v9tfPǃ0Q ǃ4Q $jWPe J0J8uyPD$0t$ )$jWP  J0J8u4)  $PjQF $0Q L$4Q ^_[]ÐUSWV[8Q t8Q 1t0DtPVt8Q Hى|$jjD$P tE t5jVt$ F:8Q tVt$VKŋD$0Q 9tP0ǃ0Q ǃ4Q 4Q UjP\E ^_[]ÐUSWV[81tR/tL,t4t$t$U9 uD$|=uօt D$1^_[]ÐUSWVP[z|$1||PWtfƀ<=t^tR)tI1 $ $lt+Vt$U79 u|5=uمxD$8.1^_[]ÐSV[͂PVƅtG0^[ÐSV[ÍPƅtxG0^[ÐSV[MPֶƅt8G0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[êD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[HD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[ȀD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[HL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[È}T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVtGPV|tۍGPVˍtʍG PV躍tWV詍묍"hjihPQhRm2CjihPQhR[FUSWV[ _t$|$Gt/uTot^REwnd1o  u-GFGFFnFn GFG    3CwihPQh$R.iwihPQh%RiihPQh RGFGF^_[]ÍiihPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[Ô\t[v̀rS[t\t[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[[|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1ETiiPQj:RU]iiiPQj;R1VAUSWV4[Z$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋxl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF jl$0PQjU!6U$\9ȋ$QU$`- FfN?QPR$`U$`51Ʌ9$Fx$P$T)iPURQw5*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L?QPR$`$`4l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$ajPQ|$W$`Uu3t;$Tg$P$T)D$D [P|$Wt$L$QR"3L$)D$D Pt$t$t$R2L$)D$D Pt$t$t$R2L$)D$D Pt$t$t$Rw2L$r)D$hD Pt$t$t$R>2L$9)D$/DPt$t$t$R2L$)D$DPt$t$t$W119D$F$PED$1$1D$ [D$ajD$׋D$ tD$ $ 1QPt$t$UI1H)D$>Ń19t$un 1f$PL$$T)fv fD$ jVQURt$0L$ ;$T$٥T$0L$RQPWt(8WD $\9vpD$0Pe;fǍ j$0PQhWC0W$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtP`Dž $y+aG jT$ PQhRx+= $w89;$(w))΍L$ WQPF D5%D$D1D$;$ ^_[]ÍWHjjPQhR FHjjPQhR $$bEHjjPQhRh ; fffffUSWV[N$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv Wu*ft#Qv$4ƃ1ҁD$D$ƉffD$D$hVQPPt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQPp uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tfffffff̀rS[Lt[USWVP[KPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pgx8^_[]ffffff̀rS[DKt[SWV[,K|$t.jWG=tjW^_[ÍjhjPQj@R fffffXJL$rÐSWV[ÌJt$u8ljjPQhrR V;tF~tP"^_[ÐUSWV[J$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$ *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RZNjD$$fxxt$ T$@>P]fD$>P]fD$>P] f|$fD$f|$"D$<$$!|$hVWt$8RTYgD$D$$fxxVT$@HVtNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$8VWP$Pj%ƫ΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WM[mPt$t$t$DQ$Pj%T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FPZfD$FPzZfD$h$!Pt$ Vt$8WSVfNjD$$fx$!xVVAVm=*h~L$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V)<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V裋L$tL$8$tYt$`~l$(u2D$4t$%Ut Q+yFPVt$`)L$8uBff#V01l$(E;$%b%^_[]QUǍ>m΍4m׍jPQhRMm΍4m׍jPQhR$%]l΍4m׍jPQhR.IG΍4m׍jPQhRl$% lύljPQhR8$%~ύljPQhR$%MTu?WVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jP Ņtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P ^_[]ÍlmjPQhR@mmjPQhR\|$FmjPQhR/USWVT[ 1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4lD$ D$$L$j L$Q諜tL$t$ t$Fe t tt,…tt$ Pu$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"R tT$GtItu܍ljPQhR=T$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1mmύjPUhk RlmύjPUhl R~USWV T$[" L$8D$ l$4"t$@jV1]F1t 1Ƀt Du`1<$L$D$ Pl$ U,1mPU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ P 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UQqGt!D$881<$;D$ ^_[]ýW+t‹GwtP܍l͍mjPQhR;IG͍mjPQhR l#njPQhRljPQhRWnfffUSWV([U$H$<$$E UPM 1U4$Um$DUtڋ$D0W蛽t4$DptPWytu뗐$@tP$Hp Ej$DWhH1$@T$t.$@3T$D$1L$D$=wu4$T$$L$%D$&hRWP։L$4&t$$DP D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$ET$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$ZET$L$ ut$t$$LUNmn}nPQhR_kfSV[ t$ t,FF#EgFFܺF vT2^[ÍKonPQhR밐USWV[Øt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ 葛 L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVP3^_[]ÍKonPQhR&oonPQhRUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW> ;D$uY ^_[]ÍK1onPQhRK1onPQhRҸu`ffSP[}Pt$1Ƀ $ȃ[ÐUSWV$YHt$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RDRWjP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W Pt$l$ Ur t l$ /D$D$<F\$hPW& |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR>~T$ \$WjRT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R} E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$w}T$ L$E E$\$l$TU_/4$U_$L$$9sD$DQ_1ɉȃ0^_[]D$D捃oooPQj]R豣W\$SV[]t$ t V5_^[ÍooPQh/R_fffffUSWV|[j$1tGljPWJt)l$XD$\|+Wy Wc1|^_[]jjWjjUj#KW8t҃D$ l$<$D$ƅuUW#뚐USWV [(|$$(rl$ NBCD3EB 3M t 1 ^_[]Ë|$,jQ 9quJٝ$mD$;pD$4$vt$D$<$9L$HL$D$ l$PpD$$$˸$`$ttl$$;%`t %)l$ p$D$D$`it$L D$0Vvt"l$ p$D$D$ it$L D$0vt"l$ p$D$D$ht$L D$0ut"l$ p$D$D$ht$L D$0ut"l$ p$D$D$`ht$L D$0Vut"l$ p$D$D$ ht$L D$0ut"l$ p$D$D$gt$L D$0tt"l$ p$D$D$gt$L D$0t$t"l$ p$D$D$Yg`t輆|$4t2z|wL$DL$ D$pD$,$t4tƁ Ot yI uD$4$D$5L$@L$ D$pl$$$莵 Ɓ Ot yI uD$4$D$U5L$T$ t|.t;L$$} f.^_[]USWV [$ $$ $ $T$hRVQPr 1xDǍD$P~L$t|.t=fD.t$(Q$;$u ^_[]0USWV[|$t$Ft)l$PUItF u1t^_[]øuUSWV[ël$|$yƋGt!9/ttO 9ou UPV( 1ɉT$t ^_[]ÐUSWV[+l$|$yƃt9ot0 uUPV^( D$tD$t7^_[]ÐSWV[ì|$xu Y 1t Q 9yu x63x.=x&Rxx"xMx^_[ÐSV[ít$ uYj(PVu youY jVQj(PڠRuY^[ÐUSWV4[H$D$0D$IuD$HL$j.QPjJyxT$PQj.jR_y$tEL$PQVT D.0;D$0u 4^_[]*USWV([èt$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$-yy֍xPQhRtːUSWV[s}PfD$|$D$ D$POlHHPPDy0ppp RQWjV}$r D$ƀe^_[]USWVP[l$APU.2PUpPUPUpPUΈpPU趈PU螈wjPUT# 1uRXMDHt? yj PU x8u$8 L$A.&L$0t9^_[]ÐUSWVP[Zl$ PU艇txF u6n{jPU7" 1u[XMDHtHwj PUҕ w8u $8 6D$t8^_[]fffffffSWV[||$t$jWPGHO~;G~ t H WR評jWR^_[ÐSWV[ T$L$Bpr~ ;B~ t 2~: RQH^_[ÐSWV[ù|$(D$$u$PfD$D$D$D$ jWOG0u ǀD$PWCjWQ^_[ffSWV[,aHt Jt @t A ?t/t5Gt E49s%{s{jQjhRE4M01U0)E41E4u0} MU }$"u uD$ E HM HL$HM xQZƃE t$ 8zV|$Wt$PQjdj$$+W2[ 9E4?PWu0> E49s%{s{jQjhRE4M01U0)E41u;D$ !u E PS{PL$ Qjdj$+WZ9E4B?PWu0w= E49s%{s{jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu0< E49s%{s{jQjhRE4M01U0)E41u E _{PQjdj$+WY9E47>PWu0l< E49s)\${s{jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\${s{jQjhRE4M0QU0E4AD$z`/}$D\$u 1M QU Qqu It$z\$QRPVjdj$ +PX\$ 9E4<P$ +Pu0: E49s%{s{jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-{s{\$jQjhR\$E4M0QU0E4AzD$#M }4E0T$WP=;{E }4;E0 E4u)\${s{jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E _{PL$ Qjdj$+W/V9E4:PWu09 E49s%{s{jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu08 E49s%{s{jQjhRE4M01U0)E41E E P+E Pt$ jdj$+W+U9E49PWu08 E49s)\${s{jQjhRE4M01U0)E41M AE  L$<%\$L$ L${L$s{L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu0(7 E49s\$jt$jht$,D$(E4pE ;D$8}0L${T${T$ s{L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-{s{\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru cE _{PQjdj$+W`R9E47PWu0H5 E49s)\${s{jQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$]{VPjdj$+WQ9E4H6PWu0}4 E49s)\${s{jQjhRE4M01U0)E41|$\$E L$ L${L$s{L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu03 E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E zPQjdj$+WO9E44PWu02 E49s)\${s{jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0q+ E49s)\${s{jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-{s{\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\${s{jQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$JPQjdj$+PF9E4:+Ƌ\$P$ +Pu0h) E49s)\${s{jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L${L$ s{\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$$UD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$ L$L$ {L$s{L$$+р਀tsRPt$ jdjVD9E4g)PQu0' E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$z|$X\$PVQj2jWC\$9E4(PWu0& E49s%{s{jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\${s{jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\${s{jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\${s{jQjhRE4M0QU0E4AE MU \$VWu,P}$E _{PL$ Qjdj$+WA9E4&PWu0$ E49s%{s{jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu09$ E49s)\${s{jQjhRE4M01U0)E41E E ;D$%L$T$T$ {T$s{L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0Y# E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-{s{\$jQjhR\$E4M0QU0E4Au E PS{PL$ Qjdj$+Wz?9E4-$PWu0b" E49s%{s{jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0! E49s%{s{jQjhRE4M01U0)E41u rE E P]E E PHE zPWVQjdj$ +PC>}$u E E PE E PE zT$XPWVQj2jR=9E4"PWu0  E49s%{s{jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W=9E4!PWu0*  E49s)\${s{jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0 E49d\${s{jQjhRE46*DD$E4D$W\$L$D$L${L$s{L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$3\$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0o E491\$jt$ jht$(D$(E4  L$D$L${L$s{L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$~2\$9E4mPt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu06 E49-\$jt$ jht$(D$(E4\$A}4E0)E4u)\${s{jQjhRE4M0QU0E4AC}$n }$b_{PL$ Qjdj$+W[19E4PWu0C E49s%{s{jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s%{s{jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0K E49s)\${s{jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\${s{jQjhRE4M0QU0E4A 8{g}4+E0-E4u)\${s{jQjhRE4M0QU0E4A}3}4E0 E4u)\${s{jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7z$+t$z$ +f@======2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +rz4w|$7z$ +r|$7z$ +rz4|$7z$+Rt$z$+2|$7z$+2z4|$7z$ +r|$7z$ +Rt$z$ +DŽ$ +====2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +Rt$Vz$ +Ƅ$+=fDŽ$ +==2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +rz4w|$7z$ +r|$7z$ +Rt$z$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L${L$s{D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9*\$9E4(Pt$u0Z  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$z\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L${L$s{D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$Z(9E4M Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0  E495\$jt$ jht$(D$(E4|$ D$f E4w)\${s{jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u >E M4 U0B  ru0M4B\$QVP"  ƋM49s)\${s{jQjhRE4M0L$M0)D$E4z|$)D$L${L$ s{\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P肨 PQjdj$+W%9E49 PWu0n E49s)\${s{jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj诈}0W$ƋE49s,\${s{jQjhRE4}0}0)E4E \$u4u0PjF}0W*$ƋE49s,\${s{jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\${s{jQjhRE4M0QU0E4AD$zw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L${L$s{D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$"9E4Pt$u03 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\${s{jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u 蕱E M4MU0B  ru0M4B\$QVP  (ƋM49s)\${s{jQjhRE4M0L$M0)D$E4|$t)D$L${L$ s{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\${s{jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u E M4U0B  ru0M4B\$QVP\ {ƋM49s)\${s{jQjhRE4M0L$M0)D$E4|$)D$L${L$ s{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\${s{jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u 7E M4U0B  ru0M4B\$QVP ƋE49s)\${s{jQjhRE4M0M0)E4sf )E4w)\${s{jQjhRE4M0QU0E4AE4D$E0D$|$)D$L${L$ s{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\${s{jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$*D$,;$p+u ȍe^_[]Ë\$USWV [Èet$,|$(D$ .ʋ7l$Ut$Vt$40RQ4‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s)D$D$Q@(D$ 9s${s{jQjhR)))x ^_[]1))lj${{s{PQhR#뽐USWV Չ $[cT$8D$4 D$L$D$"u${s{jQjhR|$4QA$93<$779$x{D$D${D$ s{D$0t$4QEAt$jPt$ e tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u${s{jQjhRMQUA+<$-&&D$4L$D$ ^_[]ffffYaT$4D$#lpÐUSWV[Ka|$ l$t$~Jt$~2UVax(ƃ|$tލF9wȉ9v%(+t$^_[]ÐUSWVP[ú`|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }?%(^_[]E ffGftC,$RWGxǃ9w,$)xD$ hHGftf,$RWf 8 9Xσ95,$)5|$ oGwtc,$RW胡 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [8^|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$." ^_[]Ð~34$U迟x(ŃtߍE;$wMȉ;,$v K"(+l$xD$ h,h,L$H(ht$0Quu]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5P!(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[è[|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.! ^_[]Ð~34$U/x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuuU}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XY\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōg|{PQhR|$ <|g|{PQhRr|g|{PQhZRfffffffUSWV[kSD$$L$1w|$ u Cc0|PUWVt$(t$(QRo3 XRL$uÐXRL$w1USWVXRD$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$<||PQj>R;\$}||PQj?RUSWVP[zPt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í}}|PQjgR1fffffXOD$pX txҋ9|Wy>TWPڋD$+D$pyȲffffUSWV[Kl$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[%K$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]腱ffSVP[ÌJL$t$D$T$ $xRQVP&x9rQRQPY ^[USWV[;J|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[ûI|$t$l$tt$$PW%t^_[]VW t W LJWVUF ͐SWV[1RjV"t3jVU# tۃtjV"t jV/#e ^_[ÐSWV[ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$vt$,PVD D$,\$YPV`uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$H L$8@ t$ D$PuQD$L$  \$QPكȸ`؋|$8tWA\$t$ t$wًD$݀Dr{|$tD$t fD$zl$z߼$Xl$t$X$DŽ$ ߬$u{*1T$89T$|$DŽ$߬$|$tDD$!=w2ݜ$$$)$$݄$\$ \$PD$ Ƀ|$8|$u <$'${|$8؋D$Ɓ\$`|$ $L$T|$D$\$P\$PD$L$$ݜ$$|D$TЁ uD$$|$ |$D$݀Lr^|$rD$r fD$xl$x߼$Pl$r$Pt$DŽ$߬$|$8t\$`ݜ$$$)$$݄$),$$$PD$|$ :\$`\$L\$PD$L$$ݜ$$$|$D$`9u~|$pT$p fT$vl$v۔$l$p$$ڤ$|$8u% u D$݀dL$݁T݁\؋\$WPt$Dt$ 8t$,t$vS$tR6D$D$ـw|$؋t$MD$D$ D$ۉ؃t)t$4$ݔ$$D$$~iމjL$L$dt $ݔ$$L$$ʉ)كD$(NNONt$@\$Lt$(|$L$lt\$(t$HԉT$T$ T$@\$7t$,PVtQD$,8("$@\$PPQV  $DD$$@$D$@D$,1ɋT$01؁T$D$ $$ݜ$`$dD$D$ D$|؁|rMD$$)ɋT$0t؋t$()ƋL$ $1 PD$gD$$,jK$6D$p|$ D$D$ D$ |$ D$|$ D$D$ D$ |$ D$ D$8 $t$DD$5%=%D$xu x\$jPt$ D$P'D$xu x$%|$8t$|$tB#D$=w2ݜ$$$)$$݄$\$8\$PD$8$$@|$ D$|$83i4$k(ٿr1Ƀ|$ 9.=t$|$ ؉|$ t$؋D$Dt|$ tD$$|$ D$$\$t6WZt$Nt$ BV9t$-"T$0L$4tD$,$t؍e^_[]ùk)ًD$$ $u=t$|$ ظ#D$|$==ppL$TtJM؋t$|$8t$<$؋D$t$D$X$t$|$ I\$P|$8|$D$%jF)$DŽ$܌$K(T$$ D$$|$D\$b$V|$t4D$%jw#F)$DŽ$܌$,$$uIzGD$D$$&D$xT$$t$|$ ؋\$Wt$t$ Vt$|$$؏̸$ݜ$H$LT$0L$4QAL$4T$0"7|$t%=s t$؋\$jt$D$t/\$t$ t$Oكĸ~D$t$YS[Þ+L$T$ t$[ffffff̀ffff̀rS[T+t[̀rS[4+t[̀rS[+t[̀rS[*t[USWV[*|$l$ ED$t@UD$t#:D$ut$UW u1^_[]fffffUSWV[[*|$l$URWG9U6W%M;OuLtF&t;tu5t;tu+t;tu!tf;tutf;4u u1^_[]Íx}k}.}PQjCR }k}.}PQjDR}k}.}PQjERS[N)D$QjpPZ[ÐSWV[)t$V'uE|$WuO;r$vtuO9Nr w1^_[Í}}.}PQjeR.~}.}PQjfRSV[}(t$t$ u1 ^[ÐUSWVZ8(t$0~: $D$D$D$D$D$ D$1$ ك˃>ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[&|$   >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[%D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[=%t$ >t0VS 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[~$D$ L$t9u[Í~|~>~PQjpRS[.$D$ #L$t9u[Í~|~>~PQjpRtD$t&L$tu1u 1tÐS[Þ#L$ D$Qss)ǀ[Ãuu ǀ[Í~|~>~PQjpRS[.#D$tL$ t 1[[ffUSWV["j G1tQ@@jjPPn (8t(W~(^_[]ÐSWVP[k"|$tcOGQ9u0$jQPm >078t  G $GT$pw1^_[Í~~~PQjZRySWV[!t$tRtC|$t3~t-0萜~r4w;~rPdV[^_[ÐUSWVP[Z!t$t@F$t*.1tt$Vt 9<$u1^_[]Í~~~PQhR(뜐USWVP[ T$J $Ћ*1|t$Wt94$u|$ l$tWiE$F;$} $)Qtu<|uprP $كU|vx ux P t&D$j.PWV!tl$t $x D$P製L$QRPD$PWU  $t!Q<l$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PVL$t$(cQt$@Ff$w-j4D$0$D3V3[mPW|$t$8t$HQj%荐T$T$@t$$P6tt$6Pj%P$D$@9F f|$0u D$(8gt$|$u$L0V!ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRIo l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V蚮=~ $!D$1$D$$1D$\$|$$R t1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<贬=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPH 4$ql$l$$T$8)ƒ)19s@Qq詻1$X;$(,^_[]Ë$LnRPUŎ 1‰(>m4m֍/PQhRfMm4mT$$/PQhR9T$4z?|$4\qUSWVT[$h>Wt1T$ T$G j(_¸hl$D$D$ D$$D$l$1|$ D$ l$Pt$ VNlǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tQPWkt1ɀ8 L$L$D$D$L$ t WPCtT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍPQhR]PQhRBOUSWV։[Ä_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUx$T$ E ulD$;tM WE=t܉t$L$4QPt$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP8L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tRWD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQVD$e ߋD$)D$UYu E;D$UOstjU|İ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q.VE0EEEe jU{1뙋t$uyb)EۍPPQjGRPPQhRD$D$ D$NPPQhREtfffUSWV [ht$@|$4u->FD$FD$\$jt$8x1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$D$ 14$G>D$ ^_[]Í{gPQ1܍"hQPQhRAqQPQhRJSWV[ü|$t$tt9h(#WV ^_[Í"h QPQh?R证uǍ QPQh@R艁룐USWV[8l$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í"hQPQhWR謀L9QPQhXR肀%USWV[(l$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í"h)QPQh{RL8)QPQh|Rr%SWV[|$t$tt4WV^_[Í"hEQPQhRu̍9EQPQhR~먐SWV[Ü|$t$tt4WVJ^_[Í"hPQPQhR~u̍8PQPQhRn~먐SWV[|$t$tt4WV^_[Í"h]QPQhR~u̍9]QPQhR}먐SWV[Ü|$t$tt4WVJ^_[Í"hmQPQhR}u̍8mQPQhRn}ffffSV[t$t$Vt$t$t$~>.u^[ÐS[޽t$t$t$t$t$J[ÐSV[ít$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[Ît$ t$ [ÐS[nD$t$ P[ÐS[>t$[ÐS[t$Z[ffY ÐX߹L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$;PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$4w;t$b\Gn߃^rxo;l$1\,, $* wkdT$Ɖ*t$i $* wi (Ћ4$ Wm;|$Yȃ|$ U(!Ћ$;PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$+{(^_[]Ë${ᐐS[jt$t$t$[ÐUSWV([ø|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ rp0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[.L$T$ hPt$ [ÐUSWVT$[ɉ$t$4|$ |$0t=D$0|$ "v-h1T$VPT\$u+t-t$0u#D$ D$t$0t@D$u20u- L$$$Wt$ $ƒ8\$t$D$qP$j V]]$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP !ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VjY$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j VX $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j WW $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j VV$9qc9uRHx1t$DQP$j VrV$99u $L$ 1t$DQP$j VV$99u $\$1ƍ|$DVP$j WU$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u7,5\$]\$$N=L$ $<$\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TV8T$$99u<$D$ ;D$pu t^_[]Ë\$ USWV[w( ʼnƅ~;01WUjP;8;$D$l$ l$hT$$PD$PUt$(t$89t; $+|$ u;"11P0^_[]ÐUSWV[8vX ʼnƅ~$;01WUjPk8:$D$l$ D$ʼnT$$t$,|$WUPt$89t: $+|$ :"11Pd^_[]fffXou88ÐS[Nu88tĪP̩[ø[S[u|$tĪP蠩[ÐUSWVP[tL$y~X$T$GsY11t5iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF :-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F :-00u҉u 11Ɂ<$)ȉ ^_[]USWVP[nD$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[ül88tĪW:ƅ~102jj!jPu W^_[ÐSWV[Ll88tĪWʠƅ~,102jj|!jPfu W艠^_[ÐSWV[khR5ƅt(T$jtV081^_[SWV[Ìkt$08Vax08^_[ÐS[^kt$jt$t$[ÐUSWV8[#kM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3@ 11uPz,R[ H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[h8}tlPQ $_ u` {Dž<$}t+ĪPIƅ,$~,01K ,$|$1jPUjW/DžuĪP^_[]hmP` 蚜QWFUSWV[f88t ĪPyƅ~+01Rl$|$ u1jP UjW[DžuĪP^_[]ÐSWV[\ft$|$LPQ6@ 1WP(t [ H(^_[ÐSV[et$L$@ t$P'ttp[ H(^[ÐUSWV[ëet$8 8t8PQx_ u` DžtA,LPQ@@ 1UP't [ H(^_[]h{tP` xtW듐USWV[dt$|$l$LPQ豚@ UP&ttp[ H(^_[]ÐUSWV[kdt$l$8 8t<PQ4_ u` ͙ŅtQXl$LPQ@ WP%ttp[ H(^_[]h'tP` $tU냐USWV[Ëc88t(ĪP ƅ~k(0z|$1jPt ̔j&LPQ@ jP}ljՅuĪPv^_[]ÐSV[ýbt$D$ t̔"LPQ苘@ jP^[ÐSV[]bt$D$ tF t̔"LPQ @ jP^[ÐS[aD$t@ PN[ÐSWV[a|$t$tF LPQ蛗@ WP^_[ÐUSWV0[eaD$($,ɉ\$9ΉT$y |F 3&D$D$l$jP$PP$PW*|$t ֋|$ωjD$P$PVV*ʼnր|$t |$|$G D$ $DG~$,\$PjQ! G>D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[Y^|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ LPQ@ jPo|$x ,^_[ÐUSWV[û]T$D$t$>O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[:]88t+ĪP踑ƅ~"0 u1jPI4$t$|$t6BR lP~;yQi|1)΃<$uĪP^_[]ÐUSWVXX\L$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[h[88tĪV܏Džt> 8 ujj}l$(D$$$t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$VŎ$^_[]ÐUSWV[ZE$$fBt π?:t ?:uʀ/\$ uuPW%tjPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ W/uD$HhPẄ́ ,D$(W$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xWe}t$D$(0WC}DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[ñKtK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9u_<;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$i4p/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףi4Ql$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$i4Q9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[C +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍà1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƔ1i4Q9uB ^_[]ÐUSWV0T$ $X>D$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$94l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ˜1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[6` PQk_ [ÐSV[í6@ j}toj^[ÐUSWVT$4X\6D$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[)l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í чPQjFRq чPQjGRj|$$b: чPQjHR@>ffffUSWV[(l$t$|$tU6^_[]Í}p9PQhRʐUSWVP$[Å(t$ ` U[t,j’tPx $Hp ,` ,` 17"@`  xuxt)txu8u밾U[^_[]Ã듍9PQhRKUSWV[è' ` D$ PZ(` ,` ,` $0` L$`b L$ǐ|$$tD$$9G t GtO,`  tGwЃ GЋ,` 9t,` DžuZ(` u';|$r$;|$s<$$<$C<$1(` t$ Y(` u#t7WIu^_[]ÐSWV[<&t$ ` W9Y"@`  xuxt&t xu8ujDu $p@@ ,` ,` 1WX^_[Í9PQhRIfffffffUSWV[U%$$$$$tD$$DŽ$DŽ$ $$jPW$@jPuXDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPRhp]PQjQRAT $ ;$u ^_[]踊S[þ#ht$t$Pt$t$7[ÐSWVP[Ë#D$L$T$t$ 4$hVRWQP^_[ÐSWVP[K#D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[ #t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[Ì"L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[-"D$ L$ $XQPRv[ÐSVP[!D$L$T$$XRQPV`D^[fffffUSWV[ø!T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQK֍PQj=R:׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]Í=PQhRL$8AffffffSP[ÍD$ L$T$$RQP[ÐSVP[\D$L$T$t$4$VRQPA^[fffffffUSWVP[t$|$PV1sht$t$ K x=|PsLfF FfFfn vF$F,F(F $tjjjV|^_[]Í]PQj>Rq)ffffSWV[|$t%jW聼w jW}^_[ÍۉPQj;RfSV[ýD$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[{t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍPQjL$aD$D?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $DXD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $4xT$ L$D$n6 D$0 L$ I $4T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P褈D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$4D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0QΘ,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwP ƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$Pl\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $8BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$$PQhRUD$뀉׋$8G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$(B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$$PQhRBU|$뉐|$UD$xT$ Ӌ$(Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ`t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P<E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PGL<^_[]þUSWVP[8D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [D$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$ J$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }TjjD$܋lT$\$8t$<EΉ7tƉP1t?D$|=WjP0 )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[m|$hE t$p |$<$ MM$Uhjjl$l$܋l|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[PEx\$t*\$47=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃и܋t܃|$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃Ըݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃ظD$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋ܸ|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQUe)$t?$L$U.$1xL$^_[]þTx0ffffSWV[ìt$|$ty8L$tu1 1 ^_[ÍPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[вM1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃и܋t܃|$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$كȸ|$tT$L$؃Ըݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكȸD$!؃|$8=؋كT$8؃ظD$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋ܸS<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[D$1r 1 9vW<t8Ɖ^_[ÐSWV[ÜD$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[ D$ PHpR=^[USWV XؚT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[DSVH[D$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQj-D$$D$ D$D$D$D$D$jPj-\ j[j[S[hS[ޗfffffffUSWV[ût$|$tK1tt (h1^_[]ÐUSWV[}uuA!\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋvt$(PV'T$4D$(YPV'uD$(D$D$7L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[ c |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[#bu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[;at$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX_`ǀb ǀb fǀb ǀb fǀb ǀb fǀb USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[,_D$H~( 1u 9r1$PƉ^[fUSWV[^L$8?tPÑ wc t{c ?u1>PƅD$t/Fn?tPcFF ^_[]1?tP8P d )ʉʁ oΉPoUSWV[]t$tbF!r VO8}t3W譐}Fc c tW苐c c ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[ø\l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UmE!r\UW18}$P]}T$,Bc c ti4$5\8}th$P1}Fc c t14$$c T$, c D$TG^_[]Ëc c 1␐T$1Ɂsrr@r"y(6s@sރx @tS[Zj,tL$H@[ÐUSWV$[YD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V?Ec Mc $t#VȇD$c Mc $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[TD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [cQE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[ÅN$t|1q15SPQjERx P$1D$jjWk{ ʼn$tƒ9tt#D$PW6to#D$=uT9tVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[>Mt$t$jt$0[fffffSWV[ M|$t@jWqGHO~ H0 WjWR^_[Í?PQj=R 럐SV[ÍLt$ t%FHN~ H V^[ÍŌPQjIRy ffUSWV[+Lt$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) p1^_[]ÍӌPQj>Rw fffffffSWV[K|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QwG0`G0ǀǀjWG GG:TPQj8RW f  ^_[f̀rS[It[SV[It$ t;F0u ǀVNuFH^[Í[PQj;RfffffffSWV[LI|$A8u%GG Ⱦ uuL  O @G0taW@9t QG0GG81t&WhG GGfG u WG t'DV},PV|GOQPwW$ GO fO 1!t Gf@f  fG ^_[Í͍PQjJRSV[Gt$ tF Ш u Vk1^[Í׍PQj;RSWV[|Gt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWP趈6@VRQWPL^_[ÐXFL$LAA A AAAÐfffffUSWV[ÕF$u hj舺1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVp VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFލj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCoo(1V聼(1^_[]14dž$j$ΫtJpHH0rPt_t u8~)1 9}8tQ詹݋t P\lV脹t81^_[]ÐSWV[l>|$tOW:^_[ÐSV[->D$ p|$s t.jt$ 1dž,dž,^[S[þ=L$tAt[[ÐSV[}=D$ p|$todž,1t$t$^[ÐSV[-=D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[è<l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNC ׍PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $w|Pύ ֍PQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[|9|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[9|$(o(o(OG0!D$;G9} $wD$D$ P$L$L$D$QPt$荠 $L$QjP t$M$D$ Gjwj $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wi ^_[]ÐSV[7t$ t$t$ #F,;F(~#F0^[ÐSWV[Æ74aAލj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr̎ŽPQjbRrUSWV[(&D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í̎ŽPQjbRPfffffUSWV[+#|$oEtjPu7 EjWu,EtP贝E EtP蓝DžDžtPlDžDžUIW@VP^_[]ÐUSWV[("|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[!D$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_ǭ D$tL$ P1\1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$̎ŽPQjbRT$(L$?̎ŽPQjbRZT$D$̎L$ ŽPQjbR*D$L$_yffUSWV([D$i |E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$|D$$t%ht$WP+ $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j=ՍPQjXRgꋌ$!1Ƀ8cfffffffSV[D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[ØD$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]ÍǏPQh<R0j$jU0 볍P"VUSWV[õ$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$qPQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$qPQh|RƐ\$T$\$̎ŽPQjbR蕐\$T$\$qPQhRa\$T$\$qPQhR-\$|ffffffUSWV[|$8D$,hEtjPu_ E wJrr G&E(uI1GPT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc̎ŽPQjbRɍI̎ŽPQjbR虍w8̎ŽPQjbRn;E,jjuK[ Ǎ̎D$wsZtvG GtfAjWu\ jVuZ DžuEŽt$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9t̎ŽT$ PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPFE EE($}fu E(jQt$xsB tt$t$jbP臈э̎ŽPQjbRdD$̎ŽT$ PQjbR8D$T$Ǎ̎Ž֍PQjbRUSWV[ë|$l$t$FtPxCF FF($nf~ F(^_[]USWV[Vt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7̎ŽPQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ̎ŽPQjbRR!fffffUSWV0[u~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍̎ŽPQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$̎ŽRQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ ̎D$ŽD$$D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyut$t$t$Ѓ [fffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fYD$PPPPP |PxPt@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^ƸL$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐY?D$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Nt$t$t$ [ÐS[t$ t$ F[ÐS[L$T$ j[ÐSV[Ͷt$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVXe$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[-t$ tAtj@PV{D FPhjPHm F@FDFHFL^[ÐS[Ϋt$t$t$ [ÐS[Þt$ t$ [ÐSWV[|t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[àMD$$&ydḰ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <m 1D$D$ D$D$L$8T$jjPQjR8tD$8m D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$.vL$ L$!L$=FL$LL$dL$|L$ÑhjjjPQRCD$L$8T$jjPQt$Ry7L$81 uHjPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR6t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR6D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$R6tD$8he^_[]fffffS[Þ [ÐUSWV,[xl$@D$D$ D$$D$(L$ D$QPjh WI1|$D1҃|$H1‰|$m 2m $m ,m 4m NQ;WvRPLt,NQW QRP FEE1^_[]ÐSWV[éD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [XT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[hL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[X|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[Ôt[̀rS[tt[S[^t$ t$ jt$$t$$t$$t$$t$$  [fffffS[t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[h$D$D$huLET1}8XM4tI$PtE8*$$E4E0|$ 1D$L$j`QPu8VR(ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$||$ W L$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U@ !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP= t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP* t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QPw t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWPl t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP: t$$t$$tP?$$tL$$s.SWV[,tM΋uA~8t:~4~"`N4F8 I9rPF8^_[ffffffS[þD$L$ AQ jQ0 [ÐSWV[l|$t$t+jP6 tH  W6,^_[ff̀rS[t[̀rS[t[USWV^ň$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLX؇D$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[st$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øyPjj%Q4SWV[,sD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[ør|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[ípt$ V PvtHP tQ P VU1^[ÐSWV[Lpt$>gthGt tww$Ѓ gpNjPQw蕡;u<tww$Ѓ 4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[nD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[Ènt$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[øm|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QP_T$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Í֒PQjGR(T$4֒PQjHR}(T$4USWV[+i|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW<P=W"1fu- O @1jW^_[]ÐUSWV[;ht$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]Í#PQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ìft$8uN uRt8F0t~@9tRAF0N FFfN ~u VkN u1uVVF11+NN^_[Íb,PQj1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[;Cl$$t$|$t9t5D$,tL$ z91Ʌ1^_[]Í"˟PQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[mBt$t8D$ t|$tT$t121Ҁ9 11^[Í>˟PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[eA$Љׅtϋ$tiRWPQ$$$4UhVH$yPVj3l S[@t$jt$t$PUSWV[õ@$$$$LЉՅt$ ti$RUPW$,$<QhVt$Lt;l$VPQhUJPUj5k LtWD$ hjP' D$D$DŽ$DŽ$  L$VPQj8L$;$^_[]ǃLYPL҃¿+w狔tу̃ǃƒӥS[>t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[Z>D$ D$D$$jVji m uƃm tjljj0jVji jIjfffffffSV0[ú=t$̀rS[<t[S[;|jPt$t$t$[ffSVP[ü;D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[4;t[PS[;[fffffffS[:88t3[Ë[ffff̀rS[ô:t[S[Þ:j1[ffSV[}:m u#m V>uP1m ^[Ðfffffff1ÐÐ1Ð1ÐX9PÐ1ÐÐUSWV,[Ø9l$D|$@o |ƃ =sdfo Fw%$o =uɋo 뿐o QUhWL$L$뀋o |$@l$Dt1o t& 9s8u+po ?ƃo #D$D$(D$$D$ D$D$D$o D$o D$ o fD$o D$D$Uj(P׃8^_[]ÍPQhR]fffffffUSWVX7$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$D*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$F8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$FD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$FD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$u|$ V1|$ EP]wm4scD$t@XWjjPGM9\$ WPuu=EP1]`t~D$D$D$ cMTtXPjjQ躨uV0D$1D$D$D$1D$D8ut L$$ȉƊFD$<t1D$,<tL$,CD$HE D$ENL$DD$<D$$t$LS8EP/|$6L$u/D$46D$ߋ]t$L{D$lL$lQ$QP] x]$:FuQ<t <uI$f;Fu;$;Fu/D$f;Fujt$H$PV] tu/]xusEP.FjhPP~ D$EN|$t$,VEB  Et$<ƉL$ QP_[jD$$P$P$$L$\D$XVt$$P$$L$dD$`jD$\PE? ;D$$D$fD$ fuPVE@ sL$ f)fL$ uωueZfD$8;u~5D$D$tX^PjjQFEfL$ f }\$ PWE%@ fL$ f)fL$ u̓|$|$ tOEHL$8Ef)fL$ t6=rP$PE? ~L$ D$M f1D$uEa XWjjPVM9\$ WPuu8SD$08D$VgRPQRt$4D$t$@D$u`!u(XPjjQ蚣]D$u a t-L$@U9ȋXQPuuV 8|$D$„u%uu,+])D$@Puuuu t$hуuE˅R@u*]C L$h9L\$ ;D$00)8D$t$VPQRt$4]8uVJ*߉D$D$4yD$80D$t$WtEPQRt$40뒋Ճb8[0D$t$W/PQRt$4'0D$4ߋ]D$4 D$:Mt$,V0 uV@)D$D$4qD$tuXPQR uV((D$4+f|$8]KT$HT$H9W؉P(|$D$4uA|$tJ8<D$@؉Pq(<t0j=Xf|$ ~80D$t0\$ Wl/PQRW|$ s0u'8uUSWV,$[0E$( 0GD$|$'j j PhW$\$\tb hPWŞ Ƅ$'D$?D$D$ D$D$D$D$D$D$#$@APD$PWt$ QRK0E;$(u ,^_[] tffffff̀rS[ t[D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[ uD$ Pj蚿t*jPy|x/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[ uD$ Pjt*jP{x/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [U $0D$$$ $fEt$$,$,$,PhD$ Pjjj$@$@$@jU(ƅu]E $@tR$4hD$PVU ƅE t'4jjjPhD$PVUy ƅ~s$4WVD$PU<ƅyvE @t73$t'ZnP-EFPxEtLGP5$OfWfw fɣVRQt$ P2r߾WU^ND$;$u# ^_[]ÉGffuXnUSWV(]D$$$$@$<jVM1t81ۀ.Qu닼$@9vy.Åt1eD$ 1ۅu\$D$#hPWVJt/$P$P$P$PPV1\$d9ٸu^T$L$\$$P$P$P$PjWVN\$ ƅF$<L$T$t$D$~D$D$ *D$sF D$D$ i^DFT$L$D$~HD$\$D$D$ ɋ$<t .u xuD$$P$P$P$PP$TRF8=z$<1t<tu-D$ +$L!5u D$$<X1‹t у9#|$L$  \$$@D$u]D$D$D$ uA|$u:$P$P$P$PjW$T.Ɖ1t P$@|$ $<t.jPJD$;$$uL(^_[]þ|$t؉j$@JJÉ뿉j됋$@D$L$/jUSWV [$ M$1@ u tE;$4 ^_[]Í!P9ztЍ\uQPetƄ$T$X $D$1PhhRRL$$t$ T$DH@u u{F$$RɷT$D$u$DH@utD$(tDP@u Vu$,FPQW藓 D7t$fiiUSWV[e$$$ $$@t-t$,$,PUQtRL$mWUPhQU=s>$4$4$4$4U$0R&U׶=r,j$ G;$u;^_[]Åt|.u|$EbUPQhWf,hffffffUSWVX[($L$p|$lGtG,t$x9t$|89cPVt$|UQ$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$AxnNj$L$|PQF$L$xPL$QE$ǃ$fB$) $W 9$A A L$|PQ|E$L$xPQaE$PjlE$PQ5E$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPr@ƅxՍ7Pj D7Pt$D7PjD7PjtD$ 1۸$IUSWV[l$ |$t$D$@tP ) l$$FPj)CF|PQCfFD$@ u1ftP VPCVj{CG fffG )^_[]ÐUSWVP[l$0t$$T$ |$D$@tP T$$։)͉ $9L$(B99t$4D$,WPBGPl$UBGUVP誔L$4 )΁r&ѤPQh=RCL$8QP_B+l$ ^_[]fffffffS[jt$ [ÐUSWV[å$ $D$0$jUAEt U uEEEjeU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh etkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU;@D$ djVU 8PpƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w 01҅tމ8D$ Ϲրwr tt$$D$ \uPd tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #Dj P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w A< vhQt$8 ƅ_QPt$NnD$ kc$< t< H$< w&8A< vhQt$V襇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tOPVDa< D$<@@@@ @@D$@D$8 jj5Pj j$PͪD$PD$;t$ s E$EtJ9P EDt%uH^PWu퍃_PePrftuV[ML$0 ;$u ^_[]VUSWV[{t$xPdžft91 9s)tQDŽͅtMtt|%X9utxt PWidžtPidžf^_[]ÐUSV[tEuo jP,_$D$F$FrWfF e^[]ÐUSWVx[EL$ L$puo D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]zTUSWV[{t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[TD$Atqt$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ j PV¡ mjPV訡 &j PV莡 Yxj PVt $ljPVZ  jPV@ jPV& j PV GxjPV jPVؠ jPV辠 %jPV褠 .j PV芠  MjPVm jPVS $`FP5d$/FP|Gt^GddGtAPt$'F Pk|GGtɥPQH7< < {$H׋$u٥t$0UP $jP 뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]lPV-T?r?D$PVt$y D$L$Ƅ|$lPVS?r?D$PVt$Ry D$L$Ƅ($H^_[]ÐUSWVx[$$l3o h3o p;o t|P9h@GtP|x$D$D$%D$ D$D$D$DPjjjQtOtt.DT$,p t{NDDDDD DDPp .j3,p tǃPp ǃ0p ^[ÍUSWV[j0W3ƋD$F P:3FF(Ff~FF,,p t 0p 1ҋL$9u<0p F(,p th0p 9tF F$F跋(,p 0p rLp R4p Dp p 8p ^_[]19u뫐S[NQPR蚦 j SWV[t$8,p t30p 9t^t,8p 4p zLp ,p t70p 9u 0p ~t v @V@^[19uΐS[t$?[ÐWVXL$ tsAQQBQQAA,,p tD0p 49u40p 4~Lp v4p Dp p 8p ^_19uSWV[<t$trT,p 0p t/<t)8p 4p zLp U\>t=G0p Dt,HLp @4p Dp L p 8p ^_[]ÐUSWV[ |$1l$|=|/j0>-ƃx hh@x@@@(@,,p 0p t.9tRt#8p 4p zLp A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍MAPQhRoL$4T$0^̎L$ŽhPQjbRioL$T$0zML$APQhR6oL$ffffffUSWV[ۯt$nEtjPu> EjVtE 1t u1@u)&d1Ƀ Vt^_[]ÐUSWV([t$@l$<}GtjP7!> G ujU誌0 81qujWjjj V 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[+|$ t$tGw#jPW"džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP!t2MQUQRP4 EG/1^_[]ffUSWV[|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$̎Ž׍hPQjbRi\$8=$oD$L$,td;l$tX14Eju7{7 t%MLH4jP7N9 ;l$uoL$1 Gw)f_ ^_[]ffffffUSWV [ة|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RU $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍPQhRgT$믐USWVhXxD$|$|G =tŋ\$jj$WO{$jj$W+\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$wo ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WwO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhTRAbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhRa끐USWV[FD$lAB9w}) >P2Q' D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p bL$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$ͫj1PjN `1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V1Ʌt‰ D$0L$ЃVhPl[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08{1\$$ PQhRX\$T$ D$4@USWV[8T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJDHjWPVVi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$PM L$,1T5MGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[özA =tl$$G)B fT$L$D$ uf͋t PU,$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PV}f t׋@f8u$dž wSWV[<|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQD$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[Øt$0l$$D$jPj |$dŅtUEfxuftDfA |$H9vjWPVtl!|$, $tt$L$E,$ύL$ WQPVD|$u( t u~$!jUWjV"^_[]ÐUSWV0[8l$Lt$DD$,9EvHD$PUV D$$D$D$ D$D$$ED$(D$ D$$ D$ ,$T$Pl$H9¹)QUV [|$xD$Ptu,$<1L$DD$H9,$vPT$RQT$ ,$uBj)N|$9s6WVt$t$ jRl$\U0ƅ|$1f9l$s*yL$)ɋT$zQPRL$ fAA)fAfDy$΋J L$ LDr2PT D$D jV0U 1|$;D$,uM0^_[]jRD$L0, ׍̎|$ύŽhPQjbR<|$ fS[þ|1 uOƃ1 tt%9HuHP 1 @[fffffffffffUSWVY;|T$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[ú{V'jV ` VP|^[fffSP[}{`b u;$ `b jjPQjRVt<$ t ǃ`b [ffffUՑܑnnnnnnnnnnnnnnnninnnnnnnnnnnnnnnnps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20260329205600Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:202603292056Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist