08PYi'&<  'Yi.P''`'". ".Yi'&P@@<@T 08PYi'&<  'Yi.P''`'". ".Yi'&P@@<@TU Yi`'".yAYiYiYiQ$f YiYiYiRAYiYiYiuAYiYiYivAYiYiYiwAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYimKps%YiYiYiX`hpx$YiYiYi (08@HPX`hpS$=YiYiYixP${YiYiYisQ$YiYiYi (08@HPXtIAYiYiYiCYiYiYiAYiYiYiAYiYiYim<YiYiYi`hpx\$ YiYiYi$YiYiYi$>YiYiYi$YiYiYi$sYiYiYi$YiYiYiAYiYiYim YiYiYi$YiYiYi $YiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYi$`aYiYiYi (08@HPX`$YiYiYi$YiYiYi$YiYiYi$YiYiYi$YiYiYi$YiYiYi$YiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYiAYiYiYi uvy8Z)u5BK o1;L'VPcN.rgn\8!wj{63s:G*dSpkvv[4nm;n~EHL!a~K". . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4Pp%4 (""(($22x` TTT,,$22Ptd()QtdNetBSDKwGPaXU,SR ffffUSWVP[o.t$DujPjjj\j30Fɉ$ux& Q/tu|$Tu?;(s(U9r\|$u t WSHPDH;sU9rHP H$06v? P*CUSWV [hn.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]-USWV[Ûl.; s' ~*u.UE9r^_[]-SWV[Ll.;s9r^_[f$SWl.5u1ƃ5$tЃ th$k_[SWök.4uYƃ4$t|$h<$kt(?t<$nktЃ_[WVD$0tP>tKj/V{t@Ƹ!"&PV!t&uVh"hȐ"h3 K^_`SWVh"h"h3J 1۸!"&PCPrFh3j Vwh%h3J uh3j Uj ?D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5t3 u$1^_[Vh"Vh"R 5p3hܓ"jwVh"jUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S,&tutD$D$$D$% D$t$@N D$l$hx3h$?D$ @l$0tD$PhD$?j >D$  |$\$4t$,s$L$)L >QPh"C? D$  L$s()@L$L bQPhە"?L$ D$  s D t 4l&h">L$ D dtPh ">D$(@9XU\$D$T$T$9tt$N9BD$4l&5p3h*"t> 1h^_[]t$|h"I%WS$h>"h["jվUX5p3hy"jt$|h"5p3hn"3$h"jhc 5t3p u15p3h-"j蔾SWVPD$Hw#t$>L&Wt ubP&$h""Wt N1AQhc5t3 u 1^_[5p3hB"jUSWVP|$t$7K[h>"WV fu T+=p3u ԟ3)u p3uhA"I"t p3hjQ蟋 t3u 5p3hR"Ih{8u3$(&SUt uUh{"jh["j$NPVS& P\3V!3PhV"V> Vjjh"&&h"h3> uj35t3趋WVοV&tuVh"j4&^_VPΉj PQ| x $9u^Vh"jWVοV,&ftuVh"jͻt0&^_USWV\$$103 ,33 3sVj=Pmx<$h٣jjhT&U2 L3H F H L3VP3uL3t;#=t%{ L3##=uthR"EL3tttut!tcuL3h ܯ3^_[] L3VhȖ"W Wh"4$h"4$h""jEhl"h"D$L$011PjPjt$h$ 03,3331PjPjt$h"ܤ33h"j1hjPPt$h"訤331PjPPt$h"脤,3tVj/L3u$1PjPjt$h)"L33ËD$ȯ3h:"j'1hjPPt$hP"ԯ3Я3h\"jL3u$1PjPjt$hs"ԣ03,3ËD$83h"j诸1hjPPt$h"薣D3@31hjPPt$h"n33fSWV3t/ 33 t53)փ>8F u롨333 3 33;,3 03r*jU333 3 33^_[á3 3 t 3 3hf&h$j藷hf&h$j膷hd&h$juhd&h$jdUSWVt$|$6T#SjSVW& u=ԟ3P]ȯ3u,ȯ3$̯3د3|&Ah"jد3|&1QQP! ̯3y 5ȯ33 3 =,3rį3uhN"롡83u#<383"H3|&1L3HH3|& hQP胄 <3yJ1L3H H3 hP583Q <3 43y 58333L3utS1V 33393rZ 3t= 3 ,3@ 3t# 3) 3I ,3 3ujg3 33Я3 ԯ3t @3 D3t L3h`u;5@3 ,3=H3 D3503VP5<3W L31Vh3hjghjX53535 33h/-,3`L3t%`3X3 d3 \3;3 3ss$3 3tQj QjP د353535̯3P$ xd53-31‰1 3 3=3 3X3\3=3 3L3 ȯ3xPh$Я,į3u6د3j53535̯3P  t5ȯ3h$茯L3 33 33=3 3X3=3 3\3CL3s 33=3 3`3=3 3d3u@s)t33H 3PQQJ 33ܯ3=3 3j133133hz"js(Ph$jWVܯ3=t=h=u <N3 3 3t;,39щ503s))Rj53V 03 ,3 3 3 u\5T3=P3 tJ5,3j53 03 ,3 3 33ʉ3)Ɖ=P35T3 t jY=<3uH3jPu m8u*H35<3Pt^_h2#jӰh"USWV,3|$,t33(p‰D$l$|$,u N3 xT$ T3P3 t!H3jQP5<3R !ƒ~t$VSh3 $~ D$ `18D$ Z T3P3 ʋ-33t>5035,3QPe33h3l31T3P3T$<$t$ 3-3l$13L$ p3t3D$11 43t,3u#3583h "9T$43L$ AD$)ʋ$tЃ|1@|p9@|5P3T3*,31 03T$1 uKh3l3I$T$ 33)ѣ3 3503-,39p3t3$ t 3)PQ53趷 3133 33 t(p3h35t35l3QPVR  tjh%jz$^_[]583h/"583h՘"583h"j583h$j蝭USWVt$(|$,\$$Uh3j{z C4WVs(P( 8jUjWz 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h"jV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h$jgVP^9v V*VPQL t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV3 3t/jhmS#jw 3 3tjhmS#jw 1t$PV4FȺMb׋ 3-։+3D$H 3iى tL$ 1FD$|$ 5t35p35l35h35d35`35\35X3h"jdW(,WPWjv 33 t?ƒ ʺZ%t+#RQPhԙ"jd|$4W'WgPWjkv |3x3 t?ƒ ʺZ%t+#RQPh"jd|$4W`'WPWjv t$ 33 t?ƒ ʺZ%t+#RQPh"jd|$4W 'WPWju 3D$=3jPt$ t$VgÉiL$it$V)QPcRPVSt$Wh"jdt$@V&$V=PVjAu e^_[]EVt$;Vlj fUSWVį35Я3=311Cد3W535̯3P$ MtgM3u5ȯ3h$Yد3W535̯3P$ ݅~į3t )u=3N{T,3rOH,3d5Я3 3=د3 ԯ353jVP5̯3W !ƒt^_[]hQ"j.5ȯ3h$jLWV43uD5@3 ,3=H3 D3503jVP5<3W !ƒuuJ@3 D3ti11H35,3535<3P$ ~J;5@3D3r,f @3H H3Phm5<3Q xw^_xof@ H3Phm5<3Q tD;5@3D3s5,353h3 3,33 03 t583h$jfUSWVX $p $l 75Ch#jj Mhk"WSm H-$&333@33333333u3i33S 3G(3; 333$333,3=03-T+=E=3u =M= 3ui $X0Ph$h3_ h"'0Ph$h36 hݞ"N^_[0Ph$h3 hug&hN 3uá3u tjwGjFUSWVjɞƋ|$11K< @u=l3t?jj5x3  5x3p3t3l35x3UjW= A)߉np3 t3N F5H3q0\3H3-p3F t3j03Ph$h3 hug&Mrh "]1Ht3p3(0Ph$h3n h"'0Ph$h3E hݞ"LV踭1^_[]Vt$5H3q0F\3H3^WVL$ 35|39})=\379}>\3839~vRO9G9~-83X3~ZX3΋Nu#83)Ou9~83RN983 |3u 3uu83^_É1jDjDVT$X3t=X31X36X3t@9uхtX3uhZ%hK1^SWV1ȱ3t3j?@h#."tWmt|8/uWh4"Wh@"h3= 3tLPU0t$hg"P`x31ۅu@W^53h$蹋j"j訋M"PJV|^_[Vx3tAPcxGx33t!P/53N31l3t3p3;53:0PVh&h3h"I^Vt$x3t3P3t!P/53轪3Vjh 3hХ3耜 "x X3X3\313@=ujuSVL$D$ T$t$33533~A23BI^[fV13333P'P|q|3Fu^SWV53953t$3Vjjh3 ut=333jjPPkth۟"h$[H303@u3=3V订tVP+G~*h "53r0h"h$G1N1Nyh/"h$G53~3H 331H^_[Ë 3u!T$73313xD$Q331HSVփuU303@u񸠱3jjPPjth۟"h$G3 3 33aˍ3)Qh3Pm 3303@u񸠱3jjPP@jth۟"h$FVjjh3^[Vt$ 3u3313x 1H^USWVh"PmƊtx<0uFD uh"h$$EGuȿ|w WjPl 1T L ш @u3hjV: PV1FthП"h$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$h& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPX3 t uh@"XC^_[]eC$tX38u@X35T3Nj-T31;-P3M1WtÃ=t3tj jwSVVVSt$,1Ʌ;L$uWwZ?E;-P3|1MV31535ı3535353膣53 3u 3uu ^j:jq;V53953}3I3P53蒝tC533 3u 3urufL$3r53 1^0躼Ph$h37 hug&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P 3ı3193@u 9uı3SkH3 t$$PPh,  $ @3| t %ܥ3ڃuhmS#QUuhq"QjD$P 4Ë $39}=3]39|A‰T$R53诛NjD$3=3 3u32$@PSWx =X3?5ƅtH3VPP,+ X38uK=3뜣ı3GhmS#5X3zt:jPDžZ"x Q:? ^_[]Í|$G0Ph$h3 hug&> 3u3utj8t"j&7WV 35ı319}'3FىDuw9@u1=ı3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEhR#P-UT1hR#PÅt*t$Sǀ}!u?S2=0觸PUh&h3#h"=eSvx(=3uWh("h3 5H3+t$0r0;PUh&h3h"=^_[]USWV |$$Wơȱ3$t3D$\31-ȱ3-t39-ܱ3t\$=H3t$ gDž~w1135̱3Y6tsH3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=ȱ3t!ɠ"9u t3 uh3PCp9¡t3Ƌ ȱ3Ӏu1A9|$t $ ȱ3 t3ܱ3t )) 3u 3ut j4 ^_[]j3USWV1|$=ܱ3t WrGHOHt uG `-б39}̱3V39rFU5̱3K-б3̱3 3u 30u t3F8W<1ۍF-б39~N3 ̱39wUQ轕t7-б3̱3 3u3uhtḵ30 F(0Ph$h3n hug&9 33j2G @utḺ30 Fȱ380uPh$h3 h۠"Y9-1̱30=t3=ȱ3  )Ɖ^_[]js1USWV|$?!uGh7b$P(t$WI,VPÅt2l$t$ US NjD$8!u?S-=0蘳PWh&h3h"{8mSgx-=3uWh("h3 t D$ )@ʼn3^0'Pt$h&h3h "8^_[]USWVPl$Uƃ=ܱ3t1ۅtf;l$ `1V$th~;-\3u=t3t =ȱ3u8 GWPt$ F x4EEs @6;l$ |=ܱ3tt$$$^_[]USWV|$\$l$19t[=ܱ33t UPrUPFy20Ph$h3x h#"61^_[]USWVP\$5X3FEx @u}|~PVq6tjر39~l3Ա39SPgƉر3Ա3 3u.3_tO5X3;^_[]Ë5Ա3W5X3V蔴 . ,1xщǃ|$uE@3| /5ر39$~Z39V5Ա3cÉ5ر3Ա3 3u3t Ա3W5@3U ,$+HPS5Ա3D( |$tM1BDžhZ"40Ph$h3^ hug&41 335ر39} Ա3|$N3Ա39͋|$|MVPt05ر3Ա3 3u 3umua(/ Y0"Ph$h3 hug&4 3t13uj-j/,SWV11ԥ3H ԥ37hХ3u8ܥ3@%fܥ39uХ3H Х3ÍF=39~Y39wW5@3躎=3@3 3u 3t @30u t3F <3C0ͭPh5"h3J h@"2%ܥ31t @30@3X3^_[0qPh$h3 hug&U2 3u3u tj_+j*USWV\$ D$1tt$hR"D$ l$1uHD503J 03;@3у  (3Q(3;=D3|h(3h%e1GD5 | <\t<03H 03;@3h(3j\(3H (3\\5tjj ShW" tVGW")Ȋ`"03J 03;@3Vу J (3Q(3\$ !003H 03;@3h(3P.(3H (3D50 03Q03ɋ\$ ; @3h(3P (3Q(3D50 03Q03; @3h(3P (3Q(3Dh(3Qt4 03Q03; @3~;ȃ t3 (3Q(3D$F9h(3Q!h(3P똡03H 03~(3H (3 h(3j 1^_[]fWVD$L$L$$$0f| $ |r13hi"t$t$ c{ ot9EtzS3ǃxtostypfT+=3먡ԟ3  $)D$|$ta$8-uW3D$|<ԟ3b3S ܱ3D35$L$jjQthj^1FhVVMVjBhwj3h3ƅux'3|$t$8t$0|$t[h3hq"a$8u h~"_-j葴u$h3hp"aht"--y =3th3h$h3 3tPh$h(3ѩ xt` @3| D3x51gH3QPP M=83=3h3hq"`h":,jl%ܥ383hZ",%ܥ3΃t0h3hq"#`j51583h3hq"_h"+VDzQ=3th35<3h"h3jrjkPh&h3 jD=3jPunh35<3h"h3f$j0yjt$8!$h0h3s} uh3h$h3 jL$ ɸ!3Phht@jط x#$r@3D$ rD3ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!h8c#Wtj/WGth")1^_L3H3P3T3x>L3 P3 T3P3 X3;t,uQX39;uH3빋 L3| L3P3t9tT31Ƀ USWVP3X3DJ@t t@X3@DJ@t uHH X3~Ã=w$D&=D3!h;"  !=L3" X3A1Qptntl  Ӊ X3A˃=L3FP”^ U X3@߈\$ ̀1ۈL$QuH X3H1KDB@,Aǡ\3 L3  Pj  5\3j$1  ˣX3@̃=83t=3y=L36DB@jLǡX3@1Hptntl   ˣX3@̃=L3DB@8!h'"=L31Hptntl  ˣX3@̋ P31PptntlN  ӣX3@̡H3HQPN"X3@1Hptntl%  ˣX3@̍H X3 P3 p1Pptntl   ӣX3@̡H3PPv X3A1Qptntl  Љ X3AˡH3PPH-T3P3=L3=P3 9=\3 -T3P39 9w hl" H3PP X3A1Qptntl  Љ X3AˡH3PPl@ X3A1Qptntl  Љ X3ADB@;h" 1ЍrЃ sOj hX35X3Nc l3ww8"%h3 X3:o t!gc ptrP  A X3< b=d3Ho1H3PP9 T3-P3 =L3=P3 9=\3T3-P3X3@1Hptntl  ˣX3@̃=L3F1Hptntl  ˣX3@̃=L3h" 1@T3 H3AQP2 X3<j hX35X3ha @38"h"N@3 X3x w =L3\3tP30h)S& X3x A =D3u;.5P3O1@T3 H3AQP@ P3jPP>X3x  1q1ۃ=3Ƀ=83 ˃hZ% X3x  =D3u-5P35T3 5H3g X3x ? =D3uL-5P35T3: H3@;\3?7H3-X3x =D3u , P3IQ TX3x =D3u,T3 P39QPnX3x QVP X3y F( X3y 1 X3y P5P35T3g X3A1Qptnt lu  Љ X3Aω X3y  P3\3=@39|PRQ 1=L3u \3P3 ǡX3@1Hptntl  ˣX3@̉X3z !D3SPhAX3x  1@+33uF%X3x T+=u<3=3t13X3x =3h3h$h3 X3x }*x1Hptntlu  ˣX3@УX3x 'ܱ3G1P3T3X3@Hptnt lu  ˣX3УX3x =33u &|$Wt7b$5P35T3QP';\383X3x ==D3uJ)=33u5P3Q5;\3)83hW"h"h"l3hZ%l31< *5 X3y qtp3@P6 p3@P>=3h&+X3x )5\3j 6'(Y$i*tEEp $A8GMi T391P3)@أH3=D3t W6U831 3u 3u u^_[]jjSWV=3uj貽L$ɸ!3\3Pjh7b$h"Hy|h#l#dtkP舢=Yà PWtGWP|3/tf/VMed.hDhup5\3jh7b$Vj=3ujL$ɸ!3jh3/USWVPl$5T3'Ƌ=P3T3-H39ʼn) u)E1u1$3E@3V}tzP蘹t_H3PPj DžtO833H3u 3u[uE6MH3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~X3L$F$ 39} 3V339|BVPy`533 3u 3! X3 u1C1E҃!%=3h3P轟Ɖ$ 39V39V53_533 3" 37 09L$]939|WPG_=33 3]9~[39V53^/533 3u 3yt v3 X3 (E X3QX39\u=QX3I ( 3G (E,$s X3L$A X3 p3y 3)9~_39VP ^I533 3u 3 33| p3A(EAp339r X3L$A X37 33/ X3QX3 ( X3݀ (539}p3R3p39|KVP]t]53p3 3u 3S53P p33D$1!Pb0+|Ph$h3 hug& 3 3u!u#^_[]h"qht"gj'jVjKQtL$Qq p PIH10{Ph$h3 hug&n1^V3t.L$19 3u3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h3?XWV X3 td< uh@"1 QX3I t;8t7P1ǡ<3t?=`3u6P@<395<3h"R5<3jO<3tV`353WP| <3t.h'h3QPX[5<3`<33/0yPh$h3H hug&^_USWV=X3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-D39}=@3M3@39|KUPYtYlj-D3@3 3u3uyS5X3Wk| 5X3=t3tsj jSWme0xPh$h3& hug&1 3u*3u(tjh"h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17uX3 uH3E#tX3 uE1^_[]8uPX3HЉʀπwR胧j hX35X3+> 1wU8"uh"1gu@X3ErUSWVX3H X3H%u,8Xu'X3L3h"t18u=P39 L3L1}5P39~[39V5L3V#5P3L3 3u 3\t YL3 X3QX3 u (\t u^X38uTX3H X3 L31< u0=D3u't @3| t %ܥ3ىX383L39|NWPUt8=P3L3 3u 3uuuw5H30L3M1IQ0uPh$h3 hug&1 3u 3uu^_[]HX3,j'jUSWVPL$H3T319P3}%H3ȃ Eh"Kl$ H3PUVPt$$KǸ1$H3PPT331S̪áH3tP芬EPPjM Ņtl9u 3l$ u3ue$H3P3+T39}yFH3@H3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=t3tj jvS肮vލD$jPjSut1t$ED$$D$1E $A9T$ 4X39Ɖ $T$~c3t$ 9V5T3R\5X3T3 3t$ T$u3=t3tjj RS藭T$=T3RSW_u 4$D$D$ X3 $9~bt$ 3$9V5T3R5X3T3 3t$ u3=t3tjj t$(S=T3t$SWt Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu&D$)D$X39~V3 T39SQPX3T3 3u3|$~#D$$ D$ ud$th."$=t3\$tjj SV賫T3SVP~s T3f |$%C<0oPh$h3= hug& 3t e^_[]Ë 3u tjjUSWVPt$ =H3T$-L3E<\<&I,$D$h)X39~Y39W5T3wO=X3T3 3T$u3%$9C T31F9uEEπ;D$$,$L$l)X39~Y39W5T3N>=X3T3 3T$u3ml9}C T31F9u,$y^=X39}T3_39|W5T38N=X3T3 3tT$ 3T$M 0E+L3;H35X39}T3J3T39|KVPMt)5X3T3 3u 3u^u`I0lPh$h3e hug& 3u 3uu؃^_[]jjfWVd3 `39|ld `3j Qh\3)# tJP\lPh$h3ٷ hug&@5\3BR1\3`3kd3L$t$T$ =\3@Q葤 \3d3RDVu\35d3@LF5d3\3^_SWVd3d3r9 \3@<u|L19tWWQ9ud3H3H3\3L3^_[USWV=H3=L3=d3t 83H3$\3D$j荣3d3 \3ÍS4R4nr@44v\1L1 [ \3\1l1sRt6,lmL)1 \3t)|?wt)LI1 \3t~l)}L1 \3,u44vL1Y \3l1}w4R4Ӆ HA9~R\34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=D3t׫H3H3$H3L3\3D$L31 3u) 3u&tj\hI"$^_[]jlUSWVL\$d3hY"J^"tNjt$`hi"SVK: fttu=T+=߃u ԟ3r|$L$ D$1T&"D$PƈƋO9rPSt$ 諉 tu;_Յuͅu t$h"-|$dD$ Du$$1Fl$?uSt$ hn"j1L$j QP. $;Fl$|1ƋD$8u&1zPUy!Uh$jj1D$ th"j&1NjC=m@!sHQPW xs{QPW x4$Uh"- =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@Wh y?60Phϣ"ӍL$fqQhmW: 3UhW#D$ukD$Ph"h"S T$#h"T$"h."03H 03~(3H (3 Phi"kh(3j 虴t$8t$8t$8t$8t$4h"Ȯt$Ht$Ht$Ht$Ht$8hƤ"觮t$h"薮t$ h"腮j諥FPhC"h3 j茥SWV֋|$t 7"?t="VQP8 JB803H 03;@3h(3j<襳(3H (3該(3H (3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hj"REth|"P萅uh3h"(Eth|"Pfu h"襷jh|"h"h >Pi7u h"j,06D$ u h"j,t$,)݉\$D$$D$11D$$h"SU44 c7~+Hr߃8tlH w&$ܷ&T+=$뼃4t6맃dtket/1@D$==T+=umWt$3Xhͥ"5T+=KD$71@D$$+L$ ԟ3 ԟ3T$uAԟ3$T$uȋ$D$,jj@R]l$L$ $tL$ $L$,1ۋD$P螁CEu S6)St$PʼnD$$8 UXl$$T$DtIL$ىL$$U$E L$)QPR8 4$EuED$ushͥ"h0?%8~u]h"bhѥ"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vhl3t$ t$,QPRet$ Fyj=l3y h"|$$tQt$(jVjhS3ny h)"%jVjh5l3 ny h;"%hͥ"l}ǽt$(1CUVSwD$PmUVSw5l3mt$,;1L$XAAA @D$HPQS =h3u'l$hD$h48jU&  ul$u)Džy hR#1O~fVS5l3 q VSt$Vq |$h5l3Ul$0fE<u1茎u@hWj uh8Z18tƉjjU tD$68Zt8tEVSt$3 x )b8#Th%|$l$8fE=h3ul$0fE9EjD$LPj, |$@f9fGfGl3G$jVU tQf|$<tٺtf|$4t?l3L$0u+fD$<=h3ufD$4 8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hM"jt$dj蚜h$y+h"PhR"h3jlPD$L$jQ5l3 XUSWVA1K8uSt<։<hU7 ~WUVF ~)u11ۃ8#ۉ؁^_[]ÐSWVP|$\$WSUyƅu]jj:tqƉx jPSj" ǀ;t$8u<蓋8"u(G=w(rfljF^_[ÍG=rhh"j$h"j$fD$0!jfP=p3tD$L$ $QPj1[ XWVt$|$ t8Ph"jZ 4@ t3A9tL t3^_SWV\t$lt8|$jYPW] GYt&Ӄ(Ӄ,P6B60@4@8?WVd^_[USWV $8 $4 5x3VyPV,0W5d&1WWPփ (JWWSփ _ƍ Wh Pl& WjjWp& TVt&h .<Ƹ jPPV(x& hVU\\ V>E=a==hD$\jPSh& 1Nxr$ SxǃW-0t^SWP&; tg0$8 hӦ"jaX0h "jJX 1N ^_[]þhӦ"j$X۾Sh"j X ¾hH"V==bt =buk $}u+Zt$WSVL$ uS FYD$t8Shv"#Shj"WVP;S 1QQt[0( Lt5|3tQP!0,tt|@P),Ɖ4P,8tg04@tt| r>1A8Љ4DAtt;L5rSh"j*V 10h"WV|$x$t,WDWHDWDW4Dx uWbjtw\wXt=39}5PBt853WVhʧ"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W+$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUy(D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"OA|$PQt$t$Rh["jDC$t&8$\T$XT$H|$RQt$t$Vhګ"jD$L$l$8h#"h"hh"mUSWV u|$W, 1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h "jCNN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPal1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPhl& |$0hSj,6StND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh-"jA^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhH" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 3333353D$D$TH Qq T$T$ t$t$QShk"j; 11KL$0t.iSPh"j:V53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<9ص38D$D$ tD$tD$|3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP""PD$tD$t$t$8WSP""Pj7tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhb"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L 33tt94 S.8|3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVḫ"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh " Qh"j4 $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPp;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qh"je1gD$4$DŽ$߬$D$D$D$@$߬$ &a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh"b11ҋt$  t<=33$T$p$1߬$$$߬$3333DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPj31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh"W $PhD$(l& yNH^L$ L$tL$L$8]:u*t$ tD$Phn"j4" ,uh2"j " uhO"j " M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P-D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW2NJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP! ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vha"jT$$BRt RPRPVWjt$$Vh2"t$$k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhl& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =p3yh"je11t$ t$$k,t$DD(D$L(L$(}tTt  t1L$(VWt$Q](x&[$t$ D$L$9Éʋ|$S=p3tQPjWh_"j>]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh l& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QtcD$XD$TPh]l& |$t$t$kL$,9 $ ?t$E0PVh<"jD$,]|$t$t$t$L$$QgtXt$|9|$11k,D(t P7;|$}L$֋L$]t$Q t$D$,TD$, m4$yD$,`14tPP3hp&j,u׋$e^_[]USWV3tWjjPߊ 39u 34t0jQjx!=p3h"jjt$3xi8tLPWh"QV`tPSh "WjSt8Vhϱ"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 3I 313Iu顀3PU,3 3~ t1@,3@9uUSWVD$931A9|G3SƉ<$~ SjV> 3D$~Q1ɡ,3t<3*tBEB(B$B4!؉B8<:tWBuA;L$u5,35,3$3^_[]V$3 3D$D$ &T$ t$ 353t$T$L$D$\$ $x"UZ$^Vt$FtN H N tNHNfr v BV9 3^VD$`sH) 3 3 3HtP4BPQ@@1ҋ3v9t3,3rh"j;tp4F@3^USWVD$T$#35,3tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hhг"9USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 39|[5$3tFNu (353t5FNHNFy F4VPV3@31@j@PU1@PF ~4D$F(^$F0^,n#3^8,3 ,3t q4,3^G FtH 7~ F^_[]É 3=h$"h"hh<"h"hhг"8Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H 3N^,H 3 33H@3P 3 (3H(3H4I,3H89t;tprp,340,3t4F ,3H^h]"hV"h4hг"6USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv 8 fUSWVP|$g|&sx&G4$O,53w0VPww D$0^_[]USWVPt$ff|&sx&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 03HtƒQ 03@ 03^_WVt$ 43F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv6 v^_USWVPT$|$:%483\$ 83$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4831ہ=43| t Pt<3031t 98t@^_[]Ã^_[]`V15435@3hVh835 503^ft$ t$ jYISWVt$frLN4F,=3~0WPvv 1|&t\fv4V1AN4F,=3~0WPvv 1x&1;NuN^_[h" 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS#$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h".USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$F<FF F F$9D$4toh4j%lj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"u$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthuW1$3L$1 QWPUSVh4jÍD$(Pu S/ \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4jËl$hu PF $\ E1PU\$tE|$8t h"s,$StUo ^_[]Éu C4CHKL1},$Bt؉Ń|$8th" st$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh˷"lCB$  $ V)19tQRh,"(C 1@^USWV |$,\$$t$ tCPPt Ttt4RQhr"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth" Bh(3D$(u KHKpStURQPt$DljT$t h,"pu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k D3VRh"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhu"D$L$9tQP$$h"t$Ht$wL$tI9ȋt$ tPQ$$hŶ"讋1t$\^_[]h."h "h)h@"h."h "h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttr|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$9"pu0|$ r]@hD$D$D$,$D$ _,[D$ p D$D$D$,$D$ 1,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$S"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DD3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW臢ƋD$0T$UWkƋD$0 u$$$UW0ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPáERP賡$GW #RP螡ERP莡$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPzt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP<|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP觚 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP |$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP聘$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP|ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVdD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0h"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hn"h h"h"h h"h}"h"h"[USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQD ^_[]fUSWVL$T$ BH3ulF1G&UhF#m,$03H 03~(3H (3 h(3j u q1^_[]V3PPh"VVjjh"2"@&Phc#h3\&ujUSWV׉΋*h2"U4&tCt[PUjhhL3s 5H3L3t2H3L3WVS5L3g^_[]Uh{"j跗5H3h$j՗USWV$:$D$VuP賥 9$j uP薥 1ɉ\$QSu# Ƌ88"u11F9Ή$<$|1ɉQSu | ËD$8ՉS8"u !t$$Vhyd5L3a tbVh"^_[]jh"7jh ".uh;"$hS"hm"$p h"h"j$05H3hW#jUSWV}E phi%VBFh"V,h%VSD$(P5L3{Z#D$0= M$L$A1yyy D$Phwd5L3 D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhjxD$v1111O w+Ow?u$L$A1AAA D$Phwd5L3-  \$tmt$ NL$,D$(H3D$FD$FD$ FD$$~D$(PPWt$,t$t$t$h"+ KuD$1D$|$Ynhxd 5L3R5H31111VQRP5H3hY"hxd 5L3> H3LQh"ww ww5H3h"hw_G|$9w  jPQ5L3!¡H3tNSVPhһ"Wt$ 5L3` ]%9tu"QAh(3SVPh"كT$;r ZƉ[|$?e^_[]jjW5H3hӺ"lhb"hC"h "h3 jQh "WV$u>$jvW s'Wh{dЀ5L3 t^_jh"j腑65H3hW#j衑VPPhtd@5L3L $t%t5H3h3"$K"u"5H3QsH3$$""s#QPhi"I H3$$ "s#QPh"$ H3$$"s#QPh" H3$$"s#QPh" H3$$s#VPh"^5H3h"jsWV$u^Vhzd@5L3 tH$D$PWVhO"^$PwwwwVh]"<^_%5H3h>"jUSWV}D$Phd@5L3 tzD$Phd@5L3^ u5H3h"֋H3$|$\$ t$jVSWVRPSWt$h"e^_[]f5H3h"j-SWVP|$uX|$_h&#S`ƅth"SLu+1Qhwd5L3 t ^_[75H3hW#j豎USWV|$0t$,1@L+=ԟ3$1ۉ؉D$hν"WV: qt\$te+$95ԟ31|$7wWh|d5L3 D$ ;D$t-i9l$sUt$ŤƉD$l$묅hhPV[H3L$ #t$RQPh/" |$ t\ư1P`VvvvvQPh@"  G;|$ ru5H3h"v $t1^_[]W5H3hѽ"j5H3h"j܌jeP|$u1Phd@5L3 H3tQhg" XD$ 0QhW#j贌SWVP|$t$^h.9#StDhR#St@h7b$SttT$da3 D$dD$ tTj/S+tF1;tٍT$d#3D$dD$,t>\$:t$1\$(XX&T&hA" u1\^_[]h"hr"zԟ3=\3uj=d3l3`3X3T3 T3YhJ"5T+=h%"Ph"jX3=h3u thο"0"`3 T3t uh"t=3uh")ǃ|u D3j=x3|$\G1PPL$lQPjW<t2t$det"1PPD$lPVjWt53=x3u4$P53eu#$=ux3h3 d3 l3 `3=3 ɡ3=x3t&jQP R 3u[53h#jhh3QP艚3y"8h3h."033=x3u'L$dQP=53h^"h3hrdAP 53h"uh3hedA53 53h"h3hK"2$$t(hQP53hh"N $$ƒ 3>s1@![Vs ) ȣ3333? 3 3333335353=3=3?wd3h3=l3L[Vl3?h3) d3>r$r$d3 333u 33]u1hQPpO 3u253h$}53EP3jq53|Vӌ3u VhD"8 11h3t1A1A1ۉL$@1h33 3h3=P3u#3d33h33l3 t$\F|$LSSWSjVt$L3n 1QQWPjV诳y53Z353j/Vt@UUUU)ʹ3333!!сis31f3t!ttb33cԋj3 t3x31n3‰ |3331 31AhQhp3'i i-p3=3 / t3ًx3P+==w !r%1H$D$ ʀŸw1D$ $}ȹj3yt\3t  u31I $L$9 p311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh8"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$d3-h3=l3x3D$t3t T$$T$`3=t3uu 3; 37=X3lP3_hp""E381uh"&3L8L$(L8L$$L8L$ L8L$48\$81=3Ɖڋ\$4PVQRzPSt$@t$,t$4t$<31K1Kޅ`1PPPPPP =38hT"1b38LFu=X3uRh"%tajh"&1""WjWWWP+h3"t҉3u b3=h3u`3u l31g=h33D$tD$|D$h""631N=t 蹵@ 1"WhVVWP+9tigfff։f5633L$ȃjPQD$ u h"jsh"!1HL$ Ajh"1۾83D$3tB?t=kWUh"~ 3L$ DD 3$ D$tD$D$ u53 31p3|(.tq<(tk{PWh" x3t3p3t (BD$,T(2D$ TL 3$3L$ щtT$ 3T$D$,F9u߃|$~O1l$GVWh"v T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R*`3=ue53$@D$ $#D$u D$ T&1$L$19;ta $Ȣ43=`3ud3ul3u h3=X3t83~ h"3~lh"]h"8=`3u1I3 3t h9" h"t3o3e$jt1 43j3t \3t3$ D$ 43 u=35p3x3t31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 43|$E9u KD d3Dh3Dl3DL /3 3WQD$lP> D D$EFI 3EPART3M u#E1M1 uu WjFV ;Et 11=p3t } tu$u SVRt$hk")UhI"3g ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-3~x p3 D$ D$x35t3D$8$t}t ։t$(tb3D$D$(#D$ 31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=X3t-t(WPh" L$ T$8St$,T$4$tD$XRQPww XL$ tC=u=D$8L$XRPQBw l$0$$L$ *D$ D$Xl$0|$$L$ tW$=T3tduD$P $OD$hl$( >-31ۉl$(-D$D$DT3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$x3 t3533D$t$u~t:t  Iuh3 щ $ l3t&=u53օ4$u 53GX3ti3Ȩuh_"h %/3tjT3=u)3Ѕ$tN3=X3u"Ph"]0h_"NPh"t 3 =3uQ[$$t%tϘ%13ti)3х $t4$P53h"=X3u53hq"1t"1`3=u )353^_[]VPD$ L$ $QPch"ԥ3H ԥ3~Х3H Х30hХ3!Ɖ t9tDԥ3H ԥ3~Х3H Х3hХ3ƒ1Y^hT"jUUSWV1=|3˃y CS t 35311 uY1ɉNVt11@5C C"t?"Ph"P h"1He^_[]SWVP$3;3u+x3u"QhmdP y hI $|P11h3<=3u;53|- 31Puh"V=3~e1p3111 t3x3Pt,p38C;3|h"OSh"O$3;3u+x3u"QhmdP y hI $qO^_[USWVP։y1ɉQPU+P 1O}t#Ë$8uP8"u r1^_[]USWVP։ϋl$=\3T+p3 3tú#t$76PSRh"T$7St$h"xD$7UPS\$ Sh"S7PUSh ";77PUSh"7PUSh."7?PUSh@"77PUShQ"7PUShb"7?PUSht"'1PPPUt$(SRh"`^_[]USWVˉ1u=p3h"HT$$8$43|$͉)uh#WhM"Y |$Z)uh#Whp"? D$|$j3:i3h3 g3l$M?>j3n3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$}"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h4" l3h3D$HL$LVSQP譝D$T$D$PVSUP葝D$|$ D$@VSPWuljӸ1=3ƉT$ L$@PVt$QR9PSW|$LWVUl$lt$,t$,t$(t$@h",hХ3jdh<3 |h`#h<3<3\$ $t < uC{ - 3DAu<-j D$$Ph<3 D$$\$ hG&SSK|$(@D$PhX"S{W $ϋT$ t։t=t$h`&SMW t't$h["S7W ct$ |$@D$1=3ы53jVWR蹛D$ՋD$D$D$D$D$$t$t$D$$  T$3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th`#SP< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh"<3Vƀ;3t$Vh_"q 53D$,$t$P։ω,^_[]hT"jDUSWV΃ twttu"^T$(|$$+3уD$ ;t3 "L$ x3|.|$,T$0 3|$9=|3|=X3u|$4u 1^_[]Ë-3~} ʉ$9twp3|(tk t3t( T( (t1+39\$ \$$}2;T$}#=X3u6|$4ttD(OG1nF/"t(n9Չػ}n9l$\$QAuƉf3tt  $tt ^j3 t311 x3t$ -3t$|$$|$}p3] ʀ|(tP t3t( ;L$T$|L( (9Ή} =X3{|$(t ;p3KC x3t3S"1$t=t t3 x3S"=X3|$(535p3)^13333|3x3t3Ɔf3t$ |$(Pf393u85p3]13333|3x3t3p31Ƀ|$(T$3\$1 53n p3|+D$Nu p3[\$j53t3)؋ p3P|$(t$ hhj#Vp3VfǀU3L$ x3D$t3ƋD$$ȉ5|333113up3=X3h""u)""=X31|$(9 3u85p3 \13333|3x3t3p3Ju UPQH 31|$(tD$t3D$x35|3=3^_[]h"j?WVp3t^ tڋt֋|҉tΡp34 3 QPV0H 3ƀ^_USWV T$L$3@hPhp3+  3p3~Cx3t3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR{G p3;UjP覠 fDŽ;UtZF , M ;M;MU;; t3 3T$)ʉUL$  31 EE=l3 h3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M3 ^_[]hS"j<WV1=p3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 3D$Ӌ53݉t$މ$!!jVWt$l!1Kl$ 33uhUPzQ53P&  ;3u[jVW53 !1Kt?D$H53#$SUPt 53V53 ;3tÉ؃ ^_[]h"j:USWV$0$,1@D$l$D$D$ $1h"WV@B suMj U5T+=迾 áT+=8=L$90誠8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-ԟ3)1<$L$jhQP4uPh3hedAPH =>3V9l$| V@f>3UjDž\$ t|03H 03~(3H (3 h(3j jh3h(3 03H 03~(3H (3 h(3j 諽<$ D$tt#tv"PhV"ķD$f<33Waf<3gdWPV xnu)D$PhwdV h"h"xV?1^_[]Ph "25T+=h6"j74 h"h"jj0˜Ph"h3苹 jUSWV\T$3< $SaCD$9d$ՉjRPt$ VD11 Sl$UV) 9 1U\$tL$j@PQp 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4\&h "ԵT$l$ >31ɺT31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$H3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf >3ŅtMaQ4\&h"轴T$ t tuf f111H3|$ L3P3T$T3U3fV3l$E<$g\$ttXaQ4\&hP"/ ;B Q4\&h~" <$\$t4\&h"<$l$!F1D4 "eGXtVjjhI"eGXtVjjhN"eVj w(hW"V说 w,hi"V螴 w0h|"V荴 w8h"V| w4h"Vk w^_Whg"j'fWVt$ |$7WVUSWV $$l$WVSU$ $ hU3WhX"B;uWVhM"jG 'D$@tF$j$h&hV=V$$$hV"jUSWV$$$$D$1 hB"SU-. $D$D$1G$D$ȃ 1$P&N|w5T+=Ft|$`N|Z5T+=Fx|$Cj$h|&5T+=#P#5T+=UFp<$hB"SUZ- Vԟ3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]h"j$Wh$jG$։Phz"h3薦 j@WVPt$jWV! 9u9t x^_Vt$h"jQ$Vt$V)t@^h$6#V^Vt$V.t@^hG%V|^WVPt$jWVQ! 9t9u x^_Vh"j#WVt$|$ VW t$?/tWh|"tVh"f^_Whg"j#fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$Q%D$ T$M⿪t׋E4D$T9\$E0D$Ds h",1VWt$ t$U%PX:1@PPVVu4u0uNË\h4h&PS\ }D@u hh& hh&S.\ }D@\E,CEh%Vzz\$th%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$x~D$x|$D$xt5Ph)"X+%t9\$t hG"?+\$xD$x\$D$D$ 9\$~\$~tShz"+\$9|1} t h"*hW53h"b}4xME0;E4ru0h"*},u,D$D E4t h$"D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ W'\$tt$1F9tWhw"'D$ 1tt$ tЉ|$TB7D7R0'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"3Pz |$)Wh"3P[ D$ $L$t$}D@tCWH&1@9tWh"E&L$G$D$$|$tD$|D$P$\$hT$,T$ T$WFD$(+D$L$,L$ ʃ{1QPWVothS"j1F\$D1VPShY"jD$XWVPS@%|$$u1Ʌ|$t1ɉAw1@|$Ph"jD$tt$535x35t3t$\t$dt$<535|3Q5l35p353PWt$L@ƃ|$4tVIaUSWVӉ $HQ|$j W\$ Sq Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ kP8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h " QPWUt$t$h:" t$t$h"j:USWV31F/WVUh"WVjh" WVj!h"WVjh" WVSh "WVj+h"WVj;hB"WVj$h~"WVUh"WVjh"WVjh"oh"WajWVj h"PWVSh@"@V^fD$t1B9| 3I 313Iu顴3P3 3~ t1@3@9uUSWVD$931A9|G3S{Ɖ<$~ SjVFJ 3D$~Q1ɡ3t<3*tBEB(B$B4!؉B8<:tWBuA;L$u5353$3^_[]V$3 3D$D$ &T$ t$ 353t$T$L$D$\$ $x"e$^Vt$FtN H N tNHNfr v V 3^VD$`sH) 33 3HtP4BPQ@@1ҋ3v9t33rh"jtp4F@3^USWVD$T$#353tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hhг"WEUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv gF V>3 3 39|[53tFNu 353t5FNHNFy F4VPV3@31@j@PU1@PsF ~4D$F(^$F0^,n#3^83 3t q43^G FtH 7~ F^_[]É 3=h$"h"hh<"h"hhг"CVt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H 333H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^h]"hV"h4hг""BUSWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv TD fUSWVP|$g&s&G4$O,53w0VPww D$0^_[]USWVPt$ff&s&F4$N,=3~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdPF?hjvB v"^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4 41ہ=3| t Pt 431t 98t@^_[]Ã^_[]`V1535 4hVh3eA 53^ft$ t$ {jTSWVt$frLN4F,=3~0WPvv 1&t\fv4V1AN4F,=3~0WPvv 1&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h":USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$F|F|F e}F F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h"n$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=3É>GHOLQP6jjWpthݐW1$3L$1 QWPUSVh4j!ÍD$(Pu S  \ EWU=a=t ==bt =b¹tTt 3݀<$u1 \$t1 L$QUSRPVh4j5Ël$hu P  $\ E1PU\$tE|$8t h",$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8th"~t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh˷"OB$  $ V19tQRh,"N 1@^USWV |$,\$$t$ tCPPt Ttt4RQhr"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"Mh(3D$(u KHKpStURQPt$DljT$t h,"q|u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"  4VRh" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhu"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$hŶ"^1t$A\^_[]h."h "h)h@"h."h "h"PD$L$ $QPj3 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt |$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$9"pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$S"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$D 4uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UWȭljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RP[ERPK$GW #RP6ERP&$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW蒨Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP臧T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPԦ|$FV D$t RP跦|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP? t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP袤|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QP誣L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv u  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0h"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hn"h h"h"h h"h}"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 覬A L$H SjQ ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP(1 ^Vt$ V(1y?1I+F$ыT$ptj42QPY(1 ^Vt$ V(1y?1I+F$ыT$ptj42QP (1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jLƉ t,UFtf^81FFH1|$<΋t$  4uN $ 4NVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$諒tPQVh"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h("h"js@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ $ 4 4uPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp 説 ^ hjSw V^_[]h"h"hhM"USWV l$4E}0I\$8u tȉFSt T$$hF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt9t/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$9"袵\$8u;l$L$4A(I,WhT$L$$D$  l$u L$4A(I,T$L$$D$  \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$ 脴 @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$fF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$fF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tW1oƅuWh"jn$$<$4D$Phd@U  tj1OLVhedAU1 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hI[%t$11 Sh"U腍 CPhQ"U# C Ph"U CPh!"U CPh5"U CK,C,QhH"UՎ C0Ph]"UÎ $@D$t PK$1-Uhzd@$<W  t1 VhedAW hjU D$ P$4ND$, 9L$ L$9u0$S11:8tx$0h"hb$11҉ $ƅ*ŰPvj PUDz ^_[]$0h"jlUSWV81ۍD$4ShPSu輂1NtAljSPSWuW:uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS hR#Ut.P|$k #V(t!Uh"JUhl"1OUh"l$D$QUPh<%W-tPUh?%WiD$$Ca2=ouVE\$c&V{V $( ]hhI"Wpx ƃaT$ #V1u\$ىjW$( hN" VT$ #V$$ h*"}V< ^_[]1ىj=ߊ< t< uGjh$W k2$( aj2WPkw EKu$( 8~y$( 1\$ىj(Sh$Ph u$PUh" "j2PWv E2$( ;(|Vb\$ #V$( @V/T$ #Vg$$ h|"h"uD$ $PUh"SwuU蹾<Shh" $( aPWh"UhW"$( x?$( Z1ىjPySh$Plg uSUh0") j2PWu E2$( ;h||$jt\h"@PUW  $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR V荼q8uUh"Ih "Ph-"4USWVՉt$hR? 1I t uFjh$Vc u<^Ft t u^F t tW2PWV' tt$hU u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhVd űD$ 1GtPh$^_V臻1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhH"+C< t< t< uhR#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@PQ t$$$ىh0"rC< t< t< uSG=$<rLjSh]"Shy"_Sh"h" t$<L$D$D$L$ oP otXljo 1tX L@uH~vCtTjhh" V*$^_[]V )UjSe D$ D$ CD$CD$C D$C$Cl$Uh#V%v u D$CV螸)1$<;obD$D$PSh" =USWV$0xjWwƅ~F$0h$1jUlw~4$hPi C9uЋ$4hR#SǍ$ىhk"$0St| uƄ$ $0ph"QUD$$0qh"QPىD$PU職PUSv u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph8%S軟D$L$ T$ ыD$E L$ T$ D $A9L$D$uPph"h"i\}Sh"h+" Sh"hK"G\ $02t$t$h"$@t$Ph#i |$W}~14|G;}|V{1^_[]USWVD$(}~;$ ~VE pSbm $PjVWjS vD$11D$D$D$D$$D$ D$hU#u Vuf H5$&D$>j 5T+=Pl Cr, 4밋T+=$P+Crj h&#Vh ىVS)1PuE$ ~S4Vh $Ph`,jSPt$VruVh# kWhB#j3ZÍD$LPSu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h#Qhr$PPrr @r ,r .%r0B$PPh%r0BV¡ a8YSh#A*r'r)rzD$(h#Ph)r])r9r rBD$>P,r<r<|$$$PWS1?$XAQj2$TPQs $Ph#Phr<rr h#jhr +rryt$$$PVW>ލ$P|$xhM#PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP` $Ph#Phr"tf#PSh8# .1$P;$h#Shrt$V#9;$PVh#T|$$Vh#;h#jhr t$Cj=, 4:$h #Whrt$9 #?c.\$jrh #WhrS$d|1$XAA$Pj2PQ轆 $Pho#Phr9rh #~$`>ߋN8}&w &PVhq#2 `Ouet$$P\$ ZSh#h#$P\$;$PPhn# Vh^#Sh*rt$  09rhe #hq #$\>$Th%d V{h #n$X~:$\1j hf$V苩 "tQ7C`;$X|j ~-h #$`>V`Ouj $X1~$1:t @`9u9u$\Ph#1@\D$,\$H|$PS1$hjVѳ L$,9F Vh#VhrWN h #AF0Ph#F0Pv,v(v$h#j h #$Th#Ph#h#FhE%VD$0L$4$PND$8Fhj#Vh(r W  FtsSh#Y$PtPh%@h#3$Tt*Mbi)QRh# j $XqPSh# ]h #$X~n$1Wȃw,u"$t&L$S7#!##}& ##PRh{#W F`;$X|ۋt$~G$`>G8tu #P}&w $&QWh{# `Kut$h#VhrP > #t #Pt$1 E$`$d $jj h$QPjVyjh$VQ\ V$`t$Vh+#W$XMbi)QR$\Vh]#$|$|$|$|$|$|Vh# $\uM$1wh#L$!r9 #$PPVt$h#!11҉4hӀB9u๔#t$QPt$h#H=, 4~S$h1h9#)1PQh#  C uߍ_ j  rt$h #Vh&r@t$^#;$Pt_#"tf#RPt$h)#t$ USWVdp׉L$$xph #S苤tÃr t1C$|L$ PVQ… Ou wu pu o$1hoVW^ owt1$4 j2tWY F29uut9vQgtct!-DŽ$]DŽ$]SuDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$]1$]G1FwGw0GhhI"WX Ƈ$L$hJ#Qh+r|$W9uh#jhr Wdp^_[]ø #1@$ #  #$Pt$h #h3WV1VFF FFFFF h#VhrQFĘ^SWV։ϋ\$1D$$jh%SZZ tVjh #SFZ tBjhr#S2Z t.jh#SZ jh&#SZ u$D$D$h#PhrWh/#PhrW=, 4t?|$#t#PVhB#: |$u$4&Vh]# ^_[$oWVέƿ3PhR #W Vh #W| Vh #Wm Vh #W^ Vh #WO Vh( #W@ VhK #W1 Vhl #W" Vh #W Vh #W Vh #W Vh #W Vh #W Vh0 #W VhG #W Vh^ #W Vhu #W Vh #W Vh #W} Vh #Wn Vh #W_ Vh #WP Vh #WA jǽVRhQ(G t^Vh$jGWVPΉ1WPhPPj PQ/ u^_Vh7 #QjFUSWV։ωl$PU\$hjS苩 E9C Sh#ShrW Vha#ssss hz#ss3h#{##t#t$(Ph# t$4t$4t$4h#m$t$Ht$Ht$Hh4#MD$8Phg#:$t#Vhz#$4&h#$h#Ę^_[]t$ t$ t$ _ tt$h#jEUSWVӉύD$(jPW1t$`FFF FFD$h#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP]GD$HD$PD$P &5&|$D$ fD$ l$ \$Tl$+D$Ty1&Ph$j($P;T$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh #j$P DŽ$ <\$D9r<#VS4G M~%Hwv$<& L 4L 4ǃDt*Mh &5T+=iX 4u5T+=M;4D 4nNRt 0 4j W5T+=; ` 4L$9&-T+=3< 44 48 43j W5T+=m; 3L$9]`d 4@ 4}H 4nPItWbPIujj=QPh#jx=D$كL$l$ umt$Yl$ 1  ut$)KL 4h!#5T+=h#p5T+=h#` $L$L$GȍQw[sV?PzPH-G A6PGu$t L$-AGL$AL$$j=H 4u ىV1 D$@W'$WlPh$W] $'h3jjhD#qb$WPhr#W  j)$WPhG#W׆ =< 4tVh3jjhO#a< 4$W葅Ph{#W肆 6WKTh3jjha#a< 43h3jjh#ya8 4ꍬ$U$P GV)1;$v7$5<P{3$P迄$$1Ehh3jjh#`l$WK(_D$he9jUP^WL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=< 4 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S菀t jh#S t ;/u f. Gf./W~S~9SW%t͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS{tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 53 4H $s-t$$tHfHxt P2)1^USWV=< 4th(3jjh!#]Ujj9#tvƃ=< 4th(3jjh>#,U41GNIIˋ^s 4 tVfV(4ޅu4=41WS"ơ4Krk=8 4tV$PhP#h(3f ~uV7dV'%V`v v"@4F$5@4vu;44K^_[]USWVPl$4M1t$"Džt.w w!ƅu h\#d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=8 4tW"Pht#h(3# W_1l$$ttF9u t G9t$8&Qt$hE4hY#h3轡<$WbWE&F~X|$<th#V_VCbV&vfFt$ t$ t$ h6#h3,EuFufFFV!|$WP`WV&N=8 41ۈH4D4|NILD4hD4muL4ǀD4|NAMǀH4EFNDt$hE4h#h(3x1N1@=8 41ۈH4D4|NILD4D4WtǀH4FNDǀD4|INOWtL4ǀD4|NAMǀH4EFNDVdPt$hE4h#h(3ٟC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=8 4#~VPt$h#h3F1t$hE4hv#]a >W\Ut$$t$$|$$WX ƃ*Vh#V%]1@KGufGfG1@=8 4$ WbPt$hE4h#h(3肞Ut$$t$$|$$WƀH1@=8 4ىV_bPWhE4h# |$u V[v vY@4F$5@4Ut$$t$$WDUt$$t$$W.PZN1@=8 4t-ى,VaPWhE4h#h(3葝؃^_[]S1H4D4|NILD4t!hD4rǀH4APEǀD4|ONTt!hD4qǀH4FNDǀD4|INOt(hD4qǀD4|NAMǀH4EFNDƀL4t(hD4qǀD4|MODǀH4ECHGƀL4[SWV=< 4th(3jjh#M4=41VWftmxtg 4W sJX tCf{u7=8 4tSPh#h(3$ S\S [빃;=44k5@4tc~ tWuLfth#W Z=8 4tWRPh#h(3袛 Wy\W9 륋v$^_[SWV=< 4th(3jj h#`L@4tS@41{ t$C$Su[SFuՅu5@4th#VKYv$^_[USWV=L 4R< 4utDh(3jj"h#K,th(3jjh>#K5P 4t$G!jj#^ơ 4;4 44,׋-P 4WV]Ɖ׋ 4 49sAWV2ÅuWVhS#p\ SPhc#h3 c렉1‰1 u`WVÅu h#%\Cuh#SXCt SZcSSPCcQPWVhz#h3葙:KP 49tPt$ ZU-P 4 4;4 44^_[]USWV=< 4th(3jjh#$Jfx 4jY9T jj\ʼnT$4 4PQ\D$5 45 4J\Ɖt$U9\ʼn$St$p\Él$9$\$ 4 49ˉs6fx 4j8DTk D$; 4 4rM\$ -P 49sI 495 4s9-P 4tS P 4E9u 4 49\$  4 49ΉsZWVÅu h\#YSCPhc#h3蓗 cWV[Ɖס 4 4911 uU9t$D$ rIWV<Åu h\#|YSPKAc9-P 4u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5 45 4fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=< 4th(3jjh#wGFtVPXfvu݃=< 4th(3jj h#5G4=41ҹ$RL$QtMƋhtDEt9VP|$ Wޞ1ۀ~UiCSPW+W em븋L$$; 44r^_[]SWV=< 4th(3jjh#mF4=4rc11CWS5t:FfN~u %fFfth#VYSvuȃ;44r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhE#V ~u,|$ t%hZ#VRWh+#h3t 1^_[]fUSWV`=< 4th(3jjh#9E54545\ 4h#hh3L 4 t=;4uFFF%)Fu9rV9=< 4tJh(3jjh #?F < 4t(t$h(3jjh #?F < 41V9vtRPh:#h(3 < 4th(3j ƙ$ 9̓>t9߁^_[]áh4tPjt$t$?uù3WVIAfF=t4|Cx4)f45d4jQh|4>u5t4F1|4PVQ0 =x4Ft4^_ù3Qh#q8u"h #h#5\ 4h#h38j辁WVjh3p1t)h t 8@ W@^_V 4  4t7#| 4=@u%o> 4  4t| 4!=@t^USWV$$$ $jhWVN,|4tE1M1 tmjWVS$8jWVS$8t$Shʛ%hVV`$ p4U Rh5p4DžtGh%PMbtShw#h3趋 5p4DžtGh8c#PbtSh#h3x 5p4[Nj5p41jPP6`R+^^$DOGrhPD$Ph#h3 :hPt$V $(j7V@ p4u D5p4Nj5p4j1PP6Q+^^X^_[]SWV׉1jPP1Q+FF9tX\$)yWhb#h3Q %؉jQP6EQ~tF hP6' F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFh%P!`;-44rv=8 4tUh"#h3f \GP1=8 4t:Ph#h37 %1=8 4th3jjh#:1^_[]USWVD$$PD$x/@th%Q輊1ƀ81Mbi)|4H1ًP1 t p4P RV]5p4At\G9uGSVP] t5p4Džu*h%D$Ptƀ8MbE^_[]USWVt$!M1 tFjhRWI,|4t(E1M1 tm`ƋU R^_[]ËD$0!USWVX=< 4th(3jj&hD#<8L 4 ߉^_[]USWV|$u hl#>W5Q(-4u`Ɖˋ-h 4UXDžuhv#z>-h 4)ً(-49w؉9vlj<(-4|$(-4WS^_[]USWV։ϋ\$ t;=44rVWhQ!#= -)4 )4QPVW={s LK$\=8 4t%[$tC1K 1 uhk!#S9^_[]SWVt$f~th#V9~u(~th#Vg9~ th#VS9FN tkQPDžuh;#V)99tt79uNH4~^ SW FtPhL#V8.>WGO(-4(-4$-4F$5$-4^_[ËAP 9ttЋR9uIHËIH hz!#Qt8Vt$VN(-4(-4^SWV|$t$Åuh[#V,8;^ty^C Fs j/W<GSxN(-4 (-4W WSNFV86PO1ɅF fN^_[USWVd=< 4th(3jjh#;*=H 4td|$xh7b$Wyƅu0]0s-Ph#h3x Wh#;t$ f 441؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6)vuݡ4$4؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W([u4$54L$T$9΋$D 1$T$| )4~L1\$)4 tAD$t$ jjS-(G )49|͋ 4 $54T$|L$<q$Q Aip 4t 4QA 44QA` 4A$t$ Vjj(Q'F @t3Q[0+Ph#h3v t$xh#8VJh^_[]USWV$=< 4th(3jjh #H'e1PPU Džy0Z0*Ph#h3 v UhH #88D$,PW6y0Z0L*Phj #h3u Uht #7$jSi ƅu h #7SVW xD$j(PW y0Z0)Ph#h3Nu Uh #{7WL 4RrD$l$t 4=p 4,$1Չ1 9$h3jjh #jj5454 )4jPv)4u h- #6PjPh%HĨ^_[]fx 4D$L$ t 4p 4D$L$ 44=0 4u t$(6t$pPh!#S6D$ L$$ 44L$T$  )4<))4؅~ڋt=< 4tPWh*#h(3V =;4 434(/4hQV 834<34^_[]t` 4 PUh*#k s-434hh@34U :0q PhF+#h3U jtJUSWVE 4fx 4 4 4D$r>:V=;4t114Bu11Bu=Iu1@'5 45 45 4Ph$,#h3?C1^SWV\$j/S)tMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th1.#WWNƃ=H 4uhV舢x=< 4t #U#0PVhE.#h3>^USWVl$|$\$u0=H 4uCWS蠌y5#0PSWh.#uuI=H 4uWSkxB1F=< 4t\`/#t #SWPhI/#h(3>6Uh0/#2$"0VPSWh/#h3=1^_[]PD$L$ $QPh3A =@ 4uh""=tXh0#)uj1WV|$ =H 4u1VVhWx!1F=< 4t8Wh/#h(3.= #!0PWhi/#h3 =^_Vt$~th/#V.FσfFVqƃ=H 4u VЊx=< 4t8Vh/#h(3< #6!0PVh/#h3{<^WVt$ ;54|$4s(WV=t xt@u;54Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$1@4 @4|NIL @4Ft,h @4qǀ @4|REMǀ@4OVEDƀ@4F t,h @4Aǀ @4|TMPǀ@4NAMEƀ@4Ft,h @4ǀ @4|EXTǀ@4RACTƀ@4Ft"h @4ǀ @4|NEWƀ@4Ft$h @4ǀ @4|KEEfǀ@4PF@t(h @4ǀ @4|EXIǀ@4STEDƀ@4 @4^WVt$ V蜱1t%t 4P 9щrVh0#h3d: 1^_SWV|$3Wh0#SB: S4HQP~ Q1 P t4HQP~ Q P t 4@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#j*h&j7h"h1#jh1#jSWV$$$VhX1#hW1D4S ^_[USWVӉ΋|$-D4RA PSUF S+ 9u ^_[]j\=D4u2#`1#jD4SWV t$t$4hc1#jV1$jfƅ~'|$01ۍ)QP5D4 ~9߉ ^_[jUSWV t$4|$8\$Whh1#jS0-D4SO PSUT WV5D4D 1B% ^_[]SWV Ӊύt$sKt$ tVWhW#0 |$Wjy01HFuD4y ^_[V~ | uDVh1#jVPt$\t$\hm1#jPV/w#jT^V$ x0P$ hu1#hVF/}1#j1H^USWVPΉ˃|0Gl$jU5D4 u/D$< t,COh2#Vh-2#jC^_[]fUSWVP|$\$C D4K $D4jhh(D4jPx(H4u?8 D4jhh(D4jPD(H4u 5 D4 D4(D4h,H4hQ@P ,&$x\&&x4#5$D4 PVbt(E uY2#<$x"VPhB2#j賯 SWUj.&Ph$jV3Ph8#Vz1 Vjj(h8#hP&L&hc#h3E1 uh3jj'h8#*T&P&hc#h31 u1Fh3Vj0h8#Vq%|$ujhU 5(H4 u*hh2#j߮SWV |$t$ >h"#W t9hn%Wt'\$j SWǫ $ 9uy6hu2#U$~h"#Wt@hn%Wt.\$j SWr D$ 9uyvh2#jD$PhU5(H4 u ^_[2h2#jSWV |$t$ >h"#Wt9hn%Wt'\$j SWϪ $ 9uy6hu2#U$~h"#Wt@hn%Wt.\$j SWz D$ 9uyvh2#jD$PhU5(H4 u ^_[:h2#jUSWVh豸$(1hWD$ Pg |$ |$ D$~P1ۈD$$,,jUh" tjUh3# tG99ufD$u\$ tR$,4jVhZ% EjVh3# 4jVh3# 5\$ D$7f@jh0uht$Vj P5(H4D$^ރ9tD$j@h3#P[ ߉tD$PDaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VD defDectsDuV}jh4#P V58H454H450H45 D4h!4#)Et2tR}jhC4#VH H}j1h4#V# #}jIh`4#V t6Wh.#G)Sh$9)UփOut$G h,9#2X^_[]1h3#j脩USWV}\$j S5(H4O D$t"NuD$Hj@PjSPh4#j!$j$Vjj5(H4rF=tPh5#J(D$D$ D$$fD$t$j VE 0?- 9 1L$81qAQQ a A j QV5(H4-D$t$ *jhG5#E p  D$ @L$jhtjPjQ5(H4hK5#j'h(3]D$t$H1D$`D$L'Ƅ$0VhQ`5(H4 $j D$tPS |$'y9D$(ȋL$;X&|"@D$Ph5#&h(3j IgD$$<JD$ D$ L$jhtjPjQ5(H4~e^_[]ÄtH<t<u'5 D4hd5# 5 D4h5#h3( P5 D4h5#h3(h5# &hW5#jǦE 0h05#`USWV $ ~($ 1j4h5# ?C9u1CCJt$LUPV  CJjh'UVjS5(H4~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P58H454H450H45 D4h5#$ vL$D$$jh'hVjS5(H4Ffȁw$VhUs VhUb ƅtL$D$jh'h$PjS5(H4]$f1Ɂw$PUhWhC9#+SWh$#vL$D$jh'h$PjS5(H4$f1Ɂwh39#Rt$ t$ 1؃;D$ D$4ƜF>|$Ń &hQ{&h%3# ~y)L$WV^_[WVPT#=`H4u%TH4<uS#PH4u"T#u3"hmH45L4WhT#jjMIhU#7=XH4uh9U#7=LH4u6hhhUT#UW xjh_T#PU V6XM4WhwT#jQVN4h]U#<7j肛VijHhU#7 `H4uTH4ujjWT#u"T#T#uT#$=dH4u D$@'T#D$=hH4u *T#=lH4u -T#=DH4u "=\H4u =$=PH4u =$$ @H4uH18hR#t(WPVV ?8Vh0T#j@ (8VhET#j=XH4u hR#(jjhM4HhT#fUSWVa΀-% plj\$ Cut$BT$ҋ $)|$4 1ɉQD$PS D$ D$ 938*8\$ L$ D$D$W|$hv.#SbDh*&SL;hu&S67h#S 3h_#S 'h_#SD$t$ |$@1ɉQD$PS D$D$ 9؋t$88|$1ɉQD$PS L$ 99։D$bL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,ShtN44t 3hb#v 1<==LN4 ڍt$81 D$ \$phjShtN4PVT$Ry$1BD$L4JD4`L$p$QRSRPV0XN4 TN4u1$P$w &QhtN4h,b#} hN41<=4 j=V9=LN4 j=V֝T$81 D$ t$ hjVhtN4PRWw\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$htN4hb#D$49t 8Vhb#S1JD$ $$Qhpa#,=XN4D$t$=DN4$D$D$,D$\$(VHGC@D$p9Vhb#0ĠPt$hb#|$oQha#=XN4D$WSt$hx_#VD$ 81ҸD$ |$\$ Cj"$PuÍD$pWVPSt$ $PW\$ E $tN4jt$tS7 $tN4jWV# -0诟PhtN4hfb# BXN4 TN4$PhtN4h&_D$ $u1@t$2|$ QhB`#(11G|$1\$ tpupth#QQD$ t$D$t1@L$ ɉ%t^_#PQ^Q|$t 8t1j t$ 螄4$`St$h_#FQt$h`#7.l 3m 3L$ L$ ف$K{8P|$WެD$ t@j QSu D$ ;$|$8tQtUL$4 T$hjRhtN4QWt$s l 3T$ gL$4D$ tN41ɍAD$4tT8`T$ Q$QRQPW輚cXN4 TN4T$J$w&Pt$ha#t$L$ $d$ r $3 $tu¸#t_#PQhOa#|$D$u |$u |$TF1@]%t^_#Pt$h<_#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qha#0Pt$ha#|$L$lj% L$St$h_#{D$$x&1ɉQD$PS L$ 9t 9St$hm`#,D$ D$ D$D$0L$0RPQt$,t$$PstBD$tUtsD$ |$tN4jVPM D$h|$t811FD$&|$tN4VVP  D$'$D$8|$tN4jVP D$ptN4jVP UD$1=XN4D$44$Vt$h#`# Phe_#=HN4he^_[]4$h*a#ًt$D$t$$t$S@9s Vt$h`# S@D$t$|1ɉQD$PSE T$tD$pD$ 9t8u8 St$h`#Qh a#W1ɉQD$PS ƋD$ 9t8t}St$h`#St$h_#D$t$։D$L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h^# jj-腗PhtN4h_# h_#ha#hAb#htN4hW#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS1Ht$L$ltT$d;WuT$h;W(u Q l ŃtD$ppPU D$DGXHr PV|oXd^_[]USWV$l 3P48tN4t P4/P4ShtN4臑tWtN4މ)ˉESQ|$ Wf DWP4V;VfǀP4/SU4utN4UhP4;,^_[]USWVhT$D$W#&1ChP4襵D$ CL$;rjt$V ufD$jD$PjhP4Vvt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPvWt$hW#|$$j@WVPuWt$hW#j^WVPt$=h 39Ph#W HN4t5lN4Ph(^#5h 3D$$PV5h 3 pN4^_V΅tOHHw;s1rt51t ttt ttth]#k 9uЋkT ;$tl  1L$D$Sjh"! {t+1:LtPh]# G,;{r܃TD$@TL$9uj Vd1A ^_[]htN4h]#+USWV }=HN4t D$ toh]#W膠tc蚮1ɉt$QVW* T$$9t8up8,Wuh ^# =HN4j211CL$ t$PSQVuu={tWt =XN41=\N4u?=`N4u6L$1J1ыT$1 u#MUPj h]#1ɅRaMUPjV tK=\N4u-=`N4u$1H3$3|$ uMUjj h]#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh]#STUh$SC t9V~b4$Euuh#8PƉ$t^_[]h]#h]#jEh]#h]#USWV\։ύD$ jPj Pl 1u0D$F|fD$Y|Uhk^#j D$ PZ$L$D$ L$/Ph:#j D$ P2[ $fL 3/LA .sD$ L<u\$ SsjPj SƧ E9[|$ t D$ PIVhp^#d^_[]WVth΋u\~8tU~4~`N4F8 I9rP`1F0F4F8FXHr P`FX^_fUSWV\$(S4,S4hc#sP\su ,S4.h"Psu S4j苆0S4Jmx &蹶'?c.5(S4芓h"P u 4=4c#tT~#l$PKrt Pu|Qߋ<-t<+u{uNh(&S萛tGSM16khc#q4S4t8u)hc#q4S4Pqt 4S4J$hc#}q8S4Pqt 8S4c#1=d#t (`4d#!d#t ,`4=4t8=S4u/d#0`4q&4`4=0`4u 4`410`4#u 4`4#⹃$8`4t8u`S48`4#⹜p&q<`4=_4tt8u`S4<`4#S#:@`4t8u`S4@`4E%d# D`4t 8t1@ D`4#1H`4#e#0%VWWhP`4hL`4qZ2#&V5P`45L`4hX`4hT`4H/s#m%V5P`45L`4h``4h\`4`&m%V5P`45L`4hh`4hd`4#;tlj=l`4:$mp`4'P&⹬$##tơD`48t,<$1QQPܟ PW<$Wf@$he#t`4%= 3#u#u#D`48t2<$ S4IQjP` PW6<$W@$7U#S>x`49$ tÉ|`4##tƹ"=_4u#t‰h#Ɖ5`4>u Hk4^_[É$p`4z8{lV t<0 1=_4u V腚^USWV׋t$$\$l$;Et*+u(m%#t D$ L$M^_[]USWVր9tMτtC1`4d2U5S4WȘ `41`4U5S4V諘 ;`4|ut$`S4^_[]Ë (`4S4USWVL $։ύl$ D$?he#W̪)?SWUm D h VU $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$yext$4h VWv L^_[]Ë ,`4S4V=4t =LS4=4uF 0`4S40`48t!4`48t=_4u x`41BhS4=4u `4S4b=(4t (`4S4H`4=4t!=S4|1Fj 2F;5S4|^Ë |`41B^ x`41B |`41B=`4ug=4t =LS4uN=(4t ,`4S4=4u $`4S4=4u 4`4S4`4Ã=0S4"`4Ë t`41BY `4S4Ht$j5D`4詚 1B)=4tË l`49tS4 =4jË @`4S4 8`41BV=4|`4tx`41B5`4t-F=_48`4t<`41BV^Ã=_48`4t<`41B^_=%`4t P`41B>`4t h`41B'`4t ``41B`4t X`41B`4WVD$ #=$ 3 lj Ƌ T`4j" \`4j d`4j=@4ttV$ L`4j5`4^_WV|$ 1Ʌ<+u OL$ GW.-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$<&1@ÃQ*A wO$ & ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$ 3 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th=%V trL$PQV t4uRL$x#e# $x2P #e#T$x )e#$x 4e#w^1Je#^aD$# $ 3  `49uVD$ T$5$ 3! щ щ! ‰ 19^Ã= 3the#Ë p`41BSWV@΃= 3tt`4tVs跄tx1Cj S*VGVʂSP_GVh%P- `4=`4!Vh e#j@WƩWZ@^_[ËD$`4WV9 3t#֍|$RQjW脩1B$5 3^_Ãwl&ÉfUSWVPt$ P!уtRPtt jh?e#jhSe#l$$\$|$Q t^tY9uE}e4u E<Ճt(ˉ $19u tC ;$u~2KՃujhe#t jhje#jhe#D ^_[]1ۅs IQRP踒fVt$t= 3tjhe#5 3^á 3xy=`4uE `40@#4@u.`4jhe#?t P4t 3P! 35$S4BF$S4V1N=`4t9t/ `4,@wB$@(@1҉,@Ɖ^USWV= 3`4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jhe#1@$qQ5 3 9D$}`4럃^_[]USWV-`41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5P4(`4@9@S `41JЅt8=`4u/@u1u0@4@ "'[WV`41t[@t @4v `44@0@{!уt RPF1G)t P4t^_USWV`4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH`49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë `4t$@(@ ,@1HUSWV5`41H(@$@9t#H1ًP1 u,@;Hs DԎ4%D$z9tG1؋O1 D$ ~9 $tG#G=Ѝ4t @t 3x9 @}lh j:tH @1HGG7FGF8~FNOG Fx ~,@;GsN+Ѝ4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@m!ƒ5`4@@ 3tOD 3Q@u;G  )RQ@w u&`40@4@&OD1@l$1tʼn$yjhf#1=,S4u 3x~OUQP 5`4@@o<$t0@D$4@=`4tU=Ԏ4u#L$ Qh$ Ԏ4j2=`4t=4u q=P45`49>tOOHO`45`4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhf# `k41H^_[]USWV`4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H 3á`4@u1I4@0@Ë9t1JQQ 9u@o `44@0@1@@(@$@,@PPP@i!ƒtjhe#81PPjt$qi!1WV`40@4@!΃t@@9} 0@4@^_SV\$t$ 5S4({`4h8@j`4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVh!ƒt`4 `4@P5S4vz`4@u@^[SV5`4@  ˀuH9tPQP Pr;dž @vv Hu5`4@uE u@5`4dž@tV;1`4P5S4y^[á`4t@1fWV|$t$ t=`4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVOtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h#jPh%k#lLh b4hb4h$b4h0b4\$ -uF :tjh4k#]jNbt'.t5b4bt0:wtptcu+$b4F&jSh b4 0b4jSQ ,uF b4b4b4b4b4a4b4b4$b4a4(b4a40b4a44b4a4hj#J1tPhj#J1F$ 3Vhj#Wh`4P(hj#dJVhj#Wh`4P ^_[hj#>JPJj3N1B thj#Jƅu&hj#Iƅuhk#Iƅt]h+c$V臑u6h,f#Vuu$h>i#Vcuh9i#VQt1B,f#w1 3TA ruƀ`4ƀ`4ƀ`4@=u=`4D$`4SVt$ a4M1ۅuDa4;1Cu13(u!=4u3 1ۅÉ^[D$`4ËL$=r!=`4tP5`4j ha4聗'`4u a4a4ua4ESCa4Ãw@`4uQhj#VPt$ u a4ESCuw `4u;Vt V5`4B$a4xPV@,@`4uPhj#V5`4j ha4論a4^WVD$L$ =`4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=`4t'~3P19wKS>~-19s2C,9r9v)CK$SUXfuF8AUJ*VA*o ɋl$u9tSv ft1|$jjSOF ~.EFE0uE^_[]VTj4t";T3t1FVh.uD$ L$PjQ课 $T$e^_]Ë dj41; Lj4|$(3D$ $X3D$D$ $Uj $Pt$Wփ ShU SY1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=,S4o=83u=h3u =4P1TAPX@PjVPWX|8QZtQL8h7b$W9É4$pu1ND$PVDx#D$ =uhVhk#a0tPƅdո(3Ex uָX3Fx uhk#h$S# T$Z]VUhk#S:S`W4$VWWcVZĀ^_[]SWVhk#/P/tt;^_[&h{#V Y1ۅt+h\%VXtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(3tX3u%k#+k#Qh$P tWh(l#vށ Y=83t"hk#h$v辁 V(3=h3t%hk#h$v蓁 VX3^_[^_[USWVPӋl$D$ $uSPVSS1tD$ t}t8^_[]StV믉hrjjx j4j4$t,tV#hj:} =P4TeuYÃ=P4e4΃ej4~o6/=j4u #=j4 t t =^=j4;j4Ct}.CЃ jS&ed~hj4 j4j4=j4t j45=j4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=j4ij4ih%jjS\Fc`$\&=,S4 &t>#-l35j4=ES[jUY  xSj4H݃t =<4-j4>!(Ƌ 3ķ>tjVUP t j= 3u J[\ 3jry C$& 5j4 h8m#9S49pS49S4=j4Sj4C1Ƀ j4j4ῃ5j45j4j4/U]VsWWr!2@*=S4%j4j47`4j4hQ$jjj4j4n=,S4 5T3j4 }h5l#j4 _gh"&y1PPv`41; j4j4 j4Hj4j4/=,S4 j4%h0m#1PP9S49pS49S4؉ك u. u.S莍ij45l3j4%aih&{jVyj4j4 PZw j4 *j4уBЃ@*? !1҃ ƒ!D$Z=j4,9S4t 9pS4h 9S4W jhm#j#t$(V|nOVrlp1BsRtM&=S4=j473j4Щuj4Mj5<3ùe=P4Iv_*-t%+q1҃¹) j4j4S\B D$t1< j4D$ D$ PD$PD$ P萪 j4tjD$D$-<{|Q<`ʃ=j4tR D$HL$@븃@j4|$ ^s 8eBj4emh m#1PPL!ùe9S4e9pS4e9S4e e 1?PS1FP@/j4Ph#5j45j4虤 1;5j4j4|j4j4n蔰VVA 1;j4j4  j4j4|\S4'M1PP5\S4 =4 j4 t|7ػT 1;j4j4|j4j4蛻=4j4u' j4|5j45j4Pj41QQm1;j4j4 j4j4|\S4|C=4u5j45j4P1PP5\S4A j4j41҉3P541;j4 j4|j4j44聺觮5j45j4DT54Jj4NVh$m#h1PP5 ùe9S4e9pS4e9S4e e /йSE*re|褹ʭn4j41n4 4 j44 p4 j4p4hc#Cjjhl#j4݋5j41ɸd9 jhl#=S4t>t5j4n4j44j4p4j)eD$t Pj{@eJr蘬 L$Qh$1;j4j4|j4j4)O=4j4u' j4|5j45j4zMj4jjP1;j4j4|j4j4跷ݫjj蟷ūD$<03D$Ph-l#=,S4jh?l#VR j4j44 j4j44j41ɉ j4|j4j41@Pe(ejhl#e1;j4j4|Yj4j4 諶Ѫ=4u5j45j4Ljj- j4j4ʃEݣ4c j4j44j4  j41; j4j4 j4|j4j4q j5<3?j415j4"5j41;j4 j4j4|j4j4 j5<3RCij41D5j4=4t5j45j4J1=W j4ij4me5S4V?P/V$j41ɉ j4|j4j41@PuGjhl#j41ɉ j4|j4j41@Pk 2V_e!ֹe54RPyJ1A诳է j4j41҉AQPcMn4Nnn4j4>X`hm#r1PP?ùe9S4e9pS4e9S4e e S賁+̲1PP5,4n豲צ1PP5,4jP#'j4j4ؽy蟦=4t5j45j4Gjj5j4d:0ؔj4j4艽*Pjj5j49; eS贔D$D$Phym#{豱ӡj41ɉ j4|j4j41@P"etbt3tFu j11A; j4j4l#|#L$Qhl#11%j41ɉ j4|j4j41@P'"e11A; j4j4l#|#L$Qhl#je5S4<h{#PV:5S41=tjhpl#o5l3j4nvh&1SVUh蠻Ag58S4rSPx]4 S4݉j4 j4n49‰}j45j4)‰n4`k4e4 S4j4 j4n4`k4i1j4j4154QPHFjhl#H3D$Pham#d ։u=j4tj4 j4j4e,5j45j4tI~V8JjhUl#bUSWVP趮ܢGVD$1Ƀɉlj щ n4n4`4=P4uH9ljD$u21xUUjn6 9-P4u;=n4n4D$t`4 P42t8teue^_[]USWVPӉơj4uj41 r4$0utV4$#j4j41ESWPO áj4 j4 j4tu1Fx` sKu j]j%u0SW5j4 áj4 j4 j4ujhm#t 4$4$^_[]WV= 3u=4t =LS4u袬׮t DS4@S4!ʃt]5HS4QY`k4u = 3uP54=`44`4u _BLE54=`41jPPB ^_SWVj4߾T%t{#j4/ V+=j4u V@t hn#t u&"&P1\k4PP^_[V蛫ơj4"~S.#V$^%=,S4j4VPujhm#  tY>!t j4t P V!j4=,S4Mj4.hm#qF<+t< t S4t QW V菛S4/7E=,S4V蜭hm#Pt% =,S4V^Xj4^(N5j4jF5j4jQP軯^5j4V5j45j4j473j4j4PVS4hm#h#r^SV j4t s7j4Zbj4shm#ij4 shm#Qj4 shm#9j4thm##j4 shm# j4fyhm#j41Ct$‰sShm#jVWVj4CuϹ #t% sm#Q\k4^[fD$=`4t@WV|$ Wjeƅ~WhV$< ^_USWVt$0l$(|$$t U/,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD `4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f j4 j4 j4 j4USWVi $AD$)< u?FP貛^tP-9~n#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp3hhh3hn#htjPV jh7n#h&n#h}tjhVn#hGn#hjjhmn#hcn#h}tjh~n#hvn#hj^Vt$ t:j j tL$HΉp j4j4jhn#荞^Vt$ t:j ju tL$HΉp j4j4jhn#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]hn# t8tMjQP[ ƅuh#l#t98t4jhn#P/ ǍEjPW WE iUUUSWVP1F=,S4jt$֢P#19jV n1PPPSK!ƒJVWS5 <$Sg11 ?$:81xM'x+xG1O|E(|n|dȃ|$j4tj4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTWf S$1N^_[]4$E |t|uVP11xtɉSWVhj4t$b<ƅui\$hj4e5j4PShk4I5k4P|j4tj4hk45k4p^_[ËT$ j4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=(4ÃB1ۃ=(4ÃCɍH9 S4~Pj#|k`k4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=(4ÃB61ۃ=(4ÃC%|$mu9S4~HPj#j`k4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P#V0ʼnP#D$X9vpG$11Ʌu2~>9sWt$Vr$ t't1:%31F9r':$3u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW #V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ#|t1=l4ƃtEuG%t|QhJp#hhM&AVh$6 Eu ?=u Qhp#$ u 覣!ƒtVHQhpp#^Ã=l4t$S4tPP&t5S4ËD$t5S4PF$1PUSWVu195S4OS4t_jP%=S4tJtWg%W"=S4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =܍4uID$xAPN t4D$8\$Phdo#FًT$WVt$j 1@t=S4jWd$5S4t$V$t$5S4g$5S4$h@S45S4#XS4t$ t$ ۨ4=h4111P4D$4PD$,$jUuWP@W UF ڃ,$C^_[]SVt$ h{#V 1Ct'hc#V th o#V 1ۅÉ^[WV$ VtVWVGtWt^_USWV 1=4]=,S4Pj\hl#1Ƌ|$ 11@L|uM@-u)Fh{#W )1%tuQ%t s@AAۃ\$WV W ؃D$jPtWVt$P1Wg "SU 1tXt^~u1O\$$D$jPW证 uQD$P4D$(0{#^jh+q#4|1 ^_[]ÉOVc;t;Vc1|$rɅuŋD$( o#1O;PrS USWV=,S4t^_[]j荈hZq#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhdq#U{PljD$UV, W! S\$ ,8jUHrS\$SVUP,04$ S \W Vub V|V$芓#N@ |^WV|$=܍4taPWI1=܍4#D$=W%*jP`qWPK<hP3LPWx#D$=@{WjPqWP;h@3V_ WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj5S4# QP t1GL$ T$34k43 0k41@ u,L$3 t'sujjh(4$jw!уtjt$WRPS#^_[]ÅtS4HPjytm=`4tPay1u11FUvUVRPVjv!уu P4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V S4~&111RP!уtF S49| 1 S419^fVt$tsVGF95S4u#1=3tu1Ɂ3tщ S4AF=3tH dk4v vv ^m ^ËD$3tQ13tЅtË 13tËD$3t 13tËD$3tI13tádk4USWV\$S@Nj533tv W6W |$j4j'fSeFSF 1HF$F F1FFF0F,3tFq0@@F=3t@dk4VEES_ËnUQ9Ë\$sU SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=n4jjPWV^_USWV,T$Dl$@ظBӃ=|4t  4t0k4 @1)ʉ|ЉjSUQP虊كQP4v=4tK uu|| t u+| t uP4ttP4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tP4ǃ݃ tkwRPW v=4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N n4 CfN =n4=4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$14l$t$1E1!1M,^_[]Ã=4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy5 3= 3H~y@wr 1N5 3= 3^_[ÐSWVstjhq#c^_[uƉסS4HPLi11 u^_[8iWV!Ӌ S4It*QRP4 S4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhr#bKy1V[hVjRPUo=4jusj'hD$ jhD$T$l$ !Ѓtd9}\S4H94$SW!уRPvlj9Љ $AS4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$S41VVjt$t$PY954^_[]1K16-Xk4-`k4S4H $)QUjSWP(1K[6=4tf"g15`k4SW=gS4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9tk4u#>$4,$tt=t|<9tk4|wC^w \$D$Shu#jW6$4,$u#f9tk4u+9tk4}9tk4t9tk4hu_G t t1"~#ut|\tt t tL@?3~|$j=W|9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuBv##6$4t$ t t_Gv##$40tUPtuQv#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV:lk4^_[]SWV׉Ή5pk45hk4hu#hS =w )WVRQo lk4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl"3 t^xk4xk4yk4JtGtO GO xk4yk4l"3 txk4uxk4^_[]ÍZ w6$"'tEGЃTZ$#'btPeu>fxk4랄tGOm>mS#놃>7U#w>Q{&h>'P&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]xk4yk4d   >xk4 xk4 yk4zk4~k4Rhu#jhxk4( #v#xk4_t>#vVhfv#m4P+t m4߲"hwv#蹻m4Pt m4v#jVLm4jVLm45k4h n4hn41$n4PҎ $uHn4^1|$áPn4Tn4Sm41n4m4 m4m4 m4m4@m4;m4|1ۉXn4\n4`n4dn4hn4ln4pn4tn4xn4|n4n4n4n41HTn4Pn4h n4#hn4$n4P $uHn4[USWV\$0l$,1=̍4uSUƉס4 H4SU\*@u6 3 3!ʃt'9݋T$0| 3@9- 3T$0| n4=4tU tn4n4Zn4m4m484 n49}Qn4Ɓm4 m4ك=̍4WV^! tt$j VRP)NV1 44)~$n4r5n4Ƃm4 m4Iu܅~+1ɊT 5n4~=n4m4m4A9uסn4H n4ƀm4 m4n4Xn4^_[]Ë 4t 84=̍4t144@V5m4m49}9 m4<u"m40Ph n4 m4m4F9|Ӌ5m45m4n4Xn4^SWVt$\$u$D$0j?oP/=`4t&v!Ss1҅ SVqt1҃Pn1҅t$Stm4~- m4Vt[um4 m4LV3Zt m4t> m4VtV[t'i=`4tVs1҅ƒK1JFVY# `4#`4#5`4#_4‰^_[QY# `4#`4ʉ# `4#`4ám4n4Xn4n4án4m4n4Xn4ËL$1wQ5m4 1SVt$ 1ۃw)V5m4uV5m41ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJv#9u!B1@uDA;1A+u%uVt1@^ÃwV5m4u߸ع#L$1uj jE1ɉHHO SWV=xn4 u|$t$\$t-1 |15n45n4tm1@Z ugx4t 4uU=pn4~+n4 n4\@n4pn4xn45n4=n41xn4=`4 pn4%=uan4Pn4n419Rhn4bmhn4mn45n45n4n4 n4H n4pn4u"n4n4x,1WV=`4t n41At^_[ÉШu-%=tS0lpn4=n45n4뢋n4 n4n4pn4USWVӋl$,|$(hn4=؍4n4uBu>%j jzC1҉PPn4n4hn4hn4twQPl'UWS n4xtn4Phn4蔅1n4hn4u+p4t4A\$l$͉=`41؋5m4m4hn4Rk5m4UWS% 65n4諞 n4n4PV軄Hn4@$n4VP诅V荄 Hn4AVUUUЍ@@Hn4dn4 n49}oh n4藅ơdn4 n4Y$gQVlu&m4m4PjVPmln4$#5m4n49|m4l$ EVjUek L$ )v %uhn4蚃5n4j n4 m4; m4 5m4|tq=m40jf jm49u"_l$\$u4Шx$_l$\$u$5m4 _ ‰$ u*t4t =4uKuG ڃ^_[]`4m_uiud1UWjXn4+n4 t"3k491J$;k4} qɉы4k4)t _m4\$ PjSi 1EL$m4) m4PjS`i ǡm4 m4tW4V)Xn4~Zln4t\ [5x"3)Й)֋$F UWh% N1hn4E1-hn4$_PdtUW ]`4t6=؍4t-QdtQd UWl $UWS t1@1^_[]SWV=n4~4։1n4Pd VW u C;n4|1n4)^_[Ã=pn4~n4 n4pn41WV=pn4~n4 n4mpn4|$t$ =xn4uu 15n45n4itb=4tYdn4S49Xn4|`n4Xn4\n4m4AS4 dn4H9Xn4} 4 j 4 4jf=H4Xn4tLn4tBx dn4 S49}; j,Xn4P dn4 S49}n4ы dn4 S49|L=_4tC_4„u0=؍4t't4|$t- 1j1j 1j5m495k4 um40m4^_V=؍4uajm5m4芭tMȺj9#e#Fu=n4u"Ⱥjv#Fu^SWV։ˋ=m4Gm49=k4 um48m44D$ Xn4; `n4~~ `n4m4\n4 Xn4^_[SWVm4 m49}1T$5m4ׁtu Ӊ m4@9|^_[ËD$L$ m4m4VD$ L$=tn4u=4ttNI1҉ tK1Gn49~m4m4+5m4)΋ m4 m40 ~^tn4dn4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8P4u/k4H9| Qu@m48GO1H^_[]cS m49t m4Mtۉ>?SUSWV-k4\-jSݎ jSЎ DžtVtRU5m4V m4UPW޲ U^ 5m4P 5m4=m4k41t W- 1Gt V ^_[]USWVL$D$ʃQPO1H…t$=k4m4D8OlV tnP4uc~m4>-k4u@m4 (I=k49rHŠIJm49s=k4)\8OVà uQL$ t m4t=k491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V蕓 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15n41Kn4|EtESSP t衴n4@ԋ=m49=k4 uS1Hte1ɺ|"3:tWAuN1|"31I:t?@u21|"31I:t%@u1|"31I:t @u^ËL$H1Ʌx "3USWV։QT@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=؍4u1@$5Xn4+5dn4~1; S4^USWV։L$|$0\$,Ѓtln4!t6tC؃T$RjQPWSQ=H4=n41ۀ=|n4tw4$|n4 Hn4ىȺVUUUЍ@)I(n4~4,I(n41E 8Vt$0j* G;}|Cu4$SG n4tf n4n4!Ƴttt$,9} 5n4=n4|n41ۃtQm4 m4T$ 1ۅ~&L$ PjQ\ m4~m4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1Edn4;n4uXPn4#Tn4uD$,Pn4=Tn4=n4~01 n4 8jG;=n4|h n4tXn4;`n4~<$~`n4 m4 \n4$Xn4~1 ;j_G9udn41;n4uD$Ph n4tm4 m49~~51ɋm44*1 m4444A; m4|١m4) $ dn4m4 dn4; n4~( 4 jdn4Hdn4;n4؉^_[]WV|$t$ =؍4u1WVP PV WVt1@1^_Ðn4H ȁ4r14̇4n4Ї44ԇ4 ؇4 ԇ4܇444444USWVL$0D$,l$$ԇ4$ԇ4ԇ4t-9Br }$r1z3|$( Hԇ4u$$ṙ4t :=̇4Ї4Ї4<$:rBJ jl$(jWԇ4tC:ԇ4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?ԇ4t_ )ϋ,$]}ԇ4tԇ4tV+BJ NF=Ї4uW-ԇ4MEu$9ˉ|-Ї4],$ϋ=ԇ4t sKӋ$JHJ^_[]USWV1=̍4tD|$(T$$!t3|0ԇ4ԇ4=ԇ4t'9PH }=ԇ4u11CŋE1ЋM 1 u ]u,444EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}P4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[P4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt4 11؉^_[]Ã=4xÃ=̍4u `k41̍4Phv#4V4xNH 4d|@4* 4549|jhv#z54^USWV|$ l$1Ƀԇ4ԇ4tKC9ԇ441 41 5؇4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9P4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RP4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=S4~%GW8É!Ѓu O;=S4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhLr#2n41111ۉu WVSU1PPWV+P4u Ɖ!Ѓun4^_[]WVT$D$ =T4t 5L41)|щƉ^_fUSWV t$ >-uF(s7h&+V+hmS#+艣D$1S6]+S)S\^S:S7jy W:h#À8t>tkV聪tmSʼnD$襾$U虾 $ȃ$jP'袷t$PSh%t$Ut$!  Sa'Ņu>tVh"F'UGU j6W9W61FVJ]V'D$$t*P*hv#y*/j ))3`k4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhv#.1N\$h7b$SS4h&Q)SH)hmS#;)3(1S|&S[jj w1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSDjhw#1KtL tGf;t=ËFHN~ ;F~à tQu VSVI1Vj 1GWZWg%e1=`k4VZ^_[]fSWV141K4t 5u'#ar'G__ _Gt P辀 GF6u^_[ËL$ 1ɅV-$t:4'W.t7^uMS441(4$4,4S4 4414 4 44t P} 4Fu,~1S薺PW豺Fv} ^F~ ^v;S4t PNu VSWh ^_[ËL$t@;S4tjh!w#x)1HËA QUSWVD$T$1ɾ4=S49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J94u (4$4uUSWV\$SκƋ 4t@PPVwu4 4h| Dž 4WU| u^_[]USWV=04|$,t$0h$W l$(4$4!ʃtWj UQP" 4u4 h{#Vŷt4VU,4Ph:w#W#u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=S49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft Pz  $FQF^_[]V=,S4tjhmw#&dt$D$tt/uKV$S4;m?u7= 3xCjhw#뵃= 3x%$S4Qhw#l&^jhw#jhw#{Vơ$S4t Py VޣP$S4Vy 5$S4蛙 ^3 S4VD$$L$ t tC8.@L$$Vh&Q #3>jhw##3xxPh$x#j VVn||P|0tB D$0Ph+x#;D$$Vh&P >t.jhw#14L$Qhx#$^ã4#3V#3x$ S41Vh@BVPRQ_4^VD$$L$ t tC8.@L$$Vh>#Q #3>jhQx##3xxPh$x#j V~V5||P|0tB D$0Phx#;D$$Vh>#P >t.jhix#14L$Qhx##^ã4#3V#3x$ S41Vh@BVPRQ&4^V|$u%t$jVt0Phx#N#^V|$u%t$jV؇t0Phx##^SWVD$L$tP04p=,S4tjhy#"VP>PR Zt V踘)X!ЃtV谕54SW? ^_[VD$L$tt\uoPe003_Pơ003t=(03t Pu VӟP003Vu 003Qhy#!^V|$uJt$ =4tVS4-44h%_V_h@^^WVD$t t0t$4l7=tDMtGhuXF 03P44Qh$5!Emtwt su!FF03F4F4F$037t V^_D$u5ԍ46Ã|$"7VD$Hs^\jh-y#7<03V)h=$&Ph3y#hJy#VA;03xu'hsy#hy#hy#hz#hCz#hwz#hz#j^^WVD$t$ʃc"y$d#'m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=@4utjhz#$FVPMy0Ph{#^_ÉPhz#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;k4~k4A9s } uE9u9t},u E&| t"3k4+|k4x"3 ^_[]WVD$Pt t*$TVaPVLD$ps D$ stopD$Tab =t"3|i1Gt$rVfD,V 4k4h#P?V G;=t"3|VݪD andD theDen t$V踪5x"3hO{#PU 0Ph$D^_à D$t t+uyL$tJQtQytWjh_{#Mà$3L$%3AAD$Ph{#!%1%3$3$3%3 $3%3 V D$t t]D$t$jh7$QVP46h{#Vft5>t 4 $ 484tP94{#L$Qh{#O ^ËD$Hsjh{#/Åu tejhD|#Ot$5P45L4hZ$jV0Ph^|##t$D$,Vh[$P >tjh,|#9 ^ãP4L4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$#'d~&s wR$$'s wU$#'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G`41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh|#1QZS`4^[ÍD$Ph{|#҃=4=P4=L4Ë 41 S4+L4t$4Ph}#h84hP 84USWVl$,H \4t&AUjQD$}ol$,7F]$8$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}#h84XO 84FVEŅ8D$EH$$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=4nAL$,9 ItIT$uWoD$,744j+o2Ph}#84VN T$jV%D$,|$?+S4t PSh GP S4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt Wg |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh`4P \4I\4^_[]É|$|$ u D$Ph|# D$Ph }#͉-\4ōD$8Ph|#uA0h}#j*h`4ËI1Ph}#j*h`4rUSWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph0~#=j UQ xt-u)%tt0Ph~#1H^_[]SWV9toӉQ{@jP ljtG\$=4t <\u ~t F <$t)\tPSo{t GFFuD$Qh}#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$`4PhJ}#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h#3rtP ~031@USWV\$(|$$1E=4uh4o?4`49<$l$D$l$ =Ԏ4t=n4t=4u03=4ubPjD$P D$tD #39PaHD$=`4t=d4tft$,SW9 4=`4u"t14@4| j=y!膨8x8#1Hpt9=`4t4[14D$ D$D$$PD$Pj 9=`4t P4t, P44^_[]øjh4UVV=Ve^]USWV\$貧0{w SV赗,jUVShW#UPѾ^_[]Vt$VHw uVh#h4B 4^USWV D$0щL$l$ |$$t$4PWU4CƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVBՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$SJB׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPBÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWzAi)$l$D$ ׋ $D$ՋD$1PPU\$S!Aыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP< e^]fSWVPP4t `k4Z1؎4WP(t>1C4$$؎4u V WSCu ^_[S=4t4 \$03=ے4r 03H 03ܒ4[V503܎4t(܎403VP503  9t `k4^Vt$503^Ã=4t4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVבي#O u݃|$0xG-Wt$8 ^_[]USWV\$8T$0t$,11|$GUSRVhي#O u݃|$0xG-Wt$8 ^_[]SWV|$(L$$\$ 1Ѝt$F#NuxF-VQR^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P腎 ƃ^_[]WV t$RVQ t|$P3GuV)^_9Hw @sÃtP=USWVPt$|$4V<$=4uԇTh=_4 v#Vt$ P]Eu `448JMp;5S4| `k4^_[]VWj .^_[]ËL$T$#PPh# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu4^_[]WVt$|$ zt!#3Ph̐#PhƐ##PPh# ^_WV|$t$ t%WVra7ft=S4 `k4 j Qu jF^_fUSWV\$l$=ȍ4u<؉%t1U舋1GWP?[PW1WPPUVd[1 jj1=S41Ƀ=H4HPVWm Åt!WP |$t8jh#'D$ tPfxD$ 0P D$ 89t VP ^_[]Vt$tP&x6eP ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQE ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u 葉D$E ʀ[} ȍ4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø ~&fL$tt"u$ S4S4HI S4I4ʋTUSWVD$T$ S454|1Gll\G9uTD^_[]SWVD$L$5S44|F|\\|N B^_[áS4~Ph54術 USWV S4; 44th!t 1G31K;)1G1I4:tl!GtˉPL  S4jQJƣ4S44~PhV !t\l^_[]USWVPL$\$As S411H$(uS41@$14<#|tZ44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$41H; t$z|#=S4|O1;Ll |C9u^_[]USWV S4~.411F1l9޻r G9u1@^_[]USWVL$T$9~1@+54A1G1֋l9߻rB9u^_[]ËT$S4!х1A9Hh&'*4=4&'t&'P 4hI''4h%'03h,&' 03h|&'$03USWV \$444|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$x%'=̍4EQ-s4C$ىË $Fw$%'#Fw}$$'X!уj WRPBBtDt L=̍4!15S4h{#P1sTu~-~$PuYQA tLу|=RP螽1 $1=447f1=n4u ÊCCs|,v, l,uȡXS4!ƒtظ:,u5S4资j W5n4QTу S45L4n9|$ V5S45S4蛅PtmƉVbG +1+5Q ic+Ɖ!уRPUV4=4H8 4H=4wA5S4kP豄 !уRPaٹ L4 S4VQRP>g 4S45S4,Pkyփr9RPٺٹ}"RPOj WRP$ #QD$ tOՉr6UPlٹ}RPVt$!j WP(  #/15S4Mj WP j W1P9;"@|4#9 4t 4# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I54Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^503~V541=4tȉt 0340AXS4^5$03'SWVQ}Nj4ع49r Ѝ4WVSdY ;4;^_[VQ!уu$x S4H9}FV!уtt^^Ð14444WV|$ =Xk4t54tZ=H`4ta=S4|<1W!уtRP虆Ws@GS4H9|vu4覍54^_USWV 3 3D$L$!ȃ 3D$ 3D$ 1H 3 3 3 3=H`4=Xk4t4$=S4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$S4H9|u $u^_[]Ã^_[]鍌^_[]T4K|$th4m=4t1=44j jh#"V΋At P@ FVC^h4SWVt$>t_w @ W@ ߅u1F FF1H,4(44404^_[h84SWVQ1u(\$|$84St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-84Vt;xH|p$x Hȅu^_SWV|$t$u;84Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=4uH 35 3!ȃt3 39 3|$|$ !@tp\$9ϋ\$(|$}^4U1tHt$ !t Q9y}1I(t(t$=|4tT$$1=4uȅt^_[]h44=|4tUWVjW7!t"j]jRPWV je^_]Ã= 4u ȍ4H44d 4Vj5<3t24jVx 1F=|4u=4u@11N^USWV(U ]1Nt$ t$tr:tm14PSi( |41 4t)1V54h4 |44ttxq @34 |4t =4tj)|4u=4t494J\$tP1ػ&!Ѓ1ojh#D$Pj@t$>SD$$PL$Qt$Tt$V>L4$u:44 04!ƒt&9L$L$|D$;(4D$,4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d84T$X/ t$3 t$ 3 \$(T$_CtN4$jjD$xP$Pt$4t$54542$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$3 V3 T$1H#E t0E t L$PL$THD$$e^_[]Ã=|4u?h4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ n4L$n4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$n4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8n4`k4t$0 t$ 0 }tEL$L$H1USWV8=44045,4(4D$$8u=L4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}44 04ȉT$!Ѓtsu!9t$ƄuY,45(4;t$T$$|@Ut$ 9D$ЉʋD$4$k4@Eh4h84}!k4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=,4(4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$44 04!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 04D$44D$$(4D$ ,4e^_[]1JЋ4$|$9ωL$}@D$ k4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=L4 USWVt$h84tH>tC\$1EjU1GGGUSxLL4G=L4-5L4t~'V, uL4`k4^_[]W+ USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)54jjSt$DPV5454s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9 tuT$|3$|$l$D$ʋ$DJ@uP@EGuLP=@ $LQEG@uu;t0 $LQXF@t@ttx $DQ@u1ʋ4$\N@uOG$DJ@t 3w_GFDY@u2BDq@tB|$h8_?VPiE1PPP 403 803H803\4t$hD$ &5003hFljD$hR#PW! \4S5[$l$VhUϏ {$D$|$!t4$US[ tVhU蔏 u?D$< t< ut$:D$D$tD$@t t tD$D$@t$D$8tD$PjD$ P9 |$tyL$Y\$a^u Y\$a8t7لt1ډـ\uB9tz|$T$QT$A"8tuӉ1ۀy$uI11T$ D$ 1ۋL$St$W 403 803H803\4$,VCY=\4/403D$=Х3P$1T4X4\41Ch#g1P1G''UDtlj<$VXSX\$4$X؃jP 4$t$ Vh#PD$9t P` hR#WWG  403=403tT4X41Cwj4''=^_[]ûD$=Х3tPձUSWV T4tA I tQPU$b1HU1P1P蔒D$1P4!T$RT$RL$ Qt$ V1L$΃ t݉!Ѓ=̍4tRVUW腐ڃ|$=؍4|$$u|Qt$T$&P&Sj^l$ŸPD$PWt$U&$t$W Ul$ L$L$ ӉWeكÅjh#1H$D$T$$^_[]VL$~4T4A1t2403t5T4X4F1I1^VL$~5T4A1tr403t5T4 X4F1I1^á\4áX4áT4t pV41@USWV׉1EUj SU@UPFSP߉D$F~ |$D$Ft$W}U@jP躾FWP褉F^_[]USWVP$ϋ-T4uV8UPWV+V 1u1$}t  tut$RƏ T4QA 1@^_[]fj}tjP^yjh!#Kx`41@SWVP|$jW5`4蛺 t&Ɗ\$y jṵt^_[ÐD$1ɉHHVt$t P 1FF^ËD$@SWV\$|$OG9}7dtƉr1ɾ9rG!GjPƋtwPV6 7] 7OAG^_[ËT$T$D$D$ s1@ËL$t$t$P 1USWVt$~|$\$1/PS E9u^_[]VL$AtpqD1H^USWVt$D$Fx~1+PVE9u^_[]ËD$WVt$ D$|$tt+19׿r#"tu u x q11@^_USWVPL$$D$(t$ D$D$d$Éljd$ L$(tL$"L$t1@ L$t$0t$0V= 1^_[]SWVp4$D$=ؤ4e Vj^Vj^hd4蝏tW1FVj^Vj^h#34t"k33=4TP L@03t%54@03PVRt Oȅu4# =4$8@hR#5t4|Iƍ|$PhWn F<$$hG&P0u$$8 E$H $5\33W/R$$h`#PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ 454PQ4D$V$8tq$ $9t $9,t$ $9t $Q$ 454PQ4utD$5t4h#x͑#|VO|$t4P |$#tX#QVN#AVN#1VN=41t4WOPWS. ^_[V1FVt$ [Vhd4 =4t&|$t4`f=33t h#?wfV$03J 03;@3у  (3Q(3jPhT4h6#+ t^hT4hhP 4x;hVh^#* t9hT4ߗh(3Q||hT4hH#Xv52354V cUSWV$$$ $Fh#PW-t܍D$PA t$4$h#hVot7 Dž"t$hh4t$ E Ɖt$ul$ U蘋9uD$ D$ tȀ uWxkto4$hē#ehw#Q$bhR#?t$t$9h3jjh#(!h$4$hԓ#h3lw 1^_[]ƃ44A4v9 t@4ˡ33;%tt$i1CS]t$qt$Ej;jVhq#WWysS ZUSWV$,D$D$=4VkKPVW* 41FVh~"5 4O Vh454{ D$ VP54* l$jU54O D$1Ƀ=d4ˆ! uϿ1hܡ4WV, h̛4輈hm WWD$VD$ T$Nj 4jU54 =d4Ӏ"\$\$4хu$4P(*t tD$HL$ uf=33tGWh#r\$D$)É;L33JSD$P$8ܿ 9th#{4D$D$ t$D$)Ƌ$0tVPW蔿 9t h#3f=33t!jO+D$ T$RPh# h4Vj* jh454. t$V!VW^_[]WVjPhT4h#% t h4hT4Hrh#n}u 444PhhP x1Ɖ54h#hWoh#VW b54hH#p^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@4Ph̛4USWV T$(\$$t$ 1`03PURSUF)ˉ<à uVh$ot$|$u u)u%u!1ɃtsQl03Ph#ot Dh#^_[]SWV \$ hSh## uPth*#| ^_[ZxEhSh^#o# 4$t t$j V6hl#뙿 hm WZS523t$S jWj}Ɖ׉U>}~*9u$h(3QlEhl#11f=33tj,)RPh@# jh454$ 1h4VWN WVKWjJ^_[]j54>W1SjJSWJVVh.#2fSY]USWV$03J 03;@3у  (3Q(3t$hVh# 1GWh~"5 4 WSJWjIhܡ4Sj, Wh454 px>jƉ׉U^{~*9u$h(3QjEhl#411f=33tjL)RPh@# jh454D 1h4VWn WV$IWjI^_[]1W54]j54MSWjHWSHVVh.#CdWj[USWVPhy#K1GWjHWjH9tDƅtZWz9uh#1Vj?HVj4H ^_[]h3WjhN$JhV#Z1SjHSVG-33j/UF)t@SQUb h3WVhN$hJ#WWVPjh=m$5 4蛰 f=33t%533>t=4Vg:PVWl 1FVhmS#54U |$VW54聱 ?nu533ha#b ^_VPjPVhs# t=(4u.5 43VoyVhy#mbh#耑P^Vt$j5 4vVtVh#+bh#>Ej?YWV5,43t)>t$=4VR9PVWW j}j{VhVh# V23t$23jh$5 4 33u33$33%33t$33t$33f=33t543t$$543f=<43v#tڞ"Pn43t$4343443t$43j43t$$43f=43v#tڞ"P^WV,|$8V54L$hڞ"W9t! $#4 $ 441GVW54 h4Wj8^_WV,t$8W54#hڞ"V#91Ʌ#G OWj548^_V1Vh{t 54Q) jWVhzt 543) ^S\$1ujP谮[ESWV|$\$1FtCWPt1^_[fUSWVl$$144l4%PhP13hݕ#t$4U1I~1L$$D$=48O>HЃ sX 4HЉ5l4jhP13hݕ#t$4U{߃ufH1K$,('T+=4뷃EFT+=jh #S6 jh#S6 h.9#S77D$QPuVT+=ho&S7h$S6zh.9#S6$_=4T+=p41@D$<$XD$4=4T+=j/S4k<$$YxD$ P1PhPjPP5T+=  l4L$ !P5T+=ha#Qrx4ؤ4|4=T+=W3*ShϦ%h4J 1@1H1HD$1@$D$~1HD$$ԟ3)t5|$L$(4hx%V5t5p4x4ؤ4|4u Vj0@Vj%@Vj@Vj@45l4hٖ#j V$ZV4$jh(3N.9#w('P_ D$tu1=4 1A111ɣ<43 433333=4t 43=x4t5l4 uW6uB=x4u5l4 u3^_[]xVh#Hh#Ahޖ#:h #j 5l4h#!hD#h#h# h #h1#jh3jj@h# jJQh3jhh]# j*QfUSWV,|$@h jQ>W^1ۅ4=x4h4 ou.j 1=|4ȍPUl4j4x3=4u?jP0 4teQ-4Uh$C4WŅ?1GVjg==4t1O,^_[]ÉVQ=|4uL$ @Vj54f 1Vh t 540" Vj=1@4jh4nfWVP=P4t 5L4t$uhޙ#ƅh#t8/u2323# P Vh23P T&1('9uQPt$ ('uڃ=l4u%hl4h[$t$ u l4%hԤ4hS=%t$ u Ԥ4=ؤ4j:hj#t$ 1Ʌuǡ4u'>/54jV>445Ф4x4ؤ4=l4u l4%Ԥ4Y1ɉ ؤ44t=4u4t =p4lj:h~$t$) 1Ʌ 4=x4u64t=ؤ4tP54~/1x45Ф4j:hp&t$ t 33j:hY&t$ t 43j:h^#t$ t 23j:h$t$a t 23j:h%t$@ t 33j:hs#t$ t 33j:h#t$ t 33j:hu#t$ t 33j:h%t$ t <43j:h%t$ t <43j:h"t$z t |43j:h~$t$Y t 43j:hQ#t$8 t|4j:hw$t$ t 43=4u 423=4u 423ܤ4tPh#,4tPhK"4tPh9&4tPh;%h4h#t$ u 4h4hS#t$ u 4h4hP#t$ u 4 545L4P4t%j,VtA1ɉ54 L4^_Vhm# Vh#h#jttu$Vh#{^h9#h#e^jJfSWV t$ |$6qkT4 X4G\4mI`4s8h#P+d4VW8=|41h4S 44%4%4%4fС4 ܡ44fΡ4ȡ4h4jS  h49h4,h4hMu j06O#9d4tC#Ph$Q 4 x |AEjj54 xPj54ܠ h,#ju h#j1h#VW vtHЃ rt+vhʚ#]\h4ō HЉl4봡ԟ3)ǃG<13DHu0W'=r$hhݚ#`hV#jHSGhWhp4? ?t GG?up4p45l4h#j VNu Wj4Wj4Wju4Wjj4Vtuhޖ#h#jh(3h #23t t4 h.9#=x4t523u,u5=x4523{523h#jPh"# WV4ƿ3Ph#WQ Vhϛ#WQ j+F=$4th$4htjq j4SWV543t>u+t$4t P Vƣ443h.9#V'tsd4h$V'tah#V'tShg%Vm'teho&V['t13Vh#WP Wd4$11ɺ230 ߈4Bu^_[ñ1WV,|$8V54WVJWV萩#NF=|4t L$f=43t D$#$d$d$ wfD$ f=<43t $Vj548^_h4jj SVPf=33tj謍t$R 330utztD$=d4„u330u1f=3333몈D$< t< u>jV54z f=43t|$ 7U#t#P{`u 2 <33tu 33tt A8u1f=33t 3DAt 3DAD$jV54 f=43D$PK/h4jjs USWVt$D$ $1=(4hג j 0D$1CSj/h4SW& Vh$hKh,4`tWD$ h4jj t$j/Uj/=(4uD$ 1;$ȃ^_[]Ët$$4$ԥ3H ԥ3~Х3H Х3hХ3'#eȋL$ < U;t$ KD$ V1FVj.5(4h7U#yVh,4 `SWVP33\$ x03t%\4039u Gt+t' u9tpD$jP54 Yـƀ_r`4^?t@آa4b4 `4a4h`4h$IPW1^_[Pԥ3H ԥ3~Х3H Х3$Х3!t1Ƀ=d4!YXD$_r`4^?<t@ a4b4 `4a4`4SWVT$L$D$=d4ut1<1h41F9uRQPI y 08th%^_[h#USL$ \$1B1t 9tA8u[VL$`4tSA ^#8t6u(^@\VPt`4)ƃuf^?݈@`4^VD$Phi#H=x03x03\4Ft33_r`4^?<t@ a4b4 `4a4h`4hn#G_r`4^?<t@ a4b4 `4a4F t*vPh`4hr#@G\4~ v 7^ÐWV1F4VW54联 VW54豕 ^_USWVt$jV54菕  uD$41؍oD<jV54f D$< t r֍,f=33t4t P u33D$y1D$h &PgI4tD$y33D$nD$jP54蓓^_[]1f=2323USWV1GWj`*WjU* VWF*Vj;*4fC4CfC 1l$jjSk ~}D$tvjh454+ ~]4Bt8StGWuG1GW4U54蹒 WUl$54 1f=2323D$hU54諓 jHƉ,<=d4  A9rWD$Pj$ f=334tyf=23~g|$_r5,33Pt. 4YSQ;Y~ڃ tZG9r QRIl$!y-R+8u!PWjl$UVbGEh@Gjf=33t4t Pj:fSWV23t323^tP[tF tFFu҉5 43h#hWAhR#WUFtRVhW@O t4=h4tWh#Cj WtWV%%33^_[USWV|$hn%Wj Wj=WHt@C@uShg%Wu S6ÉXj?Wt0tO@t8JS+?!tOYt@t tWh#A~5=23t,23Ft = @t Bt~vuك=4~h7U#p4^_[]SWV΋4C!w\C4؋ 03Q03; @3h(3j F4 (3Q(3 X4#|>Wiأ4NI$ )'Wh#@4@4N Q1f~ @403H 03t;@3lh(3j!1Fl4v Wh(#f@ `Wh#V@4@4N tEPP4V(3H (3!6h$@4#|4h7U#o^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhg%SuW 1@W̆ljR1^_[SWV231t8ϻ23WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$,)'n tWUTtjPu UK WF tQfB t th0#m*N 1?!9~ t~ N 9tF N^_[]h?#fSWV,1f=33t h@#=|$WhY#[?+t%th#>?|$ D4$ $ 4hW5 uW$ 4hW#9ō$UhPT tʼn-t4=h44hPU! x4u%t#P5t4h#h|4Pu5t4h#p4uG=4typ4Ħ4=Ħ4tVĦ4hh4Qp4u7J$ p4z$u+hh4Pu,p405t4h#Z:u5t4h?#E=l4hj$$ t 4u$ th#h4Pu$ thޠ##4=$ D4h45t4hF#1p4tpp 0h_#1 h4uG4#tt##4ơ#@t#QPh#-1 4tPhӡ#1h4uu+ l40Au*h# l4 # l4#9#hh4u Vh!##4=u#5x4u5t4h?#5}5x4Uu5t4h^# 4tP-u54hw#jN' l4Au$ th*#=@u544$ th#h#h"h00USWVt[ׅtf΋*'t#*'tVPt%]uWVhd#: j&l4^_[]hF#h;#hhS#h;#hhf#PPPh#h31l4t@t hh4Ѓj&D$t@0h#7:1h#h#hhf#hD$t@0h#:1h#hܢ#hhf#2D$t@0h#91h#h#hhf#USWVh#91Q{&,*'Qh%h30*'t*tu6h3jjh!#h3jjh)#h3jjh/#H7#t,#FKrh3j ;^_[]USWV39u1Ht$Vhht@P V$PPftхu! $h#8*'tc D$Q{&*'0tBVWؽ ;$ݸ7#D$VPh%h3j/D$,#uh3hmS#^_[]fL$t11f3QBuh<#h-#jTh#( WVD$ tRt$tX|$t3fPhT#3,fPhw#,f1@^_h#hI#j` h<#hI#jah# USWV @$ @F~  ߃| RQhI#%19ս|*Ձ tRQh#6 1 @^_[]û l$ WWSUP=9tmv h#0$ =Ut%tv h#*hjUZ 1$ PPQ~É11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPT$ L$D$19عPh#(5ch Pv tOPSQh#46$!u$!$!j?PQ脌 t$h(#4Q+PQhy#$ "u!$ "$ "hPQ5 t|hU#$ QRPh#]h#h#h8Bh#h#h91h#h#h: h#h#h;h2#h#h<h#R $$j@P$!P Pt$$"P$$ Ѷxl$$ $8v+)t)+8uHJRQP4 t hO#Í$  tL$(SUP~ l$ 1rh$ USC |4ōPUS < ߁WjP  N1\$ PPh; tB=NýjPU  9/8t %8ux8u2N1 T$ PPS 9ǃu8 8u<\$Shmdv t*hs#蛣#Wv h#v h#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSPy9u!D$=жxt9wwF̓uv h#蹢 v h۪#0ST$1uD1Gu<jUPSv5y9tu&v h#h#01^_[]hPv h#0h#hͪ#h h#hͪ#hh#hͪ#hh#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUP s DD$st$s 8D$ s <D$tf4$l$4U +'8t_uh#r/h%h$h3& +'ha'#h3n& uh3j 1$+'D$l$4$sf@8tD4$t$xVA@SPSVA \$$Vt$SJK1D$0D$,D$(D$$d$sD$4j@HP st$st$h#"t$h #"t$h#"t$ h$#"t$th/#"L$9$+'t uQh;# +'hG#z"|$4tD$4PhS#a"|$ gvVD$PU 16D$8uT$Bg)QPRE th#-1@^_[]USWVӉ͋t$V藮 1Htkt$t$VSUutGU5qt$t$VWUu9uVSWÄ t'W迾  W詾 1H^_[]W蘾 USWV$$$|G8-t ԟ3$D$ 1FD$hM#WS袩 it 1P+'539t9At&9IuJuiu3$tHPh$ AtPqhe#, 늡T+=A뀃Dtou&t$ mt$dT+=$W$uQ 1t$hWV jSVy $FWPP诫 uhpG&VhiP u h#jΠWoT$P+'53l$D$G_HrY7ShjD$*P  ft$fD$CL$fA37S_ghjD$&P ft$fD$f\$ $T$0 T$T7hjR SiZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$P \$ $ sh=#rsh^#bs h#Rsh#Bsh#2sh#"s h#s$h #s(hD#sHh]#s,h#s0h#s4h±#s8hܱ#sXf|$rL$I#fw h+'L$T$ t$"VRQPh#h%#h#j7D$f=73173hjD$$P fD$|$<73fD$ $T$73h$%H$<+'L$f|$#t޲#PD$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPhײ#gE9rh$)D$@gj .|$G4Ŭ73>~|$ujjPPW jt$t$ V VhiW: u h#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSW jl$UW* wh>#h(3Wh:it$VZ uO j.h(3j?YWh:iV u Cw8)|$##PmG$rkLPD$$PQ $<1|$VhK#t$kL4t4X+'h#h#48~1D=PG9uh$F4 D$4!4"4#4$4%PSWRQt$h#]4(h#I444,40k<SWPRQPh#4`hb#h#4\t h#t h#h$E4d6|$1A t$t&u/7t$t nu Qh#nFL9Mt$ $t$qV4fP$t$RVfh}1#Ph #h3 j) USWV։1hUS[ jWS sUPP< t'Sh9iP6 tVeĔ^_[]hpG&h#jJUSWV׉1hVU jSU }VPP轠 tAUh:iP uGPh#01FSdĐ^_[]hpG&j踕VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phײ#^WVh#pf>r1D~Phz&UGH9|j]b^_WVh#.f>r91D>Ph:# 9} j:G9|h$^_WV$fGjRW WhiV< t Đ^_hȴ#j_fUSWVu }61h#jI h#VW Hw$+'44ԃBu|1PP5T+= 4불444444너44sjh(3胢_4S3=ԟ3=4u.1L$A AAAQj jb =444444ޥ31O=t4$3tch{#Vt^=4ukjjV` ƅD$ PVVD$(!=<\$yB  ޥ3u1PPVS` Ɖx\$463=t454PL$Q_ ƅ~E14VPSf^ i)u5454t$_ ƿy54h$΍ 4ޥ31O=\$t$9ȉQh`L$54u ύD$ PS54r*V؜ 4Vhb#44444V_3h$ 43V_3hK# ˋ$B6549>Ph#h3 1@4$;Х3t=h{#WSt1(#=4uR#PW";? \$Х3\$=4 1$ӋFHN~ HVƒ =4u u u1G1=4up=4u< u7 =4>h#hF#h(3 43@t>$@$PhA#h(3ڃ 43@ t_  =403H 03;@3h(3j$i  =4x03H 03;@3h(3j^:=4,03H 03;@3h(3jMڃ(3H (3$(3H (3^03H 03!;@3h(3jIY (3H (3I (3H (3M03H 03%;@3h(3j-ڃu!(3H (3-3DPuW03H 03;@3~ƒ t(3H (3h(3Rڃ03H 03";@3h(3j^Jڃuv(3H (3^?tЃ@Ӌ 03Q03; @3~ ȃ t (3Q(3Vh(3P=F @t54h$" 4f 43@uiХ3\$t V(Х3%ܥ3Wh$ۇ 41;`h(3u 4e^_[]h"jFh$fUSWV$$0}(h#j& 11E1D$D$D$D$$׉jh 83h{#$VІQ~Hw@$+'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jT+=$ىY1ɉPXuG ԟ3$T:-u"j9uzuI ԟ3 u ԟ3)t u <$u|$uM1ۋD$Ã<$D$ 0tD$ /$4u9>W )uTWh#D$u5t뢍D$PWju!Wh۵#Mh#j$1 |$ $jSVJ u hb&PT1uj8VK1CHHf wy$(,'|$uhUSÅu뼋ss PVhW#A |$u.jSU_ ss 蹾 PVhW#  1F $tCPpQo&|$t KP;AmPsT$Z|$Osh$^1F7h,b&jPPh#h3 j7fUSWV$$6%1h#U轺 -4- 4-$4-(41ChZ#VW; e'H wu$\,'(4- 4-$4Ńo'fil<4뙃prvD4oa 4044%$4- 4-(47 4-$4-(4,4 44484048444@4u ԟ3)ǃ=@44u-tX1Ƀ=(4=$4tL$H=(4=$4= 4= 4tʉT$4SH4jǗL4P蹗t$lVUhH83m 9rUh#\hH83H83 @83QT$/u>t$|9A@83A @83I83vy/thg#h#j軄t$ D83Dh jm= 4u$PhH83/f$PhH83fu@8uT\=@4u=4t@$4 (4t3D$ P6e1#$=@txUhH83D$ P6"fu6h$j #D$=@u4 @41ۉ  t1ۀ|$/uhH83h#.t9UJr|/u (IHr IH9/touɉt$PP4USWVT$juQD P9ND$1t$CHfw?$,'ss = PVt$ hW#  Psh#x >|$(5D83C,H83)=|5TShH83h%#<  t$VM1Ga{DuO|$u C(D$?Cj/D$ PUt L$)@L$D$h8c#QT$CS(L$)ʀ</t ~/t/FD$щT$H83)rPhH83hG#t$PV~ L$@83@83=I83vx/u H@83= 4tD$PhH83cD$PhH83bT$KP3Qt$31 u@T$(3Qt$$3q u.shH83hh#  CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH83h#f  1Gt$#KPqt$1BD$ $,'=4L$ QP T$ 4 @4sHtbffM T4QT4T$ T4t$/D$ !=@8fush·#x jSt$ V8W 1G)=4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=04t$tjQ\T4H T4/uD$PVQ#X$hSWJ~ Wo{t?$ VPh%hWD$PWQѹ#t VQWu8=p5u WV?>\5 PWQVQ>tW#1ۀ=t5$u5VPWh#h3jj h#裠9D$t$QVP肧 Ƅ fDŽ$.$$PQO\$4$9|$ t#t$WP/$ D$Ƅ fDŽ$.$PQN$3$$3$ $3$$3$  WVhݹ#n fD$L$TTPQËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQPR^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP;^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87h#j菜 jt7D$Phht@j uD$tL<3555zu 5t$41۽h#WVp HσG$,'51515555155555낃wȻ5̻5^Ի5Oܻ5@51x5"55@155555555 5=5t 55Ȼ5̻51V5GĻ5Ȼ51C+515555551551@л5515555ػ5551M55rx5c55J15554515555ԟ3D$=5u=5u =5thzd#}tP-L<3=5u 55 5L$$ ȉD$5 55 x5L$D$ ы5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uhĻ5jxKĻ5 Ļ5=5x5tL$t*t,uw] kL$t;t=u^ R K =5u==5 t/ (| !z =5u=5 tF 5)θ =5u/ =5u!3 =5u=5 tN 5t1AT<3U4|5 ^_[]Ph#h3 jEUSWV΋\$=5 t1PSR@% ~jP;1ɉ=5tWP- L݉t$=5D$Wp.ÉL$ CHHf$.'ks l PUhW# |5{Dt{T.u =5tw=Ի5uL=5u%shE#1TSh#dL|$|shF#5VW:ʼnى=5ut jSW9 Wm-Å0W,08u ^_[]jh,b&j'bWVD$ qH1ftYT$zHftIf t$f tf9t=5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$d5D$ 5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P PSl$$hW#Ot$X 1@F F|5Z|$dt~T.u-=5t"fu=5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=5t-T$$L$(=л5t-shj&j $W$D$\l$t$0KjsDžt=л5tshj&j $UUjs&Ņtщ|$W‹L$@D$9ʉT$@l$ UҴʼnD$<9L$<=ػ5t/h{#sl7 D$TP蚴T$ 9щL$ 1|$Pi  à t$P Ct$ P=ػ5t +Cl$TUP`Uy ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=Ȼ5tD$|t$ |$ nĻ5ʃQPRW#$RPh"jVrV)D$|=̻5t$ |$ tHVUUUȉD$|$D$<$$SWhd$VUUŲ$t$hj&VUU袲$=Ȼ5tDŽ$Mt$4t$ 03J 03;@3~у t (3Q(3Guh(3Q=5tXD>03J 03;@3~!у t (3Q(3Gu7h(3Q@L$D$ ρÃ5T$95}`;L$}XD>03J 03;@3~!у t (3Q(3Guh(3Q03H 03;@3h(3j (3H (3 1D>03J 03;@3~!у t (3Q(3Guh(3Q03H 03;@3h(3j (3H (3 e^_[]SWV΃=ܻ5t vrh%c1TVO^_[SWV΃=ܻ5t vh%1TV^_[Ã=ܻ5tATPqh% ÃTQh$pÍ` f w5$4.'03H 03;@3h(3j@I/03H 03;@3h(3j*03H 03;@3h(3j=k03H 03;@3h(3j%D03H 03w;@3oh(3j|!03H 03g;@3_h(3j/1@á(3H (3@(3H (3=֡(3H (3%á(3H (3|밡(3H (3/1á(3H (3*USWVl$(}=5tE G=5t=Ȼ5t(DG51 5Í4^69L<3} ^_[]{E ;\<3~*P55e tM \<3554FMt%$Q  Qt $ B$Iu$ L<3șƉșD$$t$D$ D$|$1ۋt$=Ȼ5t( 5 U tt$ ;4$}Z;D$}El$)š03H 03;@3h(3j (3H (3 MuC;\$r03H 03~(3H (3 h(3j D$@D$;D$ ^_[]jILUSWVt$~=5tF G=5t=Ȼ5t(G51 5Í,C L<3-9} ^_[][Gșljș|$$.1E  E;|$|603H 03~(3H (3 h(3j 1V =Ȼ5t(41;$}D$)á03H 03;@3h(3j 3(3H (3 KuGm=03H 03~(3H (3 h(3j ^_[]USWV|$=5t_ C1ۃ=5t=Ȼ5t(C=571F  F03H 03;@3h(3j,D(3H (3, +N,03P03; L<3} 0;@3(h(3j ;~&(3H (3 "(3H (3 h(3j 1W =Ȼ5t(4_ŋv03H 03~(3H (3 h(3j S^_[]fSWV|$5Wt pSP V t81PWV Vh$7VWf ^_[hѻ#Wh#jIUSWV$UZ4(F$$1 |$1 9$)덄$PSUD$PPx tXǃt-tat$z ?tL$T$d$.?T$O$E1 $ ;<3r9vL$?T$$$^_[]SWV ΉRQSw 1t4u t|uHth(3PjSq{t Vz lj ^_[fUSWV$$31h#Wm{ WZ%$ D$D$ hx%SVO mu05T+=tChP$WJd 뼃pu D$ 뭃u ԟ3,uk5T+=h#jG#D$=@u.$VtPCS 9r*th #jD|WPb ty/t AƄ/@L$M$D$S]|/uH9tx/@tj/S覉ޅt@V$L$rSh #1A $'@PVt$ M ٍ$Ct1@$Mg4$蔺/PPh+#h3jt 5USWV։π=5ujV)Zt~VW[t9?8uR\$@SV%t{SW%9Wh$1ۀ=5VWh" VWh##? w=5u=jWYuWh-#H#D$H=@VW=5/jVIYD$@PVs$jW YuD$1Pt$LD$2x #t%D$1Pt$\1Pt$`CVPSt$D$BPh7#h3E#D$H=u}1PPWs t$HhVW \$D$$5(5VCVhS#@>1C؍e^_[]ÉVhr#h3 ԥ3H ԥ3~Х3H Х3hХ3!ÃtH tC ԥ3I ԥ3~Х3PХ3hХ3 ԥ3 tuÃ߉1ۃYM@Vh$o='$$5SL (5t$|$SPt$  Å11S5(5t$`  9x߉= 5t{\$(t$,l$( &$$L$$D$ l$ |$T$ fT$l$\$l$T$ 5RQPVSt$(t$(h#h3$5$55(5t$  Å6|$W\$S<t$uVh#(<SD$hL$l$JD$pBD$tB D$xBD$|BRW5tVhn#;t$\t$\WR ҥ8tVh|#;#D$HD$Ht$\$ \$D$t$Ph$j;VtVhc#O;t$S 1V*;5$5t$ t$ЋD$HPWtVh#:$Wt8-t$Vh#: W tV|$Wt Whc#H1ۀ=5DVt$SWVP׉TjWP t$t-h#h׼#h#h˼##:1@^_[%tPh#h#L BTjWPA t$th#h#%tPh#1돸#=5uƼ##jWVh(&Ph"S蟻Sh$q9j7#jVh(&h'#h"WjWUSWV8`<3t P `<31054585<5@55@3it$L$`.'hjV  `<3ݢVhr#0jG`<3hhVY  `<3<5hjV(  `<3cVh#0jͳD5u<31`<3D5d<31t~H5ttja`<3D5l<31@5`<3D5l<31@DۡVh#0jE`<3tH5tj`<3 h6tQ`<3hL5P}xCT5%= ts=`=@5D5hٽ#j許 !5D5hǽ#0j膲5`<3 `<3<51HPhm8@5`<3  1ɅA @5-555<5ˋ @3ug6g6<3v$t.'=g6=g6>1jSS5`<3诂!ƒu08f@5-555 a1H @3@3=5Gt =}r t~=g6g6q˃u#=g6tPWUVȼ ~jWUV讼 tw߿(=g6u g6~~=<3|<318^_[]111RSWV։ωSN9<3D$t,t\$W38N4$Mt$Actjt$ Nq#1@jt$MP#1PWM4$t$jSVV6x^_[h2# hA#hT#j7VP=`<3x=h6 i6t}=@5ut= i6tDh6HQP~'Q &514585$Pj 5@i6h #5h6 5h66o=<5uKhL55`<3yu4#T5=u"5 5u5D5I<5=@3w=h6t<3~ jP5`<3<3~jQP h6 i6t4=@5u+5h6h5#% i65h6Vn`<3=45u 85tP14585h6t<3 h6 i6t'= i6tGh6HQP~Q 5Pj 耺 i6h6tZ5@i6h:#ʍuC5h6 g6g6 u g6g6jhQP諊RPh?#V1V5h6Jm55^USWV=@3(3t3D$W^1O+ؼ5 ܼ5 u1@1ɉ$L$=h6@3\$5g65g6hc#hSM<$t$W5g65g6ɉ$h~#RPWhn#hV$VSh#hW}W蠊PW}tf=5t]t$5`55\5hc#hV觱$Vh5h#hW臱W>PWjB @3u_55<$t$WjV$h$RPWhn#hS-$S]Vh(#hPh6D$=<3O5D$ c#D$5g65g6VSPɰ$5g65g6VSP諰g6 g6 g6g64$t$VPQ$h~#RPVhn#hS`$S]$QL$Qt$Wt$$h9#hP,$t$V؈PVj "$PW5@i6hW#t$e^_[]V~=@5u(=|<3~h~V5`<3 |<3~^Vȼ51=@5uE1jVV5`<3zxRP5`<3赅 yhL#0jd 1N^Ã=@5uhl#jI&1=05u5@i65g6h#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|<3=@5t$t$5`<3| ƃu*~345;5g6tc5g6tU05L~ 45?5|<3x5<3h#j, 1裖5<3hܾ#0j^_USWVP5|<3|$l$1ۡ`<3$WUt$ ƅ~)tދD$9uȼ545!|<3@5Hs-8 uc1h#Vh5|<3:~\%tS1jPP5`<3'xx})RP5`<3N yPb萕8tD膕8t:|8t0Ty:l8t b8u |<31L8Eu |<3xt ȼ5145=ȼ5uhH#j腥`tx>h6Ht)t hֿ#5<3h#jL 1%h#j躔5<3h}#0j^_[]USWV1N=̼5=|<3 @3uh#j٤45<u85-@5sg4551jWW5`<3vxXͽuWURPU)jWU5`<3KvyQu t#45@45=|<3:h7#Ff@Phm5`<3u x|<3hg#j1^_[]USWV \$$|$ l$(1uu5|<3@51jVV5`<3qux\D$ljT$Ӄ=@5D$559L$ujRP5`<3%ux+D$T$EU,=@5u#萒h#0j |<31N ^_[]USWV~=|<3$(~$$~@5t)h#j蔢I1u)1ɍ|$h~W5`<3_ 0|$fGWhm5`<3t fD$D$Whm5`<3s \$h~S5`<3 $h~S5`<3 GfD$D$Whm5`<3ws |<3t1<$uzfD$D$Whm5`<38s f $ g611F$$~jQUR,ы$ʉD$ ʋ$$~) hm#b1F|?1jPP5`<3rxg)y11=<3|!h'#11Fs1o+h#RjRP5`<3r1yKhL#.hj#"h#h# ׏h#0jB 1N5|<3~^_[]fD$D$ D$Shm5`<3q y肏t$h#rt$h#0j٠SWV VhDi6j y7h#0j袠 jVj y h#0jv 1N=̼5ȼ5=Լ5=i6u5@i6h#趟=D5hl<3W胀hd<3Wmo @5aX*#tu# <3P#t#QWPA S8 @3#tmS#P5@i6h#h #h3#h[#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5D55D5h#sWh#T5@i6h#Ah #4h3#'h[#<=i6th#j{5<3h #5@i6h(#ҝhO#ŝ|$h Wf|$.|$t+D$5..L$f tW|= r@h# h_#h{#Y5@i6h(#FhO#9sWy\Wh#̼5|<35@i6h~# i6 ^_[h#Мм5t PA Wq/м5t D51̼5|<3h#j|5@3mtt$11Hfhh5譃th5L{51h#0j臜 1Ht$h#0jX 1HVt$V}:uVh#0j*^\SWV|$$Wƃu[1~tHNtt 9 tu/VPW[t#D$=@t .1N|^_[USWV1Fh6PH{h6P kjƉ+㡔5Hw> h6SPh5Q@ 5$ 5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5P%yPh55P+ h(3WVh5M<43@ub55 5 5QP.t h6P(jhDi6j xsZ1e^_[]jh#0jՙ USWV (=3x&,=3kL<39|׋yM1II151PQÅy19}WDu=@3h-#j.hh5OÅy1ۉ9|(=3x(,=3kLSh5<3y݅u=@3teh-#j迗51E$sVh55P* )؍51EhR#ji1IkFL<3h6Sh5#1ɉ^_[]USWV D$h6xGD$5$1F15SQ291Ch6h5h5P$ h6Qu*D$PUh5Q8 5tu=@3h#j耖t$h5h5( $W1CttUtB:x9u=@3tFh#j,Wh5Q19uhj#j1H ^_[]h#th5Q<t 51h#USWV1Ch6PHh6P yjƉ׃=$h6t/5@3%tɄh#0j4 e=h6t Rrx7t$t4h6P(jhDi6j  lzbV1ۉ؍e^_[]Ít$\$D$5Hw5 h6VPh5Q@ 5D$ 5L$ h5kWeh5duy=h6tSh5\t^h6 i6tSh5=h5Ujh5Xt@h5Em55 5 5QP=5/u+?<u"5P7sPh55P& i6 i6tSh5x h6tph6|NPWt$h5)6Q=h6i6D$L;85D$P<5Ph58 i65t@t=4i6u Pl=@3t15Hr@tZ tUh5l'9D$X;D5D$\H5?uD$Ph5$Ã|$=4i6ut$h5Åh6VSh5P@ =4i6uSh5/!؃=h6\$C= i66D$h6HQPQ i6=i6D$L;85D$P<555 5 5QPDy h5j=h6\$^= i6Qh6HQPQ D$L;85D$P<5D$X;D5D$\H5OPj 蔞 i6D$u5D$ 5L$ QPp5x5@35h6}Q55 5 5QPh5ji\$=D$L;85D$P<5Pj ̝ i6USWVj/h5]1Uh5tt>55h5Up /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=h601F h6t9t71h#jێmQHbh6P R=h6t i<h6x t `m#h6 i6t#5@i6h #5h6I  i6ujh5^t(55 5 5QPu1=h6th5hxuth5lyh6P(ljgSW, xah6 i6t&= i6t5h6h5#2 i61G*ƃuejhDi6j ^_[USWV $h6xu d?*1Fh6P,h6@0D$ jD$T$=h6jSh59]jh5Q$=h6th5~gh5+th52d5 w's1PP55^ $jh5Pƀ=5/u+4u"5PkPh55PV =0i6t4$h5Z' h6t:h6|Pt$t$h5s.Ph50 i65h5T$t8=h6= i6h6HQP~dQ ch6L$Qt$5SPD ƉPS?&=h6tc= i6tZh6HQP~3Q 2Pj 袘 i6Ph5%dPj { i6D$L$ʃ|QP  55ʃ|QPxnh5*1C@TPh5Z%~y55h#0jh58ch5)t h6P4 jhDi6j =h6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=h6t cxIxh6PHx11@USWV $$h 58i6S  = u$ /,4ŏ4/t EƄ4/FED$P58i60#D$=@`1Gxv%xmlxd=h6t exRh5!(ttjhDi6j= Gm'158i6h:#j 1GĐ ^_[]mw58i6hX#0j҈58i6h#뻸 )D$ )D$$h5 Xh6 i6tV1=5/5t$PU ;D$vh5h#jN _D$PSQE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơi6 i6tD$Ph5I=h6t5h6h5+ i65=h6tEh5C=h6i6D$D;85D$H<5h5{5Ht 1PP55  $jh5#Pt$h5 Wh5D$P;D5D$TH57wD$ Ph5;i6tk=i6tbD$D;85D$H<5Nh5h5^^D$D;85D$H<5D$P;D5D$TH50t55h#0j蕅P5WWWh5!Ph5=h6e= i6Xh6HQP~ Q Pj  i6 D$D;85D$H<5Ufg65g6u h6@g6=~| h~Ph}#thPh#j蜃1Hãg6<35D5y x1g6g6 g6g6ʉg6 g6g65=@3u=g6t4=~| h~Ph#thPh #j1H5D5 y xᡠg6g6g6g61g6g6g65~<3g6USWV=h6th;#j艂1I^_[]Ã=g6g6<3ug61IxՋ=g6+=g6|$\$5<3UVSW)9|11UV$)݃g6|Jg6 <3g6~H5g6Pg6g6;g6r֋ g6 <3g6g61)ȉQPx[g6Ɖ5g6 <3ȣg6)=g6g6 g61g6g6@31hl#jWV1N=<3=@3uh#jy1g6g65<35g6Z1<3~9} G{u'Ph#j~ xI1=g6=g65<35g6~ g6 g6g6g6 g61^_ËD$L$g6)ʉg6QPRB USWVu ]1D$ D$ D$g6 g6)ȉ9؉| g6)։ g6QPVSt)ЍT$RPQ 1ID$L$ )g6 g6|~ g6g6)ЅqxUtX g6g6D$9ؿ|‰g6)ظ|D$L$ 1H1@D$D$e^_[]V1=g65<35g6~# g6 g6g6 g6g6V1xC=h6t/x&5g65g65<35g6~g61 h61H^Vg6;g6v*5g6)QjPi 5g65<3^USWVt$g6 g6ƒ|]; g6g6}O1h.#W}=g6=g6$-g6<3 ( g69)1 -g61ۡ<31PUK;<3tS1g6g6Sg6 <3g69)QP륉g6 g6Nj-g6S5g6U? +g6<3)USg6g6g6 )VQSj? g6h6Htth61O1^_[]É-g6USWVP\$1~cl$g6$5g6<$)"5<33x3ǡg6$5g69|WUV> 5g6)11H^_[]USWVPD$~Z\$ g6 $5g6ŋ<$)Dž~9g6$5g69|WVS^> 5g6)D$^_[]ËD$)USWV\$ l$؃|~g6D$=g6t$)#5<34x\ơg6D$=g619|VQWD$ f =g6)Éظ|$1H$$^_[]USWV$  $x$|$D$|= i6t7P$/u/1N=g6MWh`#js g6.|$tjh W V $=g6g6_Sh#VPJz$ƅE<$8$S x<Sh#P$y$Ϝywb0=$i6t5h6-4$h#Vjs15g6$* $1bQh#0js1N^_[É^USWV|$?/tGj/PF-ƳUW[u/Fj/V-ƅuhW=,i6t$$W jW;y3UWu%D$ PW)jUPWV/Fj/V,1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pcyu~`Wh#0j r$tDP螚yr`$h #0jq$9 1$g6^_USWVD$Et$$^߅tPy`Wh#0jpq=,i6t<$8$W 1 (i6tt)$($u7=g6ujh g6PZ g6g6!UW@3 @3t%1PPL$H$X$T$W$tJSW;y!_SWh#0jpW&$ 1$g6^_[]WV\n1uA|$ t$t$Wt t(5h6r0^Wh#0jp1N^_Vt$#D$ PVKt%5h6)0a^Vh#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=@3t =@3D$PV}t]VhE#0jKo_=@3u&D$DL$HL$$Mbl$L‰T$=@3u'D$PL$TL$D$ Mbl$X‰T$WVU t6Y]8Nu} u&WVu:]Vha#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVLt%#D$=@uVh3#jm 1HjW |^_[USWV׉L$]D$PSt6St$th6\0wwS tՃ} tL1@_1=h6uTG3D$ 3L$ uKG3D$O 3L$ u9t$hd#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%h%StMtS0S蔕} DZ[Sh#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=h6t1A$$3L$ $3$ u*0$3L$,$3T$ uVhb#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $.'5@i6h#Kuu=i6tlD$PUuZD$ !=uHhWU* ƄD$PWKuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU-Ut$ 4$U1YL$ t uu$UFD$y)Q8=$i6us<$8$U xZL$ A$Xt$Uh#0j3j1H=,i6t2<$8$U Uh#Wji1ɡ(i6tt1Ƀ$ !($t($t$$5@i6h:#IjUxN1=(i6=@3=@3Uh#Uh#j7h 1OD$PU4x=1$ ?#D$ PU1@=(i6u;L$ ($/[Wt$h#0jh$ PU1@Pt$6UK@31 @3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWK1x1K=h6t މ|^_[]ø#D$=@u5h%W_H1EtXWyĉ*#$t Woy5h6' #0VWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5i6i6 i6i6L$T$tI AQP DUVP 9t_L$ xZjPUQ7ҋT$0y@oEP Džt<$\$MQVP D$8+$T$0)+|$$>h#jJe*Tt$8h#Tt$8h#0jf1O ^_[]SWV1|$tQ\$1OjWWS6xjhg6S萺 y%##\$DTSV0je^_[Vt$ xFPͼ=h6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(  ~H111Ã1T |A9uV$P$(պ ǀ$1111틴$(3x$3|$ uUP$(/xLX$3D$8T$3L$4 uF1VVV$(_5xE$($\h#Rhǽ#.h)#j%c #R$(hJ#0jc1N|(^_[]V=i6tg6=i6tg6=i6t@g6=g6uh g6t01x&=h6tDyh#jhb1N^WV h6tP 1 h6h61Ng6t h6tqAh6uj1ԥ3H ԥ3~Х3H Х3hХ3BtN;4=3u1tB g69G= |+h6xxg6 PW1t-g68j5g6hg6 h6&1^_SWV|$tR?tMj , tSƋ\$W@H~ </u>ۉ^F=g6t%g6p!h#j`1Hh#5g65g61^_[áh6t@=h6th6= i6u0=h6t'D$$uh6tjP5 h6 WV=h6tB5g6t;11G~u)uh#jA`6h$h3k vu^_USWV =h6u%h61N h6u h6}$ $ $L$Pȳh6t#HHf w=$.'ph##"phK#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p͵ mN h6qh#0 phi#p j_e=h6t\@PL$QL$ Qpp p09Bx8h6jjt$t$t$t$ph#p j[_ h61N1 $.'LJ$Ƅ  LJ$LJ$=h6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G h6 VqP  h6VqPi 5@i6h:#>1uh6@e^_[]fUSWVT\$tl$h=h6P($T$L$X$1V8$ 9V<$l:##t4$tVjQjRD$Ph#SVg $u2@$%  RPh#Uh$^|$x$h#SfEPD$Ph%Sf$Hs Uh#u# Uh"Sf SX^_[]Sj qUSWV@L$E\$CD$PS{3j9I#|?#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($8WVSh#t[d^_[SWVt$F=u1H|$P\&t6t)G\$QjPSjVSPGu܃^_[Ã^_[4USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]Vh6~1F1uh6h#j9W^ÐSWVL$D$t$|$T+=h6th6tt\^_[}\1KZh6teSPti:tdx:ԟ39}j T+=@ԟ3sPVWk hVh6:-u/h6Èh6nh6h6`S6hU#ԟ3=S6hl#h3a?^_[f1Ã=h6u1áh60h#jV h6t"H h6p0h@#h3`5@i6h#(7u_sUSWVd|$|j/7#@i6t@l$x@i6h#PU@i6#1Ch6i6D$ D$1D$$jh=3h#WUHЃJw$T/';t$$@$.'T+=H5묡@3t @3h6@3r@3t c@3P=@3L#\$h6! T+=kg6 g6H5#H5N%<3i65T+=R@3t @3@3\$i6tD5@3eh6h6LD5@3=i6.h6 Pt$ * NL$ T+= h6$LFD5@3D5@3D5@3D5@3h6T+= h6H5M$i6q5T+=[Z @3@K @38T+=8-u xD5D$ =h6u ,i6(i6@3@3H5#h6@3$h65T+=WO h6i6sTi6d@3U,i6h6?D51@D$ )@3 L$ ƒ ʺ3t(3 ԟ3h6ƒu 9u , l$D$kL<3h6 h6 @i6"1$jh8=3hJ#WU/~HЃJS$0'4=3ƍHw$0'Ti6뫅!T+=H5@3i6|H5M$mh6@Xh6ˀCh61H5#"h6 T+=@Ƀl~mtKotRpd(i6SatDeJ1A ,i6 (i6 @3 @3 @3"@3,i6 @3@{peT+=D5SHh63 T+= g6g61ɉ5T+="]h6i6T+=L$h1 jLjh<3QNh6bl 5T+=Vh.9#/VR<34i6 i6@5T+= i@i6Լ5h6H5N%i65T+=9i T+=E g6Ni64i6 $! T+= }h6i65T+= =h6@h6 <3%=@3h6(3 0akG1A11|$<$t4i6D$tGNutNj]]h#S-1t[h#S,uE h6h6j5 h6S^ 1AL$y#$]1 h6<$D$h{#S,l$\$thR#SXVDžu Х31 ðt5h#S1,u3h6S' I 1urL$tP؅uAJjh#S*+ uPh6D$t t P CPىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P` h{#SI+t W,)=h6<$l$S|$; h6,@31ɺ G1Fmفt#u41A 0@3<1A 0@3!5@31ɺ.1!# $ 4u h6<3=rnFr0s9-ԟ3D8i6PMԟ39}j4NxPԟ3@ԟ3<3ԟ39 1VV4b xԟ3@ԟ39| Qh#j?H 1FPh:#V(H VG5T+=h}#h#jHjlG5T+=h#hh#5T+=h#jG 3Vh#n%5<3WVR 5<3WVyR VhE%;5T+=h}#0h#jjG!jFmh\#jCGt$h]#jjP$t,(XN8@tUjP$yFD$8Uh#W-(1D$h.D$1$h{#U'thR#UQDžu JХ3tkðtAh#S'tjh#S& tj1ujSðuh{#UT't W7%=h6Uh#l$}$l$h#W']tjWB\$rt D$W<3|$ td^_[]áD5t8uhY"bD5t8uD5^"Uh#j E USWV|$%UWxUVNJ00ht$跩tAtZ/UVwxUW488ht$vu4t$h#0jxE1H1^_[]áh6t H h6h3h+#jCWV31FWVhh# WVhh#WVhhj#WVhhd#VTCUSWVPˉjPQ փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q $1>tj,VÅtj=Vvtmj l tdAE0H@h6=h6t h6sh6uh#j6B1O^_[]h#h#h#j B4$m ɋD$L$01N#WV5@i6h#h3L t(ο#Ph$h3L !uء3H 3~3H 3 h3j aO^_SWVPωPQlkt4Ƌ$| tC$S% t'ǍCPVW  DG h6 h61^_[USWV$t%t_݊M\tS8uEEh#j@Ej UEƃjSV t3l$hUVP WUh#j\@S $EE<\t:uCCUZ $AStRC1fGt,PtStgtstp1B ы$J@u $A=h6tZh6HVV 4$ Wh#ji? 1H^_[]Vs V h# h6 h61VG 4$ WhC#USWV\$tK;tFj tLNjl$1pS{G woD$G95h6t%h6x!hh#j>1Nh}#=h6=h6^_[]WV5h6t;11GFu)uh#j^>6h$h3-I vu^_USWVh61 l$$=h6Kt(=h6t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=h6tGtlD$@1G8D$@1D$\1GEt$ hy#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVh#h3?Vh#h3? $t+Et$h PV 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh_#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7Zh63WVVjfuD$L$ L$$VjHVj=uD$L$ L$$VjVjuD$L$ L$$VjVjuD$L$ L$$VjhH#  (D$,WVj "   WVj  0=@3t3i=)‹1@?9 tR=\i6t3<$/>3i=)‹1@9 tR `i61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=Xi6ujh= Xi6#t\u#uGW~ tjxGj jW; />3i=)Ë Xi6,t 98t#@u $jE t!8h $1(Wh#j9- h#h#j!-^_[]USWVP|$1N=\i6ujh= \i6#t\u#uGW^ tjxGj jW: 藺 />3i=)Ë \i6,t 98t#@u $jH t!8h $1(WhZ#j<, h#h'#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh#j+1H^_[]1je ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj蛰S CS>tKt^?tYڃCKt6C;C C})VWhd#j*S h#C=`i6t$di6X Vh#jW* 4Vh,#`i6di61WhH#j** S h#}VQh #j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$ Åt>VJ ,FN4A1R113W 1J 4$$1'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSdV!1҃ډЃ^_[]fV1=hi6u*jh hi6uh#j1(1N^USWV hi61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åujf Ël$EP覺 $$$KCs{ D$C $C1^_[]Ët$ h 3P-  1$$CHC1FwCE3< S3 S( h#j&1NwUSWVhi6t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6jn tx@ LHDh#jY 1^_[]USWVti6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj\ J1ɉHT$, $$$P HN HF F t$1 H;@u ti6-|i6xi6xi6-|i6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@xi6=|i6l$T$s}ډD$0! umщjt[|i6=xi6 tIjI t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=i6u*jh=P i6uh9#j1N^WVi6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(ı t^t$ tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W ho#jj ^_[]USWV i61Kt$/>3i=)‹/uPVDžj$Y tWW褮tN$$QVQ4y8~V Q(y,~VIlNF i6F5i63Wh#!Wh#j V` Vh#j ^_WV5i6t~1Fi6=(i6u~ t v6蚫@3 @3tWWvvvv 6踫=@3t v6ά6ο Vſ 5i6u^_jhÀ=i6u1WVL$T$t$ i611H<>u5Guu%P=i6ti611@^_V|$ |et$>t\jh#PG t A3=A3t#h #j|j A31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1NjhA#Su3hV#W u!@3u9i6Džu91FWShK#VohV#hA#hy#V WSh#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Shi6hi6   Phi6hi6  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ 7< 1D$ereRPQЬ ^_[USWV $ $Hw.$2' e| RhW#{=i6x1ۃd|Rhu#Q1l$ hVU $ jdPU$,0 $$$Hrjtr$@ L$ D /f@ 0 wh#h#h#h:#$F1 $F2 jdPV肫 fF0 $j j0P 4h6 8h6t\h6T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h#$%$ $LJ$m9rD$ )yQj0UW 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh#W t1H^_jh#W u(=i6ui6ui6h#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQ躦 Ǎ A/G<rH )Uhi6hi6o   Phi6hi6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$$2'<2ǃ$)$QgtxuJ&-u~t6hR#Vp Džu'0[ PVh#jHХ31FUW*t5Ë$rt$Vh#j$_Ft1N1Х3t W^_[]fVjh!#WxKh7b$PGi6t)hR#V0i61u;5i6V\X=h6th!#hr#j 1H1^WVPD$$|$t h6t$i6 h6t"= i6th3j  i635@i6h#W  4$VWr Wj  ^_Pi6t$L$T$ $RQPD 5i6XSWV|$1N|5i6t,\$OPWS| t;j S1t^_[SWVPD$ $|$t h6|$t$i6 h6t"= i6th(3j  i635@i6h#S~  4$WSq  ~VԽ PhD$h3Q  h3j  ^_[fUSWV} u7$h#jU \$1h$WV LtPt߃95ԟ3D$h#ƀ8/h#VNush#V<ua$PV'htKD$Ph%ht4$3D$ $3L$ u$3D$$3L$ t1PP+ƅu j02V4h(3V43@ujsh"jPh#h3 jHUSWV$$6)#h#jҸ 11Ch#VUd e~%q~3كrtރvt_xi6ŃV.PtrكRtwftAii6i6뒃Wt6duqi6zi6li6i6Wi6Ii6;uԟ39|=i6u 1Ĉ^_[] D$h jQ$D$,$S  I9v9/u؃@]9v8/@tj/S`t@À;.uCt<.u{t0\$u h3#C\$i6EHu]j$8u i6PKjdi6a$8tӋD$t$ VWe i6tRtD$WvS=i6u8ts8?ti8t_Wh$Htj苹 PWhW#  +D$@uDi6u;Wh # i6;;=i6uW41ڀ=i6utV/tD$%=@t/==i6u uW#WX i6 i6х ˉ4=i6u Ő=i6t@jPt$C u h#7P Muq8VKNjGHHf wO$|2'=i6WOwP"{jWVY GG \=i6uWOwP:GHftIfgft9G =i6u Pn PW}G  Gwi6c8=i6uG ?tow PUhW#@  c=i6uO1zuSw !t)i6t 8t18?t'8ut/wh$|i6V+KDž6=i6u =i6ti6wE.wOh,b&jww PVhW#jPhS#h3v ji6USWV΀=i6uLVh#h3C h3薷ԥ3H ԥ3Х3H Х301C=i6l$$#E=jRHh8D$Pu\=i6uvVh#k 1ZhХ3JƉt9 t4ԥ3H ԥ3~Х3H Х3hХ3 ƒ1ۃYÉ؃^_[]ÍD$x #t%1Pu1PuVPWSD$Ph#h3USWVAӉ΅:#K1jhVK $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =("D$WK1PPPW( D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWzI D$L$D$)T$T$ 9D$t;$SV^i6Vh$x)i6Vh$xWK1@e^_[]HWJu1PPPW uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWsH D$L$D$)T$T$ 9D$t1 HWDJ1PPPWn h j$P KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWG D$L$D$)T$ T$9D$tYGWIj1PPPW Th j$Pn CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW?H ;D$t$$P$!P\ L$)L$L$L$ |$D$ hkFWH|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW(F 9D$)؋L$D$ظL$|EWrH1USWV\$l$UEtMƊAuA)k')j6j聺U谺GG S蝺Gi6tVG t|$u G?j6w wݓ Wԓ  j6u=j6t^_WVt$ j61GnB'uGP'j6WVP٬ j68^|~u$PPh#Q~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5j6^_ÊVF|uܹո ѹ Ǹ É)B$:@BnB'uVPQh# fUSWV|$,t$(ST=j6jLVt:xIuxNt@jLPj V1tE@j P)=j65j65j6&1,=j6uƉS ^_[]ù5#V=j6)u ^5j6Qh#*WV#|$ |$wLA3 PA3 r6>t'F r6Qr6"N@>vuڋ7 r6Qr6t @뭅+LA3@P5Xw6VrƉRPh$j% 1 ^_USWV8׉ˋ j6j6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jVjVt$ ' USWV Ջ\$$St$$tƉ׃=j6%up1҉  ډD$$=j6&uU1ۉ D$j6 j6ME \$$L$SPy t D$$ ^_[]ùQ#SWV֍Qȋ\$L$|$$$3'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹###wSWVP=Xw6j6Xw6Q +Ɖ=Xw6=A3ttxt>u &E1ۉSPV׵ Ɖ+9u$8t*8u+$t@nB' t$@u^_[ù#\&USWVPՋ\$St$gƉ׃=j6uKl$j6 j6MES1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաj6HwSjP ljաj6uND$j6 j6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THj6 j6N&ىWP1Eكra$"ى=j6#Éj6݅~hj6 j62É׃'1Hj6 j6NPىWP1 1j6 j6NىWPÉj6Lj6 j6NىWPe$É׍Eكwj6|$4t;~l-j6b1A1Ǎt$WSh"jV#jV5j60't1I1@1l$QPh"jUjU6! ؉^_[]ùm#T_#J#@USWV֋] $t$ơj6 j6L$ D$T$uPV֋=j6Ww,F'8F'}uPW ֋=j6ȃ}tً$VPt$ ֍GwF';E Qȉe^_[]fUSWVbA3$D$ h#D=etuD$ jr60hj6GVS?SU@P耩áj6)QPS, j6)١r6pQVǽPSkC$jh#l#k%ƅ<.u 1~.D0t/ua$Ph%BtGPVBt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$t/h$ur68Ltjr68j*5j6uj=j65B33B3f`5j6 B3HQPPcB3Q 5B3B3@u1[h#[.0 Ph#Ah#7SWVW蟡WPeu2\$V=8"u6WmWP3tVj6V^_[Åu0a Ph#jj6tjPh# h#ÐUSWVD$ B3fa1Ƀ|$‰tpыLh=$S$thW#Sܶu 1t$.4NJ]taM\uNEU\rw$d3'\0u!11ЃwxAunjt$>B3HQPP=B3Q t$.PN    ȉšB3HQPPB3Q<$t*B3HQPPB3Q 5B3/B3Hu 1^_[]ÁfHh#jfj6uL$ j6jPV=j6t j6K15j60ppp VPj) 95p6t =A3ujV VG^jpPT$=k6u k6D$ $1APVj6j6t1It$aVPL$T$ D$$PD$k6jWVP|$t$D$$A4$ WWV׉ΡXB3t LB39ty u hLB3 =j6j6uuPh#h`B3 =j6t5j6h#h`B3 t*t$ Wh`B3 x4hY%h`B3WxVI Ph$h`B35 B3HQPPB B3Q h`B3 ^_SWV|$t$\$SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vf3'T$ L$9upu'0fuQhe&j hj6\j6@^1j6j6j6j6WV|$ |t|$wLA3 PA3 r6>t'F r6Qr6N@>vuڋ7 r6Qr6t  @j615ʝ+LA3@Pơj6PV j6^_USWV\$0t$,|$W蜛5Xw6jVRk jҷ=8B3thƉ؃$1t7=A3u.D$0t h $uQVi=j6u"W菛jn=8B3u11E kW3u j6D$0u^_[]jUSWVL$,|$(A306̓V褚$4'Uw1ۀ=A3_=j6Mjw1ۀ=A31=j6$=j6jwH1ۀ=A3=j6=j6uQ=`t6t,jw1ۀ=A3=j6=j6t  u8V1tu j61l=`t6tUW_j\$0SWh a=`t6tWD$,E=`t6tet$,WK_=`t6tKt$,WE\$,SW=`t6tUW=`t6tUWyPh#= hLB3k=`t6twww. j6@jw1=j6j6 jwa=j6t j61V耘VEL$,=u6t D=rA3t j6tu u^_[]P&jUSWV@|$T5j6D$$w=*B3tttnTv65Xw6Pm$Ph#Gtj P5B33 Kȅuh#5B3*l$jUth5j65j6jE<$t&4$@h#35B3|$j6\$Xj6-j6j wD$ j6u=j6tSwj65j6j j6u=j6t]<$t&4${h#n5B3@^_[]j5j6USWV\$;s3=*B3{Tv65Xw6PPh#stj V5B3o vh#u h#B3HQPPB3Q 5B3.l$j6tt)u }tF1ۃjU/~Sl$SP tuQV}j6Ju j6u=j6tjsUsVxj6 j6u=j6ttJ=*B3tA{t;Tv65Xw6P!P|h#o5B3^_[]SWV|$j6jw1=A3t j65j6^_[Ë\$1j6u/? j6ut΅tSw5j6j6t"u8j6H j6Kj6jw=A3tru+j6H j6j61 1@65j6+USWV1=A3t5j6|$0D$Pm[thUS- =j6tiD$j6,$\$4>GXw6=*B3 Tv6PQ`Ph#w B3HQPPB3Q=uYB3HQPPfB3Q 5B3juw  Sw5j6=A3uZj6t"u*j6H j69j6m"uj6H j6 j6 j65j6D$Pu ^_[]USWV|$0t$V"@O Xw6jPw+ _1=j61{t'GXw6$pWXuuޡj6[tZtT1=j6uI=A3u@l$41; u{CXw6Us t=j6u =A3tʋ-j6-j6V} ^_[]USWV\$K1t@ j6PS`yƋk1OuD$}t 1{PuVz uR j6u=j6t~ jW|$x4$jt$ejux W<$t$~mE{t V+x1 V8}j6 j6u=j6tA^_[]Åx W'o08 Ph#USWV$$D$1t$ ,v6D$$u6D$Du6D$Ht$05j6$P莎5j6EXw6L$XIEtH1F\$XljtwuGXw6hSW( 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGXw6wztjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P踌$D$XtH$r4$ ȅu$1ɉL$@=A3t=j6u|$ ~ $@D$@D$ )$=*B3Tv65Xw6PPxl$41dz=u)B3HQPPWB3Q9}j=W{Ɖt>uB3HQPPB3QFPU 1Ո`1t$XtOË$t)B3HQPPB3Qvb É΅u$u t(PV5B3 مt ȋN΅uءB3HQPP+B3Q 5B3|$ +t$4~jh@5'W  u|$$ƅuf|$X# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$X# f=`t6t*fsD$= t= u ftm$}u$D$@f%$u D$j6jU+sD$,ED$D$tD$L$` =zA3u f|$t$Ut$4t t@j6|$D$D$`t$d}D$,F L$j6=j6tYD$t;=j6uj6=j6t.t$`jt$hL$D$Hs*|$^# toD$ t$,vj6.u D$ 1@t$,lqj6=j6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]@w6D$(@w6j6~[<NjD$ j6 D$(@w6=j6j6Y1PPWC 1ɅȉD$PPVjr6\$pfr6D$ Hr6$r61r6j6 @w6L$( j6L$L@w6D$D$hP j6u=j6t$jV~0j6D$ 5j6|$t&D$1f|$tH u6u6$j6h t$8j6H j6=t$rL$QPy j6j6t$ D$(@w6D$Du6D$Hu6D$Lj6hr6қr6t$pD$ j6|$Pt j# j6u=j6t=j6u 1j6j6D$@z$jW+j6D$ =j6h!t$85j6t$Ut$8pWt$Ut$8&rD$ffD$0fD$8D$L$D$u#xB3B3tB3|B3@L$D$j6D$pIUD$lj6D$ 1D$T$PW%t+j6D$|$D$k6=j6D$$ ,v69t;D$=* t=7 u)@w6D$(1@w6D$TL$$PQ`t$u |$ uD$0ufD$D$4j61f|$ˆQP$j6$r6r61@L+=ԟ3D$j6B3f`4$t$T$$L$tj6D$ j6B3LB3B3`B3,|$TtuD$(@w6j6D$tD$pj6D$D$tFD$t D$f|$t$l]Sj6=j6t|$^# t jD$uB3F tB3)NB3|$@tht$DhT%E $Pf^_[]h#5j6it$1=j6ȍPu =j6u"D$4thB pȅu5j6t$ t$,Pt$=j6uSa'h#hr6Hr6t$p|$Pt jt$hD$(@w6D$Du6D$Hu6D$Lj6D$ j6jP|0 j6u=j6tV.t Ph #xj6uj6jj6tk61ϢWVt$tr|$w$5'j Wv 9 $@Fvu;Ftj WP $jpV7 ыF @v 빃^_V t$t8>u3Ft,pߩtF ,v6QjRp ^SWVQVSt1OS jjPy  t6 >F1"jjPO  tv ^^_[USWV|$41GGG =A3l$0\$S-j6AjUThjUPj uAj6=j6t 4$ 1CSt$SU\$t$ $w j6u=j6tS~^_[]h#VPj6u1PPVPjhA3n tF$P|j6t.1QQVPjhA3n tj6@=PATH5j6XW j6 A3 A3^áj6SVh#*r68uj 1^[1ۈA3A35j6thB vT65r6 ,v6SSQPVj6áj6ËD$ j6j6PËD$@j6 j61j6j6Vt$ |$|v(Ph:#1@ j69~1Ҁ8cBj6 j61^WV15j6Vr690t\W|r60PjP6J5j65j6j6@j6jvy5j6yLW|j6^_USWV$,v6$j/Wjt@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVCuD$ %=`uVh{jWS ƅuWhl%WhL# Wh #L$j6x j6V|$|D$ pVj6j65j6uu~9} ~ j6j6^11@1USWV4h#3|$$WBT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hb#5B3(14^_[]UWV׉΋ k6uj'-k< k611D$ T$l$ &D$ $,$<$\$ D$#D$´?6u0uFjh=$WD %W[|80uHx.t x0@te^_]fUSWV|$7j/VXhu#$jVP uaK$$WV4诜 Pu 1@Ɖ$m=k6ud$$UVuG:8t8+8t.!8 uPV#t VKxju$P OfSƒrtt~ k67PSCPVhW#jSWVt$|$t$VW et Y^_[Ã|$u0 jWuE6vr6j6VmjUSWVPD$tnt$ t%1;t <:t9tGt$,89-PA3}x,; LA3t,WSQL$ nL$ |9/u 1xAA/D$PL$Q۾k6E9u,;E-k6L$Et <:tEL$<:t1ED$(QQ $+ LA3AQu^_[]USWV$1C1D$ 1D$D$D$\$h#躎Hw5$H5'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ r69Ar693t$$1CjWtV@wM$5'|$t&|$ t4t=0A3x'@ |$ur6H r68u,v6PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ k6/tPEȃw?$5'|$u/|$ u&u |$tf<u t$Um묃k6r5B3B3$@th#1@$$$$^_[]SWVt$j6 k6t5Hftfu950A3| P^M 9p}Ëu̓k6r j6t^_[Ã=j6t^_[USWV$G$$5'o,v6EjWS PAsM䃼$$twh#Vh#GPh$j6wPQ` j6u=j6t h#D$Ph#/th#h#GPh$) t*B3HQPPB3Q*B3HQPPB3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)! k63tFWPtc6|$tTj6W#P#pƉf@@ WP6 j6u=j6t u1k6^_[j6k6QJ  j6u =j66USWV$$$j/$_turfEE^,v69tth#V#t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$K襓8藓8艓$ u=0A3x $u  \u =0A3y& u $MƋ$1Mtfyu0A3YL$$j$P 1OD$V0oGk6tAPh#=}t$t-'5k6h#}t>/u19}-9j$$PM ƅvvD$ PVX x3D$(!D$ =u8=k6$Nu$ 8t8t D$}o$E$\$|$$t$t'5B3jS\P$h&VffEo$T$pƋ$$j6|$ÍD$ uj$HfxT$ ufBuω7 j6u=j6t ׅt"G GfEG EG fEGE fEEĜ^_[]j6T$ Éuj$fxE$ufBj j6tbiV茀C+LA3PkVjj$t3fxu*SVn$=j6V$h$#SWVPB'1t8|$B'L$8u%tWP裁L$ t us^_[SWVPD'1t3|$D'L$8uWPXL$ t us^_[VD't%D'jPf@NHu^V k6 0A3trft fuxB =k6r^USWVP\$=,v61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#yt1<:CG럡0A3y x50A31Ʌx $y $Q50A3^_[]SWVj6 k6>t+fuw\WC ߉?u׃k6r j6t^_[Ã=j6t^_[WV|$D$ j6jP+@ft*fu vfFGF GF GF j6t^_Ã=j6t^_WV t$D$L$ j6fO A3fOPLGWVU j6t ^_Ã=j6t ^_jt$itfxup%1USWVt$4$1E11D$h9#舁ot Vu߃pt vuՉ,$Љl$ʋct <$ |$t<$;r6:6Br6*1\$ D$}u<$uh#߃<$u U{9't']:'8uUP}ujU>ƃ<$tvh$h# j vVtih#vh$r68tcB3HQPP,B3Q 7<$t"Uh$;h#Rh#sr6H r6(|$t PjD$PU1L$#jUHfL$@D$wS$5'j/UUjU':~<$80Z Ph_#@<$ulh-#]<$uh#D<$u h#7<$t,Uh$ ),v6\$|$tIGh#:t$r6H r6(nv<$uh[$뒡,v6D$ CjUD$PO PeK<$u h[$Vh$^t$vt$1^_[]hO#1#ct#RPhr#Ph=# f1PPt$  5LA3@PYdUSWV|$D$\$=A3tk6H k6 LA3 k6 PA3 r61ɉ k6 k6H Xw6Spr6tH r6~k6k6fH k6k6+LA3Pck6k6u%Vjvcp k6k6sk6UVk6-k65k6x=tEk60va5k6΅u!ek6r62Vk6k6t Ok6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tu6t D$B3 u6D$k6+LA3D$?~uЃtRWT$4$ D$1@D$ wy< r6H r6{k6z1=r6 k6; LA31y VT$0>u!y@u=D$D$k6$r6H r6k6=k6unk6+ LA3;L$~[xuUHk69r6H r6k6r6H r6k6$ |$D$ЉD$$ r6H r6k6bT$,H k6>~=u|$ D$ RV/ uXw6r6H r6~#k6%bT$,H k6 CaT$,H k6$$Ut$ NT$4 k6+LA3jPHPT$8 aT$,H k6>r6H r6~k6 qaT$,H k68 Xw61>uO@t*u t  $! QVT$4NaT$,H k6Xw6-`T$,H k6$ `T$,H k6D$$ |$tu^_[]USWVt$,|$(=k6tu6t$D$B3&jy]xNFu6D$1@)D$ D$<$k6_w9gD$(Êxr>jWhG&T 1;$uɉl$'ED$ l$Ewt$($9$?${?1@D$h|$t$;$tj[ $HT$,JB^_[]WVt$ NȊ@>*u [t?uߋ=k6j6k6u(Qo9PZk6NQPg 5k645 k6 j6u=j6tk69t31Ʌt AuQP#u=k67v k66^_Vt$t"k60v5k6΅u^V5k6t1j66Pn4 5k6 j6uۃ=j6t1k6k6^USWVt$(PZk6+LA3PYLA3Gtr}t  KvC#:t /tQ t7=A3tAL$,u8 r6Qr6:\O@랃tPwZ^_[]Ã=r6u \r6LA38t!P tx P1Zu$h#l#ljP ZGËD$,tÊj@'$< t< s4< w*r6H r6~k6b[H k6r6H r6~k68[H k6Gw/u}/uE'P USWV,D$DD$L$@9A|$$D$ t1nB'‰T$ D$D%D$ j=L$ QGD$pD$$L$(<$ L$u:|$ L$D$PQ1ڋ\$ L$xv6T$)11Gk6+LA3D$D$<$u \$ l$J n%t$l$UPRaT$NQT$ L$t,1t}u;@ڋL$uk6-k6+-LA3=A3t%1<*t<@t1$ ws1D$1D$L$u!L$ȃ@!ى!:@u =r6t1C L$@11ۋ $?|$t$Ut$T$RV* U`L$()<$ }D$ 1|@u$r6H r6~ k6ՍQk6LXk6MPk6EK1ۋl$$]|$ D$ GEÊj@'$< u.r6H r6~k6 WT$H k6r6H r6~k6 WT$H k6]EuKl$ u% k6LA3)k6 r6\$ \$ L$D$ E< w.r6H r6~k6 WT$H k6r6H r6~k6 VT$H k6]Eu1l$L$sD$ 1l$` $Ik$6'|$tr6H r6~Sk6Q1GAL$u3L$ QV1>t5k6t$8k6ud{%VH k6=k6+=LA3t$ t$(Ut$ WV3uk6=LA3k6)=r6Um1Gk6+LA3t$PU <$t[1@Ftuրut܋ k6 k6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh]#Ls)Ѓ5Xw6hu#˳׊t!#u(HL$IQWP5Xw6h#衳D$ƃHQWP5Xw6h#yUSWV5k6+LA3D$j6k6D$ k6D$$k6D$(k6D$,=k6k6l$0UR+LA3PQD$ P$URD$,k6D$(k6D$ L$$ k6k6=k6k6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 j6u=j6thWt$ yu8tj6HD$EEt< uD$C낉$L$}1A9r6} _SL$ƅ~N$ r6 FK1:r6H r6S FK1Ƀ=r6 S1ɉƋ$|$tj@'$< t$< s< w r6F$ r6Fj6D$ x PD$t P) D$tP>j6$u+LA3jPt$$ 5k6 j6u=j6tl^_[]USWV D$4L$@-k65LA3l$)hPD$r6H r6~k6QH k6=LA3UKWD$ POk6+LA3PN5Xw6W"ljӍD$ POLA3 k6k6) r6 r6 ZQk6SWh"jPk6xt$GF9Iu|$"tjVU0 k6A k6r6)r6D$ ^_[]SWVt$1ۃ|$|$ák6t#9xu 9X up2jKM k6k6k6k6xpX ^_[WV=k6t$ 95k6~?=k6j6?P' =k6 j6u׃=j6tPk6k6t?9p|j68PZ' k68 j6u=j6t k6u9q~)q$95k6~ k6k6k65k6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) &r6H r6~k6 DH k6r6ڃt$$@8)΋=r6$E1 Øt4t/*r6H r6~k6CH k6r6H r6~$H $ k6Qk6 ACk6 $Q$ Pk6$jr6H r6~$D$k6M ȨtD$BD$)r6H r6~k6D$ D$BH k6$k6 LA3T$5 8'~s18'H k6r6H r6~$H $ k6Qk6 >k6 $Q$ Pk6$eØt2H k6r6H r6~$H $ k6Qk6 ->k6 $Q$ Pk6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-Gr6Pr6}=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡴk69tH9u %8/t F%QD$;5k6tF/}tEEGXـxs@<$uokt$atdǀx .u.uN jWt$ t8tG@u@/UPWV05k6=j6tt$tWE/Q k6߀xruX@8tB@9tD$P5k6x5k6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W:L@P7WPdj7p k6k6^_USWV\$D$|nOʼnmIWP)|$SUÉpslMx 7u߅u҉3D$^_[]SWVt$(\$$W7C k6LA3k6PA3r6k6jsMr6H r6~k6g9H k6k6+LA3Pw6jVP W7^_[USWVt$FPh#˩B3HQPP|B3|$Q1ۃ|11E4{JE9uSh$qB3HQPP"B3Q|=1C4荤B3HQPPB3QC9u1^_[]h#h#k6H k6~k6H k6#=~uk6H k6USWVP8A3H k6t+u yk6H k6~xhLB3裤h`B3薤 k618A3~PXk6hSp? {eX8t_8A3xLX8#>WjW !Pjj  h#>8A3pk68A3@1ҋk6  k6@@P t 1+k6k68A3{tXAˋ-k6M k6~ @لtk6أk6=B3t$5k6D$x5B3D$k6H k60~^_[]øk6k61k6k6h#\USWV=8A3w j6^t)kU1G~D(< t< u 8B3Hc Fk6Fk6F k6G $9t V  j6t^_[]Ã=j6t^_[]]V k61~^Ë8A3r t ~6u1@1zk6 k6SWV\$t$|$j6 8A3y tja1 8A3I  8A3A$A k6H k6H k6H XtK =k65k6 j6t^_[Ã=j6t^_[邒WV$j6jW]ƍD$PV1uT#D$ =uD1PPPV7 u2jPVѼ u <$ELF1PPPV7 uZV9t:$Ph j6u=j6t近Ā^_Wh#V蝽h^#V芽WhD#VvWh'#Vt$j6hp VjjV |$ t8A3H~Q 8A3pxuh/ 8A3A1k6k64A3 j6t^Ã=j6t^֐8A3tL$T$9PuHuák6 8A3A k6Ak6A4A3Aj8. 8A3@1ɉH H$H8A3WVt$|$ j6|$t=k6WCk6k654A3 j6t^_Ã=j6t^_V58A3j6Fx P׊FtP ~ u8A3V 8A3H k6H k6H k6@4A3 j6t^Ã=j6t^酏8A3Vt$ 8A39tk6tPu^hv#辏=8A3k6t-Ã|$t=8A3k6uk6~P8A3@fWV|$ 9=p6=p6@A3t P誉jh!#貹@A3MPЈ@A3ht PE5@A3jp6Bü9t jj1Vj薕Vj苕Vj耕苼 p69tQj1p6P5@A3;Q0! h2 p69tQjp6P5@A335@A3u@A31Vj”Vj跔Vj謔=p6@1V,tV_@A3Fuh#RA3^_\P0% hPh#j=P0 h'P0 hPh#5@A3;D$u D$@A3h#Dr6SWV= p6jQEƋPh$Ϟ|-1GPhdm$訞G;|ۡB3HQPPJB3Q W5@A3ktJj6V[V j6u=j6t請^_[h$# h4#N0 hPh#Vt$ h#C^USWVh#vC= p6r61FjPlj+p6i5rO@QPhV#Y |,Phdm$3E;|ۡB3HQPP՘B3Q Wr68tH r6@(1^_[]h4#跊h$#譊USWV\$n;%u(sVd8V7HW#KS?8W#dS7 p6M5p6At#~i9:0#I {p6W#4$D$D$=p6C1tQ~H$8?uEt$Px\uUt$6t W#tlW#K\$ueZ*t%tS-tU+Eg#DA3x+;p6}#5p6it #\$1|$ t5^_[]áDA3t p6iv#뚽v#SU讈USWVp6)i5rO=DA39u=DA3)p6~9ut Ku ]t]tu`ǁTtCiu3itit0 5DA3^_[]SWVt$j6~X1tttG9uމjQauDJ19}q~5@tu ƆH j6t^_[Ã=j6t^_[鎆+5p6i5rO@Ph^#+5p6i5rO@Ph#ȆPj Ph#贆WV11Fh#_>kt!Zu忀ރlt puԉпɁur6tg8tbPh$+m=A3u =A3u@r6tA5B3jPvW:r6H r6@ujW5B3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh)S&W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th9#jD$PȖ ] p6)i5rOC-DA3+9tti-;)t RPhT#jl$ Um\$D$P37$t+,D$0h]#jS8S\$7ŋCt:tBuM ,%Phb#jQD,ingD,Runn}=tQ` l$ ,j SP0 D$xxl$ ?Se6l$ ō,@)QPhk#w0 h%jQZ ݍ,P 6WD$P腐݃FD$ ݋\$GHO W贐H EuݍCWP:$u/1M|t؁Phdm$WH N1MM|FGHO WJH GHOl$  W&H|1GHO WH ~T$KWqD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =A3$tCt>5@A3 9t%5@A3PV芶$=p6~y\$t$1=p6tEt*t t.<$u u/S0= p6u WE;-p6| $^_[]C0q hjPh#趀USWVD$4\$,tl$0|$WUS ƃuSC8=u6tj6p6p6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1op6D$ p6$iD$ 9T$tcu tQ=p6t 1=A3uL$,uP9tPtu B3P j6u=j6t~^_[]Vt$j69tP džƆ1z j6t^Ã=j6t^}WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h#5t$ntpur6D$D$D$t r68D$t(1PPSБ EjS== p6u|$1p6-r6~6@ p6D$u}t!AH Et{1jPƅt9u ED$u :u G Eur6t Dt111D$uD$p6L$L$t$D$\$l$|$ p6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$p6C$jU9 L$tc|$tNuJD$1rȋi4h#jD$(PTl$D$D$L$D$u U D$\$l$t0~Ot)D$p6y\$l$D$tUD$tMjPSL ?jVDžtjuS+ =A3u V <Ń퀉0^_[]h#ySh#ySh#yUSWVP1$1C11h#J1it"gu$ڃjt puЉ̉( r6t yjPƅt,1tp6)i5rO@PhQ#H$t#tH~1i0 tPh)S&Ŋ11G^_[]Ã~1i4h #荊B3HQP~G ;| Z %P&G ;| B3Z;|lh #!xh3#xV1= p6ujt$ St1+^V1= p6t. p6~$Ap61F:uI}^V=A3tO=p6tFD$t+ p6i5rOA1ɋB3u0VQh#R^USWV= p6u65p6~%=p6Ft WN p6l$p6~"5p6HI}j6tfiPƋ-p6=p6iPUV  ~ ;uKuU> l$hnƋ=p65p6i 1҉AJw)׉=p6 j6u=j6tuj6fdž=A31p61B|iP j6u=j6t u^_[]SWV\$|$!ƅtt.VSt$W\$<$D$ #^_[80 Ph#&uUSWV|$ p6tWdW~*15p6j6p6V>V}5p6l$t$t%t =A3ttttk0hWj~Wj~t uuhmul1VVh\%tOh\%h#DtGVjuV5@A3:tTWjzWjzt*=A3t!WjzWjzWjzu p6^_[]60b hPh#sUSWVt$ l$|$1ۃ=p6t/t*=A3t!ttSVu5f@..@.^_WVt$ tj6NJujVj 瀾tW5@A3n<u%+p6i5rO9DA3t mjVt=tu  ρπtt=ttu j2u VK j6u=j6t(q^_f40/ hPh#tqSVD$L$ =A3t1ۅ SPjbz ^[Ët$1҅tހu1=p6u2 p6u) p6~p6:tzt Iuh#~p61@SWVt$$1@= p6|$(1@$*#$|6'Wh##bjvu hv#h%tjjvjv 1~ h#21@^tjs%;th#h>$jvha%1Wvh#1Wvh#Wvh#jvu hv#xhH{#kjvm~ t+u hv#Gh#:jv <u hv#h##Rjvu hv#h#7h#v h#jvh#jvu hv#hh%;h#kFp]h#P~tF1SwJh2p#.Sw 1> #t#P uh#h$vh #v#'1e#1 ###1#N9tQh#jWWSxuF x%Ph#jVZVjv S h{#51^_[h#h#jvUSWV fD$ p6 p6l$ 1D$U$u1!" $6']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ <# t@#,$$׃߻&!$}D$C#I#} uQ#$a%)4$<$zT$tvӃux<7't ur>u<7'_pE~FЃ r)# ,$t3#\$҉Ӄ9uG8,$"2D$1&<7':7'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I p6p6 ^_[]WVt$ tG|$t jV~t'h%h%jVvu^_USWV$t (p6 =(p6D$P v6t u6v6 $=(p6z1jh8'S褑 `P>;Hx@u8/UD$PV臧x D$pL$t 1D$tD$p1ɋ4p690p6k6tH1 8t:tGt89=PA3Z 9=PA3~k65LA3WPVT >?#<=r6l V: fiDle cDhangD ged߉VvB3HQPP~vB3Q D$pL$t 4p60p6E;-(p61-(p6D$PĔ^_[]'fUSWV<1UjG(D$hhh UPj舑 @Ib:9u 9Èp6j U p6jp6h#U= h#A3,$Uhp6Wt$T|$Pj6p6|p6p6HdD$PVWVW~=p6 Àu{=A3n$h#j6ttQu k6 j6<$B=A35=p6(ȃu6p6p6r6$j6u?=j6u7B3HQPPtB3Q h`B3tD$Pj6=j6te$$=p6u>h#l#R8't1Ph#QPP[V$=A3uA3 p6t N=p6uEt$(Vh#t8t$PTPV$Xw6=B3t =r6tjh7'kuD$Pr6u/jM=A3tFhmS#rh`B3's*1ɀ=B3ˆQPOh=B3u=r6t4A3Xw65j63p$$#uSWVD$8t^j6jPȎƅx jVO j6u=j6tcx"1=A3t=*B3t*B31G ^_[11=B3t B31j̇V3V躇=A3tt*B3uB3^_[USWV|$(V11C=u6tn1=A3u4t0j5B3ujh`B3qA3P=8B3t.te=A3u\1Ƀ=p6 p6jPg1;tW1R=A3uIu=A3t7=A3t.h#ppEVu襄$uĄV#^_[]Vt$j6jVx1jP j6u=j6taj^Vh#,bt1Ã|$|D$pPmmft$1 th#at$t$ th#aWV|$ W@P tWPH^_h#aSWV|$PA39~b9j6؃P tr HA3 LA3PA3HA3 j6u=j6t `PA3j65LA3>LA3)PA3 j6u=j6to`^_[h#`D$t LA3) PA3LA3j h#j證  D$ HA3 LA3H PA3H r6H r6Hr6ËD$j6H r6P j6u =j6_Vt$j6HA3;t HA3P FLA3FPA3F r6 j6t^Ã=j6t^m_USWVPA3<kj6-LA35HA3p6t|F9uuHA3PV  HA3HA3+ PA3 r6LA3=PA3r6tG90uC HA3 LA3H+HH x@WSUPY 5LA3=PA3 j6t^_[]Ã=j6t^_[]^h#^D$j6LA3)PA3 j6u =j6H^V5PA3PA3r65LA3^V5PA3+5r6PA3)r65LA3^ËD$ LA3) PA3 PA3LA3+D$ȣr6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$#t&jQh#Fb USWV1\$@<uPƋtPEu1ۉ]hr6r6=r65r6r6^_[]SWVP\$t$t2uh΄%V1C$"h#fZY%(,B3u*2B3#0B3RQPh#^,#uȡB3HQPP|ZB3Q (,B3t"2B3v#tڞ"QPh#p^ u.$(,B3tPVtu#VPh'#&L<$u#1B3t(81B3uƁ2B3u숟2B3h#DY(2B3:3B3t0,B3#t QPh5#0B3QPhK#] uB3HQPPSYB3Q >1 [A3t$YA3t(81B3uƆ2B3u ZA3@uă^_[V(D$ T$0B39tu#RPh=#Jt#1B3t(81B3uƆ2B3u숁2B3^WVt$ ~t)~tPn uvZ ^_USWV jA r6t_y 8-uUD$$r61r6P  r6y8-@P1F Pơr6)j6r6=r6~-r6Ft7 r61Nr61ɋur6 j6=j6I1F5r6P)ƅr699Sj6 r6r6lj4$މt$\$)1*C/5r69rL$ 9v!\$ۋ4$ P; r6w4$ 9vQ9wr6 j6u=j6tHW1 ^_[]hb#bHhQ#XHh#NHh#DHSWVT$ r6tstm8u'1z:trrD8uAÀ~:u"9u r6Qr6 tf r61ɉ r6D5r6>1t6?-u1t+O^r6-uta5r61^_[Ph#jGPh#_G|$u1PjPPoej6jwr68t PI j6u=j6tF1ËD$Ѓ w#j jP膠 ur6r6ËL$~ND$tH  r6=r6u r6r6r6hr6hr6Qpphx#sFUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh#h#Y J|$:uUD$8@?jPh#Y ^jUh#Y 1|$D$0)@<Ph#h`B3V jh#f1?\$D$01@11T$4*l$Ph#j UVhUh#%Y D$EEjUt$0Y u0^_[]À|$:uD$8@:Ph#K1L$0L$4HUjCfVD$ 8B31qqA1Ʌ p6$0PQ8B3p ]t u 1%8B38B3@j* 8B3 u^qqh#CPD$p6/$iQXUSWV'ơ8B3@tu'tƃ 8B3 x,$@D$t.$xJ$18uWPtG:'uD$tKjD$ph(t6NjpVWPVl E$ht8B3@^_[]USWV8B3@|$u 8B3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8B3@@|$Fu6|$uD8B3@ 8B3Ap8 u|$u8B3@^_[]jjX 8B3ASWVƻt u j pxʡ8B3@^_[USWV8B3kE1͋ 8B3x t*p6,PyN8B3@ C1Ƀ8Qs s j@8B3HOH O oKy K9t?U1CSpt ^Shh?'P= 8B3HO@ G 蝯8B3!^_[]WV@t$P 8B3A uyW wWh#49'h#j"Q Wh#j"PQWuL$Lx49'h#Vh#jPQWUSWV8B3@1u 1=A3tMtݡ8B3@xuUj @jtÉGpj`aC+t8B3@tj,(pƉ^_[]h#8B3t$p0h+#>USWV8B3@$ u8B3@$EŃCߡ8B3@$$8'$ 8B3APUj já8B31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt8B3xJjG B u08B3x,u%@nB't@/@nB'uh#jÀ=A3tjjj 8B3H0+H8O U 8B3p0j^@ 8B3QPI H pGu58B3~ h.%vJm|$F8B3xujD$ 8B3Hu 8B3H L$ qx0j@8B3HKH K {@;u.8B3x }8B3x|$ T@0GjG 8B3@t(HS u 8B3@8B3x\$\$j 8B3HK @0Cku8B3x ux,uh.%pjP@u:<$ t=u葞$)jWP萞 |$l$$uS\uNr6H r63\F u%r6H r6  F4A3#ár6H r6ƈF t詚=v4A3菚=t h<:' u4A38B3HH r6H r6r=LA3)FV,8B3x4A3+D$^_[]USWV$$1҉T$ T$$D$(54A38B3r0=h?'t1$|$ fw|$1/fFn D$j8fNLA3 PA3 r6=lA'u ƒ=r6‹nD>  $8'=f>'u f|> r64A3Bס8B3=f>'f|> LD>fT$ T!uhЃ`Ę0N,諘05,/L>=j@'fu r6Bn׍MN|$=@01fD T.fTT.fTT.fTDj@'fD1AL$*(lj ƒ(M r6FD r6BvNO|$s@81ɃfD T7fTDlA'DfDfD> 0 = r6\G_T$ t$>Hff r6T$ Bf|>D>u6t$G nMn r6}f|>  r6BFfL U D$$D$f|>tD>t r6Bf|>u D> r6B r6B3Ã{t nB' r6}E+=LA3 r6E{|$ðD$ #tp#}cD$ 1@Qftf|>u f|>Iu6v $ nMnD.=f>'! r6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDh?'fD r6T$ B1AL$~ R) NjFfL r6B)A 4A38B3@8xt p6 p6 $8 Nf|C\:`1" $}f|  r6T$ BFu6$< Ft$HFfЖD$$D$NP`ſ1۹$8'D$ 1Et$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDh?'fDu6t $) FHF r6BW赕= t]H\t 'u 4 t =u 4A38B31Ƀxɉ p6$6 r6T$ 'uF|f>' r6F$ j@'$< u r6T$ BT$ r6 cʔ^t$1  4A38B3x5p60nB'ωD$Ѓ K}\$fj@'f|t r6 r6B\j@' u r6BNf|t r6B1@D$o r6 r6B݃"XŃ'D D$0$ݟ nt$T$ Mn r6B1@D$t$p6$4U ۏ` Ń< ?\u豏\ ? \$1RHЃ w&Hw ÃHÃéOu \ r6vNO|$@81BfD T7fTT7fTT7fTDj@'fD\$ B‘L$ uk%=O =r6 D$ wF r6P?ˀ r6@F r6 x?ɀtw r6@ r6W?ˀne r6GQT$ A跐,D$8s69s6D$D$$8s6薐1znB't.r6H r6;LjG nB'u\KЃ w4r6H r6LjG ÃЃ D$ u t r6׃Zn r6H r6=Gt/ up}tkr6J r6#@ǽh#tE%t@Ń:b D$D$$[:'s¸U1#, 9u.1|$Nf|uf|t Ms@ LA39T$ vNK؃|$`@11fT T3fTT3|3|t3ft1BfTft|f>'fq fq ƋT$ k6H k6~k6H k6 .ËFDD\$D$$[:'1[:')G r6x ?ʀtw r6E r6O?ʀ r6Ga r6x?ʀtw r6E r6O ?ʀtw r6G r6A?ʀtw r6A r6H?ˀ; r6x?ʀtw r6E r6O?ʀtw r6G r6A ?ʀtw r6A r6H?ʀtw r6@ r6A?ˀ[) r6AD$ ??zr6H r6~2G:r6H r6~$_1:B ˆB1f>'nD=lA'G=f>'tf|cf|.3r6H r6腿5LA3Gf|uNT$ ؃t 4$t$eŀ>ts4$]lGT$ )B8B3L$H,L$H $̾8B3pM tΉ$T Nu8B3xĨ^_[]1HE;p6} ;p6~p6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }8B3h$ Ή$ Nu=tuS$z#$#4A3 8B3A0$#l$#Y$#M$#A$#5$#)V 8B3xt@@ ^Ãx t#p6$?)8B3@ @8 4A3H0k6H k6~k6H k60袄ƃ~0:=F $@9'5 t=uv럃F~t\u^ 4A3@4A3 8B3A0ytp6 Kp6$R(*;|u0d|8B3@=t*4$D$D$f>'Buۡ8B3@1v u4A38B3HH @1@Q&8B3@-8B3@8B3@&tQ;ub8B3@ 8B3@υ8B3@8B3@ 螅8B3@u1\u?' u64A38B3@81Ƀxɉ p6P&9jjh^"8 сVȋ 8B3y8~0 r6Qr6׹@ 8B3Q8rq8^USWV\ӉΡ8B3@D$ 1,$j6D$U+LA3D$$UP?j6$~Sʼn$S5LA3P8 l$|$tD$$j6 j6u=j6tfw4A3D$-LA3PA3r68B3x t*p6PK%8B3@ 藀ǃ[~!\u9膀ǃ[C tJ$Q u"4A38B3HH s`un=ub\tX`tS4A3 8B3QQ NDt""u$r6H r6~E\E \@ŋ r6Ar6@r6H r6зELA3@|$t~Pߴt$jP脅 D$pŋȅut$ j贴E8B3xtH@1D$4A3D$jEǡ4A3D$Bt5 8B3At$ D$AExB8B3@t$ Ex PA39ًl$诵 PA39~=LA3r6t1SUW衫 )r6j6U $ j6t\$=j6\$t 8B3T$ Qj6Nf|u%Du r6Qr6-@Vt$+t$ r6Qr6@~.Fr6Br6ȅAJ։ȃՃ\^_[]á8B3L$H0h#Wu<$t 4$ /8B3@D$j6jPjjjjVtQ̌ N^V 8B3#ytA5p6t7t u(@v6v654A3P5p6@#^USWVt$,|$0l$U5PA31BW;LA3u(VXG@s69w&Hs6 jjV 1 ;DB3~=DB39t VM1^_Vj 跣tL$ T$5Ps60Ps6PH^áPs6tT$Ps69Pt u0P"~ 0USWV$|$<\$81D$ $D$1F5L+=5ԟ3h#WSFi !1Ɖ\$l$T$ L$+t-T$L$ T$L$ FD&:'VSC9rWUV> t+ u)CL$ ЋL$ !hC &jl=ƅ|$<\$l$ftL$e ԟ3$D$)uN=p61NF1jt$;5p6|dۋL$D$?41ɈL$ D$ L$L$щD$%D$@L$S述NJ<0u ]EuU;=p6| ;=p6|$t1Bt$ t$1B6ËD$ Ds1d$sЀu tPjW-  D$#D$9tPjW- <$t1BRR5B3 B31Athg#1@$^_[]Vh#UhC#h#0y PWh,#Vh#0S PWhL#USWVƋ\$|$tWhu#5B3 #t"&D&:'ut&PWh%5B3E!u,u 17t3Ph}#5B3 u1}thC &5B3E uttVh#5B3q hmS#5B3^^_[]SWV|$1\$t$tFHN V@HD:'>tbh$WZh{#WDuo1<`s6tEj64`s6#v `s6t jV j6u=j6tF@u`t6>h=$W輱thv"W誱t D$1p@|MD$K}h(&Wrt8D$D$hn# j5B31CKD$D$u}h# v11 t=t8<`s6u.u hs#v VaPh%  GF@uhmS#A F@uu=`t6tk1uu膩ND$E11P@É|$t<`s6tW4`s6h$Ah#<`s6t4`s6 h{#{SfPhZ# Eluh#5B3 Cu|$tE1F-j6D$t P1<`s6D$t4`s6Bs D$`s6t jS< j6u=j6tEt hmS#11<`s6t:`s68u.u h}#aVLPh%   GF@uhmS#/F@ut hmS#1<`s6t?`s68t3h#4`s6VPhZ#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=`t6t61B=p6tbu^1Ƀ~7t@tuH1=A34 `s6t1Ҁ9ƒ (u1=A3B1ɉσu1Bdt61t)9t`tbփub1^։PjS- $u=A3d1@ָ PSt^udt6u jS1D$ D$D$$K?r 蓺 1@ jPj! ^_[À=A3u=r6u =B3=A31@Vj6`s6>t8t6o `t6r`t6 j6t^Ã=j6t^SWVt$u `t61ۃÿ`s6t6`s68t+j6SP j6u=j6t,ds6=`t6ru^_[,^_[V1=`t6u#`s61A:t2>u `t6r^WV|$ 0`t6u"t$=j6tg=t6u^j6WuS =hs6tӃ<`s6t>`s68t2t-t6u6=A3tu=j6uJ荸0^_WV|$t$ dt6uWVjdt6<rjV膵uƆdt6^_ás6=`t6t1Åt8uUSWVt61Gu6Qu95B3u V^_5B3t$WVt$ Nfuu6FNtF t0fu^~j6 ?NQP F N)Nj6v͏F FF j6u=j6t5 V N^_Vt$F t-)t'VfxQPR yNFN F^5B3t$USWVP|$t$j'Vit~th7#VQZ<k>t!h<;'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=B3uUWMGHO W]H"WVGHO W3H"^_[]WVh<;'QHj'Vk}t)19<>^_hLB3oh`B3bUSWVD$~@|$l$1SWU t 蜱8tF r)~1H^_[]ËD$)D$j6XB3tP?g 1XB3PB3 j6u =j6PD$L$ T$$RQP XVPt$t$V2 tt$ P4$f ^h<#PD$L$ $QP5B3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+Xw6+u6Pqq h#jhDw6Dw6SWVPu6;'C PVw u,$$wSCGσCGCuhv6Vh#8 u*$ v6v6v6v6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv* t61^_[]ËD$t8SV ^Ƌv6`uv6$d v6#t#$>#t&\Rv6㟉v6t$D$$# ^[WV<5j61$|$PWt $D$PL$LT$H=j6PQR 5j6$<^_USWVL$T$tHtA|$9t91nB'Írjt/9t+1nB'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U蓝V菈Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#0WV<5j6j6$|$jWu"D$LL$H=j6j6PQ5j6$j6<^_USWVD$ èu|$=ZA3uÍD$PQW Ƌ@j6Nt$݁ uF @SPуF`u vb F~tuF1Ɏ! s%t É^~u6tu6uv6t jw~ j6uk=j6tbF[r2j諆XxL$H @ $  $#`uW2a `u W"a fy^_[]vv h#A D$@!|$$~L$( t 9-uD$@-=r6u0@=r6tc@=j6tf@=A3ti@=A3tl@=p6tp@=B3ts@jPh#,WVt$|$ j6twɅVP? j6t^_Ã=j6t^_WVt$ t|$Wv 6u^_USWVP\$j6j*ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR߄SP}j=StS跄UPu< ؉G@54B3K54B3hTA3Pi| ~ F1gjt$tv6uQG L$<=u5u6Hu62UjS $81F FFu6tv6~@w65@w6 j6u=j6t#^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ j6t8Q12<08uF=u =ut j=RtLGu% uwy\ Gu#Wi\ @twՁGg;u8w6r^_[2SWV|$tfh)#WLWG9uWh$V't*tUj'Wgqt8)WPhD# hA# Gh#Wh؟%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhI{$tUhI{$>=uDB3HQP~ j( P B3j)n~=uGuth|#EUB3HQPPB3Q ^_[]USWVP8w6u)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP%yI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$<<'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$G t$k19{USWVӉϋu`w6fx@$<'$PWg1ۅD$PVOr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW!1ۅBD$PV ,$3D$ $3L$ $$3L$3D$1 dVW荋1ۅTVW}1ۅfVWmVWY1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]>Q9-u1tQyt8ytBÄthA$Qa='t1hy, jjh='Qhy, jjh<'h, jj h|='R;ËD$L$  )VL$D$ 2)u AJ)^USWVPj PV6 ljڗ8t"Зځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]VhU$VhD$USWV׉t 9Fup  ^^ g9uM1PP'g~ōP8rPUg~ LH;NuSL #~^_[]ÐUSWVt$(h#jic D$,^H $x?-Ok-u)sstdluu~xwGWÅu"3DHt'1Ʌ Sكh$mh3DH\ƃ~ƀtVatVVhf$jyރ $h &S<1Ʌt:Su+$891V5B3V|-$K$8ʉT$h(&WՆ1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.6&|" $4Ph% 1@D$l$t jW@Cj D$PUv ljӋD$9t-ف8ur1u 8tQ#6#x#UPh$[ 1@D$\$ $4h$;1@D$F \$ t$(Ph$jj6PPPPh$5B32jWVPΉj WQu 9u=у|=}^_Vh$jQh$j5B3jWV@l6k6k65Hp>>t)j=W^thW>uPh#j@VjVh$ VhB3h" vS$VWh# ġ>#t&VQh# j,h$h#q VWh,#bL^_=j6t 1k6k6L?8B3r61s6s6r69Ls6tj=Ls6uB3LB3B3`B3B3tPrG B3Vj観15j62>CPkAQW1^_[SWV|$t$`E'$D'Vw vVw d_ t"Vst Vw?w$N@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u`E'E$D'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tC Ã|$C USWVPu }dw6hw6B3f`|j%vXm O1@ 0lw6D$,pw6|$@t$(q%v>%L$ h $V5<*u C h#S1N .u{*u{ 1HD$Ch#S1HD$  t$CD$'C`L$&~QF0 $E'. D$׋L$ jj D$tfL$tjWt$QPhw6TFu$E'lw6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Phw6lw6L$ Q09|$lw6H lw6T$ l$=hw6uM|$L$ jL D$tbL$l$tf|$ L$D$$w6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$w6L$\$L$$X8Glw60lw6E ƋL$ cjl |$D$VPt$wlw6lw6lw6lw61  lw6 lw6Wt$*|$$w6 \$$w6w6t P? VyP. w6҉D$xF\$wZ$F'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~Vw6tw6T$t P[> T$tw6xw6t P;> T$15xw65|w6Љ\$H\tF5|w6X])P0tXM\$u/^t-u#F5|w6벸^tic\$>T$ j5|w6F5|w6{ 31:DYt 7GuF5|w6\$DF5|w6ȋ\$+1L$ jlD$t1L$t5WQgw6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hw6 PRQt$QP  ew6FP+ xw6 VjxP詂 7sxw6T$t t$L$ t PVRQhtw6MT$L$ t1PRQhtw6.VWhw61PQ*t$P PQhtw6 ttw6w6T$z \trB<]*<0tu$\F' ?$0F'."'#Eu uSh$dw6 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hR$dw6\),ҋ4$u|$ uWhm$dw6 ^_[]WVPlw60tplw611ɉQPV Nj 3$DQt$cE$r& lw6+ pw6VQP\ dw61^_SVˡw6H w6 u:B3Prp~r0 P{B3Q 밅uw6)B3HQPPDB3Q^[SWVPlw60t"lw6<'t<"u1B^_[11f1ɉQPVb lj+t:<-t6 3DAu)lw6+pw6VPh$6 dw6 $ڃ^_[SWVӉQoǃArVh$dw6GPVhw6K" D$w6w6Ƈw6^_[USWVP׉1PPP  ,>U.o@PUQ x$tG9tClw6+pw6VPh$Vlw6+pw6VPh$ dw6$^_[]WV9t"΀:t9lw6+pw69t\VPh$Zlw6+pw6Pho$۽DP~8"uD=lw6+=pw6j"N PVWh$覽RPh$蕽 dw6^_USWV\$$8l$}hG j jhF'Uڎƅu!hG j jhG'U轎ƅH h]#uFj PV裁 c8u$8u؃^_[Vh$jWVh$jUSWV fܝ6w66 ԝ6ƒ ԝ6w6 ԝ6€ш ԝ6w6 ؝6w6w6hw#t h$ $gt8ƿ Q'H$PVTtG uVh7$j $$1ɉhc $SU P6$XL'x6kj j5T+=4 ƃu5b8"5w6x6v T+=fw6Wj j5T+= ƃ _%x6j j5T+= ƃua8"G5w6x6 x6x61A5T+=5T+=h^#VRtch $VRKx6x6B x6x6/w6#`8"tD5w6  9uw6rCjh $5T+=h $#Vh $5T+=h $ 5T+=h $ju h $ w6t 1ҁ‰$x6ԝ6փ95w6u<9w6u2ܝ69w6u#؝69 B3t B3x6x6=x6u\1ɅQloh1 $ ԟ3= x6t)ͅt=x6ut 1jhh(x6P4q $yh(x6h$j=x6u1D$(Pt$?;u#D$0=u x6x61N1$4M' $$h#."t$h$Qh%hVuV蘘th7b$PJ$Ph$x6}6 $=}6=x6p(|6B=hR#tyt1@$$Phmdt$ hhC $h|tW9Why$ $=|6u |6 =|6u |6 4$h(|6 T x6 $$1 uWhPh(|60 1@|6D|6H|6L|6tjVh@|6n( h(|6\ $RhS(|6h(x6VW0 5x6VWF5 WKl$t$D$ 1ɉHHD$UD$ Pj Džy#[8#Bj.x߉DžV蒊x9ujUj- 1|$nhR#$PFw<hjh(|6W ^ WKt $h($sh(3,ԥ3H ԥ3~Х3H Х38hХ3Lljt9 t4ԥ3H ԥ3~Х3H Х3hХ3Kƒ߃NyjUj hR#\1(|6(3h(x6VW4. 5x6VWj3 h(|6dtd($Ph$$P-1@PijUj OP1P hc#^ A$tǍ$PWh%VLD$uh"Z$P誓;%jPhq#QQ>ƃu W% VEiWVθ $N'PV Kt uVh $jG w6w6Gw6Gw6O1ĝ6t^_^_WV΃=ĝ6 ȝ6t>w6t49t0 $ $9t^#9t^#QPh>$| 5w6ĝ6ȝ6^_SWV$VS'R'VSh$h3sz[#ujhVPjj"P thY $8|1Q1M'$ =uh jj"t$ 1$4觟F"u4$ 1@^WVκ u1H3 r1P^_V΀=x6u6=w6t/ t41t)Ph(|60h(|6hedAV xk^Ã=w6u/ Jt=x6t7x6t.h(|6hedAVp th(|6hrdAVY t=}6ujfh$j2h$jUSWVPύAPjhS$h(3qGw4\R'hw"$Ph~$h(3q (3w(h$Vq w,h$Vq w0h$Vxq w8h$Vgq w4h$VVq W4O<W8N$9tQhN$h$h(3+q#OHtQPh$h(3q#OJtQPh$h(3p#OLtQPh$h(3p#ONtQPh$h(3p#OPtQPh$h(3p#OTtQPh$h(3bp<$f$1۽a(3PjjhN$ !wVh$(3PpwVh$(3PoGtmÈJ9|6{u;[tVPWht $rvD$(ffL$(D$ 1ۉa)D$u!)tPt$h $vL$4 <)ǘ΋I<9vt$h $u$N<.”T$9vt$h $u$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h< $cu D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( |6|6t$(L$QhVu  D$ 1hM$VtG<$h`#V躔4(1>tYj:WD$AL$\$h`#Sr,1tD$hd{&WBtkhAo$WAh$WA\D$Ph$W( D$q;w6ef|6ujhl&l$!U; l$\R'1tUP\ QFR'r܉1hD$ Pj <$WhQ$ksD$ D$t$ <$}trÉD$h?"U t:hJ"U t/hO"U t$UWh$r F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh$rD$ D$|6FʼnD$uf5,|6l$u D$l$l$h%W?h&W?h$W?h$W?h"$W? h3$Wj?h"WT?ThC$W>?hQ$W(?h^$W?Uhm"W>khb$W>hl$W>hy$W>h$W><w ~W|$Wh$p T1<$|6jD$<$rt$Whg$p D$f,|6@<$Wh$xpw6f|6jUh0|6jUh@|6  <$t$ht$0Vp J21jD$ Pj< D$P|6뜉1jD$ Pj D$T|6q1jD$ Pj uuD$`|6J1jD$ Pj uND$X|6#1jD$ Pj u'D$d|61jD$ Pj^ tt$W|$Wh$oD$\|61hD$ Pj uD$fp|61hD$ Pj uD$fr|6a1hD$ Pj ^D$ft|611hD$ Pj .D$fv|61jD$ Pjc D$x|61jD$ Pj8 D$||6; w6sr"jW|$Wh$W|$Wh$΍L$$ t$|6|$Н6L$$ L$|6t$Н6rh`#Vhl$}}M'1ۋ>t.W(9Lt t uPUW ÁN'r D$3MDHu D$"91hD$ Pj t4$hQ$lD$ \$"r)Ut$h $l h;$lD$1ۋD$|6ND$|6WP84(t$|t%h`#VD L$1Ҁ<tʉT$D$< w'<$$TM'L$ L$|6<$tL$$L$ L$|6|$Н6cL$$t D$|$Н6L$|616FL$<$C fF|$Н6L$! L$|6|$Н6t8L$$ D$|$Н6tL$|611A<$D$ h(|61D$ ȁ(^_[]4$h$jD$ WVPθWEV(|6|6f|6h(|6 f|6=x6u=x6u#$}h(|6hgdV 1h(|6hfdV yF8t E8uv$=x6u(PhmdVn xX5B3h sZ1=x6u$h(|6hgdV2 y k$1G^_ùZ$hC $ 뙃=B3tt$ t$ t$ ' IE1HVD$ t$=(|6thPh(|6 ^D$L$016VDt,uVh$-t"uVh$Vh$Vh|$Vh>$h^h̝6hmd5B3& USWV8 $RPh h}6Q76 x6v|Pt$h$mh lj D$T$1D$ XƉ 11 ‹l$T6 6}69}6hWD$P $;D$#=}6t =}t=}uЉD$$$=$x6tȋ $x6=WEVuT$tf9w6rD$Pftt= x6%4$t$UhF$;g D$t=VEW=$x6$t=VEW4$t$UVh $f= x6|4$t$UVhu$f=}6$D$PSt$Ut$Vh$![=x6u $h(x6S(3V 5x6SVI SGSt$VhVWe }6D$ L$D$11t4$h$8^_[]USWV T$ $11F1Ń= x6|Uh$e QPWD$Pt$79$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99= x6tUPhx$d Ɖ ^_[]Ã= x6tUh4$|= x6tUhU$dċL$T$tPh(|611@Ph$t"j QP.^ u1@8"t1Hw61Yh$jPh$t"j QP] u?8"t1Hw61Yh$jYSWV։ϋ\$+ x6tItEu x61tGtB}6T669w1}6 1tth(|6QA1@^_[Vh$jL$1=w6T$ PG1ɅɉWV6~( WRPh}6Q~ 69u ^_h$uQVh$jDPQVh$jUSWVPӉ΋l$|$uj WVu\ Eus>"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h`#Vk<t#ƍFh`#P1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Whj$Wh$a1۹Н6؃^_[]ËL$9/up`|6D$\$A/jPU u$D$ T|6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.WhQ$`Н6!Wh$`Н61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh$D$$Th$Sut] #pS'W+PWS, '> uۀ$U-$T14TT'D$XP tpC"uD$TPh$S$T$끹d$TT'j" $eFMu SQЃ {Sh$8Sh$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h$|/$PQh$R~$ $J$fGLGNPh^$S t,Vhj&S  tSh$J$fGNwPh$SE tqtNVhj&S  tSh$bJ‹$GP"Vhj&SY  t'Sh$6JwTh$S @s$GT^_[]WV$ Vjh$W~ jWV ^_5x6t$h(3 Á"=6uW"Ph-$Q? ~5$w$S'66 h$nxVh=$P~I$ $u ~ˍ|$@WV!9t"b&J~PH k$S'1OJH w@$"GXtVjjhI"GXtVjjhN"Vj Rw(hW"VF w,hi"VF w0h|"VF w8h"VpF w4h"V_F wu 1<1A71Au01<  $jj@PD$P|uD$ Ph$;C9u<$u403H 03~(3H (3 h(3j WA1^_[]h+$j^fUSWV $ $ D$-@1666666$666t$ h<$US c~!P$V' 6˃PtdT]=T+=?1AJ5T+=˂6뒹 .T+=6h#n 6b 6D$6T$:@=6lT+=D$ Tnt uBxou D$ 1Ɉ 6hC &V>t6h#`ءT+=$j:WC-6tWutm6S c$ \W6t6t 6ԟ39$ 1ɉL$tVh$P׹ tj/Uu Uh<"h%h$ U7V'DžuVHDž7h$Pg Ƌoh#Wt(h"WthM$WpV 1QQ$ 4PU7L$9C9$ $ 9tU艦lj?,$u1QhD$PQV h6hzd@Pq tq$ PhedAWW W襇|$ WD8$9",V'uWS6,$hK h 56P Ġ ^_[]h$j辷$Ph$jڷVhP$j蝷h"h"ʍD$ Ph$ D$ Ph $j袷D$ Ph# $롍D$ PhI $땍L$ Q4dV'hr $USWV։ϋl$j4 V詽 U螽 CCCOK G^_[])h|W'Ph $h38jj-USWVP׉΋tAS Wz 4$4(VS7 WhЍ$Vt$ P4 W É^_[]USWV|$1_h#St$h"SthM$Su\6toU3t[u= 6t .= 6t%6toU3\t [u^_[]USWV$D$|$6#tW3t CÅushe$t$ uD$n%D$ 6t L$ mt L$ ^$D$ D$h $$ t$h%hV2$0|$D$4$L$hC &Q81G@΍K9|,SP6 Ŋt><-u(GD$tj=Vt>FD$ GD$thC &D$P<8u|$1F1B,$֋$$$,$D6tP#t"P$h{$@3 xF1Ë$4h%$3C9uj 32{t2ƅ|$t t$ 4$ tA710h$|$t t$ 4$ ^_[]ÍD$jPV ` x!L$ȃtuuhϼ#z묁tlPj PUhW#= 끉 6utD$P$:7uW$P$ uj'USWVt$86ut56h#u06l$\$=6t!u56h $H06USyW7 PhD$06ttj /6tu^_[]Ë56PVh $/ j&PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j&USWVu6$Ph%v$|hWV} t Ƅ|D$PV;1ۋD$ !=`= بtLV0h$P- Džu6h6h$1 Vh$PK DžD$PW蓐Vh!$Wh!$ue^_[]Ë$3D$($3L$$ u6Vhh6 t9Ǎ$PWx#$= uVhW!${Vh!$pWh9!$eUEM JRtHPQht!$ t$t$h!$hh6+6]áp6tjЃj WVH01Gj0hW'Wfz =t6jjT0^_SWV01GWdmWS%jS0^_[USWV1x6|6x66661@D$ $1m4DžW$ t7h$P Ɖl$Pŋ$ tUt$h!$+$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU t,ƍD$Phzd@V t$VzSY 3‰D$H9rHDQtD$=6t*wt$SV u D$<tQ?1Gj5 S誱 GL$G 1ɉO GO6G8=66\$w tUvbtt6jб UE Ft$6 F t$' FD$FGF0wVh!$h3t, rUh{"$,5_$ }L$ AL$ 156tyvhr"$t)~ twh%])?j o(6Í$Ph$V؁^_[]h!$h!$4܋6Ћ$ t9‹-6҉T$։鋔$ t$ t $9|ȉ$mNu\$6t 9Ct,Ph!$3$P>u$ȃt1{ $ t#Qw wwh!$-($ȃt*t&t!Pw wwh!$h3* OtHOKt|6G8=|6 t$w w W C6H 6{ t t 6 6I 6;D$\$96MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P<\$tqx6c8#t=m$hJ"$Ph""$h3 )5x6.>mS#t,#Pv vvhd"$h3(6($SWV։ϋY Wss ss҃ 6t~j fWss ssԅuA 6^_[ÐWV1t$|$ ɉ @4u ȉXȉX\ȉ\ȉ赜蕜u PQ40A40<8!<8D@D@LHLHTPTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40'40<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7mVw wZV FwwFVFww2VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(јS,C(E@ȉC@u4u0赘S4C0EHȉCHudh$$VŋFNФ6tbSQP Ф6x 6~,=X6tffOfGG@ Չn,~$N()ǃ~$N(=69<$D$hP-6>N,ș)N,)n$F(teh$$V$FNФ6tbSQP Ф6HT$<L=X6tAf=X6t4f.<$ ^_[]66F,)F$N($fOt@ 6븋D$L$t$ QPQPUSWV$$$ $$$(hI{$SV\1j SD$SVWUhPD؃r_|695x6rPSV Pt7=X6tf%#=@t#WQhL%d Wh"$T^_[]USWVP|$\$s s@=X6tf9uRP6t=6t=06tj:D$1PPPs sQs s6O63C 63K u B3&=X6tf%#=@t#Qh"$胣s s/)SUh"$ 6u =06t:yj h"$6tht$$uB=6uh#$u=46X6t7t;f56D$P6jh"$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=X6tf=X6tGf#@t#Ph#$/SVz.=6t)1=46L L h$$KAh#$$p$l tRQf@ 66 1VW B3L$@D$DD$] t$|$ 46pt95X6tʋ 465X6T$Htt tɉL$LL$QPh)#$=6uhA#$515B3PPPj66  5B3RPjjt:6=6h$$?D$L$ 6656=6 tYjj=46HX6tt,fI=X6tftfI=X6tfIfHVW516696t-j . 66 djjQP 66 AQP=X6tf%=@56568,$t$R=|6x6 t# Fjj WS’9ݹÉrFND$P9|$P$d닔$hjj RS耒 )ˀ0^N9wht#$訞h#$Ntf56615B3WWWj66 CRP5B3jj_hH#$h#$161P^_[]Ë$d#6 6$tҍt$PtV$lSUQP4$SUfH1G@u5656h8c#SUu.$l#$pth8c#5656SUq5656H=46X6fA=X6fhH#$6h#$hmS#X<jj5656D$DD$N t$\$ VS@@PD$PQVSf@5656tfA=X6tfA$l$p!fHG5656qf@5656SU5SUh#$ t$p$ph#$/  =6j 8 USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡؤ6@4 1WjPQWWRS 9=X6fB3 6ffB3=X6twfB3 6ffC3=X6tjfB3B3fC3=,6tB3ȃ=X6t]D$ YfB3 6fB3fB3 6fC3fB3B3fC3=,6tB37D$ G UV=46l$$tApQt=X6tRPA(=X6t1ҋ ؤ6I4-Ф6teQRP Ф6xtt$V/11jWpj =6=X6tf=6fB3ؤ6;x4})}jhB3W( =6E ؤ6A49rE =X6t<$fGj \$l$u6_=X6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=X6tfUVfXW|$$Wf@t$$W=46HX6tt,fA=X6tftfA=X6tfAfH ^_[]UUSWV$$1Q |6x69;$$߃9։$PU$T$L1 B(Bq $BjZr1B$J$=46pt$ =X6t ɋ=46X6L$xtt tɋ=465X61L$|1ɅDT t$t RP~56UVRP tE{[|$t}SWJ~ljUVSW)SW"~lj_{[ |$t]SW~ljUVSWW)SW}lj?UVSW-)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV 461ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =X6t SW| ؤ6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =46<$\$T$|$(t$,DpLtL|Dx=X6RS|TtDpؤ6D$0X0vv{RP{VFvv{ RS{VFt|tx|$8{D$T$Rl$$D(D,=X6tFB\pTtؤ6B0FN FNDxD$L|׉L$L$؉D(MU =X6t]RQ{ ؤ6I0VPzU EMhɡؤ6@0 ȃ=X6t3ȃ=X6EhD,t($ؤ6@0MU EhEhD,=46L$ tL$D$D$=ؤ6,$\$ 1QOP\$  t19}#8@#pLp0l$$ Ф6ɋD$taVt$P= Ф6x4ƍ$56pS ؤ6@0fPt$t$ Ф6x56Spټ 6=X6tf؋6fB3ؤ6B09}+^jhB3S4 6ؤ6B0N9rF =46tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL Ф6taPt$t$$ Ф6x=46t$,|$(DxL|DpLt1҉TxT|FN=ؤ6<$09X6QPyx)RPfxVF^vvOx )RP>xL$(D,D(D,EM =X6\$QPx ؤ6I0)RPwU EEhhȋ5ؤ6N0 )ȃ=X6t^ȋ5ؤ6T)FN^FV )S\$L$4$*5ؤ6V0)EM Ehh )ЋL$Ev8QS 61Ą^_[]ÉjhB3p $PhY$$k=6th$$.hm$$߻F & ؤ6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lF46pt =X6tɡ46=X6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=X6tf)9F=X6\$tAf)=X6t4f=X6t'fL$=X6fVT$Rt)f~T$JR>>fD>=,6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=6=H6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=6t Vt$t$Ut$h$$$1Ƀȃ^_[]1A=6t1=H6<$\$ HfUSWV $8$4}tE1ɉM4M019 46‹DT 9 X6tRPqM$U(E$f M$E$U( u ^_[]%=uLIؤ6(9‰|ǃ=6t<|u=46tFNFh1 t46tD$hVP" |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =X6t RPp ؤ6I0VQRPn|։D$D$ ЉT$t ؤ6=46Q8k=46L$$tL$D$ =X6t QP)p ؤ6#8t@DQL!!IT u‹$8U t#DT tE=X6t!RPoD t(=X6t1҉EU}@U=}@|$6EM QPQPh$3WWh$$聇h$$'uQ{u u ؤ6y0ƃ=46X6t:tMPWn?UUlCD$T$NQt PWn~V ~V h'$>&L6Ԥ6@ 뛋5ؤ6F8E -46T$$tT$D$ =X6t RPAnv0 I)؉$ʉT$t*DT tZ=X6t RPm$8D t6=X6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W6E$8I QPQPh$3UUh$$薅h$$<$<t7ؤ6Ht)$|$-46Cq qƃ=46t0FV=X6|$$tJRPl)RPl4FV =X6|$$t&RPl)RPl)FV )FV h'$$L6Ԥ6@ USWV|$ \$t|69x6a6 6 ‹-ؤ6t9ˉrux9ˉ\$؉jL$QWPwց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סԤ6t`v0WUL Ԥ6ؤ6pxjV|$(WSp)Љ 66=46jVPSH Ԥ6A^_[]WShv%$Ԥ6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$ؤ6p0vv_ $G ؤ6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPu19rÃ=\6$t$ \$ti=46t,ۉ~A1_t4yiT\$F9uۉ~1O ɋW @9uG W5H6萲t$ D$x. ؤ6;Xt|$#=46t JًL B tmt$v vh}'$hWWVt=46t$$B1ɉL 6t$ $$Bt$ B Cؤ6;Xt`R5H6踱T$\$1ۃ=46t%JًT tN=X6t#RP#hBt/=X6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb6L$AI QPQPh$7W]Wh$$h$$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=46t+FV=X6tGRP g+D$RPf1FV =X6t*RPf+D$RPf+D$ډFV +D$ډFV h'$VL6Ԥ6@ 1@$5USWV\$41F~3|$0l$,|!l6 h69|)S9у} ȃ^_[]Éދؤ6K89}=6tOI.A!1‰9)=6l$,|$0t!t$4PWUh$$fؤ6PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=6!$l$|$ T|$0tN# $ND$T$RPWUh%$J ؤ6<$\Ttq!qIVPt$ Sh%$$@l$19=6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh8%$ؤ6t$ShQ%$l1Al$,|$0USWVD$,\$( 66փσ56=611 J 6966 66696@D$ 6=ؤ6\$jD$ PL$QT$Roց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =ģ6ȣ6tУ68̣6T$tԣ6‹D$ȉ66أ6WUS5أ65D6贬=T6l$$-6+l$(=46|$`5أ61VV=X6tf%=tjvdv`aVdF`vlvhaVlFht4aTCut4aaTCuG9a=6t< ؤ6(1أ6SS=X6tf%=u1=(6u(x$CS =X6t RP`9Ƹs& ɉ @u ɉ @uG9wt$t$t$5أ65H6襬أ61Ƀ=46 6^_[]PSh%$awUSWVl$|$ؤ6jVUW{ 1ƒ 6666=6-6=6-669أ68#{H1ۃ=46(=У6-ԣ61ģ6̣6ډȣ6t@ģ6 -̣6=ȣ6Wh أ6t^_[]UWh%$Tvh%$Jvأ6t PĄ أ6USWV l$ =461ɅDT =X6t RP^ ؤ6Y0މD$ʃQSRVk wÉD$4t,Ps 1ơ6$6QPt$0t$0踫$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 6; 6u3P56} =6t-66d 66Q64 ^_[]h&$\tSWV|$t$66QPWVttH 1P1 t^_[WVh$&$ tV6tR 6~%646o ;56s6PV 56H 166^SWV\$t$s sǃuG=X6tfL$%#=@t#RQh%t s s=6tfh'$66{@t1H1PPQQsHsDs su SW=46t6hh 6Wݞ -h;&$葠u7=6{놹 6s sԤ6H 6^_[WV|$t$ WVhA&$ C|695x60WVhJ&$=6t7=46pt=X6tPn t 0hI{$'=46pt=X6tPhU{&"=X6tfPhR&$=6tqPh#1Ƀ=46DT =X6t RP.ZRPh[&$ =46tF(F=X6tjP|tPhf&$z^_SWVD$H8=X6t3P PP0p4u'11C9}QBRQp<Ҝ P0p4^_[USWV|$_8+t]Cw=46RMT$=X6HRPI9L$0ơؤ6@0 T$D$=46D$0T$T$4=X6t$$t RPEIMt$t$$=X6tȋMD(ؤ6@0T$,‹t$(΃=46X6t+tMVRHuVFt$t$ H7KVRHMQ AD$:MQqD$T$AQ!EL$DT=X6t1ҋ ؤ6q0RP耐 ƋL$ jWSQ Ӄ=46D$ t7~SPt$t$$NjT=X6t RPH|$)~SPt$t$$谦=X6tȋ|$1҉\$$ t/f ؤ6q0RPݏ xËD$L$ L$0|áؤ6@0 T$ʋL$ȃ=46L$0T$D$t!D$4=X6t)PQ>GD$ T$8=X6t@ɉL$ D$ =6t hF)$X=06t hd)$Xh)$X/=6u h)$WX=6u h)$W3=6u h)$W6=6u h*$W<= 6t=6u h.*$WT ؤ6|$Y8֋T$  SP56565656hI*$Wd,$kdыؤ6@DWSQPTD$T$iщډWSURjj RPwRPt$t$t$t$t$VD$Phk*$$=6 ؤ6+x6 |66 66 6 tQPh*$M =6-ؤ6KC)s, 6-6Ջs4HS8\$ ډD$$+h6$T$l6 $ $ډ Љ 66tRQh*$ =6t8h*$56tvvh*$b 6j t=6t8h*$>56tvvh%+$! 6j 3156565695@6tmj8B ؤ6405\6h QVO 56Vʍ=X6t\6PPҞ5\6z`6=L6t 6j ؤ6y,t+61TtRma 6 ؤ6F;q,r6PLa 6=P6t =L6th,+$SЫ61=@6=6u h\+$S=L6t h+$SGRtgD$Ph%u1D$t)L$ jQPh%hn%YXt-=6u h+$Sw ^_[]1USWV6D$45ؤ6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B p6l$9؉|5ؤ6|$0G;~,$LHN4H~KT$މ)1@ p69׋T$9|5ؤ61҉t$L1F. 66669S,SދD$4HxL$HD$81ۋjV ؤ6ׁ\Tډ\$tQ!QЃQ SPh6Eؤ656|$D$Xt1NPSWUߍʼnFظ|߃\$ <$w4F46<$t LX FuWFsT$ 66$@=X6tfL$fAf|$l$$j C hX 66T$ =6t| $=X6t RP.RPh.$l=6gq$ʋT=X6t RP-WURPVh-$Q($DX=X6tPh.$,6h7.$Eh,$frT$ '|$@@u' T$t$SUt$A 6t$D$, F=46=(6$@=X6tffu$@=X6tfft}SU{$@=X6t?f=X6t/ȃ=X6 $ApfAAt$f=X6t $ApfAA $AtfA1ɉ 46 06 ,6 (6l$T\$X46pt4$9 X6t ʡ46 X6$tt4$tʡ46 X61ɉ$dtX$t $D$LPt$衹=46=86t=6u,$$@\=X6tȅSUhQ.$C hp.$,p~SUؾ19 X6t1ɉH\H`HdHhHl$f!B=86,$(E\=X6tȅƄ$E\=X6tȋ ؤ6I0H111҉,$L$ D$t ߋ ؤ6Y8Om\=X6t͋ ؤ6#8߉@DYL!!ÊIT u,$\$lD`Td t<=X6t RP *D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9ؤ6H4 D$|$׉D$|$=46t݋AQ=X6t-RPg)!Eh=X6tȋt$|$1҉11 ˉl$$WVRPSUh.$uA=6th.$h4$m|$t;SU蕼ƃ=46D$|t1$=X6t RP(FV6=X6tȉFhܽ$|$jj$$$$SU z $A`Id=X6tEQP4( $plph(1$D=X6tWUPVh-$  $AhQl D\$C5ؤ6;^,T$$L$ $6 6׃ƃ= 65$6 ؤ69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-6t$| ؋T$(tu3D$1 Kl$@؃,Ut$HG ƋD$9\$(s+l$ Uh,$>jSWUt$@h,$h~-$m=j[sUSWV |$ ow@u Xw VUp D$t|VUh5$w w,6 (6ʃǃ(6=,6|$ |:w wh,$= =6h,$qjG $D$|$tjVU¾ p6<)1CVUh2$D$,p p*46 06ʃǃ06=46 j 9 hp 6tH6 69tDy1Y1 t 9u,66$|$ ,66Q1I1 ы|$ t6$G0W4L$Aڃ]D$ p ph,$J< =6t)h.$1C+6h-$;h,$h1Ct ؃ ^_[]6jpjBfUSWVP$T$1B@B2 686ؤ6x,11=6t>Q:ؤ6x,$kd1PWSQh.$h366ؤ61ۃVU聶tzljl$ t$46pt=X6tʡ46 X61ɉT$HtttȉD$LVUz8tD$PWbu(Cؤ6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$86ŅtTM1ًU1 u3VSh2$w w86HPUMpX86 69tmu1 6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $hX'ho/$F9h#$eh0$ejj聴=46X6f@=X6fh&/$8h#$eeU1hPVPVҜ1BhX/$8h#$'et21VWhVWVW莜1 tah=/$+76h,$du<tf@=X6tf @f=,6tjjxfh< j5656bRT$1B@B= -66  $6$Wt>E6+56=6kdPWVQh/$h3%6uF$h/$vv 躑 6A1ڍF$h0$cvv 6ǃ=46F$ X6&jPZ1 6I F NQPQPhSt=06F$ 6t%QjPSh[D$h/$>6#6QjPSh[D$h/$36=6tht$$s=61F$6 I1)щN$uh#$b-vv *ǃ=46F$ X6$Wt jPK1҉GW1҉GW }hjD$\P. =46X6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=46$tD$\=X6tL$Lu$D$PD$PD$XPy6;,$/6$W=`6v`656;4$]|$T{$AhjW -46=X6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=46$|$TtD$\=X6tD$L$|$TtD$\D$PD$PW٧;4$=6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h0$ss QPTh0$(^t~s sqf@fNCKK CQPh8c#ss oOCK =6th0$ss QPCKh8c#QPss fN 6;<$=664~^1ۋ/uu q]]8u9rۋ=6/CK tS  StQP HKX9rjj轄`^_[]6j&ej跗Ph/$/L$D$@, +A,USWV $0 n8$=46ui=(6t`E=X6tȅtNE=X6t$;x6|6s&E=X6tjPo@E$F0N4 utEh%Px)$0 F=X6tȍL$A=,6AAhh%QL. ,6 X6tD$D$L$L$D$he0$v v薉 E=X6tfM9v%}EPh0$.0$hq0$4[4/E=X6f)=X6f=X6fEtf=X6t΋$0 AI 1 h50$QP辈 h0$Z$0 F=X6tȉE$q0$PpZEL$fAWQU.( $)fEPUV ( =X6tfD$fXWPU' $0 G0W4w wmfH$X6$0 =,6t>}t8hN0$v v贇 h0$Yu EB6F0N411G9 v vGD$@=X6tȍL$A=,6AAhh8c#Q+ X6 ,6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=X6t2f)=X6t%ffD$=X6ffX6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=X6tfPjU> D$fEutEh8c#Ptl$L$Aq $0 JR ωtljh0$RQUW݅l$EMك9v%}EPh0$*1$h0$qWD$$0 T$ 3F0V4=6h1$ڃD$=X6t΋D$p@ =,6X}$0 ~h0$v vڄ Eh0$VJ6B0$$0 1GPVtXD$T$ F0V4=6h1$ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV# D$fXSPU# E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUM# $EtMw\}.uVV4~0|Juh$1$ } .u8h41$v v% Eh0$ U4$F0V4=X6tȋ |69x6s5hE1$juv v݂hT1$T4$=,6E=X6tȃu}uE=X6tȃtb}u\FN U=X6tʋ4$h[1$jRQPX=X6t}Eh0$T1 X6EtjPgC$0 A4y0n1$$0 t=6v1$=06JR u=X6tPjVRQ菁hT1$cSƋE=X6tjP1Ƀ=X6t fX61ہ@€@t f X6fG64$Crv $0 A4y0AI U=X6tʋ4$h1/$jRQP褀hT1$xR6zE=X6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=X6l$\$tȋM=X6t1퍜$UQUPhScSh1$$"Ph1$ %9-6th1$Nl$\$ hT1$zQƃl$\$$0 A4y0| AI KC=,6taEO9tU$0 AI U=X6th1$jRQP%GEh0$Pu $ 6fO4$E  ^_[]ËM PSh1$"ȃ=X6tUSWVT 66,=6t>)"=6kdPWVQh2$h3s6}ww cO W $T$ WGO ƀÄ:1=6t4=P6t+=06t"uGO 1F9ƺw1 tbQPc8uS=6xJ1v6KNj@ $GD$wOG tQPb8u E;-6|E;-6=4$h%2$b"h#$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D46pt =X6t ɡ46-X6L$Ltt tȉ݉D$PD$PRmu hL2$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t 661JQPFafp69)T^_[]fUSWVT1ۍT$1BN ؤ6x,@=6t;ؤ6p,kd1PVSQht2$h3h6ؤ6 6<\$11ۃVU衛VUm`$t$l$ 46pt<=X6tϋ 46X61҉|$Ltt<8tϋ 46X61҉|$PdtX 8Džtɋ$L$HQ$X'xtCVU誓tV=6VUh2$^1=46L L tOjh2$s6tuQ1y1 t6 u_VUYdtl=6tHVUh2$47jh2$$PxyQ 6P8, jh"$D$P C6L$;JWD$ P`646tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$$d$$8ffs1$8j h<$V VSh'?$ BVh#t-u h7$*lؤ6 h P5\6V 565\62=X6t\6PP"C5\6,`61=6tؤ6Ph+8$hؤ6tZT6u6t2=H6u!=6\8$t$Ph78$41OB 6uha8$ؤ68< l6h6B,x6|6J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ 466u@,$\$D$=6h8$?,$\$`L$(l$85\6F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ 6|$T$D$DSh>$h8$"eؤ61XǀPh P5\6 565\6S/95X6t\6PP\@5\6f`6 466 ؤ6=6th8$ ShR?$h8$"ؤ6PP.=ؤ61@L1XP\hhPH h6W76h 5ؤ65\6i 565\6-.95X6t\6PP6?5\6@`6ؤ6 Ph9$uh;&$!udؤ6  h P5\6 565\6-=X6t\6PP>5\6`6ؤ6h49$hY9$ udؤ6ǀh P5\6; 565\6,=X6t\6PP>5\6`6ؤ6@ ؤ6HHщ8<=6thX@$e=6uh0$u_h 5ؤ65\6Q 565\6&=X6t\6PP75\6'`66ؤ6D@RL҉111C QPh:$[ ؤ6HLщ@D=6thX@$肋=6uh0$h 5ؤ65\6j 565\6.%=X6t\6PP665\6@`66*HHPLщ8<҉@D1ۉ,6 466ؤ61Ƀ,=6h:$1L$ ؤ6L9| 9Ph9$ؤ6=6thX@$=6uhY9$Ih 5ؤ65\6 565\6#=X6t\6PP45\6`66@h:$L$>(6ؤ6ǀ,04ǀ(<HHPLщ8<҉@Dh P5\69 565\6"=X6t\6PP45\6`66 466G?ؤ6L-=6th:$:h;$7$6ؤ6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5\6 565\6!=X6t\6PP25\6`66=6t}=6uth 5ؤ65\6n 565\62!=X6t\6PP:2ؤ6ph5\656& hd65H6=ؤ6Vh LVjP; G011D$)9|ËLG8 $HLOd t1SRPV5D66t0|$u)hj;$h,$s1AL$=T6tLSVV36 ؤ6A8$HLId t1SRPV5H6U=X6t SVV5 =ؤ6G0ŋ $A9l6 h6ʃƃVh` p6VjP9 jw,u6y9 |6x669؃s6É66C 6UPƣ6US6 Vh 6Fؤ6 $06=6 61Ƹ1ҽhWV5Ȥ65D6|56=665Ȥ6=LBALtl=6Hh<$Xh0$11IPPQQPV7Ȥ6f@5Ȥ6+6 Ȥ6fA̤6FȃtvFjPh<$ =6th.$A=6uh4$nt1FȤ6f@5Ȥ65 Ȥ6fA̤6Ff=rmh<$=6tha@$=6uh =$t0fFȤ6f@5Ȥ6,5 Ȥ6fA̤6Fffuzh=$=6thX@$G=6uh0$tt=11IPPQQPV6Ȥ6f@5Ȥ64 Ȥ6fA̤61Ff9D> <:$ uh)>$=X6t hH>$=T6t\6PP'h 5\65ؤ6 =X6t5ؤ65\6& ؤ6\=8 u86ǁ\TT1=T 46U-ؤ6Eh= |_>$1^_[]ÉD$<$ 6D$ t$΋E4Md1C6QPVt$%"L6H6P6 =6h65ؤ6=T6u=6u =6t_h 5ؤ65\6 565\6=X6t\6PP%5\6`66<6M,I\Ttu!MȃMt$VPhd6+ 1=x6=T6t6PP$ؤ6ph565ܤ6 =X6t5ܤ656$ܤ6\8 u ǀ\T565ܤ65ؤ6o=6tVhB@$Dyؤ6{hr;ߋ-ܤ6ދM9t+ؤ6QPRhy>$I9rҋ $>$1Ch=$h=$jPD$ 86 6t(\TtTu 88 \=6t(\8 t 8uTT\ËD$L$=46P;QP ;Q P;QP;QP,;Q,P0;Q0P4;Q4P8;Q8PH;QHu|PL;QLutPP;QPulPT;QTudP`;Q`u\Pd;QduTPh;QhuLPt;QtuDPx;Qxu<;u.;u ;u\1;\1@À L~.PQWV|$t$ FGF G FXGXF$^fVD$=X6tfs r.1=6t&=X6tfPhn@$C1F^WV|$ =6t h@$4h,$Wj Bt= 6,=H6= 6u u= 6tWh@$(C1@ Wh0#Ch(3ԥ3H ԥ3~Х3H Х30hХ33 t ԥ3I ԥ3~Х3PХ3hХ3 ԥ3 t ܥ3 t^mNt"YAyt n+j aA yWh@$BP61^_USWV 1Ф6Ԥ6ؤ6$X0Shl661N56566hh-Ȥ6̤65656Ĥ66 6611ƃj$ShfÅ…t|txt$FD$61_G6yG 1HG GG9l$td$X0j$ShÅEtu56rPVQ躺 D>/|)Ot$L$6ܭ62ܭ6$!D$h8Jܭ6$ D$tB?JL$h)PRQLSWVD$t$ |695x6r==6 ؤ6jSPV0)޹C394v t^_[PVhJB$CWV|$ wu$Y'1XD$@uPw w Ph$*=6thC$j^h&B$t ^_Ph.B$趽6USWV$\TM@$ 5uh`dh`VP =6t h)C$]=T61ۃL뀃=X6t\,L$UPQ DPPz$\, X6L$L$UPQ |$u $PP@1LDffLD@9u=X6t8PP\X6L$UQPb t"PP\L$UQP<  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]hmB$(USWV\$t$=6!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]hB$VD$ L$56#p9tыR9u @^USWVt$|$VW/ؤ6!t7^Fu+11 33 1u{ 6tqt$0|$,\$(l$$T$6t9PtjRQ 6(Xxp L$ 6t9HtjQ56 6(Xxp ^_[]WV ؤ61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$['$1Aȋ$sY9UY'<`Y'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$ Y'4  <QhC$hcC$脹D$P`wZL$ D$$0Y'1B(ɀ!1RhC$hcC$SD$H`wPD$T$ $@Y'1C%   [QhC$hcC$衸SD$H`wND$T$ $PY'1C%  [QhC$hcC$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWƅuWh"js$$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hI[%t$" 1 Sh"Um CPhQ"U C Ph"U CPh!"U CPh5"U CK,C,QhH"U C0Ph]"U $@D$t P3\ 1-Uhzd@$<W t1 VhedAW hjU D$ P$4kD$, 9L$ L$9u0$S11: 8tx$0h"Рb$11҉ $ƅ*ŰP j PU, ^_[]$0h"jUSWV81ۍD$4ShPSu褺 1NtAljSPSWuWr uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSW$1NHD$ D$(%=@= j/Sxr)ك$0PSQhC$hR D$jP躅ǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSՃ1@$D$hh SLp ƅ%D$ PVD$3D$ 3|$$  D$uH$0PSD&$8$P$TRPV Vp D$4@D$1$VhC$jSBVjSo ƅxc1GD$ PhFV   8u;VOp WhC$jSjjS1o Gy pD$t PE<$t t$jA1Ox Vo e^_[]D$(%= tn=@u$0ShC$hPVS-AƉ\$1@$D$:\$ D$ PŚB$D$jSGn }tSBtN$PhF|@V x4D$t P:U$$JhF Vp$USWVP1hUU= ƉRP)9-X6t1@fCM+PUUSF ؤ6;A0u $ytWVC^_[]Ë\$-65X6SUqRPX$@ `ؤ6ؔؐh P5\6G 565\6 =X6t\6PP5\6`6[USWVt$(~OholX6tUQ Չ 1=46L$$t| tWVӔƉt$$H$áؤ6@05X6QPWVsUC cMhml=X6tUQpՋt$( }ؤ6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=X6tȋ|$ؤ61ɉShD$=6th$$8HhA#$lt$" ؤ6QP#T$1RQQD$P1Aáؤ6;X0t$~~1Ƀ=46T$DT =X6|$t RPޏL$ pL$QSRP讛ǍP6$|$1D$D$t1)ÉعF@jPPD`r9w<$r$l$T1C @<$9uG<$;|$}ؤ6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡؤ6@0)ȃ`T$1ۡ6ـ#h*E$b=6thX@$Eh0$ ع`֋,$L$t1ɉȉD$ օt$ tH ؤ6i0T$,RQUt$> ؤ6;A0l$,} $L$l$l$,ؤ6@0D$Mt$ |1TT1PD$T$ ʃ=X6t RPL$(ωQM D$H 9tet$C9\$t$$hBE$ 64$F4$;t$SD$`160^_[]ËL$ ʋ ؤ6f9u ShD$褤D$`,t$$h E$lj  ؤ6PhD$CUSWVT$L$D$0(D$ X=X6tSUҋʼnӉ OD$$ؤ6@09ʼn} t$t$5D$PSUt$< ؤ6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5X6t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP變$<$G L$;L$t9ta щʼn$;D$t`1hE$辢^_[]USWV 6$ؤ6x0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR轕 6T$4$1B srl$,$ ȈU1wX=X6t 6!9GX=X6tȋL$,1Ph F$蚡 6L$ $  hE$y=6thX@$@h0$t$D$OPWTP1GTGP^_[]61USWV|$,5$t5$61@$ؤ6sll$ 6t6 L$  ƍD$1PQQVK9 ؤ6;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh]E$џ=6thjF$?hE$Et3s ss3st$Vn[E;,$u6G%t$6#Ph E$0jUSWV0\$T|$HOX=X6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGX6҉L$D$td$PQdÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ֠C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;hH$C2'hH$hwH$h hG$PhVH$O4$V0VhG$hG$h hG$hG$hWVt$ F,t@6th I$1F,P诟1~,>d9~8uv0葟^_h,H$hCH$h hG$ D$x,u@Pt P[ShVG$hDG$h hG$WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_hH$hH$h, hG$oh,H$hH$h2 USWVEH1Bx,T$1hM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS!e^_[]hWG$hoG$hF hG$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hH$hH$hK hG$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hWG$hG$h` hG$hG$ha hG$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hWG$hG$hq hG$hG$hs hG$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hH$hH$h~ hG$ffUSWV\$$|$ l$t$6t5H6SWUh&I$tUSWV5H6 1^_[]USWV\$$|$ l$t$6t5D6SWUhWI$(USWV5D61^_[]V= 6thI$Œ2j56HtahI$腌h,$+tS6xL~61 6 s"@Pt4hI$ 66F;pL|^56vj6t'x,tP6P6á6t x,tt$t$t$t$P1WVt$|$ VW=46dtX=X6ts,ؤ6`uau33 u1@1^_WV 6t1 6 ؤ61!`u/aʀs2hlpx1Ph J$ԊPh?J$h,$gJh$J$蹊ؤ6 ǀdƀah P5\6 565\6=X6t\6PP5\6Ѱ`6ؤ6!1111QWRPjh6hh[J$h,$艶lh$J$ۉؤ6 ǀdh P5\6$ 565\6=X6t\6PP5\6`6 ؤ6dPs+aʀu Ph?J$PhJ$h,$蟵h}J$ؤ6ǀdƀah P5\6= 565\6=X6t\6PP 5\6`6^_jUSWV1L$ AL$HAL$@AL$<L$  l'L$A l'Al'Al']u }hJ$SVȀ ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uh['jBƉe^_[]Ãu95ԟ3ujhl'D$PZ u1PPD$Pju95ԟ3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$K$uD$xjhl'W>Y uWutL$XT$TЃ|>j}$RQ>yRPt$8t$@t$8t$@WT4u2hmK$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Ph#hVnD$@w ww7VPhK$S  1hYK$+hK$W fUSWV1L$(AL$$t$@L$ D$ }] h1L$WS| aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9ԟ3u~]#D1غ$Phzd@ tN|$$tOh['jt$ _t$@S1Oe^_[]h['j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SbljPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWTSl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALhR$S$qh S$h*S$USWVP\$|$tus$" $?"$jjtQ1@PVSjPt$8t$8W E1u>4$hU$W VpShJU$W4$heU$W 1H^_[]UWV} uOʃT+=|RQPhLS$VUJPR`x& $T$W1ٹ|$5T+=hhS$ 5T+=h7 #V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhl'Vk5 1OujV5T+=qMuW?,VQ>~IhxS$Qp1$VQ7 t1PhS$Q= 1O^_SWVP|$1N?u\j S5T+= 8u1u/|$¸8u 踸5T+=h7 #W ^_[WV|$1N?t5T+=8\1t^_h0U$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5T+=l у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5T+=]xL$T$$$jST$ RL$Q tXS?$$ىډWT$$jD$ PST$R t)t$hBV$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jhl't$1$ tjVt$1$ jQV$Ѓ $V I iTh j$U$  V tZs0whS$V1t^_[]1;BB ,Fjhl'P0 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0hS$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1PhS$Q= 1HUSWVt$|$ t)l$\$$jWUSS tWUShS$1hS$VD*l$(\$$jWUS  tWUSh3T$V1H^_[]Ã|jWUSO11USWV\$1s3hC &5T+=) t^1W`' tuWhgT$t$ 1N`'`' ChC &j) Džu^_[]WV|$ `'`'WhT$u^_USWV t$@\$\$t$<1Hha'j$^_[]ËG $jVUSt$HV!1Ht։l$|$\$x 1 $D$D$8|RX9g't!uPh\$j@h66g'PVhX\$t$D $„xTwiX8s[G8jHPWQ0D$G ŃG$G,o(F']t!t7ttD$ t|$uL$8T$h- L$8T$h-Wj 뗋t$8V]V(K<$Ǿj@jWΕ t$t$t$$Wt$VO1h\$VqPhq\$t$@ USWV͋D$,jPRQ|t$08WEVuWEVusH(L$҉l$ $T$tx11ۀt3ʼn t$19޾|݉Ƌl$ $9u-h\$UWMh\$U1@1ۃ|SWh\$U$D$j$SWD$T$f|$$à1|;#rPh\$j@h46:46g'PWh\$UPWUT$@ toN8jHQt$VP-$H(K$t$11+D$t$9L$w‹t$V n$SV(n,l$ $G9%4$M^_[]V1ND$~t!t#u%0t,u Ph]$t$. ^WVL$ vAw$a'11H$a'tuh|$t$ #r?Qh\$j@h46蹭46*81 *#g'PWh]$V^_ÐUSWVP|$u*t$V.ljjVthZ]$hDh'j jVjV jVjVt;ƅ tDE h$1݋@ 1 t:ړPh]$V G t0ƅ uh]$t,uLjj2hq]$Vf1M^_[]Ät +Ai UPtσ tu'SWtjjtjV1u1UjUUV t|jUUVtu1hUPD$  $fǀUUSWP1@Pt$jUPUUV PVt'h ^$VBhM$hM$hM$VUSWV΃tuw?"""?"jp Rp pt$,t$,Vp Et1PV:t*SWh^$V1(Rh>^$VOWhP^$Whk^$V 1H^_[]USWV Ӊt$$t$$RQ1Ot, D$?"$"! D$"$?"8$s p ՉT$e Eh @EMKM$E OEHMLEu UED$0V t+t$t$h^$Vc1%Sh>^$V 4$h^$VZ 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0K#h_$SU2 tPVW u9-ԟ3ujhY3VWVhXh'j4^_[]ËD$ l'H l'H l'H l'fUSWVX1L$ AL$A\$HCL$ u} D$hf_$VW52 bt(t?qt0PSD$PD$,PuNulD$Pu?D$9=ԟ3uHD$|$|YutJL$T$xupt 81ϋX1 t$@uhlh'jƉe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WtCD$@PWjhl'D$LP  tXj$t$t$ ~D$0T$,WL$T$4t9_t0uhp_$uShT$W \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQJL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh_$P%1D$Bh_$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u4$t$w7t$Hh_$u51fUSWVPM(,|$8O] D$1h_$uS. sujsWVVuutqD$9ԟ31t$$ta%VRPQhb$藘 Mt+WhD$@PSw M tPhb$d03H 03t$~(3H (3 h(3j ܝ|$G8jm$CQj$PJ$?P#PVhb$#PVhb$ G0O4 tQPh$P:PhVd$|$t$ ދD$$ʍ RAt$Qh#Phb$u03H 03~(3H (3 h(3j GHt$sG 8-uXG $1҉QQ$$Ph#hD$HPD$r> E+u(ljށD$D$Mj@$PVw tPBmL$9wȉD$WMj@$PVw tP mL$9wȉD$u|$D$ ?L$>G CVhc$XE$c$PSw71P E$yW$PSw w1P \$|$tD> 1@D$,$t$|$@u  jhWV ƉE ك@T$dt$`wQj h#|$Wt$PV豽 x'D$`D$t$ \$\,$c$t$ tn"tc$Vt$ P|$pWl$pU蝈l$9~?r1D$Fb$t?b$Vt$ L$( PD$D$D^_[]WVtfy8tH8|$jmWj$QÞh%c$jb=ƉjWP t VjC=$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj h#UPjS1 yD$4$T$dWRVhd$诈;tShD$蜈j 貇P^_[]fUSWVDt$`l$\\$XT$1 l'A l'Al'Al'B0d$` hd$VU k)Hw]r$uStJPSTu7HsutPD$PSH uhLi'jXD^_[]1Hu߅tjhl'D$P t9-ԟ3uPhVD$PS觷벃luhQ{&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh e$SW a~bt)iuRt7D$PV""uUt$D$PV螺tD$PV蟳uh`i'j<e^_[]ÃluhQ{&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=ԟ3d1t$t$PPt$VqUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H 6H 6@6 6h616F6F6F6F^Vt$|$uD$ h606FD6F@6F<6F8^fUSWV$$${#hJ"WV ou-T+=95ԟ3rv 1O$Qhh$D$PI! $~ƋFHt$ $8l'v ^ hSh$&PD$() xþ1${u Whd$P Ph#VO$ CPhi$V4$ CPhi$V$ uCPh(i$V# ZCPhd{&V# ?CPh7i$V# $CPh@i$V#  CPhKi$V# CPhXi$Vw# C Phfi$V\# C Phui$VA# CPhi$V&# <$u $lVt$* WGU $ɿt$ D$tQhh$P3 D$PhM$t$ rp~ s whi$P}" fG8Ph#h\$SfShi$V[% 4GPZPhQK$V Vhh$ $>s D$$$Fo~ 1Cs OƉShd$V )Wh#hD$PD$Phd{&V$ Wh#hD$PaD$Phi$VR$ wwhp%V# wwhY%Vj# w$w h)#VN# l(jm$Pj$W$t$Ph$V# ,Vt$ C$$L$ AA H94$hi$t$  t$hh$t$ t$ v8t$ t$辰 h{#U Rh7b$U{PVF(3tkSO`hXl'j<VS hi$$@1ORt$. 1O4$ 6h(3VV1*UhM$$衔 Vat$ܯ ^_[]ÅtV¯ hh$hej$h hi$hi$hhi$hi$hhh$XfUSWV]} {#D$D$ hj$SW, iu5T+=tFumD$ D$9=ԟ3uUj]$,(MǃD$T$ЃD$,jS腺t%D$t6hj$hll'j葞jSQ D$ tjS9tD$t hZ]$w@h{#VOj$tQC "hh$P{s )j$PRW hh$VLs hi$D$ P2s jhPW D$0PhQK$t$ D$0$L$ 11t$ L$ D$Phi$t$t bD$\Pt$ tpt$hj$SF 1O1PV. 0h)j$hJj$SV hlj$St$ ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$Phui$S $Phi$S t$(輫 Åt$( $fǀU1PPPEd9!ƒ[u$t$ ;$4t$8F D$t$. fËt$01 |$lD$Phd{&S D$lPt$SD$Phi$S D$|Pt$$Php%S `$PhY%S B$Ph)#S $D$Ph$S tj$$Pt$ 菄 D$DPhd$S1 D$D9M$ $ȃhL$pQP( t$ʩ Åt$ U$61QQPu7!ƒ~t$ M$$VP 9U]$|$$D$jRP7!ƒ=M$$VP谺 9E$1SP|$WP GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$k$t$hj$u҃ hZk$VPhk$u跃hxk$fWVjLQ"udhC3!"6hrV!V!6hC3VZ!6hC3WG!Vn!We!^_hk$jH h3jjZhm$USWV< $P ÍD$P4jt$ SKW D$t$s$;\$vSCDn }71ۀ=P6jU ED$E\$S1QQhWPU0thh#Wm Wh9l$ijU ~11ɋ\$luAu꺀UtPBD$ 1ۉs KuT$ )ڃt rKu\$t| It11ҋ\$Rhѭ"hF$;td~jW Ƅ$;t$1QQh$KQPW$W/thh#Wf WhCl$xhjvhJl$h$LUUhl$KhD$tPhl$5hjL ZjNh jl$ UzK jvUl F QPD$0Pw" Uhji WX1 tpD$4 D$,L$0 L$( $;jljhl$gT$0L$4 tH)Љ|M1KN8/$;N81$;tyhl$Ujhl$&gPh@%ghl$gL$(D$, t )|1hl$fWh@%f$;|$tv vSj e6D$1P_@ ^_[]h.l$h l$ h~$hpG&j5 USWV $Shm'U  Ǿn'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHTD3qL1ATAPAXkiA\l$A`i Adl$Ah!i All$ApxQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph5#V |$V V ̹(C 1Љًй(L$I$1 sD$PƜD$D$ t2t$ ^ {uWv=u{u C $\$uoh+o$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hGo$ MHtU4uL9rRQPs t$|$t%u@uhVI$ tIA81tSul|$tDEM9rQWP" u@u`V$ u@yu@u`V# teEptUt$8ЃtEu8uXV# t, ^_[]hn$hm$Ahn$h l$5hn$hn$)u\u\h]o$udSh o$j~ wlh$j fUSWVt$S 1tvt$KU t[Sl tCPm_ Vt$~W tPUWX uW Si 1S\ WS ^_[]USWVu]Pho$SV t$f1j?1Nt}ǍD$ PhJ$S td\$ t\hjD$P=< jS\$S- ShiW." t$E L$Uf jQho$P je^_[]PPhJ$t$ u1$YVPt$ t$t$V tPhJ$V u1$^USWVt$t$T t Nj\$ Po 9v?? ?1N*Ƌl$Wo VPUJ )SjU; ^_[]USWVt$t$oT t?Nj\$ P\o 9s9Ƌl$Wyo VPU )SjU: t> g>?1N^_[]UPh F&u^ t$->1H]USWV@uPhdo$V# ] ho$VS tPn |$ P\$$ShiV\@ |$ jSm Pho$u U V ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPl t!Pho$S%U V蚍 1He^_[]h;%ho$hhmo$~6WV|$$ho$WR t;Pm u1Vm jPV VhiWQ? t^_ho$ho$jVhmo$ 6ho$j V6hD3V V Ȯ6hkV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh$p$hVq>tVhZp$TV+FߋD$t$j7QPh$p$hV,>tVhop$ITV+F߁^UVuPhww$Vr t3$L$ AQhiV= u h~w$1e^]h;%hrw$hhq$4UVuPhw$V t3$L$ AQhiVe= u hw$1e^]h;%hw$hhq$4UWV}W#ƉPh$W tZt4$P<tW@PVi tGPhAw$u R t>V1e^_]h;%hw$hhq$m3h*w$hw$hw$ hw$hw$jY h]w$t$kO tPhAw$t$Q Hh~b&h u Whs$j2 P@D$L$AËD$L$AËD$L$AËD$L$AËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$ I3I31ËD$H@I3 I31SV\$ ShI3-uCЃ r"CrCr /01H^[hI3H?r }/ ؈I31ыL$t 61ÍAЃ r)Aw AwÉ'/1HUSWV1t$ D$hVP=+ I3x6t8u^6ǁ666 6$6(6,6064686<6@6D6@whI3R&uh,v$0hI39&uhOv$htI3 &u hgv$j $5I3tvhD3%61N6O6P6H3ttI3$hI3$U ƃV B~>CNP6F v/FwD$,p'U6Au"hq$Q$o'Q6xu>Wu4D$P1VhVVj V5T+=  \69t$:*ƀ6l `C LvmsI3H3u$F3S6T6rR6W6D$P1VhVVj V5T+=  X69t$taYN6>O6OV6CatTl5$F3+wtzH39tI3 F3$ÿE3؉$H3ԟ3 T6$u =W6uB=&6=O6=N6u|t =W6u =6uftu^W6uS$ttH)ŋ$L$ T$ RQL$QWPU%u; u&h"hq$,5T+=hg&j& t$PD$P & u hq$D$t,DtVPyDžuh"hq$JW WtS)uh"hm$Wuh"h l$I3t H9t@h"hq$$@ t%VWЃ$Wj9hNr$h"h*hq$,#USWV3(: uhwx$hq$j ƸI3jmP##t%y$jLI3Pt+y$USWh}x$h3DI3t VSm#%y$u#WWWWWQWh1y$h3QD$VXy j8V I31tT$q9t Iu^WVΉhjW$ D$Phw$VL tZhM#%V*> tQPMY L$PyRPQ WhiV* u hw$Ĕ^_h~b&hw$hhq$!WV ht$Q= t;PX  u1WX j PW, Whui V^* t ^_hv$hv$hihq$!hv$j hYs$`o1ÃD$ 1ɉJJJ JJ BRhiP) t1hs$j $1ɉJJRhiP) u 1Đhs$j QhI3GUSWV΅t R9 7 7 0($D$PZw!\$D$1t$$tsVHsD$tVP+VhJ$W trC=Q6D$uCt\=R6uCuM=V6uCt>=U6uLhj$V" VhiWn( t!$uۋt$$4u=T6t ~ j m=h(3s譮Wt& I3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhs$h$VVUhqt$= jl$U$V Vhit$ t$,$t!Pht$<=Vh~t$L,$jt$V Vh~it$ t$tPht$<j <ꍄ$P$$ j:QPht$h$P]$t'$Uh6u$n<UE}uj:$$ht$h$P$t'$UhHu$<UjE}u-I34$tVWUmuj|$W$VL $$ DŽ$@Vhit$V0 u$ hUu$;1@Pl$U%jWl$0U 1@D$81D$ƉPV5d6h ǣ`6V1u d6$hW$Z1H^_h%h}|$hh{$WVPt$T$hz$V,+ tbPMF VF PW舸tIƉPV5d6 ǣh6V1u! d6$hW$1H^_USWVt$T$1h|$V* thƋ-d6PE VqE PWt6ƉPW?t>Vx ݉-d611H^_[]h%h|$h2h{$ hO$fSWV|$ t91H>t$|$\$j N PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VC tE$$PwCt/$F ~G F1c V 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1O USWVuD$ tV} ]CtP7' tEC tP7' u/D$ Ph F&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V,t|$,$hC &W.D$ &tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$GRD$4D$4D$ PD$8Pt$ t$ 3ÅuD$ xG1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP7 t9t1ۉD$=rW"11HD$$P&|$1OL$L$D$L$T$PQRh}$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P³NjD$fVSP sD$ t P4$Wz= W<4$uM S]s {te|$t^t$Vt$t_@PW = WtNVsE0z% ߉Vu] ۉt3EF ^C F1Vt$h(}$h }$h(}$hw$ h(}$hw$j车 WVt$tV=r 1H^_V t3t$L$|$ Pwt΋D$F ~G F1  USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u' <$t@1@>y .1-t P[ 1GG GGI 1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7M t+{0t>-uUsbt>VsRt)u`  S 1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1${'4v6 !6 PC  v6 tMtk $t$ 4$UQ1Ht$(T$0)i̋t$,;sYtU+t$(ϋMjt$WPUu$i1L$,;soOui<$T$0L$, $ ^_[]USWV\$tPl$1Mquut.D$Pumt$PփWT t Ku11H^_[]WVօt 1E  |$t8L$ tWQP t1t2WnT '6bT WST  1N^_ÐUSWV$,hS}$U` hL}$UP ÅVe4 SZ4 ƊG:FhjP \$yPWS $yPVW} |$u9D$0;$$t{|$ tt1FVS VW PhJiUm 1u1h}$蘘"j`h|}$hv}$& 1N^_[]h}$ h}$h}$jʛ WVt6hK3VV|6hV6hWVW^_USWV, $@ 1 8P6t1ۈ$+$*|$hjW WhKiVb l$(EPƀ}u jUd $GL$$*SjQhRPUzu jW) $L$ $+SjQhUPWB1f|$0t,L$f|$ 0t,D$ t$L$ T$QUR$6QPh}$, ^_[]h3jj7h~$ jhIit$  t1hg}$j% WVt$ HK39tEttM`\$hjS jVS ~$$<uU&$D$sVk }EyPUD$(PV D$ED$D$PhiW  tjD$@:$<tkC 1Ҁ=P6R1RRh$3RQPu7$#t-$#Pt$hc## h~$h~$/$1PQ(^_[]h~$h l$h~$hm$ h~$h~$j葔 USWV$GPRt\Ƌ$hjS jUS D$yQWP Sh iV tD$,}8+t hpG&j g81t ]8/u 1Ĕ^_[]h~$!변=T6tt$t$$Ph~$USWVt$t9|$\$nUSuF H9uPUfu 6u1^_[]ðfUWV u|$ jtRPh$V譲 t($fD$Wh9iVl 1uh$$Y1He^_]h$h$jȒ UWV(u|$j[D$Ph $Vo tXjt$W茠 D$8t!D$Ph$V t)D$fD$$Wh9iV 1uh$$1He^_]hS$hm$j WV6hK3VV6hV6hWVW^_VL$jNt*D$ $uts$tRPh]$ ^h3jj#hz$$SWV׉1B BBfBQt&jh$P u3KDHu|$t$1H^_[Wh:iVT 1h0$j蜐 Vt$D$Ph$Vı tPhiV t 1^h;%h$hNh$gh $jk VPt$ D$Ph%V腯 t!D$ Pt 1^h;%h$h4h$h$j VPt$ D$Ph$V" t!D$IPxt 1^h;%hۃ$hAh$h$j襏 WV$t$0j!jW@ D$j PhA%V袶t$WhiV t1$^_hl$hZ$j hv$j7 UWV uPhq$V諮 t<|$WhiV t=$D$WhiV t)1e^_]h;%hl$hh$h+$hJ$j謎 USWVx$t$xhVh$W&^1@D$D$1L$8DL@uVh;$jVhC$ u$D$ 3DAt\~:uVЍ\$C1|$8+jPWhC &Vƃ uր>$t^hL$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh$j5 1Hx^_[]h0$h$jی WV0t$<|$jWh$V萴t8W t7HfJBRhiV t!10^_h$h$Wh$jg h$j苌 SWV6hK3VS6hK3W@VgW^6hHV36hWȴ6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW" Whi$ U $!h$e $HQPۍ\$4|$fGWhiU t$$f|$*u$=O6t P fD$(WhiU t$Ą$f|$*u΄$=O6t P |$fG WhiU t2D$*=) Phل$ =O6t h$s fD$(IWhiU> t2D$*=) Ph$> =O6t h$& 1Shi8U |$Dh$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQh;$ʙ uVh$X11t j,fDLxPtT h;$"v<u hC$j $PhiU tDh$$t$h$ hv#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR Ph)$3$=tPh3$j ,$=tPh$^_[]Ph$jr h3jhh<$[ÃD$1ɉJJ JJ fBRhiPm t1h$jB 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h$j USWV,$@$PhiV tr$A jjj"Z xgljj2 xi$-hSWYT xB$/uE$0uf$Ciu.h$藂1H h7$肂hQ$vW=U 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$h%h$h$hm$h$h$QL$4Qh${(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q д6t д6EѴ6tIAtcAtCAtPA tSA@tBAyAAT$hд6UWt$PVt$D$VPRRh$,l$ }"E!Ê<)\<$ }'=O6`Cs|$[VPWl$Ph$h2$#<*<0<2=O6<$$<t$sQh$Oe#1L;#y$QRPh\#GC &9u<]K%C=Ph$h$=O6S<$CPhV$KPh[$K s k t?L$D$Fb$PWh%b N"&܋L$D$(Mu} L$D$D$Fg$PtPtPu$x$ $ #QPh% N"&D$ŋL$D$(ȉ</=O6%<C<$T}';$=O6CPh$=O6CKSRQPh $h;$)C~@sFNuQPhO$ IRQPhE$Muj>l$ L=O6?CPh$(sh-$h$=O6<$CPhV$dKPh[$NCk tAt$D$xb$\PVh% O"&܋D$t$)E}twt$D$pg$ttu$x$ $ #QPh% N"&D$<t$)ƃl$ rPhl$`j>v<$€$$@}'"$rQ=PuJC<u;h#$h$=O6yCKQPh$ ]=O6Pȹ($6<"<$+$ 0$F$P$X$`$h$r$w$$$$h#$h$=O6<$CPhԁ$1D3 #t $T3 ׃l3 URWPQ'h$uj>l$ <$$CPCHÃ)gj vEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h $hk$j1| WVD$(1www ww7fWfGfGwWhiQ6 uh`$cx1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQΉ ;l$D$tD...P3^_[]Wh.$Q蟉 1<$tɍGrD$X1.Ph:#S@} E;,$sGwUSWV։ϋ\$Qh$aW)Ǎ 9~)j^_[]ø wā'ø #øSw܁'ø #VPt$ D$Ph$VG tD$P^h;%h$hh$ VPt$ D$Phń$V tD$P^h;%h$hh$WVt$(|$WhiV tgD$Ph@$V蒖 t7D$D$WhiV 1uhJ$u1H^_h;%h;$hh$Kh+$jOy fUSWV8 y h$uh%^ y h$dujh3$E t\9zL$jQP% D$tPh$ ujh3$  DM31 VPh  VPUSWQRPh`$1EVRQUhBVWh . 1H\$(C CCVWPPUPP P P PPPPS8VSjD |$www wwVWj VWj VF SF WF D$ @ )T$VVQRWPت1I9u 8tމ56 DM3tщ1@8^_[]h3$Ksj jj h$ u8$jV t $jh$h$Vh"h;% j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjPکut$Vh$< 1t$HFFF FF1G>\$SVjm l$ UVW^ &wƅZDM31OjUjj" t:9uB$=h$jVC  8uh DM39tttn1VSj VD$$Pj DM3vh$@jjj! 1VSj{ VU6h$1=DM3u$=|$ u'1VSjC VWj7 `^_[]Ét҃t̓ u1Ht$8F FFVnA Ph7$u1&$WV諊 t3$D$8x xx8WPV1ɃL$jSP $H $u˃^_[á6H 6t$Vt$V辩Ph$ij3VaDM3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjv GXWV1N=6tED$@ L$1҉RRQWjP,t4$ he$^_VQB jh'@ jVk@ tPit^Vh$>j>Vh҇$)j)PD$L$ $QPj蔨 eXPD$L$ $QPju Fj1XÐUSWV$$D$D$D$,h1H$11D$hI$WS.y f~/P w`1A$'5T+= D$u[FtR=5T+=D$,D$낃gT+=8#u(@j L$ QP n $D$8LT+=PNu@$)T+=8#u)@j L$ QPm D$D$8T+=L$QP j D$ P5T+=xm D$D$8c1Fj D$ P5T+=Am $D$85T+=hh$8ԟ3<=6u-6~q561ۋtVPuJVh$FtPh#$FtPh7$j -6C 9|?,u)É\$(k <D$jP D$PC Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u 8tz`Xt$76u 6-6CPV2t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPP jd |$tt$ VUWN  UW= b8C|$$8D$@PWNtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW t!t$ VUW贀 #|$$tS9u$UW= RW> $D$utSPW> uWh$hh1ļ^_[]Ë 3DQu^_Whg"jN fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3Wh%Bb uWVhM"j N D$@tY$$QPhl'hVdV$$$$$h $jUSWVMu1} ]hD$ PV" D$ FxD$D$D$D$D$h$WST L~)Hw;$'5T+=Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5T+=L$1@D$kjuh,'5T+=JPcJ=N|45T+=1@D$5T+=Fp1@D$5T+=L$ 1@D$ԟ3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ ,tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ WGWf@$N|dže^_[]h"jJ t$h$PhI$h3 j)WVPt$jWVG 9u9t x^_Vt$h"j]J Vt$VOt@^h$6#V^Vt$VTt@^hG%V|^WVPt$jWV]G 9t9u x^_Vh"jI WVt$|$ VW t$?/tWh|"Vh"r^_Whg"jI fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$s] uI趯8KD$  =l6%D$ Vt$S jHSt$D$@D$ $p QPhT'hVu_D$tS\$O$oj j ShWt$ P*tP=Ph$/t$ SWh$t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h$l81p^_[]WVhM"jH jwSWV\$D$@u+t$0Rt;SP t7V t5jhS$W* tZPWE $T$D$0PWD$0t 8D$ D$(JD$0PWD$0t 8D$ vD$$c5&$T$$MA QD$5T+=D$o5T+=D$1@D$Q5T+=tD$ 1@D$35ԟ3)h4uUF }WtD$0PW|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5T+=h3$h" 5T+=hX$j7 Wh2$PWh$Wh$ PWh$jH7 Whr$kPh$h3+ j豭SWV$t$$$$\$VPWS$H$HTj S7Vh"-K D$@t$h$t$t$h$ t$ t$ h$ t$:At0h͓$ϵjt$h$躵 t$;t0h$蛵jt$ hۓ$膵 t$ h$u1$^_[Vh$j)6 WVt$ |$7x WV1^_U0E\$D$,1ɍT$ QQPRha$xuUD$ L$$L$D$l$&\$ D$L$ |$D$ fD$l$|$l$D$T$]hn$jp5 WVPt$jWV2 9u9t x^_Vt$h"j5 Vt$V9t@^h$6#V^Vt$V>t@^hG%V|^WVPt$jWV2 9t9u x^_Vh"j4 WVt$|$ VW运 t$?/tWh|"(Vh"^_Whg"jg4 fWV1t$|$ ɉ @4u*ȉXȉX\ȉ\ȉ*a*A* PQ40 *40<8)<8D@)D@LH)LHTP)TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40(40<8(<8D@(D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w79(Vw w&(V Fww(VFww'VF^_USWV\$l$EffEffCEffCEffCu u'S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu&SCuu&SCu$u &S$C EDȉCDu,u(&S,C(E@ȉC@u4u0&S4C0EHȉCHuh$YY=L6<$=T+=hP%W~uT6G=T+=1{$PPjPPdO31@D$$T+=1G#PPjPPj@6mT+=1{$PPhPh<X6P9T+=1,$PPhPjd6 =T+==46j:WLWAj/W9W.?y86T+=%$l$0UU݋\$UW|$Pv l6h6s3DH,WD$hJ%W}hw&W}$6W <6N1$PPhPj lO3,H6 3DHW}D$<$$6h$ԟ3=dO3_=<6tVh$z5T+=h$j5T+=h$Zhʖ$Ph"j# Whv$9Whp$.D$ =@6u1=D6@@6$1󫍄$B,6Al$$+D$ -D6t1$ 1D$$$MljL$$ PWc?t$h[$X6l$Ul$RQPu $׉ȉ h6=l61| h$$t/$$T$9‰sQt$t$WPh6$tFtA X6WPUt u5l65h6t$hy$|$(F=$PU< uRt$h$ A#$=`hp6h$1=P6 $VhWu Vh$al$VjD$Ṕ h6-X6-l6݃=@6~VUWt$h˜$ |>9|Pt$t$ O )̓ }4$:\$l$ 66ɋ|$  6=86 l65h6σ|,@σ|1ҿ9  X69|щ 6|$ D=P6Ejjhp6 .hp6h$6=86t686t&hQh$ 866t=|hPhZ$̧ =(6u1=61@(6=`6u 6`6=hO3,=$6t#jhљ$h$h$i$6=\6u=dO36\6t$t$ t$4Ut$$Vt$t 9t V t U =D69$PtEvtƃhR$Nj s&Ph$jd$ Pə. j j j h%1 t6$X6h6ApQt,6@jxQP$PhR$/ g0ёVh$jd$ P,$\ $|$8j@&U$P菟 $PSfsu/jZ$P$dPr u$<mfsjWV 9uD$8%PPP$Ph$h $|$D$D$4jPc $u/hp6h$$Ph$jXF hϼ#j : /dev3p6 t6/ D$ u6tD$ p6<$~~l$4 $jWh<"{q u ƃrl$Wl$$UrMGWUr:l$ ʼn\$4Ë$H$|$06\$L$ u D06$dT$dž,<tx(=86dž dž,dž(Ɔ lO3pO3u(jh$=L6-5|6u"jh$=L6,5|6 6N06F4Qt$QhE$臒=L6w,5|6F4Ht$Phn$\=L6S,5|6F4 X69}"QPh$- =L6+,5|6F0=)hPhȟ$ =L6+5|6F0=|)hPh$͑ =L6+5|6F0N49}QPh$衑 =L6+ 6|6;6|QUUUU)ʹ3333!!сis{09\~\{0\\5(6sXș9}%CX=@6~QhY$|6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hq$=L6**|6{4$=X611F9tA uPhŢ$jW $Kd=l65h6 u։<8=dO3[ WVh$X =L6)|6<$C4$8=X6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPFdNjs8ƒPVRW蒒)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh$=L6'd6tm |6yxH1҉$q1ҋ8$$)$<$$1C$I8$ `6=|6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W!b1C1 t׉Ë$$QPV$$V 9s($$$VaÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP ƒ$$$$$$׋$$$RPVQ $9wȃr$9‹$֋$r‰$$$$$B1WRQP^Ë$Ë$ʃQPRS5)ÍC4$$W$$P$Q @$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ]j$P$$ @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh$n =L6 |6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=dO3$_|HL!ʉG41SSjhjPSQ6N |6I4QSPg |6H 6 6 6P44Q56щ 6`@#HL 9| Hh hO3H< (6HX \6H\ $6PTXH fǀ$%=|6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=dO35O _(HLJ$<6$$$t!LJ^F=@6$$߬$$ڌ$&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$/$  |6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$j$誀=|6O0 9| IУ66=D6u\Tu))У61VVjhjPV 6u696656jPc =P6Gl6 h61ظ|(RQh$ =L6l6 h6565X6~ ș)dہ|4('GuȹC=86tL1$PP$$546V1=X6VhZN X61u;1$VhjVu  =65|6h`VWB9 =H6tWV5|6x\6hhPa 1@$=@6h$^=@6|o5|6N,I\Tt~!NȃN׊Nd1 t1WPhd$RRm|$639u1H$Whht@P-G PPftu!ѡ@6t $ Q$=P6u$|&|6H,$$DŽ$%$ |6I,$1$ DŽ$1h(35|6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hH$ʪ=L6Y |6j56_ 56FU $F +$^|6$~J`^p=dO3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=86uFh$ NlK`ڍOȃ$ډFd;v&h*$=L6|656F $11ہ~U uv`щSA|6$~!ـ1@ 6Il |656F=dO3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\56N uҋ|6B8H!tk)D4|6B8)Nj56$9sE)ȉـ1B~U uv`56F$CHu͋|6B8$؋N9ȉ$J`~U uv`щS|6$~!ـ1@ 6Il |656F=dO3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD456;Vs2р1@~U uv`56F$Bɋ|6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$6H 6V$P V PV~x; 6up=H6t6s4PP |66@6Kd156s466 |6q4jPW |656{0 9 6PVQ. =H6t65|6P56g |6y06$ryxtG$\%TuCl$AP$ |6Ou$ց\TtQ!QЃyId t156563 5|6\TG~8^xN`1?9'6+$~0lj$Ɖ$)ى$=6$%Gl669wߋ$9w$|6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=@6} $H$$$~A=P62$=|j.Up扄$#t% |6ׁ\TtQ!QЃYId t1RP$Vh$p$$;$$|W=@69|6H,t =P6 $$ DŽ$j WoDŽ$C|6;X,/$~ j )o=P6 $hjPeS dO3 D6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A8tx$0h"b$11҉ $ƅ*ŰPj PUD ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VW2 t$?/tWh|" aVh"`^_Whg"jK fUSWV|$$\$(SWt$(t$(9)jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPoE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV>8 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^u?Vh[$jY =6jjhػ6^ hػ6h$ljt$1=6 |$u =Ի6л6)j5Ļ65Ի65л6O$ףл6Ի61҉|`$$P$T u$$j5Ļ6QP# $׉ȉ л6=Ի61| h$$t.$$$9‰sQt$t$ WPh6$qt%l$ ʼnt$ Ƌ$Hl$ |$($tWPjUhػ6uhػ6hԓ'=Ļ6u$|Ļ6u hޗ$D$ػ6$t$>$Vj$u Vh$ Ļ6Ի6%л6ʼn߃=6~VWUt$h˜$'K|>9|Pt$t$k )σ}4$ 6-6uU-6uY5Ի6=л6Ļ6@19lj| 19ǃ| 6u 6͋5Ի6=л6Ļ6ˉjURPo =̻6l$ Ȼ6uA@19lj$ $t$u hػ6h$jPVW v|$wext23$2fs3$ Wh`"hػ6h'Vhػ6hʗ$} 19ǃ} h $ ̻6t$VUt$  U" t 9t V jF@USWVӉ $E0|$j W\$ S~P Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ h/8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h " QPWUt$t$h:" t$t$h"j7 WV`-3Phl$VJ 1GVWjh" Vh'ͷW>USWVu} D$8jPC=ؿ65ܿ656%UUUU)3333!!щ%i6BĻ699S3S3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=Ի6л6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1̻6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ̻6566S3t$ƺQ=6D$6D$ 66D$661 65 6D$8666S6 6$6N5(6,6<6@6[D6Z:f06 f2646 S3f86\$H$SWP 93rWhH6芍 56|$t"VYjVhX6 1h6666,6D$<6 6+ 6 1҃r1I156~σRVPW56H19w+56|$OL$)9r΅u <6f565656V6YVjP% GD$AD$ 11L$\$66tnD6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@<6t 6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ,6|$11t$66=6~i 6 i{56Q5Ի65л6PRuh_$~@ 6 656PQWh$W@6@661QQjhjPQ6I 56jP# =6ukԻ6 л61! V5Ļ6 1N1Ƀ *&Fu  1@D$$=6|>h$n=6|(L$ 6 61PQhd$PP=D$$639u1H|$LWhht@P PPftu!ыt$6tL$QT$=6uL$L$D$ 1D$L$ 11T$h(3=,6t$tXD6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5:6616 56D$ hh6P 566P56Vt$~ =6=6 615Ļ6ǡ6)؉1t$ P =6Wjh6 ! 6H9|$u_656 6)ʍZ9s1Gр6B9r)6VhP  t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P 6 6L$)QhP u16@ u6L$ D 61Ҿ6Vt$# 56jVs =6tb1=6t 1S3[a6F;56r6L$ D 61h656 G;=6r=6t$|\tX=,6teD6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=6|$T$T$|ʉj.9t$몸#|$|$t% 6 6jQt$,Ph$:T$;D$_=6* 6t=6u&D$ D$D$j Y91h6c##:~ j 39=6d=,61<6$hjVU fF쀁0fFD$8FFF fF56 ׉؉t$ ֍$fBt D6$,F܉VDF81 L$ F4D$4z 61CL$ =6WD$(\WD$S56tPjt$0H 6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ D6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP" L$ D$1t$V 61CL$ \$6 6=6t$,9sD$()QjP t$ML$ D$41ҋt$(VW'V($Yj=,6t@6t V3W3V3@1=6à r t$hhjV  fFA>-fF6ÉFD$8FFFm 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h65656f5X3|$D$1ۉt$ X3x1ɉt$)r6RQP WhX36V X36D$ f 6 61Vt$ \9\$t56X3D$ CiL$T 1VhVD$pPy 95,6t@6tS3T3U3fD$TA+fD$VS3ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h656iL$Tj f:61ۃ=6 56<hh6W 566P56V 56 615Ļ6ơ6)؉1WP5656e^_[]h$h$ >$h7$Px3hš$Ph$h$Vh$Rh$PRh$hVh$hVh>$RVhh$Wh$VPhݩ$h©$vjVWt$h$gh $`h=$Yh$Rh%$KRQhӦ$B$1h$'h$h$"h$h$h$hL$ h$h$j USWV6=,6trD6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ<6t 6 6Ѓ^_[]SWV=6u0׉΋ Ļ6\$QPSt$ 5ܿ6茅 9u^_[WVh$h$j^ USWV=6΁ 7u=61 6 7Ļ611;л6-Ի6ǡ669v@1Sh'8!;HtH#P;Pt1A xVWh7h$($ h$ɕh381B 8$8@88088488888 8 uCء8888 8 88 8 8 ؉+88D$HT$Ll$H 8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88&wh87 88 888 8ʚ; 886eĉ 811ۋ88D$T$ ؋88D$8D$8D$5 8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v 885 8=8|$(t$(|$D$ fD$ l$ \$,l$|$,= 8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8= 8(7t 1A(7y77 79}(8i-@=B'7@9u8e^_[]hA$hv$jЕ USWVh8j h7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$D8;,7D$D8 8 t]+ 88$$߬$ 8+8D$\D$\5&&s=$8uZ(7tQ8 8 t5+ 88L$xD$|l$x 8+8D$XD$X5&wD$DD$D(887 &w١8 8 t>+ 0848$$߬$8+88D$`D$`5&D$Dw\$8 7$fDŽ$jh8j@` D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$P` SD$lD$lPD$,Pj57575 7[` <h8j 7D$8<BC97)؉D$D$8 T$'\$A98I؉L$A 8Iff9u$88888888 8u888888<8(7 1D$18 8l1A h\$蠍h3A(7<1A t$, PVh$B ΍T$(jt$>Phd$ D$ (7t$؉T$΍T$(jt$F$'h$΍T$(jt$Jh$f΍T$(jt$bF$'h$΍T$(jt$$Fft$NfQPhN$ ΍T$(jt$؉t$hi$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh$΍T$(jt$ ؉t$h$΍T$(jt$؉t$h$΍T$(jt$d؉t$h($΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h<$)΍T$(jt$-؉t$hQ$ h$ Phβ$ L$lL$AQ D$iPh"$ hͱ$ h۱$h$ Nh8h9$e t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ$L$dT$C;\8u#Ph`8QD$XnL$$ D$L\8PQh`81 T$Ҹ$u1G$T$Pf L$r |$ rI03H 03~(3H (3 h(3j (  }T$A{^N2D$ˀ) h$ uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$A h$+ 9 |$ sS03H 03~(3H (3 h(3j   }KF߉Ήs(T$h$ L$T$؅t%03H 03~(3H (3 1I h(3j h(3-ء<8;,7*؅tء(7!^L$AQ T$Q=8 8 t+)|$L$p|$tl$p8)ЉD$PD$P5&8888Y3vY3(8v(8\$CfK%8f!t8 <8T$ .KfKf8D$ 8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J8@)t2(uK 8(7t1 8h$ 8 (7 PVh$ Ph$h$h4$hU$AfPhr$h$h$hð$hܰ$h$h $h#$h3$hD$wh]$mhw$c 8hЭ$>1BD$D$pfY3@)f~\(7tSωL$!ȹT$V!RPt$ h $T$ D$,(7t1RT$D$fxf5Y3(7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B7C9D$=(7 ؉T$57|$77)RQPh GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E57)7t$>RQPhU$K7;7}0u h$+Ph5$Cы\$1B\$D$\$D$T$jhe$j褄 1AhM"WV8@8~bD8H8 03Q03; @3h(3j.+ @8 (3Q(3.H @8by`)D8H8 03Q03; @3h(3j@8 (3Q(3H @8|tN=D8t403H 03~(3H (3 h(3j ]D8H8h(3菻h3肻8P88T88X88^_jj1A1=<8P_USWV׉E\$1AM(7]E uWVh$t h߮$Sh$(7t5@D$ &\$D$$$(7fyuh3jte^_[]UVh1AtD$7$$=8D$$$(<8D$$1$8tD$$G$8t9+ <8} $X$!L$LD$L &D$Ht$H\$${$$  <8(7 8L$DD$D=8@|-8& Y3 (8\$,D$(\$ D$\$D$\$D$$$(78 8 t5+ 88L$XD$\l$X8+8D$@D$@5&48 08 t7+ 88L$PD$Tl$P88+8D$L> QPh$l(7tkD>L> QPh$F|>uGD>(7ufPh$"L> ffPQh˳$ ^_[WV)7u8jjV. t'86 PWh$hh8"6} Ph$hh8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h $*$t$t$ t$SPh$ UPh$s t$t$t$ h $Zt$ Ph2$@t$ PhH{$&r0G9s'GPh:#| KG9r߃$^_[]fUSWVƀ8-uFh"T#Vu 8hS#V1u 8T$,11CD$D$hG$Rt$0 Hw؉$P'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 ԟ31;L$(ujy1L$ 1ɉT$Љ $PL$Au $AP+D$t2ڋL$ PWpV Wf uމ$DuY|$uj] Džu蝋 P_$t8=8uIj Vh"T#& WhP$T1FVگPh$V[y SU$J hT#=8Mj VhS#Я Wh]$Vɯ \$#3"$VWSo jjVWSa\$ulE 1GWWWjWjWjWVrWj gVWG u h$jx jjG u$8jN8 uD j;8 j jF t)qtOQ8 j jF u$8t1Aj jhT#臮 ukWh$jh̶$t$UH $Q&t>0WW%F $t#VPSh%Wmw SWho$jAVЕ&=8u#nVPh$h3-jfD$tPhԷ$5h'Ph$h3jvUSWVPu } h'WV~ cR~5StET $8͍Hw4$'8벃L88둃ftTdL 8t8e(8V 8G,88 8) ԟ3谀08=(8tjjh\%D 48ND$ jjj"腀 48jL$$Qh@hPv u h%q48i )ލ<S H $'= 8t1Aj D$<1CPS͊D$D$ PS越D$D$$PS蟊D$D$(PS舊D$ D$,PSqD$D$0PSZD$D$4PSCD$8|$ |$z |$o |$ d |$Y |$N F D8D$8gtj548]D rD$ D$#D$D$#_;-88S;t.H$1ۃ=8uWhi$hM$h׼%T >h &Sg =8uh8$h $h׼% 1CH8FLCSS H3 VT$W$ؘ' \$@1ɍP$'`81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12h8#H8L$L$# 1AD$ PD$@PD$ D$<+<8R D$ Pj$D8[3D8[3D8[3 P8T8׋t$#D$ Pj@8d$zT$ ED$ L$TL$@JL$CD8"[3-L$#d$d$d$L$׋t$p8:8@.8"x88 8\$ 8P8T8 t X8t P81SSPr L$Y\= 8j$)/jD$D$ D$#D$#88L$9a|$u q<8 @8ta|$  ‰4 D$=H8T$tD$1@D$ 1ۉD$0|hxSh8 atgcuL$8 88X8@X888888X8 8 8tJt$(~A|t188t|$ ObT88(8tPt$ tH@WVh(8|w (8=,8t= 8uT$88tMD$tH@Vt$ W(w =,8t= 8uL$a$88tDD$(tIAVPWv =,8t= 8uL$(o${88tDD$,tIAVPWv =,8t= 8uL$,}$.88tDD$4tIAVPW?v =,8t= 8uL$4$88 tDD$0tIAVPWu =,8t= 8uL$0$8)f=8=,8tP= 8uG=88t403H 03~(3H (3 h(3j 81=8IWh8548t8 u+787t-t)7|$t+u-$/9|$Ph$!$|$ $ P赡Ph$83u=D8t"1ۃ8=D81ۀ?D$PSVhӾ$wh(3j^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV莋+D$  Pc1PPWSjVV|$dt$ \$hܿ$D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9[3tE[3P{y$L$t h@$he$QQh}&PPh*$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP{#PPh˿$T 03H 03~(3H (3 h(3j T$h9t$,r hܿ$L^_[]h$ jh$jU D$t'T$tt h@$he$QQh}&PPh*$ ËD$t%u_$%tuO$Phi$F$Y$PhE#:USWV|$<\$8D$4t$0~u/jUp u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR"Ph$PWh#w ^_[]USWV|$4t$0=`8uM`8hha8n_t a8'j.ha8…t@hPha8a t"^tCt0Wv`rhh΄%hh8a ^_[]1w)ȉPjQ SVU, fEu jUn WUu&Vhh8Sh$hhh8h8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhh8Sh$hhh8th8[SWV$L$4D$1GL't$"tZ@:t9rD$Ph$,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vt@ha8PXu7ut$o ΄%hVhh8_ h8^_[VD$L$ 1Ҁ0QRRhhh8VP thh%hh8݃ h8^Au yuyt$Qtu ȃPץ Qϣ APhԿ$hhh8h8SWVD$h8Q4$Rc84$Rd8ƄRe8.r|I1AFL$ tWWVWh'$ u;D$ D$ POWWVD$Ph't$ tt$`Ĩ ^_[]h%t$ tԉ1|$l$Vh$PVSPZHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$Yt!ʼnD$t$Wh|dt$ʋ ul$$WhedAP诋 f$a$>ukSt$h<"h&h$WsƄ$tt85w$ $tk$QPW $Kà9Éu|$$PQ 1h%j Å~A1ۉh "PAujVh<"h%h$W蝿Ƅ$|$tt8\w$ $t蒦$QPW C;\$ mU]|$l$|$$PUSWV ) uj菷D$$D$<$sh$VUth%VC3hU@ Ƅ$h%s ut s h%Vtt s h$Vt PJ t8D$ h$VͶtHáx8th'$P耘(j,SqtZ S8J,PD$PUs!xD$!=`ÉUh$< SIDž?tG<$tSWUh$h%h$VMV tEUh$Zh$?Uh $h%h$P15x8tD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$SZ\$ =8uD$$D$ P$P蠭 ȕ8\$t$Ph$+8PU uUh$f+1@$~#Qht$葹1@$\$$$Ĕ ^_[]$Ph$j. 诓Ph$h3o jUSWV L$8$T$t-8*jh8V 8š8$T$1i E$48t!u6$t$PVT$ uF$t$P:T$ tEM<ǃ h$*1 ^_[]ËD$ t 08$4$݋D$ t 08$$ؾ8Phh8>- uh8h$jV- fVD$t.})zhʑ9h$59 9T%%%О'PQh%59Ǯ#u59hBn$v9^ËD$ H^WVθ%О'PVt)uVhm$59W 9SGt8tPwh$j wh $Xuj whʑ9E: G99^_WVD$ t;59D$=`8 9u `8О';pt8@uVh$j+ @u=`9th`9Ph$赀 Ph $襀u59=`8^_Ã|$t $y9Ã|$t %X9Ã|$t $r79Ã|$uh<9h"$59Ӭ 9Ã|$uh9hC$59袬 ձ9Ã|$uh9hf$59q 褱9SWV$$DŽ$HH$pyƋ$ ƒtS!=9$t$$atσ=9 =9 PSj $;rtr1Auu($$h$PQ te$P$$h$PQm t8$(1;BQPVW7VE>9^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hh9trʄt<$1ۊ9t8tCu 9s9B+$=FFu4$D$|$ 1 ʉ9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ ʍ9<$؉D$ʍ9$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$59h$^<$?uhVW2 x^_[]USWV0$Du%$H$Dh$PQT y1E-9h=j(Uh8̷ t$H4$=9I1VV$P Í|$0;=<9=9$H595959s =9$t$9ƒ=L8RPSQGy=9uE=9t<L8L8$Hct9L8 9VV$P Å 4$j990^_[]Ã$D|Ã=<9t=H8;1 T$󫋄$HRjh4 |$D$=<9ʉǃ=9$H[L$05959j =9$t$9Ã=L8VPRQw=9u9=9t05L8L8$H1t95L8G=<9-=9$H$HL$05959j ƃ=9$t$$H9=L8PVRQv=9u_=9tV=L8L8$H1t9=L8$$H4h$"D$P% E;$Dnj=9t#9@=u1HjhmS#P jh8 WV=9t@=9t75L8=PI9L8PI915L8=PI9u 9^_USWV1@=L8S=PI9Fϻ$ͅtUSh$59K59Wt$PhVhХ3xd3L$DH?u9t$j9Ą^_[]59jj/h$KUSWV $ u{$$hR#wtrƉj h%S& x9 |97b$t$l$ jhUVx!|$ toSjWj@b!Vn whK$59 9 ^_[]Ã|$v#tڞ"Ã|$t!h$hv$hf$59躙11H9WVt$D$ tu51>#t5D8RPh$Qh8#59jj6hm$Fh819^_h$hH8t$t$ 9h$h\8t$t$9WVD$ tZ}UuZt$~hڞ"WFtOhv#WFtBWy7vh$59' Z1H_1=91@19 91Ҿv#tڞ" щ 9PVh$59Ȕ1=99^_ËD$uD$L$h $PQ tvD$ph\$gu<=9u0=`8t59h1$D$ph[$fgu+999>9VD$ L$9t u]H 9HQ"tsP( t8[=99t5h9ht$P苓 9(^鳘Vhc$ Pjj$h$WDV-^ËD$tIDuD$L$h$PQK t$D$ph$Gfu909SWVD$-uD$L$h$PQ  1G=9h=j輴Wh8` t D$1VVt$@ ǀ?tx=9tyD$thWh$teu 9=9uB=9t9=L8L8D$bt9=L8 9VVt$ DžaSj׳99^_[ËD$uD$L$h$PQ tmD$_D$L$h$PQx tI|$BD$ph$mdu8D$ph$Tdu9Ãt89USWVt$ |$.E1ۈ$59jj,h$@% u v1.贔9^_[]9USWV D$ #D$$L$ h$PQS L$ ȃ#D$$L$ h$PQ) D$ L$$|<$Dh{#t$Qet3$8|t+4$$H$$ 3D$$h5$0eD$1E-9h=j臰Uh8+ t D$$\t$=91D$ H9=<97b$t &$9t$t=E$T$$VVP4t$Q܀9u?=9t6L8L8D$$" 9tA 9L8E_t$j覯9$9t4$'衒9 ^_[]SWV$tKjjQ tK~S蛠 9uWj(1uhL$x+1H9^_[þV! Fujjۮh#" ;%tj/VO t@hQW =9t859V: 9HQP~ Q Pj Q|j5d9hq#WVň  jWV跈 Vh9$9j腀SWVPD$D$t&D$t$hs$PV r9^_[ËD$ph|$^u|$h$ tD$x|$Wh$^W`PjWl uP|$h$ t D$x |$Wh$;^W_PjWk 1ۃuM|$ Àu*D$p Vh$]Vt_PjVk <959h$Q D$9=9t =9u&=9t#h9h$59- 959jj%h$ ;ËD$9-=9u=9t#h9h$59ĉ 959jj$h$:ËD$uD$L$h $PQ蘺 teD$phC$\u<=9u0=`8t59h$ D$phB$S\u9<9ËD$uD$L$h $PQ teD$phu$[u<=9u0=`8t59hJ$Q D$pht$[u9蒍9ËD$t8uD$L$h|$PQQ tD$L$QPh# B9USWVh$V $|F$$h1Gh4V 9}hh%V G9$uVh$Zu jLT9^_[]ËD$t8uD$L$h$PQ\ tD$L$QPh$ M9ËD$thuD$L$hO$PQ tHD$:D$L$h$PQ t$|$D$pph$Y Ãt͋9VD$t$5`8`8u h$Y%萋9D$ ph$rY5`8^VD$HrV9>5`8`8uh$*YD$ ph$Y5`8^VD$t$5`8`8u h$X%؊9D$ ph$X5`8^Ã|$u|$t蝊9Ã=<9t 1PP)jg=<9t 1PP jy|$u|$tD9Ã=<9th$%X釽V1VVcV]yVPD$ D$t}uD$p*9h@$W't+h~%W&t hG$W&u7 1Cvݻtt9u9hz1H!9P59hO$59 u19^_[VD$ L$9ʃuCuDhF$P(t$DhP$$t$蜵 $t|$@t$t$@ЃD$;p8t|$tt$D$L$dC.$`7.$s.$tg.|$Htt$HMD$H|$Ptt$P2D$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=p8t;P襡D$HL$H+p8tD$Ej/t$L"* t@Pt$Dhw$t$HYD$t$Ip8L$D|$D$81|9x9t9p9$$9t8t1$Pt$ u$\$` |9x9|$py9$hR#t$L蒸D$|$t$A$QP&u5$8$<$$$\$` t9p9x9 |9t+t$޷j5|95x9P,Y=`8tPt$Hh$59]e |9x9 tQPh $597e59hmS# 1O$=9Y91O$8|$pu5 D$TQh$mD8ht$hW =9|$Lu:|$LD$puuh$t$HhM$[uh$}D$L9$|$LD$L8|$dD$t$h$}8P莞$$W8$<hB &Ve1A$<$ǀ?tvj:W& t=@j $QPf ~޻t?$9u3;$u*W"89$<r$)PWR t/hB &V#eDžm1Ft$Hh$1$t P$$u |$p$$x9 |9t$Lt Vh)$t$dKt|$dj%Wt WhV$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1h%W8tVh$j$7(2WjDŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB 8JBB D$$PRW$86 t ]E0~RtD$$Z$$Pf-j j WhSvvt% t%h #PS j #PW =`8t+D$$xt!~$t$WSP59g`v jv7 Åx`=`8u~PvvS-x)$P$P$Ph# ykSF 1KW$Ph$[ Nȉޅɍ$P4 PW$4h$qhh1N=P8tJ$t$uP$$t$uPљ$@9~R9Wh$5tNu1h@h$hL 9@ t905LI9ދ$tPYDŽ$$t4Wq3PjW? $tPDŽ$$t4W23PjWF? $tPDŽ$D$$t P63 |$D$$hj($9<tQh$$芰D$$\t$ Bj9tV=`8tWhc$59] t$$tI=`8 D$tPt$hh<$h@$59G]1@t$ht$hhJ$t |$dwh^$Vĭ #hp$V譭h~$V蟭9xt'1ɉϋ4h|#V} G9Љ;zrۡx9 |959h<$m 5|95x9h$V/5|95x9h$59d\1F&1t$lhL$V $`#=9t"D$$$t$QP躬|$h$- tPh$W薬 h$hv$h$W|D$$0$|$Pt1$t<$t,#tD=`8$tPh-$59v[ FWhc$$8W $$0t-=`8tPhB$59.[ FSh]$Wʫ t=`8t59hS,$ hN$t$ 虫t$21V|\$D$Lt$P5b3DƉ$$ىD$ډ׋$$|$8‹$4$8$ 8ˉƉ$D$@1S$P$+$$$$+$ى|g@By)QLj$Pz$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5858" hN$58"M|$`=$@$Dt$h#Kh{#t$~"D$8|jjj m$D$@h7b$Pu D$@|$@DŽ$%|9 x9 m!ڃt9}M#$H5t9p9$$!;$$=`8t59jj h$D$TLD$@(3x=9=d8|8 x8ƒ89}%9HQP ;HQ#9HQP<Q 8tB$ڋ$!t p95t91ϋ$H1 D$h &P h7b$t$JD$@|$@tDŽ$ t$oD$@Ph9$h$Vh$Og."8)PSh$.h$%Pt$Hh$jykh*$hL$HRbh$l$,|$ $tc?tTj/W L$9uut$@jh%V @L$ǃuC=H8taD$t$uI$t>th$V1Ʌ $t}th$U1ɉL$<=9=<9t 1PPѼ=9 %|$DhPW |$L$D$L$D$ tD$ D$$=P8P8L$QPp=P8<9t=ut$8t$8t$ D$Pj3D$T$ #tQPh$I "D$Pj觓<$l$,|$u'j/VtG1|$t>tFhhp&l$LU l$t$1l$ -9D$Pj9-9*x1l$,1Kd}Z<$t3$DSVWc Sh%W SUW <$hh%t$LV) t$l$D$ D$<4uT5L8L8=t8$t$hP|$LW |$D$Pj5L8p8uj/U t@ʼnD$ D$$=t8tAD$Pj?>uP=9uDh3jhh0$)1D$PjT891ۃcÍL$%L$0d؁D^_[]1Eh$xGPh&$h $j莼 USWV օ\$ |$$jh$Q l$t=jh!$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CS:yS\$$UP { uG<$WxC Uxj@Vj|$$tZ{ u 9w@PwƋ_j:S2t@PwG_Ot[uUnj]U$tYÊ@t<:uL)SUVr Vf,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PU> }t $9ut=s fCt$t$Uh9$DCC tWt_uk<8KUVh$D t$t$Vh$D\$ n1HJ3@8(u#U8vC{u{ %t%PvC1 ^_[]h$jq WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj_\=9t<Ph"$jdVQ6~ 9Iu1IPVQ jh 8>L Vd88j[=9t<(Ph\$jdV5~ 9Iu1IPVQ蔄 jh 8K V΋tP/FtPFFtPF^WV΋AtPF~t,WPjW FtPF^_SWV׉΋j:S tDSsP蔄tj%StSh$Vz SNSh$V` G tu)GfPu G=tPhH$V+ hN$V^_[USWVP։ϋ\$l$ 9<tP/ZPUVWjZ x.1tETw4s,I  $8 u@$PhC$@1@^_[]USWVPӉR} lj4$6Mw sEWSUN 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ D8 H8 L8 P8 T8 X8 \8 `8 d8 h8 l8 p8 t8 x8T$(JJJJ58rBJ PRSW t u !0$@t0hP.P0 PSWh5$ ?9hWhD8n 9D8<$l$\$HWj j UhSww t h #VS j VU =`8t*$xt!$t$USP595w jwh x6ư=`8uPwwV^yWV蠂 USh$迯 #$d$dhJ$= 94$ xwwhD8 GD84$ $D8D$HSh`8Vk] D$H`8=E8uD$jUjjVx hR#Vz9h7b$Vg9=9=`8t59h$59+4 j}^\$WSjUV WShUV 9c$d$dhN$M 1h$<9t P9t P 9V׀ 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4|88h~jUD$(D$ hjTD$,D$D$8D$D$$$911L$8L$\$0D$t$$ 9<tPjTW59v=W59\r&wW598tPhW59tPhhh>$59159?Cà u $E`8uw|$5uprk=9ub=9t&t uu59hw"$59h1 9HQP;H\˃ PQ $w3DXt9CУ99uss)5 $ ȸdtȃru3DXu 1@OuJ t$ tB$T$у)l$t=8s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t 9D$ $؅t荌$79L$`L$AL$PPS2=`8\$0l$uE5u@=9u79HQP~ Q Pj 259D$x u@uhD$ WVP=9|$|8h~jNƍD$$PW590 59hN$> 599h$W1ɅQǃ=|8t @w3t.Vj1Nh$491^_jփUSWVu} 1D$(D$ 8T$L$9"D$|8x81Kt9p9 d8L$,9`8t7}t1?-tWh$59_+ tVhe$59G+ =9tVu u ~999t jP }D$ \$\$jh8< hjLhjLD$h{#} W8 ?|jj LD$_hR#SS D$|$4d8D$ j3=9u9D$tt$jHLD$tt$j 1Ll8xPSw l8|$ t|$t D$ t$Ѓ|$t t$;D$,d81|9x9|8x8e^_[]D$Х3d8} 5jh8C; Ct$jyKD$=9l8xPv l8|$tt$D$j9|8=x8jTKhR#W;)D$|$D$ D$fxtD$XD$0PS}x.#D$8=u$$ t9p9u h$59H( Sh9$WhM$譢|9 x97b$ t^L$$h$Wth$Wm7b$u39H D$fxL$$D$@щ˅tVWh% Wh$@9SvD$|$ 89t9tP 8tQ99|ʉ׺9օt 8Qb8j@D$ujj HD$=9tD8=d8t t9!ȉ'D$$jSPt$f19HsoL$1HfytL$IT$fztD$PW585858E:u h#蕠%\$(St$tƃ t0ti|8 x8;L$D$|T9HQP;H~0Q#598L$D$L$Pj#(͍D$ Pt$ j t D$@ @x8|8D$ Pt$ Vt ttD$@ @ujx8|81HjSQPЅx,5|95x9h $ $u h$6n} tc|8 x8;L$D$}%9HQP ;HQ#9HQP~ Q Pj W'D$@ @tt$(0Wh#褞D$@ @t/t$ 08 t h$x1H|8x8j=|$ tD$ t$ЃD$t$)1t$V|8=x8NPj#&SWV |$$D$h $Wt D$ $=9$t$D$9ƅu=9=9 4F959t jVuh>$)j$=<9959t jVth8hS$t$ jh8\4 jh8E4 h`jzD8h $W 9|t1@v59h$ M59h;$͏ j!#9!hjC$ |9x9 tQPh $ \$$SWh% j_ j"D$ |9x9 tQPh $ Vt$h%v 81WWE"W4$jCj%"=8SVh[$59 4$jBj! ^_[Åu1t P!=9t jI  |$1=9P!=9t j  |$1=9Pi!=9tV 91j J$,y hq$苚=48t 9j`YVV=9t j j =48t 94$jAVt$h% t)Vt$h% u=9 j =9{jlWVd881V A595|89rt suY$$dWPV" Wh$Vӫ 9Iu1IPVQi jh80 Ph$j藜 USWVD$=T8p8`8 8jjP6 l89tL$jQjhP  8<<=8w=8j=`8=9u `8h$Ɖ=`8~&t =<9u!h9h$59 =<9tC9=$ 59h$8 h$֗1A =8=8=`8=9u `8h$JƉ=`8~&t =<9u%h9h$59 =<9y9=tT$ wJ59h$v ?$tg8h>$=<9 >$3$t28hC$=<9C$PASV3Q LPSV3Q QEPSV3I1  $9=t$$ <$$T$$$VRQPWh$h8 $$:$:$:$8D8D$ff 8k=X85l8oh l8T8=918`8u f 8l8t Ph  8jjP蘣 l8=9u(QT$ RQhPx l8 8Qh8P 9tjD$ Pjh5l8' D$18 88888 8D$Ph85l8B OD$8j5l8hy h$?=9" 8$t#/=8=8=8=81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =`8=9u `8$P$Pt$h9$Ɖ=`8~&t =<9u.h9h$59 =<9+8 8tPV 8 8858= 8 8SWVRQPhI$T8$8$8D$|8D$x8D$t8D$p8D$l8D$h8D$d8D$`8D$\-88=8588 8 8PQjRVWSUt$|$$$$$$$$$$jjh`$;X=<9[=9N91ۉh$51A#h$h$u 91ɀ= 8D$jD$ Pjj5l8A 1Ƀ59hH$ 1E= 89=$ w59h$h$n5l80c l81AJ9;9=t+$ w!59h $W59QW 뗠 8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhT$h8 , |$ |$|$1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ fD$ L$$T$(t$\$VWRQPSh]$h8 1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ f 8f 8;H88jPh85l8_1ɀ= 8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph0$h8k \|$ |$|$18 88888 8f8L8@uD$ $ ff 8jhL8h8r 59h$59h_$59h$59ho$59h$=X8USWVX=T8l8tuPjjP^ ƃPj5l8^ t$l8D$fD$D$jP9<D$T$ |$ Mbt$1PW躡T$L$+T$ +L$(x@Biy1PjV_ u8t8#th$uh$`8t$4\$8VS5l8^ ǃu+?8t 58#uoVS5l8] t׉5l8] =l8t$jWI] ut:|$9uD$0jPjjW V5l8Eh$藊5l8Y] l81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$59hH9Z K=L9thL9hI{$59 59Xjh@hL 9hХ3'tEt W=LI9k90t&ƅu'"$l$59PQZ / $~ tN$=<9tPI9j 6Wx 98905LI9V =TI9t'~t!9HQP;H~Q~  Pjh6j hj ^_Ã=9t9HQP~Q fPj fV5D9u<FA\t"uAt""tFAQt FAAtF5\9 XI9;$\9 XI91tu `9`9d9^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4,'RSt$Dhi$QP t9p9ȃ|8x8D$u݄$|9s0;T$ D$r$|$\$|?؍<)h$؍<)h~$QP# N+x9 |9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh93 VD$ B J1rrJVRVyo $^Ã0D$4L$8T$ 1ɉJJJ JJQRPX x$1H0V?0j.0^USWVh=`8u=d8u }t$XjVm+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5&|8 x8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и#t$|$d59PRQh$hWq|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ#r$+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ ayƄ$Ƅ$j.V菇#tŋ$$$1Kt. u<$u$y n$u$U w<$H'/tу&h09PUt8h09h!$ 둋th$P$t2,9H؁tȍL$QP}x D$ ?x:$8!h09$,9H؁tȍL$QP x D$ ?)$8h09Q$=9 ,9APQ~ PQE ,9 t tʃ  @9tý9CAPQ~ PQت 3DA@uCr ,9븿9 uJ@9t~9CȚ99ush093E1Kt ,9APQ~ PQ3 ,9 tu7Ț999 ,9APQ~ PQ ,9< u@9;Ț9t{t C9uKB@9̚9$1K 9$$r(!%8tOh8h$M;t%5,9̧1$59h$A 5,9觧1NĄ^_[]59h$59h$Qh($ h$h($ hQ$ 59h/$SWV,91@ `t^_[à t,u>,9HQP~ Q PFʍHr̃t"1,9HQP~ Q P\t"u5,9HQP~ QP辧09Gdu091G ,9HQP~ Q Pp[~#\uE,9HQP~%Q'H wr? t:,u3P&t%09Gdzh=$ 1N09=09i΄%`'h09P莧tu :v2USWVՉh09QUtDj.Vʀ1ۅt6UP4u&)Wh09Vc_ u1ۀ091C^_[]SWVD$=<9t59hV$59V nD$t$h$PV` uA h8<8tD8t$~Vt. 99PQ 9^_[Pv蔘t=h8t"=`8t59h$59 1G=<9 Sh%hʑ9[ =9=9Sh$h9[ =89Sh&&h<9[ =\9Sh;"h9k[ =9Sh Z&h`9R[ 9=P81PPv h$jL WVPhL 9苣ơ9?snt$h$P ƆL 9 M 9?)PRQhХ35 x?t$|$ LI91; 9 ^_Ph$< ^h$t$h$59 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=9tDt W;hh$.$t Vhh$PD$D$ L$PQRSm:4$uu|$l$ 99tQShi$P/Shx$P D$WjPUhХ3tU59sƉ$t=h8t`V菡S脡<WFWt$PX Wh[$VY WSVY $t Pg4$Vh|$覟uD$uqh$, t66hR#t$h$59#9kt$VD$V躠PjVά D$Ph$Ƌ|$W荠PjW衬 u{D$ u?h$G, tt$VD$ VEPjVY D$ 8Ph$蚞Ƌ|$ WPjW# 1ۃD$  ˀuPh$Vu_4$91F=9uR<9,=@99Sh$IOuh$y 1$tP e$|$t.W?PjWS D$tPdD$|$ t&W PjW D$ t Pdd^_[]h@h$hL 9KV 905LI9Whh9 u999V5`8=9u `8h*$Ӝt>h$h9xT r1ɀ9.)h9Ph$59Ljh$h9W tfjhf$h9W tN=99t9j h$h9g) uh59h$6 S=99t99j h$hʑ9T thʑ9h$59{ 1H9999998h$1Ƀu 1A9u ǀ9u 985`8^Vt$t3DH@tNFuh$VPytQjh $VV tDh$V*yt9h&Vyt.h$Vyu'999 99^á9t P軛19<999=9u 9l8889t Pa9=9t@988j=9t#9@=u1HjhmS#Pm jh9 WV'0jk=<9tp9t1@=u1HjP 59赚9l8x#jPw 5l8i l8<9|$ j%=<9tD9t1@=u1HjP 59.9<919P8u )0^_WhO$jwC D$tPMt hX$jUC h~$jyC USWVt$ \$l$|$WSU tU| u;HDO 1 t%$ t$fO gK9uX ԥ3I ԥ3~Х3PХ3hХ3f ԥ3 tuÅt7$g t^_[]Vt$VjNt^Vh$j~B hh9O t9USWV=9H8t`=<9tW$tw9Phh9V j h9s9tJ91P99tNjwt99t$h59VO |0/thh%V+P hh$VP V5$$PG  `8L$`89$-d819d8$ t1=9PGt*7b$1SSQPVh$y &u89d$$r t9$ t1=9PfD$`8$9-d8hR#V9V9t2$759N9Vh$D< h$ 1^_[]USWV,=H8t8l$@11 SjhU tUh$0 ",^_[]<$tދD$0S ,^_[]WVP5`8=9u `8|$=9tft$hJ$+uqj h9p@j WP  =3LO@1 59jj(h!${qru=9u=9u 91HtJ=9uA59h9. 9HQP~ Q Pj 1H‰5`8^_USWV45`8=9u `8\$L=9=9!t$Hh{$+j h9ot|$j.h9|oth9(94$uY9519 91f u>h9h$59( f920h9h$59 9t$1 U誓Vh$U2U D$(V!у $ `859jj(hR$ou=9u=9u 9tj=9ua59h9, 9HQP~ Q 0Pj # 9tUh$59 4$|$5`8=91Hƒ4^_[]t$h$j2h97ft9h$j; USWV\$l$jWnh#WnUhC$SS Džu&Uh]$SS DžuUhw$SS Vjwn^_[]SWV95`8=9u `8=9h#+9u_j h9ltL8tGx"uAHt.1Ҁ"ux"u"@9ZHt@r1Ӎ95`8=9^_[SWV$h$VH VE h%P赒1Fta\$SWp t?|$/uH$VŐPVS踑 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh &P菉 ƅu 4$ 1$^USWVHu\$ $Cj j ShWuu tx t #hVW? j VS? 9]t/M I9Nt vuvvSl jjSH ƃPjS. \$fD$=9~%|$@jWC9O$Cuu S VjP 1D$ PWhp" D$ PWhE$ha$$-781\$@jPPhSvv*w thh #S> 8ShN$,-D$ PWh$і8$\$=9~N1PD$PyBT$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,K8tA8#tj}ud+8AuZku<FD$ t:D$L$ PQhhu`t t\$ ۋEu Y ΕD$ PWhJ$+ 1He^_[]9 t$xe SWV|$GHO~H0^_[Ë\$1NW臆u4G `f@uM8t C8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWSHu4G `f@u<辔8t 贔8#ug GHO~렉륋t$t 苔WV|$hvS$WRt.h &W@t!t$?tt$ h$"*1F1^_, th$j- Vt$ Vt$ 茬 t^Vh7$j- USWVHE ML$8t$QPV DUt$F|$tGo1F u$0 G(1@1(u8,t<_tGO T$t$)9|JSPVIa _ ^_[]`USWVPt$$\$ l$|$WSU tU}| u2HDeO,1t%$t$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV蘋h"P~t+h"V~th"V~uԴ9д9u }h$VW- Hσ s Уb3߃c u1Դ9σdt ltntHд9뵈ش9д9맃t Vu'ԟ39u=д9q1z4$9-u yt$$PQ 1ۅtw<$uaд9tXދ8uNW{ƃP+1VWP_ 3.gz$PS߉ޅu4$hv$\1$tE=@Vh$t$$=д9159=д9jV DžD$PWLg$$P Vh$D$V=д9$=Դ90Ɂ==11BWjV $=Դ9$uXh$Vh%PWw9r DŽ$.gz=Դ9uhh W |<$D$D$P_D$ T$W` =Դ9D$ #D$H=`t= ujV* xLVVh$;Vh#*$Vh#Vh$t$ u h $VD$ !=t D$D$pD$59hVWR0 Wx|<ǍWh$mztI=Դ9uCش9u:Vh$$Wh$-hХ3xjD$P|$W t $Vh$1PPPWfj=Դ9$uL=ش9uLhh Wu ƒu 1@P D$ 1@PR T$1=ش9uW4$T$WjVh$$P t$t S1=N| $T$ V1PPPD$T$4$ t h$D$ tP t h $L$#L$Դ9tKfjjWb tT$PQL$btDWh]$b4$u WVh"$Wh#KWh8$*$l$pT$ 3T$ϋD$1 u VC4$ $Qt$Pt$h$s4$ $W|h"$1B1PW 5ܴ9蛕h'h$h3 j}V3h'h$Vנ Ph$Và jIUSWV΍D$PQax#L$D$xt$hb"1L$h $tSR*ǀ=ش9u$h$jى\$9r<$SWV t*t)u1ۋD$)؃tǃwh$ h$@<$D$1Bh$PW|$ WW :e^_[]h"+PD$L$ $QP"=ܴ9u ܴ9XPD$L$ $QPd"jʓUSWV׉ˀ=9u h $ t$9jjjSf!ƒt7jPS tuh3$Tl$h3$11PUVWhM$ ؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph\$jVL0L0D0.Vhc$h(3 WhZ#J^_[]PD$L$ $QPϨ =ܴ9u ܴ9XUSWVpT$hL$lh'}h'D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0Ra$T$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$'1@ɽ9jD$0P轄Ń|$<T$1D$ D$,8@D$,O|$01PPD$(P T$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0C<\  Cj$jGٍ$'j  1$'t$'1T$JAjD$ $$ _E@9ED$$hMD$1$L$$ L$<\tu8< U uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhW V hG1$C<\4 , Cٍ$ j - H$$ j  Êt3DH@tKCu$ D$VVD$PV;Ǎ$$ D$ VVD$PV;94$=<31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhPN 911 |$ 1 $R:t1BuڋD$8L$ Qj Pe:  Ǎ$Pj t$D: ŃuuD$ L$ }D$HP Q4xWt$ PHD $(4$hUt$P&D L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[oj $( PS藍 o8"jbu$$ K1@C$$ jh$H~?It1g7EŃitpEE먅t t ;$'OtQ$'O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =9 hh V EKpCDH@uٺf$&G=9 GK4CDH@uٺp$KfCDH@uٺ}$GQC t _DH@u&ƋD$pW]@1҉ϊ@usFCDH@u\.tDH@*BhD jh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVZ ƍ$ jhU uG1,9t!9}uEpV]mj]  9xt$p@ 9>GWV t$F1Ejhh9 Å%|$څ,h$|$th?$z9 911<9t* uGph$W ߅uFu¡9t@P5 99P 9(^_[]Rh{$hj$hT$VQRh$$Ph$$Ph"$jjUj h$Vhj$wPh$lhV$bh$XQh$Mh($Ch$9jj h$&h!$hF$hk$h$h$h$$Ph$Sh$h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u9_NSFJ1<9tJ9ouwvSZt?G $pS|$698^_[]Ë$@Sh$SWV׉HЃ s%j SVL G3^_[Ã.$tJ+ueFɃ/t\uRFjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$t$ V7 uF99s9^_[]VP Ph$' USWVP׉΋$1m~ w]$D' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x b3b3[>u)jH1҉P5b3 b35ojH@b38 b3>u+ j59h(3Pu  9Pph"ja \_PPh$h3|jpUSWV\$|$t$ 91EtB59WVN <9<959,P1<9@9Ht8hR#p{9 <9I D9Kphav#jh9Gwrf89"49 ...D99<9@9 9 =@9u98#uxnu 9  9W1 t,E-9@J}9<9R)ʉ1ɉ<99‹\$k@91m1 @9Q@9u>#u~nu 9t91B C1ɾ8f @9@91ɋ\$u@9\$t1A ^_[]ÉZQh$j USWV|T9uN X919u:=9uT9Х3Х3D9$\9(3`9"P91NHQPPNT9=Х3PkM=d9tCd9S褗S5D9 thd95D9n od9=d9tM\9t=(3tPLV\95D9hd9 d9`9=P9tP9X9 X9@X9D9=9QP3rf|$98t0W5D9d9V W59V =<W5D9$V W5D9$U V BU PWVh$Whd9Os9hd9\9޻t=(3t PKh7b$hd9xw\9rH9tt$t$P \9H9tȋL$!QP `9d9=9u@9D9\9(3`9"hR#PvT95D9h$  9T9$@1Q5T9P> 5T9hL9hH9 ƅttbH9|0 uNt$@ $@ $QV5H9P@91@|^_[]5D9h$j 5D9h#hp$hZ$5D9hP$jK h>$h>$ =d9uhG$ hd9Փjih$벡T9@ u:HQP~ QPJt5T9P 1=9t 9t SWVX9X1t^hR#3tt&Nj@HOW$JuWH[뾋HWPm WH1F^_[V$ $ $t$QPhVoV5D95@9h$j V$ $ $t$QPhVoV5D95@9h$p| ^SWVP\$|$d9t PD$jPSW< Pad9VPSW d9^_[ÐUSWV@9jhh9n91FD$p999JBtOz T$R uW|$+;A h9l99ыR L$y th|$ @9)щ;HT$7D$t{T$A h9l9+9. @9;H@ h9l9|$to9u1ۉ@91;A@91;AT$t1jT$ 9=91ۉ__ WjWSQPM|$t4JT$B8 @9;H`9T$9591~>~ VjVWQP{L1FT$19=91ۉ__ WjWSQP,LT$t tCsBtt$u @9;Hr9xt$t@91BtȉÅQJA7$'=p95l9$=h9FPj W' @) l9QPW% 9Ҿ5=9 9R҉Y = 5@9h("5\9 o u 1PjhmS#h9S1P5959)1PjhmS#9S1P5l95h9S!1PjhmS#h9S1PS =p9 T$h9=l9GPj S& ƅ t9D$4)أl9t9 5999a9j5959hh9j5l95h9h9 4 5\9r  T$h9l9D$<=\9(3=b311 |$@L$ɿ1D$@PL$ QSD$,P\tǃrT$ 1 |$@1GT$ uGF;5b3r5\9jjh%5\9j$Wx 5\9j Gx 1-R=L$ tKQ7D$ ;b3r5\9jjh%15\9WjSt$ tsQtejPhܥ'$ tQF;b3r5\9jjh%81ܥ')b$Ph^$5\9l Z;b3r5\9jjh%1t$ D$13Phj$5\9k F9ut$ t$L$)4b3F9r5\9jjh%~5\9j$v 5\9j v \9@ @9  ֡9 p9u55\95l9j5h9=t9t5\9j fv j jhh9E p95 =p9( 5\95l9j5h9=t9t5\9j u 볋59999+h9T$JQ9T$ut Q;P l9T$I9D=p9yBu%hh rN F 5l95h9P詴 ;l9} jhmS#r艴  [ T$=9ujjh#h9 p9D$0l9D$,h9D$(t9x9|9h99t9L$(t$, 959L$0 9999=p9_ l9QZ=<39h9 @ h9 l99r 9֍9@PQ)959 F@+6vFt PF uF6^_ËFp vh$j USWV ՉL$99щT$Љ$ 39E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B 99r7 9P59999$90D$SPt$V it}ŋ4$L$]\4$L$t&uE\99r+9P59!ƣ9959F1C4$99\$D$ 99ȋ$r+ 9Q59999 ^_[]USWV`}$111D$hp$u W uu5T+=>ut0GtgT+=;uT+=$8u ԟ3ȉL$91t*VXt@T$?D$D$t Vlj|$\$ |$t?1hC &S] t+8ttDGhw$j 1E L$3. th%\ u3h$j tD$PWW uh$ۃ|$ tt$ uh$뼅tt$< uh@$렋Cu/h#| ;%tjh$VV VeSPV QVh$ 5=Ph$h3Y j{NUVQt@t $e^]Vh$j WVP։=>1ɉQPW V?t$8t>1H^_>8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPv wF vvZF^USWVP1k<jp3~4jp3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<jp3jp3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph3jjCh$\jJV1=9ZKaFt*jjj VdV諌5<m95<z9j5<@9jPs9t#1ɺXp3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$dtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAh3j>\ W@$$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$4'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuL^=m$ 5<۪5<1QQPSM;t$V5<K5<m1U)19}1ۋ$p$)ŊEt9}1< ˊEE5<>h$1VV5<藎UVj5<腎Vj5< 5<f5<x<= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3j=Y bxu+=9 9σqt$VkV,V5<Ih3jX ,$,$fUuE 9|)BfUh3jX ,$T$4xut EfEuGza|1x(| E9}ED ufMh3jX !}Eu)uE t uPuf;}]D; jt[D; tt$4UЃF4; ~ttt$4WZuE tuPu }E ubu}E9,Et)u"E t uPuEtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃu%}EE tP}E ^_[]gZt$59t$t$h$h3JZUSWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$pHtS;tNt$Cj S)؃ QSVWD$pt G}uo $ $l$Atl$|$qʤKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufthr$VSw҇|$Gu1PPw|$ GL$G)VQw( w ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59#Ǎ PjQ' =9ۉ9t @tFjm x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uh$PRQUgvzh%PRQ8g|$ Ft$uMh%v;FVx$9tكaw~ ـb(Qh$P t^WPS\$beF8tt$SVЃ F9u v;z^_[]fUSWV|$59ti=9WWG-99v1WPuá9t P9=99 9^_[]SWVt$3t59P轅31SSVr 1NtjSSP91ASSWQQPSЬ3Wr =3t@h4x%Wt59W63Wj 91^_[WVt$ w?=3t-t)959r!Pmj t;9slj4\{3^_59a9 959w59UxVt$59!9 9VLPh$^PT$D$ $1APYXWVPt$|$599 9D$$WVP1A4$^_USWVt$R5959>-9E3\Jك@to@uwt uDZ@t< ty< =9u =9tI59~tj 59("=9uj 59"9 999?=9u"59$~tj 59!j 59!1999 99 9f) 91ۈD$u9C59}t$L$4 59~9Ƌt$|259}VUUU9}j 59 |$uCj 59 KVW59d E߃ @ Ȣ9 9=9uW59|t7j 59v %59590`999 959S ^_[]t$Ph$VPt$D$ L$ $PVP1A4$^h#t$t$t$t$USWVP|$ \$$l$(t$59L9 9D$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GWFj59n1ɉV,$E|$@t[D$@8tRD$u:hkx%59^t$@59~^h$59k^Wt$Dt$ hY%59E^4$Z59zD$ 59z59{‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US592^59zth"&US59{^/)PS59 59X59j Ã~0L$ZD$  -5 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ躤 KOuLuH|$@tAt$t$D|$W+ Wh3j*( D$z19Dzf tN;L$$} 3DXuh3j'  $9A)RPQ  $8GED$t+)j Pt$59L$9 9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P& 4$d0^_[]h#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59'w59v$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PStC@j P=uL$$)݃} 9WUQS59諏ƅ|$ V ƅtV5<4$597PW;59TPWP1PPWF WmD$E|$ GWUPS59 Pŋ=9VPW=9V(TPWNP599 9#WUt$ Shvuɸx9:P):1:2: 2:h%P D$|$ hx%SU e~o~1pKrtCGDT*:붃fg5T+=hR#VPhW \$h`#WB> D jPhM$ t \$Sh|$W u4 y%8'WPWVu t }u몋}tE$th`#S= <=u͍4@h`#P= Fh|%V赟 04$VW H,:h 2:h2:hx%5T+= bS$$$ FmT+=D$/J1Wh|%su#D$=uD$h|$d}:h|%s t61W躜 t@ < uFrW>k 1W1k jhvS$h$ AR5<oǃ5< o1FVVPWk\+:$ct52:5 2:W5\+:h^ VjVjh7j5<0螌hh:rD$D$@V觜ljD$ V蘜D$1Åj2PǚL$t|$ o u*t$ %n ut$ {%n j|rjUĥtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11V|$ t$~144C9uWVݫj tPjjVhj#i ![,:j2:j"X*:$u誸t`=,:t jǡ jjGȜ/ 91 ^_[]Ét$ hT1GQWP Ph$h3m VW=h3jj,hnx%CjŹh3Vjhx%"VV1Fh3VhEh1{%VUWVV蔊 h#l# P 6|[7= :t>V萙Phw|%W 5 :5 : :=`,:t>VHPh|%WP 5`,:5`,:`,:= 9uh3jjh|% e^_]Ã=d,:tá1:tt$P蔜 jijbh#l# tP t h% Zjh.w hjUSWVB L$Qxm  P Ń j h${%Un ~ uF t$|$ W WfD/UWHh Wjŋ>7P.tn,$n ;nu:FUW}t^FPvetFljFn ~D$P赕4$觕UV S ŅSd ^_[]ËD$L$I41@fUSWV1t$,:j%Vt$t$ t$t$4$jjVP;=,:P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15,:4迅|9:VPX~Bjhy|9:jPWyjhx=T*:V/Vbu%|9:ǀ$jhxup臹|9:Ph$jX jtO|9:)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jPhtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVfVfSWV1t$t$t$ t$t$4$5,:jV#jr4PVf8 |9:$*tKuKt!Pуt|9:$P|9:L$$Q3 tXD$t$VSVx)VOu|%u|%t*VB^_[À)ujhbsu Vt5<1WW5<{ 5<m5<ρSj X9;xhj_jZjC]jVkJ|%|%!}E'USWVο$WQS薓 Wh|%SG WSUz Wh̢%U+ S1tGUt0VVVVVVVVVVVh #h41PP/t US^_[]SWV$SQV Sh|%V虓 SVW̒ Sh̢%W} Wit VW^_[WV1t$t$t$ t$t$4$5,:jxVtkjo4PV[5xG|9:*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV^ \$ 9tOL(tu(D, $ $ rt04Ԏ Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVW| 5 :t@WPhw|%V 5 :Q5 :S :sh &h!}%5 :t*W蚋Ph2}%V 5 :.5\+:$0tPhw#h%j[1e^_]PhF}%h3H j UWVV{ =`,:t>V1Ph|%V݄ 5`,:Z5`,:\5`,:wh7b$h}%B`,:t81h}%W莄V虊Ph}%Wv 5`,:$)0Ph}%h%j[1e^_]V1hhPh4PjjPj jjh3hи4xjP訪V輹^h3jjh}% :tPjjh}%jl SWVD$x1|$ :t`,:Ps1; P]PVhW#Wk^_[USWV$$$L$$QPhV $hR#V( $D$W1K4$ 1G9r6|$  WU豓ŋ$(\5F4$茒 ÃugD$ PV5^uH|$dhR#V $t:|$G= :tVh}%hk}%P9 1KS1D5$$t 4$, 4$nu :tVh}%h}%P 1ۉ؁Ĉ^_[]UN$$$1K \ USWVu ED$l|$(PVWH)  ED$8D$1ۉΊ<'t  j Fj'V;u Vljt$ t$PS D$ t$ )VPh"L$Q$) h~%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W調 tW[ É@/ W[ É|$PD$S ND$+D$D$ .t Vt$W tS҄ Džu]D$T$L$;ȉD$Pt$ 諐SD$L$Wt$t$ h~%P' 뒋D$L$T$;t RSR |$\$$h%S$$ G|$\$1\$L$< t$0Vhht@W  fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=<jP|$ W& 5<t:5<j5<f5<z2t<D$D$(D$$1WSaD$ L$VWSPQ >1N|$p$ d,:hd,:hptt$$ =ȅ3\$hȅ3hbtt$( us=ȅ3ujjh&P&jyD hȅ3hf@t$$ =ȅ3t0ȅ3hȅ3hbtt$(Z D~%\$ȅ3 :t P螯`,:t P臯x£1:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5d,:L$@EL$D$D$9}GD$hP2-HxPn|$u9Mx{;5<tVOjP}|$ۋ|$t hmS#b2hPL2nԥ3H ԥ3~Х3#hХ39Nj|$tmj 2 2 ;5<t V&|$ t E%u15<U5<j5<W_mt$(/twPuW D$td$8u-e^_[]D$t$ h}%j{q Vh}%P 1S@ 1FVy@ Sjh\%i? VS? t$N@ $ D$pL$|PSt$( t$ Xh :t*t$hc~%P 5 : :`,:t*t$h$Pz 5`,:`,:hp&D$ 0u.hr~%D$ put$vm t$e s h :REtt8tjPzB u%t$V6G 6h~%Hl j3L$1Phu~%(l USWV։5<1@P5<]5<8kh 1PSU|0 $DhP1/DhPS1CSA0 CWh$fDhE%.FPU螎j5<K@)VUPRQ5<_ftcjPn趰t05<PV 5<o+PV'1PPV V?j^_[]h3Sj+h~%3S fUSWV-1@=$9$h%Pjq hyD$1D$ $ $?$Vr92[%VWz PWt$ K VW~z G|$R%'3D$WPWt$  uD$L$DAu >uD$ |$O 4$ ))ht$P0{ FD$ |$$ ))Ƅt$8$)8 }? jSD ƃ $NfF$MJu1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p $9 )) hPh(9y 14'jVh(9X t1GuD$(Vh+%j@$Sb 1PPD$0PD$XPSL t|$Lub4'h(9h%h-jSj"D$L1QD$PPQQSK Sh=%s1=(9su=)9lu3 *9DH$D$$Ph%( u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV j!W|$0W iW&]hh%QCh9PPji=9 h9PPhh &h% Ph%j+o h#%Woh%Woh$%Woh'%Wnh9h2%Wn =9t!h9h>%Wn $9hI%WnhY%Wnhg%WnWh%jtnh(9hj%h DŽ$h9VVj~j h%VJ 9defa1ȋ 9ult1 j h%h9J 9manu1ȋ 9ual1 91 9none1 9 tlf=9 tb=9t`h9h(9h%jtCh(9h %Sj~$$Ӄ9(9hhdž%HOh"Ifh(9hdž%hԆ%hL [ 8 (9h~%D$ Pj3 ~ht$ h,9t t$j h,9肘th<%D$ Pj ~ht$ h9:t t$ʂj h9:2t=9:t (9h%D$ Pj ~ht$ h+9-t t$j=+9u:hF%D$ Pj@ ~ht$ h+9s t$'j h+9菗t=+9t (9hh*9pu=*9t (9D$1@$" h9S$Wds V*9PPjxV+9PPjw SWlt%(9|$$|$ t |$uj)9PPjye|$t jG9PPjz^h)9+ =e9u=Ȁ%=r!ƒӀ%tހ%=ujQhe9r je9PPj{h,9PPj}(9u4D$D$Pj|$uh9:PPj|=9:s$s$t9:=9%t9=)9t)9|$ti=G9s$s$tG9=e9s$te9=,9t,9SVWQRh(9Ph*9h+9h#h,$L=e9s$s$te9=,9t,9WVQRh(9Ph*9h+9h#h(jjjm xP2 9%Ph$hb ha}<h(9h%hSv S"jrjQ$H1WWV$Phq%B t( ;$P$Tsh%jPbt^DŽ$ 1WWV$Ph%B ? ;$0$4&h%jPh`uq52: 1H t$t$}1t$t$}h%j<$t$j{$91@$F=9:h7b$h %R h1%jft$(Vl] VlPhk%hN%Wtf=+9th+9h%WXf =9:th9:h%Wt<3:1ɀ= :/ :QPh%hh`+:f 1^ËL$1Bh\4:WVt$=$9u jG7Wj 螄u1@l3:x51:o1ɀ= :/ :%QPVWh2: =1ɀ= :/ :QPVWhT): 1^_Vt$V dЉh,:$^WV D$Ph4": u:$nfsu-Vh4":h2:ve Vh!:hT):ce tWj 蔃1F?t[h:hZ3:h%jPu>83:ւ%h4":VWh2: h!:VWhT): 1 ^_SWV=$9hU(9u(h%Q\u9h9h߂%U=9:t h %˵=9t h%赵|$h(9h%hW h7b$WƅVWPh%j[h<$V[=9th9h%Vy[ h%jj[(9uGWPh%jK[=9tDh9he9h)9h%V%[=(9tCh{%Th(9h%he9h)9h'%VZh%jZh &h6%XPhA%jZ $%SWZh%WZSWZ=+9th+9hƅ%WcZ h)9hޅ%WPZ =+9tPh9hI{$W/Z h*9h$WZ W讪h%jZh[%Zuh,9hh%nS=9th%XSh(9h%FSt VGj-^_[USWV։ϸjPP^ tCËl$hjWo ojh(9Wa WVSa S" 1H^_[]USWV$΋$Phu%谫u tW#V ^l$PSU ":<$u3:PVUWh%hC1Ʌȁ^_[]ÿ%fT$L$t$"u/ÁtuR$Ãt6u8h6h/u uh%!w'hhV D$L$FFh V~ ȃ ^SWVP1ۉSSWSjh'踅t{4$]1ۅtjSSWPjh'荅tEh%V. t&|$\$PS׃th%j. uVn Vm1ۉ؃^_[USWVo%'\$|$jSP@ ƅt Eu$wS7a_ wh &7` G^_[]WV'|$u't%|$ jWQe@ t u1^_ËL$̅34USWV1td։σSNPSWA t u6P1PhPPj D$PU9 D$t΀8uɃ<$uð1^_[]ËL$؅3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E{%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ` $V1VPL 95,:D$40$X@hO7P@tt$45<>IhХ3lb 5<+9r ,:ɉt$ =1MD$Ni8D$$11t=i8,42:tǍXUSN݉|$|$l$$0":|9:ƀyH1ۉLPTXVUQ|[ |9:" .hQPb[ VUh,:S[ ,|9:L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP|9:$()1HD,048Ƃ(1 ,:<50":6W2:|$c[ 0":P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً ,:ɋD$L$ӾV W#QSPSl$GU |9:$H@ VW#RPQSD$BP  :t% |9:QUHDRhև%P =|9:$0@ơ|9:$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-,:L$QP5|9: u<5|9:h_R$Pdž$l$|9:()8 0": 2:VyU0":VjPB L$ D$@D$9 ,:yuƇy$u4P4 44S*$똋D$|9:$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$$MD$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4$MEl$L$),$|4xfDŽ4DŽ4$MT4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ$MD4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ$MD4B1hPPPPjPPjjR$Pjz4$1K|$$8h$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh23T |9:31@멃=,:yu,:,:s19dL$w BsÁt1USWVD$$|9:*t1G.$ )$Ph%hV n%jt(hfMVh%h% j$ i%W踢|9:$PhϦ%hV WVhN%蜥 ]h%Vjj\Q1PP3Ahjl1qm$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$̩'h%D$PS %D$%X3|$0tPh3%hW Wh9%D$P n%D$H%zh%D$P %D$È%i3|$0tPhW%hWH D3t#Ph^%j\$S+ S\$W D3t#Phe%j\$S S\$Wb L3"tvS$P%tWRhl%D$ P D3@H%t%D$n%D3|$0tL3tQh%hWs Wh%D$P %D$%Q|3%t%PD$Pp %%D$,%!hˈ%D$PM ׈%D$߈%D3 $t!t$PQh%h7t)$j4$2]tQ ]d3U$ :=,:t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh~%U EtjP&V t4$0\؁ ^_[]Ê$ hn%W$D$jV ù D$jQQPS S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uh%SSVUh%SC$ Pu1Vt$h%P4$7[$ l$Sh#U@ h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ腖^_[9rwًz89y8rw19HUSWV |9:1G*ZƄ$h5%进h7b$h!$菞Ph:%jVC 5 :t |9:QPhS%VY 5h%SC|9:)\$J$WPZx$L$@PQ $d$ PV D$@PhӉ%SB D$0PV`Y"D$0L$8L$D$h "Pw\$D$H$194$h "WݔFuށǐW$W; SX;t$$ *h^ :tPjjhn%n1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t#$%\$t7ȉL$7 T$wX%D$ n%D$$'#$uht$$P"I %Pt$h%t=uD7L7qQPhT%u$$#d%D#t $D$ % $T$h%RT$ D$L$ 1@D$hy%RT$׈%D$L$ h%R蚒uD7#t$$D7#@t%#y%#t%T$(#t%T$ |$$#tŊ%L$,#t̊%#t؊% #t%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h%t$D?@غRPh+%t$>ClE;F{Pp\$CPW SUt$0|$4hh褕L$0QjP7. P8WCUtVh%t$y> S"U=h,:u#D$@h,:@@h Pih%\$ S0>h%S">h%S>=h,:thh,:h4%S= $ 1|$@VVPWhq% ;w#r>#t>#QhV%S= h%ٕh%̕h%迕=h,:t h%評h%蜕1h%WL=SލWoe^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ Ԫ'h%U%9 Ueuh׈%h%U8 U>FjVL1Ktljt$<"h%AG$Gn%G +w<"Ghɋ%@G ${$n%C(s4C8Ԫ'hۋ%@C<{@n%CDsP$sTԪ'Sh%U38 UstlSh%U8 <"UX@F$F^ +FSh%U7 FԪ'U#@F $F$^(+F48ih׈%h%U7 Utl׈%Wh%U}7 <"U?F$F~ 6+^Wh%UI7 FԪ'U?F $F$~(^48+4$iƷm۶|$9U:1Kh5%賙tzh!$臙tiD$h!$Pj記 XWl$UVt$t$ Q6POu4$P|9:Ph$h 1PP}#|9:)t5PhϦ%hU 鋔$ 1$ 91APuDFl9Ɖr:|9:Ph$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhh%h\%hh%L$T$jt$oËL$T$jt$XWV׉κn%jujWZh#VhR#蘔 ^_V91ɾ 9r^^VD$9tU@8xtlIuAH1FVVjjhh90QRx tjh9jD t9^À=9tjh9jwD 9USWV 1WWjZD &iP=SPj +D t$ Eá3D$x1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tE`R|$$t.jVjC t 3L$Nj4$D$/devG4$D$M[1O4$1O1V%M ^_[]USWVPD$tPpP11OFtFh%Pt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T%w%Phu"h%V- ^_[]Vt$D$QPbLt(D$t%t!h.hPQ_YD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$52:.@ujPDD$1҅D$t 9tL$BuT$ЋT$P]1hPPh5hw5jjAPjQQh3w i4WPZw JM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@hO7PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPCD$1҅ӅtwU贅t\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$.IЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$WFAŅjW1A{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ NCD$$@$;E tL$ A;L$tI1۸hSShoCShj%PCL$LQhd{&PL t$,04t$jj h#RPjVY |$LWLz3r \DZ@uWQVt$hH%ht$ V 1C}$Q.1ۿ9PSW t$L^^^F~ FFVhQt$ ? t |$dJSjV觅 $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h#RPjV VSh$ht$ }G8@É؍e^_[]9=}t'fy"9 9NuEt FuXt1€1ɾ9( Ӏu A'w'9 ' Àu A&r  uȃsƄ\$,04t$jj h#RPjV $PVShV%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h#RPjS! W$mPSVhb%ht$ @ -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h%q Y|$h%u wDžtohԪ'6wtkDŽ$v/rDŽ$/dev,$$VuP- D$/devf@/VuP- Q踃낋E\tu xt@@AED$52:$ttt$PуuN|9:덬$WPU- t$/devfF/|9:WPV, [St\as!a9aO$CQPU, {PWV|9:$t(tt$Pуt Nj5|9:,$1D$0$h@hO7P5tt$G|9:PUutTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS+ $WD$pV?* l$ UhC &Va ǰD$h"WIthM$W3ttyh#W!ttgh$WttUh%WstCh4"Wst1C &D$t%tD$VPSA* VWS6* UhC &j` DžED$4$v PS} t"vh$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=,:SWt$t$o$1PWt$t$o|$u1@G3:-Hs :%VPWSh2: wsVPWShT): 1^_[USWV |$ faa@D$$1C#=83:th%j83:VrPWh%h:vD$PUAD$h,:5:hi%j訙x83:rW!":u3:QWh :Vt$D$PWh%SR$'D$D$ =mdt2Vh4":h2:! Vh!:hT):! 1$hVS9v t$t$t$D$ 9jVV) ~;Ƹ PV(D$i jQP e9]D$|$hpWwf/o ~#u4h9hh,:违 21jioh,:ލ$9Hf@$MtJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Phh,: u`~*=83:t!h%jU183:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hē%h%h'h%qUSWV|1ۀ=h,:t}hh,:h%jŕ ue83:%%2:h4":VWSU/ h!:VWShT): VU#N@1 É؃|^_[]ËD$L$I1@Ã=83:th%j(83:Vt$ D$t PmVj=m5\+:v ^USWVPWj<1F?tih,:h<3:h%j讔uL83::%Ԏ%h4":VWSUh2: h!:VWSUhT): 1^_[]SWVPVj`<>u1@;:֎%h4":VWSh2:謍 h!:VWShT):藍 1^_[ù1@t 9It1ùtA9t 1ùD$9Au9ËD$9SWVhflhy1$hWVq 㹔3WSChWWh PWj659WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW9tI1r rr2s0u&1q1ur1ۃ0݃tr @뜃|$tB tBBt^_[]USWV|$D$L$BJ 0uQ=91۾l&-9B0t#1urF9tu99u'Cϸ99t099t90 59|$Q-jVPhU%W;,^_[]WV|$t$ Nt tuhݎ%Ckݎ%%2t%jjPWV^_USWV|$=3:t h :j;WWG":u3:l$}QWVh%hU衊 1PPk ơ3:t3Ѓ<PUuu#D$=ueߋ$$$t::P{jۉt{uh%jz$t]PUh%h[Z$t::hhSjP2 jP W@(V7(jUh=%h V! V(tP$t::Uh$hi jj7ah5\+:21@|^_[]Ã=3:t=1:tUha%ju C91$t::Vt$hI%VactV2:t T):`+:^t$-":u3:USWVt$,VJaD$j$t$Vw<to1\$l$t$GSVhVVj UP  L$Vtu(;D$0s"L$44`L$|$)L$OGj$W <DžuD$@PDžj$t$0;|$1<$t$]D$PVhVVj D$PSg NjD$VtuK;|$0sED$ )UPt$V}C 1D$44Ui D$44`$D$D$ j$SB;Ņm<$t$ >tV\$S V_$|$);\$u ^_[]h>%h0%h h%hSV531/t.T$ 39u9t 9t q/u^[V1ɍt$QQPVhg%G y1t1^USWV|$(1$PPWVhg% $D$(1PPWVhg% Z$LF1d$Pj%J4$>$ܪ'h}dE%Ueh~.hh %ehhUdW=5\+:OD$h jU5\+:Y B'PPqhVjU5\+:0V]t PVW$ WD$ PASt$5\+:NY 5\+:55\+:Sjh&% j D$ PUX Uh%c D$(SSWVhg% $j) h%fMuQ1AtCjVn u4VhC%"1ɉtjVJ uVh%j) D$(SSWVhg%} u$~h{%jTȁĐ^_[]1USWVhh%F`,:tPjjh%;81::::::::::::3/u D$83ڃ9t9u@::Q/uD$/u.::::19haj 31@|$>Z9M ::L$ ::L$j5<5<T5<&=83:th%j聈83:::::6P5::h%jaa3:Wj b0D$ttRN1ҋ0t1t /u oBrg9uƃ9::19uAuVD$u,D$ ::D$::1@9::^/ ::F::::QR5::5::5::Ph%h` jj\/_5\+:]19tvh%hu>h,_t$FVj.~th%j軆h.%j謆hZ%j蝆1G99thv%jfh%_L$QPu{h%_$QPvuYD$3$L$3$ t?h%h%Mft!h%jޅh%h%a迪1=83:th%j訅83:]$1L$VVPQhg% }t|$ th{%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h &hK%{at@Ƌ|$]1Ph%S9 4$WV VVh%S^_[USWV-3ta1F3t&U7Jd1tUh$h] 111Fo u1tjh1@1^_[]Vh%]t$hPV hh9Vy x(9ƀ9h%Qv j/P`1@%::^SWVh%&]9hPVa VU9K5::` 9 9PVh%hW| jWhT#: h`VbjvZ0c*PVWh%h3u ђ%^_WVt$ 0PprPGt$>FFVj F^_SWV=3/t/t$3GtPVKt /u?É^_[USWVj$t$ -%1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$V$ƅu1؃^_[]VPT$ D$t$4$_VP ^USWVӉϋl$jU\tMƅtPt$Vz, S3OVUP tP׃SV^_[]VPT$ D$t$4$VPv ^À= 9ua 9g"::U%>:_%::ef$>:i$::&">:SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWUD uD5<w |5L Ku1PPD$P )ƍD$Phd@V_5 |$D$|PhedAV75 V茻f$1 GaD$P$,hՓ%t$V 1PPV $C]su PUhh(9t$t.)9CD001 -91 u=(9tZF9|4$蝺ja$,hv%$0u. EPPv jOhP9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$t$$,hv%u EVPh$P EtE @E w-G$9@  V褹؁^_[]1D$L$I@P9wʀu9Au9 91USWV$$1$hWVL E jShWWh PWh59Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur9A1ËD$1ɋ0t1ur9A1USWV ։D$ $E1$  D$$ ,$D$P% $Ej%u%D$$_%y%u%F\$$::is \$\$$&HD$\$$)|$=,:=<3:=::$ <$D$D$Ҕ%!<$Dq|$4$D$ ::D$% |$D$ ,:D$<3:D$%=$9u$ByD$1Ƀ 3\$p3C|$D$$$E%D\$$({|$!<$D$::D$p3{=3#|$l$ D$D$%$kljl$4$q K=$9u $fxD$|$D$$.$E%C\$$'|$u1=Z3:=:=::$ <$D$D$Ҕ%<$vt|$4$D$ ::D$% |$D$ :D$Z3:D$%$juLl$ t$<$D$v%i$ \$<$D$%i$z l$4$^p > ^_[]Á=m3ftp]%=3PFSWV|$ty9GO4VS=tRVT t{Sn59 9Vh959h~%hSb jShT# fGl3~"PptV莄Ve1^_[ËD$ 9Ɓ9 49fH 89fH1SWVt$99V~)S4:QU F49F89F1^_[ËD$L$01b<fSWV1ۉShPS$ tD$$P, t V߲#J8V˲J81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3Vy ;I81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=,:1SWt$ t$L$ T$6D$T$SWt$ t$6D$ ׋X*:t$ t$(2%L$\PSWt$t$,t$RPPQ^ $,:1WSt$t$H6D$T$WSVt$16É֋=X*:t$Ht$H迍$PWVSt$t$%PPPQU^ $VD$`Pjhq1@USWV u C(D$|$8hjWB wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QRJ<$L$ PP@ǾX'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$ tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)h{#SD$ Z0L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDhj&WSjU 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ay%W pT{H:FH1@LQwFHpX5X:PQE|FHp\5\:UhL%FH@`L$Phj&jQL hw+VjP P5`:50:h5%sjV b+~V|$jPWRUvPQd@( m4*WP50:h5%sT1hh*P54:50:h5%sh^_[]Ës=`:h*PWUh5%VҋFHP5P:UUSWVP $1jlv VD$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$v0D$F@ F52:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|ƕ94$ukGllPwGX FPvt~C $i)ىQRP_ 1D7D77qfD7 D7 ƕ4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A }Ou\$ @9fA |$tAqfAAƕ 1AA tAfAAߖ A AAufAA) 91jEVVhhhrjJVjVQPh94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch%P"uF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$4C$10s$C$s(!C(1ۅÉ؃^_[]h%hy%hlh2%j(USWVt$ kFllPv!Nj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ 7 1/D/D/D/ }{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV|9:t$ 1$V[/} Vٞ$T$GD$ pjV<D$D$ 1ɺ<t$6t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vh%D$DPa D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P  |$YtZVJz MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV5 )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ,:}] aVt$ nt$b؉e^_[]USWV D$ 8t$8L$j QP腖 $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋,:1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VS|D$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hd$jVu, C `L$rL$DPh֕%uL$DPhە%jQ8, D$D---D$D$sX*:CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh%P[ SVh%P[ VW S,:D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hd$j$P* t"?tt$ Wh%D$LP[ D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD $uR1jPPPhhPj jjj%VjMF4x!t$PW0V 1@^_[]h$%h%hh2%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ x'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh$jSO# t$]E5fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=:t@u.1}hGju tEx %rtט%tŘ%M u@=Uu,>t'D$ L$|9:;\M`|ˀuK(Ѓt tu tPjbjWa^ƍD$(PV$1 $$QPV] $V_9$ul$`=u]tP$PSn $5fǃU'V^Wh$h% uQe^_[]SWV0\$@1҉1 F FFF =:tjP4D$VjRRS0<^_[USWV|9:(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h %jkt1e^]USWV8=:EM 0~klP1踤ËE E8؃lklQSP? ߾$'|9:$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =:u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hޝ%hƝ%heh{%vUSWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSWX L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$@:u z@:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQP胃 T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(@:u x@:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$̭'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ荁 |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut*%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV~ >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDz l$(Ph(%Uq h7b$U [Ɖ$Uh:%jYu D$PhI%VFu wXw\w`hm%V/uPwdh%VuwTh%Vu f1ۍ{aE4'WuWuWh%Vt E< t<uEMPWQWh%Vt$<I%9|mS#PVwtC9z1h%WTtV D$PD$Pt$\$4Shݟ%hǟ%WS1(^_[]h%h%hBh%h%h1hҞ%h%h h%h%hh%h%hh{%USWVhj~{1O1ۍD$ShPS$4腄9+ōF,PhedAUY l$$4$0$($<$8у|1҉$$lw F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Qqz D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$;$$h%jP r=t31>t9>u 9>t0uk9uVڇV҇OVʇU:1@19$,|;ЃV荇t$H:؁^_[]USWVHD$1PuهRhju;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'ugt FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h%h%jg6h%h%jh(hҞ%h%jih%h%jj h%h%jkh{%D$T$ L$DrRQPv ËD$Djt$ P USWVl$j/U膭 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=:ui"sv<: @:@:tx(9w4Ju1AQP}ã@:@:H @:k4+$1 4+Vhj&jRo 1D+ <+ hsVPhZ%jWB 1D+'<+(D+($D+,t+0^_[]V΃=:un:) 1t(@"u@:t @:9t 4Hu1^USWV|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=@:u Rf@:~V19|(1@@89|~@w1A^_[USWVP=@:|$(L$111='"\$uӀt0t u@tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh'h\:N \:k :\11Kj1lƃwDݸ'DtGCuޅtH=@:Pk@:t)1ɀ<t ʹ'AuVD|^_[1V @:t(@:1t ҡ@: @:F9r@:P{^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h%jQQWRjjh>%(,1^_[]USWVhu}WWPHD$T$|9:L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv|9:@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  #1ۺL$#PWVSh0RQG t$kPW#PShPV! |9:VL$'Qt$t$t$ t$PPh`g$hE%Ǻ|9:$0Ͷ$|9:$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC ffC C CfCC =@:rC fC*C, G1ۍD$(huSSSSSSSjjWPh貓48P胓@,Ćt$VWrW膔FuQ1K5@:Eut P3ut$A5@:u1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h7%h%hyhE%:USWV$(E]0輬ƋEp謬ljl$E@ t P蓬#PWVSjh\1U5,:|$ ww4D%t$R5X*:RPSQV{ U5,:w$w l$45X*:RPSPUJ G\$skhSjPD P迹Vk:j!hk%V V谥h裫y%L$5X*:PRUQ hv$5X*:Py%PUS hKPSD$Ph%hhD:k 1҃9Q:A \߉$4PWh:b$j$W& hWhD:] Nw@EƆ: Ft3N$t.1@Ƅ:-H9s Nr,:$EBL$ ;QUD:Vh%W\ Vh:W\ hE%&İ^_[]USWVX] E81h#PPPPh%PPE 9_ vSL$QSWPL t@D$ tWD$8uN T:uhƩ T:D$9H*h#Vh;b$Epk+D$8u RPt QPVW҃,:1VSt$t$*D$$VSt$t$L$8QRPt$ t$h%Ep7kD$V9p1h$YQVu WPTtY$UtOwGD$VPʢ)vVQj PӮ W@ )Q$YQPZ H LCF;puD$VPh$Epj e^_[]USWVLt$`T$d\$1*kvs0C41GPjht3  9u vEL$QVUPL 1hPPh=h5hj6Pjjt$(SP衅4ōt$ VPqwU腆Sbg~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5@:g|$.@:L$`ʉAfAD$ 1Ƀx fJ1O Sf1L^_[]USWVpU t$01^F4jj_1AǾܯ'D$ǃ@,'SPHD$ $|9:L1OًP|T$|$`1 |$0jP4D$DD$ ,:|$ 9ϋ$|$1HPPVt$t$WRQjD$%W^DC 4:P:~?u 8:F u<:7{#VRQh5%P^^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4肥 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjPTƃt m Iu1PPPhH!PhjPj j WVPjy4ǃtSWBkC=WRzV/[1H^_[USWV8] C4t VPQRL u s ss3Z SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQK D$\$1hSSVVjjpK ;tUSP@u54$1hSSVVjjp |$u^WVD$ t$tL$ HPQ0vtpvhhMPh$V\[ ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV hl%1jx$u%xtD$PVH$%KtD$PWX1yoh%膙hPWI D$PW1u!h%VPWh%j跿1EWh%jA hW#h{%W赘$hPSOI D$PS1u"h%WPSh%jA1Eh%还hPWH Wh%j 0l$Sh%h%jt D$m%PV$SPWH hŢ%Vٗ%1PWQU虾h%V踗SPW]H hѢ%V蟗PW%PUam%PVPh%UC ah6%VZPh%j ;h%薗hPWG h%VPWh%jڽhl%ShPWG hm%VՖ1BP$h%V趖Ph%jy h%hPW2G h%Vtƻ$ؑ3Wh%hU輶 1tVUh%juŃ|$tjh+'$Ą ^_[]USWV ։Q 1Ht L$ L$$WC $f} r= jh %U輏 u&USh%D$P$ uh#R4 WB Ņu>L$4t&t u$Ut$ t$ h%jt$ TW $ ^_[]USWVՉfD$/D$jh%D$5謔t&裔8t虔SPh%hU VSU;E 991j/U| t5ÍD$9tK9vH8/t@PM CߍD$ PWD$%= h$PWQ FƄ$/u&踓$QPh%hU% /h$PUJD hh%U2D e=@uW-L x*|$VW$PC 9r>R?G0|$W W*01Ĉ^_[]hU~ t}/u }$$tcD$UWƁ`|$tVh%UC 9=VWUC 9%|$W2 x(W7X>1F1S>0jh*#j SWVύD$ PQ1xVD$)tOjWx@ljj PWO W u $=rɁ uƉĜ^_[USWV h讐ljPhW@j| \$hjS蛖 jh%D$ƍD$ PhW@V{| t$1hUSN ,$T'tWPԋu-X:D$C R+E,$ !u1L$PPPPh+jPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@L'VhW1{ F\:1@^ËD$ X:fH \:tPPQQQh+%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺D$L$~D$<P t3#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$#t$DRQPh%jV D$ T$Bj5,:QP~#t"&t$DQRPh%jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5X*:t$h%jt$hVD$XP1WWjjj0賕,,:|$4D$0|9:L$QW<W,D$DPV[~ljӍD$DPV蓇|$߉څu D$$H؋Pٸ"D$<h%t$R|$,] {t+[1h%S&t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$h%jt$hVD$XP1PPjjj0?,j D$DPV D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5,:PQm.|$ RPhd$jW藩 ;X*:CVDSjP jPPh_:9 VG(^_[WVt$ 5<[5<%'~$uFjP@F$1O~(1h_:QQh5h4hRjFj WjPv$h`:{e4F(x;F,VPOWv(afv$tlIut5t.j+ȅj,輅L$PVh׼%jPQ 'u tEj,j+荅L$jPPQ6 hmS#7j*fL$QjPT6 hE%j-?t$R5X*:Ph$jFVb j.h'PVh%hh`:: İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5,:RQo}L$RPh$jQ G<(\(|(Pu#]j#]L$>PSWhD%j&Q%j5,:SW}L$t$>QRPh%j&V] $F|(,u)|$hgPh%j(W* <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh$j(VŤ 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhʥ%vREt 4$B|$|$upd^_[]1؍L$>PWh%j&Q,  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V謣 4$h^VjP lj|$D(dph-PVhå%j(WY *USWV|9:$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá|9:H1WjHDWWQZơ|9:$1$ |9:@u <@TX uDHXT=,:tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W#WRPPQ.1ҍD$*W Q#QRhQPD$$W Q#Q1Qh0QP&)ߋ|9:0D$pL$$QL$.QL$QPt$SPW/ |9:0uNjpfL$$QL$.QL$QPWSSj'B0 hE%0+|$pG$DŽ$$T$0<$tT$@BfBBmEffJ B {EBfJBEB fJ*B,E=@:r~(uB0fB:B|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh%D$ Pnt5h%t$ nu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0,:)ދ,:\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(z L$)։t$ t$A52: 1Fh`%hO%h]h٥%@kL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQtt0\$4ZS( tt<1^_[USWVGD$52:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1@:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX$MAL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}:k<4LE1UЍe^_[]USWV1@:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=::t*=xM:11M<t9\@u 9DDMHEr=::tOTM:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=>:L:J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@xM:D WV:tGjhq"P0L 1N=::Gjh9f$PL O1TM:|t 9Lp=CuSW15xM:1Ƀ|t9TtPH= u#Oи0M:8zt9JtCu)Ή7xM:r4)΃؍L$tu)y8u.q$t"y8uqxu Hu^h$h%hm hE%8RD$x8u@h$h%hm hE%RV 0":; |9:tD2:t99t‹9u€2:2t 2:^WV΋$tRtt:t"h8jQM:u >:=::t!jHj)xM:u::=>:t$hjL:u>: lL:5TM:<^8M::\$1ɡL:L$iɐ $|1 $kt 8e 8 8M$Ѓ 8QPh%h$Pf =2:tAt*GL$xQPAtuƇy1u0":y1LPTX) L: $ف80":ǀ,ǀ<j\$|SPF 0":"hSP/ 9=2:t 0": 0":ǀ2:W0":WjP{J Ft L:rL$AE\$ 2:t>yu)2:9tЋ9u2:0u1H|$52:,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $k:tPD$< @@L:x L$(AAXM:y yHًT$PD$P%t$ =::t0D$@@8M:1ɉH HًT$PVKT$ B1ttD |KttD z :xIfKe^_[]VD$:Hօ19fH^USWV4k$L<$PT8J^$H|$x'|uxP?"PWh%uD4\@xt 1ɍ$4jQjQhRVSЃ u fDŽ$4-L$QVSPL tt t 9uP ?t$$t$$wƋD$&$4WVPh#%hS ` M$4jt$t$8u"DH $4jj h#QPjS{SW"?D$5$4why%P w01k,Cy uC,1uSPQD$=PW Ph%D$=P? 10u?x@t$5w%Vth%1VbW0 VTM:t(|$WhV%h^\$t$uqW TM:t)Phk%h^uKTM:t(h%hq^ u,TM:t(h%hR^ u TM:D(Fp=::11xM:Pt4xM:t(:^@111 $D$iL:P@L: 081tsuL089\04t$1Ɉ$$|$ |8tkPh%jPe\ L:Ph2%hK\ PhM%$U L:QPU L:8NuL$L(ɍ$~,QhU%h|$%WxU hWVi L:L$L,ɋ|$ ~,Qh\%hl$%U:@D$1HD$$D$1i8M:$P52:\$ "$x 1ۋWSPQL $($0}U$W|\ W3(|8/tW#(fDŽ/M: $< R(P$PW( t $L|$$t0|$t)$P't$'9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4=M:,$V-' PVh%hD$)PMN 5M:.#tR#PS)[ >tiD$Pt>ShE%hfT$\$ M:$DL$4L$0M:0|]t$VPh%WS M:( ( PQVh%WSt$\$ CCa5M:.> >,>(>$> D$)Pt>Sh#%hTS$$(t$,t$(r  :t P:1` :tWWhn%C `WhҨ%h3yP :t8WhҨ%PaP :1Ntjh%PEP ^_[]1N =>:tt$h1%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ |9:V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$}$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx:0^_[]h$h%hm hE%,USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4 'jP8 D$$tI 5:h6oh71PPWVha%U4du31PL$Ph$jQ= 5:h8t)u D$ h#jP= 5:h9t)u D$$h#jPB= 5:h:zt)u D$(h#jP= 5:h;<t)u D$,h#jP< 5:h<pL$QPVha%Wy ^_[]USWV$@1K $ $('_ 1hSSVVjjh=p$  /t$l$ WSUi Uhۂ%WS< S|/D1l1_|9:, 1>WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h#US: 1USSVVjjt$" S xL$1^_[]WV|$ 1uOG Pt/1; }Oq"hL:x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h^2t$hPV $$$P'D$@{tUh%V USV 8Ouڋ$xhLuhMSPhާ%V}C(~Ph#hV8 }hNHC,~Ph#hV8 }hO#C0~Ph%hVq8 }hP#VPhާ%W1^_[]USWV$3u*11IhuPPPPjj PQQjh3P43Nw'$R($d'WP\1N1jWWVVjjhQ lS, T0D$4h#QPz7 1PD$PPVVjjU D$P谀 x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jPh 荧Qkd)Qh%Vi ^_USWV$h^|$hPWe $$$|'{hV VPhާ%{hWvvPh%W[hXp1~,t[hYS1~0W[hZ6ǃ4V&uh^V0FT~Ph~#hW25 sh[[h^1~`{h\vXPh%WF\~Ph%hW4 sh]mFd~Ph#hW4 sh_HFh~Ph#hW4 sh`#Fl~Ph~#hW_4 shaWPhާ%V/[hb1~pPPWhާ%S^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol|9:,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h#QP2 1PD$PPVVjjU D$P| x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@Zp$Qkd)Qh %V ^_[V: á:th5(:Vt$:uh5(:9w1 k<:^Vt$=:u h5S(1t*u: :t:92tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hث%h%hhe%t SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FL'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$:uh:s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$'@21^_[Ã!t*Wp1@<QKWPV辵 rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph%Q& D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=::$Wh%jP 1t t^_[]Ë :! ÍD$XWh%Pj1~jDjtD$$mS#Vt$\YvVjNvD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h`#WU ƀ8tt1tCuVL$ D$ j jV'{ É$qj jV{ t#D$Zj jVz D$T$C\$ \$D$|$u\$uthh%S¦ hVS賦 \$E61ۉSt$,j SVz É$ tbD$ ʉ $tQD$ D$tGjhfc$t$}Vy tOjhtc$Vy tdjhWc$Vy te|$ushmS#j2tD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Uy hjL$tJ@j`PQT$蟤 T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<W߅uv^_[h%hۮ%hhe%e D$ph%j iSWV=:5:t^s蕭3苭t{#$t$j(PV 4$I_u9hsj|$0VPh$jxW WVV &t Ĩ^_hO&h%hhe%w USWVσ=:u h5 1t0?t+:t!-:E WP tt/|$thhC &Sї !hvS輗 u4$$$$$St$h %j ^_[]SWVD$Qt$Rh%Pj hmS#t$ce$jh'P uWhmS#j:e$tAt$h`#W 8tjt$2hmS#jd$ut$O1ۉ؃^_[USWVӉ΋|$|$tBhA%S hH%S hN%S hT%S h\%S hb%S hi%S \$h,#S ǀ?t(K$`'WPW uE F@j`WV譔 -j(W` tj)PO t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVUO |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h#WU WUUjUwѻPD$x0h#SU SUUjiUH H=wˉ|9:DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á:tq.:Vt$ :u W. :19vFt=NM:wu1wM:pz:^ËD$Hs-s 4'.h$h%hh%= Vt$ =:u-(t;u2L$ rȃsT'$tuXp:1 pz::^WVP|$t$=:uI-j PV# =v1t-h;t M:t4ƌM:^_Ë $9u։^_-=f:tf:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWhp. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jhl-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh4,^_USWVP} uD$Phf,D$PhH,1\$}UM;t;Gs} ShϦ%q} ~ShD%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh$%h$P $L1QhPjV趑x`WhydP D$VI|$t;jWS \$;MU}h!%h %h h%o 1e^_[]RSQ} Sh%RQ+ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSj )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋HM:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt 1|$ 4蕅FuW膅1HUt 2: USWVt$~0`t40014@EuS10ȍj@jPm 1 V^_[]SWV|$0t$(T$,01ɉHHH HxPh^Ät?D$L$1 u džV,t2t$t$QPR1%t؃^_[USWVP]}tG,t Pw,|U w0D$PS#tC\$t$h'wSVt$t$w'G,x(t$1U1t$4t$0t$,t$(t$$t$ t$t$;M ӻ|M 1JRRRRVPSQjD$\PW,D$8L$SUb @$\Cǃ1:k0hWVq D$4WhPW$XvwD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(q3tÉ|$Uk#D$0jPUQt$(931 Ⱦu#\$,hPt$ 蟙 W||$\$ 6|$=U|$twt$ȋL$PVRjt$t$,Ph P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjArtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14xFuUxt$D$l$x P.+tn{ C K$;}sL$4QjSPL t_D$HtWM:)1ɉAw Puu2S"j@jP8 fdžUSw1ۉ؁4^_[]h%hi%hh%; USWV4D$L D$PhjpƋl$X\$T|$H'W5e F|11Kn^؃N$F Fdž?džjh>US @džPWtwt%D$ D$D$D$F114^_[]h%h%hh%( USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWY D$vP6Y 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%h|%hxh% USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715:5:5:D$D$ D$1D$hȲ%WUI pu T+=:e~ft$lt*zD$ƒbtCeubD$벡T+=D$ ChjVV5T+=hӲ%],::zVhVV5T+=hP$2,D$Vu=ԟ39}4D$$D$l$ t%1PPUJ D$yUh$IL$ tHt$(Uh޲%V hR#6uRh%fD$0Pt$ #D$8=$$ ::jÍt$0ShV u UPV] UjD$0L ::Sxy h%t$(g\1|$PqVy h,%A y h6%vuWjt$U1St$U4$t$N%ShP#PP=t1hD%t$t$eU4$zt$n5:5::(3|$t3:63t3=l$u1HL$(Qhht@P貇 PtL$* :t$JuhS%lʼnP9Uyh%T? D$ yhi%@$uBL$$4jPT4$ t$ V6衼6h~%jP>Pj h!j ۡ j|$WUt$  x>tq1.SPt$  yh 19u2::)uE 8t1FVh%1FVSh%V=t$ D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u 蛣 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj 膠 U6YL$ɋD$tP& V PH h#PVh%h3o j V jV' jRG VP ^Ð= 3u  3:@=u1HPL1; 3USWV}uCjhȑ:JN ȑ:ؑ:̑:ܑ:Б::: : đ::|$(jWN 5:5:::?X+=ؑ:ܑ:@1;:)ω|$$\$ đ:95:T$s;D$0:D$(L$, ܑ:ؑ::D$đ:D$$D$ =:EtQ1$w ww7wwVWVNN 7www ww$PWj: M$)1~~~ ~~$PVj 1@F ~~~~WVWM =:B5fDŽ$ :t$Ph$hQ 1F: :ƒ\$\$xT$T$|l$x&ݜ$݄$ &L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)WhK$QPQ :9|ӡ:tPL$ L$)΅~DQ4))h#Sh'RhR$QPԶ Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4t'QPh\$SW[ L$(+ ȑ:T$,̑:NjD$0+Б:x@B‰L$hT$ll$h\$@: :1F؃D$@5&|$vqL$`\$dl$`&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4t'RSt$Dhi$QPݴ  ::ȃ||=::݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h~$QPI ƃ}u 4)hmS#QP# ơ:@=u1H$VQP e^_[]+: :T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppu%h-%W^ 8tT 8#u$SjVi tGtV $1E48FB$)Ex t$7@[h-%hP%,ڕ h-%h%Õ 7h-%h>%FW^_[]$Vj$:t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh91jPGuhb%h\%\VÉhPKt4VhT1jP5Guhb%h\%V1H^_[USWVp $$$!19L$PVW1Hl$US ƃUE VD$PWh tb$U1tM$Tth $TPU t$jWc tu)$j4'WVU 1Hp^_[]Ë$j-UP; D$L$PjD$L$PjSVt$ t P닆t>PvGdžW1ۃ1ۋt9P+Gfdž t^[V芒 V 1um 19^SWVlT$|$$VPC1Nt/ǍD$PC PSW t Wl^_[USWVӉjh0jU ǃt{jjjV L$ Fi#t#i#tŃ%##t %؉껔#t%|$u#SQRPh%jhV迨 ^_[]USWV$=~8 71Ha~B11ۋ$4V5 <(Gs@ ,PVQZd C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)腐 jj?ƅuƋNtHNO N uFF9sSP@tVF^ St$Pwc ^GNON1wOWh4Pw cBvEVE1H^_[SWV$uShɴ%hp%&Q $%~GuG$O1@G$GD$GD$ JPRv @ tOt;HO6 8  89h%hݴ%hPNF G8~ ~u3FVh4jv ;Auh%h\%Pt6hWv  t%uh%OPWVu  s V^_[WVp׉$ftPh%hp%O jL$PQW jjP8 PjW  tnjjW t\PjW tHD$|PWV t2Ph4jp @u6h%h\%N"h%NW h%Np^_fUSWV\$%{ ` r^5 tS1r 5 u$SMjڃs tAt1t% t&%SdG su^_[]USWVt$48`ځ% t0ty@ !ȉف tVFt !ف tVkit ع!ȉ`! tvu1%r u s^_[]WVt$ N%PN1jW:jW:5^_WVPt$4%@5@u^t8tW%V$%8Vh:j%B#45@ubV,>jjP,. u hA%K,dž,sh*%[KjB3 t1t3u5$0a$ $1Ph%J a$ $1PWh%J^_WVt$ hu5#OK8r4@84^_6t8t uhR%W蟲j;A^_WVD$  uzuq0x t-@ hR%P9t3ttuu@j@^_USWVD\$\t$XFtt+NQT$PQhj@R:uhZ%ID$n D$SPU6Yt,Ǎۉ,$t1j@SP/ SUh%JI SUho%I 1KNދl$Xua1Ct'D@Wt$ PId ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uV"r'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j+(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pu w_ǍCWt$PY ;)QjPځ h%GJu^_[]ËFUSWV |$8t$4l$t @u^_à PQh,%YA SWVt$~ t^_[Ë|$D$F ^|tNxD@WPS`) ~ t^_[gV6uYhW%Q{~PtVFDtt NLt}#t%PV2^WVt$ >~Lxw16tЄuOF$uItVCu h_%@jjAVB u h_%?^_vF$ljjVB ZUSWV|$$L$|$|$ 19ID$PjRQEWPDǍh UD$ tD Ãx tC Ph%>G$C$G>C>>l$ tك**PWQP IWtsDtZƃx t@ WhY%A>Whx%k>1Bj FNt*HN+ }  hp%t>1KtJV @1| 1KGOWtQWVl$ GT$tIO9tA tBSh%\=G|txD@1ۉSSP)& 1C~UVt$$BB  tWtHPtQPV P?V1Ut$ B؃^_[]USWV $ D$PQhhZ t$h%h%<$1PhԶ%<1F\$ MbihS$( EuVh%o<u{ 87t z 8 uF띃tVh%@<D$$ \XPWoB5Ƌt8t* SVAuSj$(= ҋ>$ 1GOtHONG PtFAIKuUGGtIO9tA tBG|tOxD@UUP# {KWQjj0>[V/t?t$VtS? t@VS@ h%: ^_[]Vt$N QtT@tv$vLP ^e<L$-USWVHL$dt$\tV\$hWQQ@D$t9<$ڀr/x 7 Vh+%hW#B:T$1|$`F(f9t(~ tωӍV QPRh?%9ڋL$tf~(^>8u(F*4$QPω> ~ tcF D$F*|$ <UWSPωT$IP\$Sho%:9 <PUt$W"PSh%9T$ V>t*4$QV2K H^_[]USWV(|$H\$@?h%Wi )h%Wui t$nuD$ 붃Nt1Uu@뤃pt)xu D$D$녃뀰$vkbԟ3rxD$@@D$!ȉك 9D$t$< 8t$1j,ot$<7@D$tۉ$l$t~BD$ D${ t^T$9}*k |$ D$HtU@Gu݋$;D$ut$Sjb D$l$$[uD$L$jPD$Hp + D$VЃ с u VbV藅^WV1PPPVAD@PjVK48@t @ sfyt ‰48WV I^_USWVP$t0@D$ |$9}$^ ŋD$4S` tE9uD$ 9t9~ ux<$h%V赗1PPt$$X sUSV soV#d9tuF 1PPt$$ v|#~#t$W%uF|uh%_/F|1ɉNxlVVD2D$ v^_[]USWV$$1|$|$ |/Xh%SP_ h%S:_ l$$hWUi j%Dž0%$31K$ 8@DjW9u1,1@PPu1Ajj uD$$l$ D$D$ $\"%t!%UhH'P$V?u$\uYM'4tQ6uD$럍Hv H w?$'T+=$Tw$'D$ %D$[D$PxGD$ %D$2 $\ $$$$`"!5T+= $`D$ %D$D$ %1@D$x ˀFD$9ԟ3t$ZSX-$`q-$$h$dԟ3)$|$t$$V|1UUUV;Å$U$SjVFދ$h% D$9ԟ3Vt$(VCԟ31UU4V^;/$$Pjl$4UAF@h%英 1h%$\u($\uh%N $XL$9 ԟ3%ދ$HSKY 6i#|$t#i#|$l$$th%QShp%j+UC $\$h 'h%| hȾ%菰 1#PPPhp%j+l$8U  $X$\$X ԟ3|$tD$$9tD$tnU C$X$\ڃt@  u% 艌$\$X@l$$$h%{uh"h%0)k"$jj d Uh}jjh'$o!$!|$tYU7Hr?Pt$hԸ%S( |$WV m g 8$U $X$\$X$\ԟ3T$QR$4A $$Xh"h%l$$4D$t<t.<unh%4 D@U uDh% LHU[T h% TPU5{ $Ke (Sh#N' h"h% h"h%,'$l$$$Zu UMuh"hh%&D$PU,$tCt)QqtrqpQh($PDŽ$SU?$t PT $$Uw$U(UH$;$3t P$\P@1uhy%%$\t3$Pt'jjQP uh"h%%$H'$`h(35 $$\$S ^_[]Ë$r,u'ԟ3Qj$4J $u*$X1PQQ$ $$[@u h %$$VU h.%&$$X0 $\$X$\Uh}qjj$t'Uhqj$$[h"hG%h"h6%Vh%#U Uhlj2j$rh$Ob 8th"h[%#$X,b L${oZb 8 L$X$\$\l$$hh% u!a 8th%h"h%# hh% u!a 8th%h"h%" UtUh"h%Uh%^"1$Xr;$\@ щ$X$\U=tePh"hJ%b"KD$Pjh0j1@ B|hR#%UPhĹ%1" 贪$X$\҃ ׁ u$X$\r>1rԟ3$L$QPU $X$\p%r ԟ3$##tz% t%WQRhN&ΖUY#0t$$1:D$OhPVu h%!Vh'nj$$uh"h\% $|u($Xr$\$\$XL$$PQV&$$$|ޅ1ۍl$$$4P%t x uϺ%%$4P; C$$|$9|-hbH&D$L$$PP  ƅUQh%)$\D$L$$PQl$$Uh5mj$\$puh"h\%I$$h"hX%hl%&h"h%h"h%h"h^%l$$t׃z Ruh$\h%PHD$$P$Zh%7 tRj$tKl$$Uh5mj$\$9t3'$\h"h%h"h %h"h\%$8l$$t$t21ۋ$ tSS$ uދ$|$WPt$,V-" WV#D$$Z@t V$1t*1G{ tdS u΋[uً$XL$r?$1Ʌt6z u$R Ph(%V$X8uDu4$\@h;%PED$$Pl$$+ɍl$$t#%@tD$$Ph:Qj$t$D$(P4$01ۅ~ tVhEjj$vP:Y WVjh\%*t*VP uVh%Wh\%h#}^_USWVt$4rLD$tX8tM,t=t8D$jjPQN u!h%h%S j^_[]Ã~+ajjjٟ ˃ph%h%hμ% 1m>h(%h %hμ%W <Ph6%>h%h%hμ% 111dh%h%hμ% @+X1BWDP h%h޼%hμ% 11G18 4 ى48rPyWeh%h%hμ%L t0LvPh>%-Vt$VںtVhljdjQ^jQ^Vt$V蟺tQPhs% 1@1Pd^WVPt$D$uPhս%hp% jP,踾 tuIhս%h8uM,z ,赿dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS,# F>)^_[USWV$lt pvh%PW; t=wM$lDgO 8th%h$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ U> =wfD @PUhh%Wudh%ha%htI{>tA,$fEC(ffEEK*S>RQP! C>4() P1pČ^_[]ÍF Ph%gtt {>u[[ht h5%8~>t$fF(ffCCN*V>RQP ! F>4)mC Ph%$D$@USWVPl$tGL$ %ft6 $L$qt 9ot4?uYyt(Wt5PW0M 1HAjeDžu މQ37tq >y_AofG1ۋ4$D$(T$$W GƉ͉PGt/u+Wt QWU KO9{fwEi^_[]USWVx$zJut4<$ u%<$1F1ۉ\$t$\$ \$\$T$1F1u u /u*1@kNt3yu%ytzy~ ~yNхuFiPv`v\1PPvX.D$tq^\|$~hud~ju^CttuGFPt@vT3Ѓ41@fKS΁  QrR u$03Wh$t$ 03= (1ND^_[]á(3ËD$(3@PW )3F SVt$ a hjh(3h3[(3 s1fà ; jSP  t< V1H1@^[ fVt$tYVV8VgV1jVB VzQ6v|`^W^SVt$ V葆1Kt=jhj t!jhjk 1ۃۉ^[N Vt$t'PY蔤džtPvdž^D$t$t$t$ SWV$hjW7 C jPW Whi 1NtF$$T$ !fD$f9t hWhiY t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv : 7 : V1H11Ʌtx $BD<IG9uލ|$$ ^ F>L$jPWV uF>*PWVr 1T^_[]VD$0tVjV#v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8$?=^_[]ËL$1t$VËD$t 0k VD$0tVV"v^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjVu4 Fjŋ$@V $1WT$ȍD$l$C txuD$ Psot uAutF L$0QPd) tًv\$~;1$D$0Pt9) tF9u19D$$"$8ЃD$P1~11TjT$4R4ۿ t GP9|PX~11\jT$4R4蠿 t FX9|XD$ 9D$H$~11LjT$4R4K t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$؃uVh%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$U l$D$m@t$ FGF<<y<$l$D$0P$0n& R`~/1djT$4R4L F;`|ӰD$|$0WQt$\yWh% $_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tW}tmWqG@W fGDGȉGHW葀t GPGH$G sWGLGMO9EVh %oW$7t)|$ jVW w_ jVS r1 1N^_[]j:S? t/@1UQhQQj QP G8mt1 (G8GjSP1 O t 3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS- F jPSe WSh~i tD$Đ^_[USWV0 1<^_[]ËL$T$jËD$t1t A$uIUSWV$|$P!D : : ::hQ%F: : $<  O+VQP} 9v1 LJ\$ I;<j,j@t ǃD h%j,jHt ǃL h%j,jgPt ǃT h%t$$Wh'V D$9rh%h%[H$|$ 7D$PWݒD$t$h`#D$PH ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PWbD$u?\$SZ J9t& t uJ؀\tJ\$9u돉닋@$8pDt1@DHLPT $A AAXX\\X\$<t$$hV0WsD$t|#t3=w&AL$0h%hW# HD$1D$S0Ws 1ɍD$D$$D$ 01D$ύD$PD$$PӐD$h`#D$PF ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U  hA%U h#U $D1)hX%U 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS1 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$ `Dd<t A`Nh%<$Dt&u"t$ $<& 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U'B tu;uHUh`%'D$uuUh1$t$$t$$P$'t$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPjtt*t$1PPU t xTuXTj卆jPW67 $@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWdX\tWg,\u싾XW2($V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(ԟ3|$$t)`#L$# $ 1CƋl$ \$18"%s!%ShH'Pt$t$Xh%j|$XYt$1VWjWWWWt$t董 L$P9>t$Xh%%|$Xt$1VWjWWWWt$tL L$P9>ut$Xh%|$XD$PKHLt$X$/L(t$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆD$PHL$ $D$P`jD$PZD$P"GD$P 7|$X|$XG\$PH: ? 6@D$P@|$XY;D$$\$ |$t$T$XPD$$PD$0PD$(Pt$`l$LUSWVy+$6?mjt$\D$,0USWVX9jt$\t$$USWVnXjt$\t$0 D$P9D$PHt$LZD$PD$PD$P|$XRt$P jt$\h&& D$P|$Xt$1VWjWWWWt$t> L$P9>gt$Xh%D$PIL$P׃L$P׃ D$Pf D$P|$Xbj,|$\W  j,D$Pt$X=h%V& h%V Nh $V Vj襂D$VPl>D$ 9lt$XPkpD$P |$Xh.9#Wx t$P^h:t&W^ -h%WH h%W2 Wh%D$PD$PzD$Xt$P jP#h%D$P 1D$P!D$PD$P|$Xi;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWV'$6?mjt$\D$$0USWVTI jt$\t$0USWV~T+ jt$\t$(+|$X ;AD$(\$ t$|$T$Xl$$Ul$$UPD$(Pt$`l$LUSVW&$>ujt$\L$01VSWPS jt$\t$$VSWUS jt$\t$(VSWUSc jt$\t$,VSWUc|$X j=|$\Wx Ê@tC< t< u CCu1j h%W j h%W 0jh+%W ojhR%W ejhK%W MjhA%W 5jh>%Wt jht%W\ Kjh}%WD jh%W, j h%W L$P1T$XP_L$ T$t$XV5&1I $'j/V uD$|$PjP 'L$ r L$rL$ T$t$XV%1I $j/Vo uD$|$P jP5 L$ r  L$ r  |$Xi D$PPTt$X%TD$P@|$X D$P ;$3t P 11j|$\WtdƉD$"V[ jWt>th\%V  VDž(@x |$XP L$P T$Xj Y D$X t$P jPCb h8%b|$XD$Pn<a't$X赹 <PD$P/|$Xh/#|$\W  t$1VWjWWWWP趗 L$P9>t$Xh%J|$X9;D$\$ |$t$T$Xl$$Ul$$Ul$0UPt$`l$LUSWVY!$6?mjt$\D$$0USWVlNjt$\t$(USWVNNjt$\t$,USWV0ND$Pt$P1t$X "džD$X8j/P 1|$Pt@j/P tƍt$X!t/F1Vu!gL$P ЉT$jt$\3 hc%|$Xmj,|$\W 9ƀx-9l$Ps%ƅ |$1WShSjSSt$t ,9hq%{T$P |$XE|$X4t24u t$Pt$P6tW6u @W F t u VFu 냃|$X \$ 1H$|$XGl$PGt< t< tGG11V@jP R  L$ j / % < t< nGG|$X{t$P$t$XO $ h%|$X:; D$$t$ \$8|$T$XPVD$0PD$(Pt$`VSl$$UWD$(PY$Ɛjt$\V3u7D$ 0kJU  8ut$Xh%t$Xh`%11IT$P   D$P D$P D$P f$6l$PTD$X   @Vh%pD$PR |$XG D$P2 D$P" |$X6t$Ph9%D$P@t$DD$PPt$T$1D$X%u31L$0|$X_D$4KI ? 6C4$F|$X7F$D$(%1|$Xt$PXD$\D$XxG< t< tG4$G\$1SUjUUUUt$tV貐 9+aVh%SD$P D$P  D$P |$Xt$XVU1@Ty D$Pi D$PY D$PI D$P 9 D$P) D$Pƀ D$P@ |$Xtut$1VWjWWWWt$t譏 L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$to L$P9>t$Xh%Rh % %Pb|$Xh1%T Ct$Xh%W à \$S ƅ|$PPh%SV#  j Vflj/t$\ G1|$P# 1 t NOGN|$XC1j:W; t4A|$1WVhVVVVQՍ 97Xh% j=W FD$, h% @1 t  H@WhW%D$PɋD$Xqt$ $D$Pƀ 1_1t$P # 81t$P '1L$ t$X!d$ D$ D$D$D$4D$D$0,tW(͉֊E|$Xt/t3f9]u-8eu(D$8EuD$48EuD$08Eu Nul$P(BjRQr HƋ,HR‰(,f\|$XD$ D$ DD$DD$DD $$j/W GVh`%ZT$P   Vhs%)D$,h% hr%aƆ }h% D$Pǀ`h%f 1H$Ta Vh^%rN D1DDD DD.u h%  12D$,1h$W>h%W(1h%W(hd$Whk #Whf%Wh%Wh%Wh#W7 h%Wvb h3#W`X l$h%|$WBX h%|$W(l$ h%W f h%t$W h%t$k h%t$ h%t$ h#t$ h%t$s h%t$Z h#%t$A h%t$( h%t$t h%t$b h%t$P h%t$> h %t$, hW$t$ t$h%t  t KC  t KCWh%Ɔ  gt$Pq1pƅhihq%ottC< t< Cuh!%GDžh%A3D$0s%1@Ɔ 1]L$PRGt$P jWc  륉h%W t-h%W thz%W t h%W t@ChH&V th%V D$P@ tsFH t t@@1 t  H@ttC< t< Cuh:%ƅhhz%sF< < F1$SUjQ tUh%t1C CC"$f8l$1USjxSjSSW轄 $D9]$ƃWh%- # t KCƆ L$P1SnF D$ PVC   7ƅh)D$Pǀ1FS #؄  H@+ ! t KCƅhD$PǀwFt< t< u GGu1L$ T$SfL$1WNF U3ÍD$ PS$CL$QP$؃8L$QP$D$PUSP WL$PT$Xj :t$PjPj 1 Ӄ  (jVtAl$P  hv[#1E1؄t  H@h%%1H$$<^_[]ËD$PǀǍ0PVj%N Zh%F -{L< < ChZ%11_Ho@@V ыD$ * * h%2 C]{/< t< tCCB؄t  H@hP% yt$1VWjWjDWWS& L$P9>OSh%L$ 1SK 1I $ԉljUSWVL$D$ T$114É GE9u1D$P$tj~>$ 1W4L$ Q 9s: $T$э A@)E9uы,$t&hD%h%h h% 4$1^_[]USWV׉ˋt$$V >"u y"uIFA $Vje]t*Ń!9 VS<] ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P# T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P͌ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋR* j=P ,$|$D$ VV 1ۉ\$t?t9D$ 1j=Ss )9uWVS" D$\EuVͪ4$虘 t5ƍEjPt$  4DL$h)%Uh)%h5% |$$t#4$' tzSAD$h% D$tHTNPRh%h.%hh% WVt$ t)1WWVf tL$@Tt8QVW ^_Vt$t$Ƙ^hL%h%hdh%L SWV1SSQ t&WV W荢SSV٬ Džu^_[WV|$ t^ǘ1PPW責 tPW©h蹑ƅthjV} ^_h%觭1hL%h%huh% D$t L$tHTh%h%hh%h%hh%M Vt$t61tpT^h%h%hh% WVt$D$ L$zVP9tVY 1^_ËD$HTt1Pt$ h%h%hh% USWV\$tF+1PPU; t.jVU) 9^TuVU8VWu^_[]SWV D$4toHTty9|$0uPLjPWΣt<Ƌ\$8PWڧShX%j W VNV ^_[h%h6%h h%h6%hh@%h6%hh% USWVa$c$L$<D$ VPU@ }W D$]8D$HVPS SËET%t EtuHt4t uxjhh'P_\ q /1hM%hu%hh% D$tEHt;tu&xÃxu x uxux /1hM%h%hh%i USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+[ /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uP:މ^_[]Åt 1u19[:Rt1hM%h%hh% h%h%h'USWVP|$G<t<$ $ l$W)Ã|WhVh ۋ|$t(ٸF\$$)؃|PjV3 1=:u+:W9u!: /1N^_[]h%h%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ Y ^_[h%h%hh%h%hh%z USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQmASKWVPQ_0 ^_[CPhԿ$WVw 1t߉h:&h%h{h%h%h|h%] D$tL$tf HhM%h%hhxF&h%hh% VD$t&L$ t/fqPp QPI H^hM%h%hhxF&h%hh% fV$|'Ph'% u^USWVD$t$V1Ij0V1|$/ooo WVN5't-1C 'I?r   DE9u֋-'t/11C 'I?r s   DF9uWt$VH 1ɉt$\T$\RVQ2PoVtt  81I $ȃD^_[]WVP|$D$L$ $QPWJ tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP詯 tbL$1tHh%hs%hM8| /IG?uWG9rD$^_[]h%hs%hh/%P USWVl$t$|$t1ۅu>t7NL%t}&}#tÉS1ۃ1Ct:tVtXtSh%t؉8txt@HtPt؉CjVat.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVF 1H^_SWVD$1t^|${t 1NA~0jh%W# uW W G9rh(3薨 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%;S$t^DžtnjSWc  8thR%h˼#z9h%k1HzSlt$hR%hW#? tG11CGt0WD ؃uh%h%?Ņu1 ^_[]Ë$t|$u%tPWht%h]% =mQPWht%h%論KUSWV֊B D$L$$t W *QP%u vuPh%W #V@th)%W|$"D$<uPD$@tEL$q Pt$h͢%W;͢%D$ W|$"D$<PD$@LAL$qPPt$h͢%WXUSWVl$t2E1Ft/׉˃PWhL%StEu11N^_[]fUSWV\$l$|$ttUPW%r 1tk<.tgh#WK tUhF$W9 tCj h%We t/tj.W荕 tUWo 1t^_[]D=|Vt$ 'Bء03H 03;@3h(3j ; (3H (3 Fut$03H 03;@3h(3j (3H (3 Fsh% Fsh% Fshd$ F shj # F%%%%% %@uwxn%rh#r]%rR#% rG%r<%r1%r&f#r%r%Q F sh% F sh% Fth~$ Fsh% Fs he% 03H 03~(3H (3 h(3j h(3c ^ù%>VT$ L$\tX9t(,Nu2\1tX9t,Ju^USWV$$Vtg$$QPVh%h%h"%USX 1N@t+9w');@MQP'At9w :)߉h%h%h%US ^_[]USWVD$<P>j t$ $h,#V ]NjD$@HD$?1jhO%W[ ujhK%WD u|$D$4Njt$0tNF tA.t;\$SPз D$P1U1HPUUUUSG 9l$u9t[,OuD$,Njt$(\$Sv { t-D$P1U1HPUUUUSG 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h,#V\ Dž4$z14$z 1H^_[]4$z USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ胖 t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ V "1H|$0t1rЃ^_[]c V 7I USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DH \\$ $2f\\ $$$T$$$O$sZ/t uP tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1p T$$t4<$t s%|$$u1F7 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElL 1 ^_[]ÿ2 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3VQf 18襾 1H(D$ 1%tK%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS? C@G jPS[ fC $4CCD V$4P UShip C O*W>RQP UShip迕 e 1N^_[]WVPRQ9 ~u~uF $uG*SVP tu萜 1^_[]fD$fx(t1ËL$ D$fx(uD$A V1ËL$ D$fx(u D$ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjJ`Ƌ$(@h@hF%ljFuJ1ۍl$ShO%j U該 h@UFuC* 8tǍ\$($PhqB@WU} f<$f|$ jUSvB ShlBW} txD$PhpBW| tZ$$VЃuBD$PhfB@v| t(D$FP?F u+ hZ%[Ft PVP1ĸ^_[]USWVt$fFtV)vv vh AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ l FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPh{ ^USWV L$@T$v lN^cNVt$1B6t,1(th~B vz 1Ƀى1H^SWV`ȋ fy(ue\$߾''|$('󥍼$tC'DŽ$DŽ$@YQhgBA跗 1H:l'DŽ$DŽ$@YQhBPy `^_[USWVy%'t$PhW# uD$tt_L$p1۹tU1ɋ|$;t A,9u9u'u uh{%豯 PUD$tC,9r|$t"w 7h{%{ PW,Nu^_[]USWVL$$w莖 1H^_[]Ël$ |$ $9;l$ tWj  L$tu!s^+9ED$tSUD$ Pxi ݋D$1PVPhn%WU auPh%W/ $P3Wjs 1Ƀ H蚕 "USWV$ vS$$AKtGu4|$QPhW"1Nt8Wh$S, u!"! 1t 1F^_[]0Ph$VA 1Ntҿ9tB$Uj ~ t$48跎Ph$U u$j= HVPL$ uEt9BSu3 PVjp] t<$uffDw D1^USWV(t$@1ۅ@hHL$@D$E_l$u$D$T$Pjyt$  t#3EoD$T$Pht$  %L$T$ sd 1K41ۉL$$$ s09t$@OōGD$ t=VPǍD$PRf 1HȉD$ 7΋IL$uEtD$D$|$@$D$ PUEL$QP谶8L$QP蝶Ut$@!t1CL$$9΋l$'1#"t$@1Kt$@l$t>*@h t$ Vh%R $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@腥ËD$D$ PSTCL$QPC؃8L$QP0St$@败9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU膴EL$QPu8L$QPbUt$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PKPVh%S'1I/ދ$0$4Wj$@U t|$r $,84$HP܈P$0Vh%W说SyGPVh%W芴$0$4|$WjU $,t|$w1Ћ $ QQPVh%$4'$4#]SPVh%$4T$ }ltE$u?ClhPhhWzWVh%$4衳{,t=u8C,j@Ph@hW5WVh%$4\$0ttp1WMC,;tr鋆Dt%@1WC,;Dr\tX1WC,;\rF $t'p1|$TPÀsE,$0;trT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph"<Vt$$@$@$L0 >}k|$`$0PJDL$L$QWh"<Pt$$@$@$L06 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph"<St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V\ t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$  V1(^_[]ËL$DtD$L$tPVQ\ D$ƅu薈 SWVD$ L$tT$$wq .11t$|$X+9sA "11T$(|$ttp 9t,Nu:^_[WVt$ t?GL^_VF\t% p#<v\F\^VF`t# P;v`-F`^SWVjh0jJK 1NǍ\$PSPhWetrjSjjWjet]jSh@hWOetBD$$1ɉ $L$ L$L$D$fD$DtD$jPWQ[ t W_^_[USWVt$+VjU=Chu,$t#tVhV?PjJ=^  r%sL%PSh2%PSh%G 1Bht? ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%F ^_ËD$$PL$1Bht?: SWVt$tgw]Vh?ja<^ w$~PSh%E GLhSl ^_[USWVhuD$D$G$D$GH t-wQ:GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%?E _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%D w$x}w(3<PSVhR%pDG0GHq% w$7}PVhx%@D G0GH%c1HG8G4 w$|PVh%D 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( &|$D$ fD$l$|$Hl$D$HG4N PQh%C ?G0D$ D$$l$ &|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P{w0PVh_%B w${w0PVh_%Bt$6u$HujGtGht:?%tP%I^%GHPu萪j19c@O;Au<t %?u|%GH0ts]Sh?w4Q 8ShFw8P7Sh4Gw0P7C w8w4Ph%A 1HG8G4]@uPD$u>C wiVPh%]A wwhV3uVh%AOhD$L$u2wHSW3jt$S9 t"GdGh SzDtT$e^_[]Ët$;th*%@jaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6J8FD$ًT$ PjU t |$rF 6 8F Fn ىj3Wt$(a& tEnىj:Wt$(@& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hhI%w SWVt$^ Sh%L?G0+G8PSh@%> VhSlj%51Gh%WFiP7 WhY%>NhFL^_lUSWVӉ΋9 6uuufEt@M;AutLEdPDE`t3VhnmjP"/uh%h\%=^_[]h%=^_[]o$USWVPt$E $u %21E E9t~WSV5 ur6jSVy5 t jP= $WEWSVN5 u(h%h%h hI%+u PPV&5 tSE EdP $PEt]U$uu h J]CF Ph%c<6u%EHPVQ Vh"%< ^_[]WV։h,j*t/L$ PǀcSc tfǀ 1 ,^_ËL$h JVD$tF9tAtIdtI;u D$ th%P^USWV t$ t1t+L$$OH# u( VjjI1V^_[] GiP6_V><'C'C'n w$sPUh%: y1WVVWU0VhgYSU.Vjji0^_[] USWVxT$΋}T$0t$ JL @r@t‰VLih莾 D$ɀwȈGGV*QRPI T$  |$t t?t`t[\$XSjeD$ 1WPS\+ 9s1Ht!tfG f|$fGT$\$ыT$ BTȉGD$8D$LJcScfLJ5D$ȈB$tAzDcScu8\$t;T$u_T$ Rdt'\$ Ch\$u;Bu1ɋT$;|$\$xfLJ2L$ A$y$tRADT$ 1ɋ|$cSc=cScu/t+D$ x<t!D$)df6D$ @f2GD$,t4t"D$)f3ȉGD$)f7t|$p1D$ L$$rnX|$(\$u'1C\$4|$\$(|\$4r ,1CL$|$(L9Pu|$u)L$:u\$L$$B,;tr\$ L$9L$ C\$ \$\$Pga PL$|$)9 OGPSQ|D ߃T$\$'HT$|$)9QGL$8 $ GfGGPQǃT$|$D$ DD$$|$GD$D@1L$ σ| \$D8 C9rJr{\$\$(u3L$1C\$4\$D$@D$(\D$@ˋ\$(r6L$1C\$4\$(L$LPL$4u|$u$L$:u\$|$@,;D$$H/9|$L$\$ =C\$ \$ˋDL$$|$GT$ ЈGCWu&D$)Ѓf9D$8ffB L$tICY uCL$)9ׁ BM AQSPrB \$ǃT$y׉pfG GT$|$,t4L$t+C^u%D$)rMftGL$T$L$ T$  txL$)9vDF Ph%/t$=$]tVSt$Dj`%e^_[]Á G AQSPrA ǃL$G)ˁ+),PjWj ,1OD$0@hX|$ 1|$CD$PjwǃSt$P@ G D$G D$ GGDCff_f_1ۉT$SfGEh3 fGG@D$ffGScf f_ t$WhD$wK*PQt$: u)C Pt$hH%1( ىt$ t$ [u^_[]SWVt$VtB1ۉwww  W6ttt9uq@苆xt'Px džx|tPdž|#1^_[UWV}tuP/G><r 'u#r G(ftf u  s% u`hC ƍG 4$D$,$5&D$\$$4%&Wh_Vj"e^_]Íe^_]USWV($uZD$>48Ѓ% u x8u)|u jh0j\( |u&h4jj@`GHW%GP_iVjhStSE0菭 LJ  twAQ  \ BjxWh|jPhk%h\%$sY EX>@P UB( A J*R>RQPB6  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%O# Pj(Q1wLw !w wL$u]rruG XixiF SPh%" D$h$PS61Rhk%*#@uB3EpCP t: @ NH M plYh{%"u Vhw%"h%"ޥ3=u1HL$h$QP] t=w:F h%Ph%c" w` 1Ƀ8tmF SPhW#'"1Ƀ W7@uÍT$D$ Pj5S؃ PG tL$SQP3 h%!1ɉOG @L$jQVT$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6˨L$ <G cSc{ ni;`CLsu#1C &cMScq s$2XPVh8%; M+1Cjjv؃^_[]ËL$hSlYWVP֋T$D$WPt$K 1Ht<$u 1t ɉ^_ËL$hlSWV1{\t^_[Éjh6,Q C\t4Whmjp4 uh%h\% W 8u"543h%  Wh%hW# 1NcD$T$ PUSWV$$($$$$_\ftPh%hp% ch$US迼 t'sPUVZt3_\t,Ct$?tF Ph%hW# V$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%hp% t `xjW0 tD$ WV h%6`(^_[]WVD$ t01r9wu f΅t0^_USWVӉ΋$$D$~ #5;L$GTK9u@F>$wGKV*PRQ T$ t.Љt$PĬPځĤ^_[]~ D$)\$|$ t21ۋ|!9wPjA GPBt$WIGPuD$xgD$@ @w"D$@@wϹкS%WPNjt$$V t@uxt:?G@L$AG$GD!T$D$$Pj6t$O |$$L$ A<Źj%t$t$t$ V9tHhj1WUkVWSVh >jS%?EtT$jjPt$ ur%|$u%%D$ @<6|$uZEtTjjPt$ t>D$ %t$t$t$ VK%t$\$SWVL$ A 9Ys#Pj4$L$ A L$ $QRt$P 6Vht?j|$XtVhc|Pjh|j|$ GPG $9OsP4$L$ A t=|$ $OQt$P G@Vjj*h% D$ @\$ sCCCC C KCK1{ {^%CHPVuWC\iH`|$ GPHUSWV։ˋ$($$h%Rm= \$ t$t;ED$PyEP $,uzh% $,tKPD; Í$PumSVht$ P谈V1$,$t$Vj6S >uD$߀ Vj4W趿 t|$u$$}, uZtV,j@Uh@h\$ S  t$LD4$teSPh#Vt$Wh%t$(C #ۋD$t$0D>% PC4$L$ t/PUVt$Wh%QSPh#t$Wh%t$$$PUt$ Wh%Q h% Vm^_[]USWVPPj8t$ 膾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjjkK AuA jQV_ t=Ht*ub 4$BPVh.% OVD|$ss D$L$ q qQPWVI  (^_[VD$ Ph% v 1F FFL^rL$h|ËL$D$1PnSWV΋1u1PPVF t7O t P SGt-^_[cF Ph%%GHPVp^_[WVt$ F PhR%lOhGL^_D$ȅtȰ (1SWV\$C rF 1H4t${GPhVC ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWVdD$xti{ W\$ uEhk}dGh8'|$,WEdx \$ t]SW ƀH|EdH #HL$|$WVgEd@ D$WPsgF9V|$,WW1VVPd VVPD ƍF8Pauv3TV[hVP' SWVG| WD$,P\WjVP ƅuSWhC$t{tlSVD$|$WPYfFWPLfF8MdQP9fXMdQP$fVD$,PVSu1PP\$0S tzVS$~xF| uF|EhtF|FXMdQPeV$%9tVTVGS1PP\$0S ƅu\$ C$t$|h8'D$PU1PPVh ƍC D$~gV_Vn8U_B1PP$ 9tC9t?UW%cT2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j 81t7> 8t-> 8t#= 8tG h%PhW#\ GtO9KuS ;W t u^_[ËK StQSP Svt9_duGhGdhxF&h%hh%6 Vt$u.jt @h"%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4t"lj$D$GEGGGh0%1lj$gL$$\$ G Gw uM6 Ʌt ѹ )QPhn%jVyS D$h @$n$tt"D$$06PSVUh=%WjtGt $AG8y-; 8th0%h\%1Gt Wq^_[]USWVP|$1!{t3s$Cd$9Htju  rj7R{htCdt Pj7oRsHWdH ;K(uH;K,uO PQhn% 2C(K,QPVWutAhAd v: 8u0t0t 9Ft!6u Wh%^_[]Ë $t9At QsdChj7Q;usHW1c7衮묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P7Pt2Njl$$L$1tFt@t0Q;Ut, u&8 G8 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u2L$( Ʌt ѹ )QPhn%jWFO ًT$0D$,t1FVfOыE@rt$4VQ ƃu V}^_[]h%VD$t:t0t!PtQPV P4V)^fWV|$ 1u7jt @1H1N^_USWV $ yr6 t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU( a6 8th%h%t$@s"j@{Dž@7_t D>tSPjjS> t'O N ONWVHHN@LF |0 VUSWVD$1tW8tQ\$l$G@tjUP般 u8u@$<tD<u/F*QA^+Y ^,Y fA ^-Y ^.Y^/Y / V1H^[ÍQF*v.q Au41USWVL$,Afw\l$ u L$1@tNduFdШ(u1@1^USWV|$\$l$USW USW@ 1ɉ t&tuttNIHP;JHrƉ^_[]WV|$ Gd1@ur t3uh@uDu HuLtPt$W!wd9t WG1WVVGd r1NGd^_USWVE1t$t$4$tC1;PSKu"KtHKUJS#ue^_[]USWVM1D$D$$9?CdEu} t!KtOKUJ9} t&CѾ!! u } tK@} uStPSuVCjQ0 ƅtF;Ct SC## ut PVWSe^_[]SD$t1tKt:t4z@u ZAtz@uzDuzHu zLtB`uI볉[USWVD$$L$utyt$(P.dƉpS|$,VD$IT$D$*tE@jWP¢ tmu11D$ D$8E`1ۋD$ $t*EMHMT$4tbD$0jPWV P~uE$E E0Et o*Sh'U Sh'U TD$ 1L$A AAPj@QWjti1HE$E D$,$uLM@U EWP+D$uYUfs V f 1NE@M U\$SWRQPUtD$D$]@D$ (tE@jPS t=m<$hj.PSj"q 1T$ JO9zPW[7E`t tDD$@D$,$OE hUPh% 4$p 4$Ud 1SWVt$\$Gt!PtQPW P1jPWtt2jPu3%W1VPj&^_[Vt$~^USWVPD$D$8D$ h@$1F?C@jPU, tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%_C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JS0t4$| 1H1^_[]SWV\${C KhQPWƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUt?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPam t u"GPt$,h1% GdD$ D$1xG O4SQPl t $tsOdtYG %tM#%OhQRPhH%"Wjz[u! 81t 8t hZ% w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPw2l t $t8$C O0QPhj%r OtHO\$u4$FTjPS' NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjqUt$&$T$9rхtȱL$D$<$zL$tRhQj苹D$ t;t$(h%j6h%Vn+e^_[]SWVt$Vjjvtj11G9quƁjwمuިt?5j6R  sh%V*^_[USWV] D$@Cxt$rj.VL$0QjU |$,wVh%}D$@PSu0 t[x ub‹  uIT$D$K9Ou:u5D$t |$,w:D$rPhH%h%9e^_[]T$rRQPh%6ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQp t8D$ L$rQPh% RQhi% \Rh%<$EL$t^9HtutL$BEۋL$t$(t&9KuC jVP{ L$  uhj议ËD$CNC KFCF CCj.L$vQP Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h\%|$$HL$Xxp jP$P' D$<t$h%|$rst$hs%$p΁Vt$ h%t$$蚻$x|$D$ƀt$h%B1|$t +D$(t$( 4XPjQK Vt$D$`PY \$Zt$h%t$ $A D$PAD$LIL$HD$DD$xdt4D$t!t$but$h"%e|$$t$L$U@AH|$u D$D$6D$t0t$t$<;t$0Vj6 t$ \$1ɿSQW赬V1QW蠬h^%t$TD$u%D$6jϬD$@`L@O|$ut$h\%誵몋sLߋD$,9CPut$,t$Vyp VqGPD$$t$,әGLtbt$,Vt$P wPD$(À|$$*"D$$ h%s|$$/W̩!t$4q t$h%Etk,΋D$9t ,JutVt$4q t$hD%U|$u/j |$u$jt$ut$hL%Դt$[t$4t$t$hf%葴|$$tL$11BL$jOD$(D$$UWV}u WYh8 ƍG 4$D$,$5&D$\$$0%脳WhVj覩e^_]WVt$ VhW辩VhW觩VhcW萩^_SWV|$G Phh%1ujjƉ6§F_>tC FPjϠt.t+@JAH *RWP tF F^_[h%в^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSWҿ D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%RL$jQW u h%許$BHJAWhcjj G Ph%۰WhcWh iSh%,Yjt7Uh)jP*@h%h\%)h%d^_[]USWVP$΋A1PUj貦vUW蚦VUW艦<$tNtHN JFxUUt$ Pt$PtQP P覤vL虤V萤^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%ï t#@uUh|%ɯ S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%賮j봋4$VUh!%Ю Wj`Du! 81t 8t h%L$o@G WQSRPUitDD$GdՃGdD$ j.PUjWA t'OQPhn%j.Vm h%z)h2  WhPj8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWYh uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPwE Odt Od tY?uŋFuh%Ph%Pt-u~`?w#F0a`F Ph%莬^_[]jt$USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%hp%藬 jSWR tD$ SVS h%Kp^_[]ÐUSWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh)%* PUb D$C,9r|$t"w 7h)% PW, ,Nu^_[]WVt$ tqwgVhjW1GGG G XGt^_# Vhs%hW# ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUW¾ u?u^_[]USWVD$t81t9\$l$tp|tSUVs u6u1^_[]1USWV$.FX|$ j.WUj< \$wWh1%&$$tXjVWm ÅFD$Pjt$ L$QBƋ ulp|$NjSW tL$9uPWVc t0 D$ PSh_%̨ ^_[]hQ%@jjt$ t$Vt+> |$ u2}E$<ދl$ D$ PSh%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%觧$ WSh%8 F PSh%y t){4t#D$} t*tu Vh% Vh%5jjt$ U5\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U~G $,D$;]Er%f4'9t Qf9Au<< <\$H $0'|$|$W(jD$$PW[' !ȃ+D$>t|$l$ T$%R WV PWVh%D D$ PD$p Vh%% D$ PD$p VhB% D$8|$Wjt$ U"$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8l$ |$W~'jD$$PW#& u4F L$ QWPh%D$`$T$BWhnW˼ 1^_[Ët#uujWuW 1NUSWVPt$$1퀿?^ Shj%P o1@GGG,G o$ t?t/Sh%hW#Vhjj jV^_[]USWV(u48Ѓ% u 8uu"1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VL61OxhD$ 0,\$t(1$f:t$˃Hu[1PPShjPAh%h\%$1ۋ6<$tD$D$$t;F SPh% D$$hPS6$Ch%舜Jh%ޥ3=u1HL$$hQPFB Ã37@$:VL$QRP,$ \$\$TSjZjp D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%КT$E|$wD贏S(GDtL$$SQP _Hbh%ߋ$t|1QhQP蕰T$R6 #\$sDA1CDCHB-ۅt}u24 8tn* 8tdD$ Ph%hW#舚 FD$ u9H|t;A`t"ftftAdu y  Љ-e^_[]1ɉH1BPP@ H~ Wh)%讙t/Vhj j`1WhK%hW#贙 vF Ph%躙*YD$twËL$1Bt$USWV ׉΋L$ F $L$t 4(@D$tVjjPo  VZt|tw;uY 1CCCC CC$ J4$h%hW#_ %1GP6U 1҉$1Pc*sL{CDKHCLKP1ɉKDKH<$u5t1!͋T$!11 t%L$tPVyCLP#s4s< SdžVL6ttFtu7@t'P5p>dž ^_[]É ^_[]L$1jSWV|$Whnj׌txWhS豌WhS蚌WhS背WhSlws^_[SWVt${Du ?~ Wh%P͓ 1@1ɉKCCS(C|S KtHd sHdit xt^_[Wh%hW#諕 ^_[ønL$xtBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@PsNt3O WhpjPuhZ%h\%ߔt|t$WPV跷^_[D$T$J P1)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$\t X1WC,$;\rD$Vhj%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ h Wt$$t$$t$PD$\0 t0L$ D$ PQh Vt$$t$$t$PD$\0g D$ L$)1H t$臆1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s D 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP迅G4 w$'   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$(Z Ãu t˃ D$0uEpD$D$WjUP} D$Ãx3 t 11A9r1Ë71$1 $'D$HDH0D$PjVQC$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj URt.L$ 6Njl$uD$ Ph%ٌ1l$S>qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N й(H ̹(H ȹ(H Ĺ(|$ t*G>r!D& D$H<D$@} VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%S D$P4 uOt$ pffBfBpɋ<$tXQlR˝ ڃ p7t$ffBfB<$tD$WVPR艝 ڃ L$t3D$fffBt$tVWRωP ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPќ |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHPdtKWUP D=l$_D$ fǀ<{ 1fw ')h%R|$Qh%j W D$l$ f9<t1}~ QWh%P(}t$sf< fu.Wh%~й(Ex̹(Etȹ(EpĹ(El6tjsuD$0^_[]USWV΃|$$w VhU%~1H׋J 1ۉt$$S1ItU% $]h]d]`\$,Džu\$Sj٫ƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vhp%&WV΋rjVtVrjVtVJ^_1USWVP׉΋\$D$PjRSRtLf|$uD(͉čF DQwUjs(Ph%|k(UPh %f} ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh'%t|},WVhA%} ^_[]V΋Qhjr1ɉHH@@ @ @$2t h^D Vh[%hW#j| ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VP6'uVjjq-wx9Dth%Vku Vh%|{^_É1j9VދL$t1Bh%USWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Qx1%8WjjpD$$Pj <$w$'8uJ7%=ǃ8%8u+%8u%8u >%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ hF%y ؋?ut$u {`<$uhs`t$ hh%y 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%q:fD$D$D$PjUVD$0T$4)̓w!> t$h*%qfjPD$DPu D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$hJ%Qql$4D$h|tjD$@PU4 upmjhD$DPt$*ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%o( t$h%o|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%#o wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Pho%Ent}u^_[]8Vf6!^_[]SWV΋y Wh%0n 1CCCC CC$t$^_[Wh%hW#0n ^_[Vt$F Ph%2n1B^L$$Vt$?N Qhn%Pk 1B^_L$h}WVt'׉΃|jt$RP9t j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPVt:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjvb1CC C XCC~ ;u Wh%5l Wh%kt#^_[Wh %hW#l ^_[ËL$#Vt$Vh#jaF Ph%k1B^]Vt$?N Qh%PJi 1B^'L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hp% k tjS0b tD$ WSVn h%j`^_[]ËL$VVt$?N Qh^%Ph Vhj?`1^L$L$@ <3 T+=B99T$:,=Z(D$j P5T+=> 83 T+=9T$:@=coRED$j P5T+== T+=D$0؀:؋L$9Ʀ 18D$8j P5T+= D$袦 98} TءT+=8B؋D$8Z,# <  <T+=X*|$W5T+=RP<} 8yeT+=D$# < 7 !<# < D$# <  <D$j P5T+=T< T+=K9BT$:5(<I1L$xA AAL$hAAA :h,<QP5T+==,<wwh0<`x GL<W} L !<@(PT <1Wh(3h%P1|$L$8jQj*j)5<yu h% <rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5<xy h%Q!<t+DŽ$j$Pj&j)5<xuK1ۃ|$$83D$,tD$t3S?<uhI%h.%ƣ: :|$$tF1FFFFF  F)F.N,: :9rF t$ƃ|$t.t$!L$Aut$hf%+83D$,|$,tF)F/83F !<@;DŽ$jjjv= y h%1<l<8<p<<<t<@<x<D<f2<'u|<H<|$tjt$ j.j)Vw=83ujh0<V9 yPh%UPh83Pj)VvuY=83tjh83j j)Vvth%$Ph0<VO yh%h%h%VD$ <3 | h%$jPhh5<vt$8jVj$j)5<uy h^%u- jVj%j)5<uy h{%O-  <H H r8r <30 s~|9~ h%4t$jVhh5<5uy h2%jVhh5< uhH%d8<3PQh%J <Ѓ1۹<PSSQVRh0<iv<t #Qh%  <ЃPSSPVPhd<#vt #Vt$0tWNu3Vj Vj 1<<L$?V1Fh3Vhh"&b V芥 USWVX (<<t91ɉ $: :1GH < <Ē<f < r+rm ]1sq!:$:Y!:$:l<0:p<4:t<8:x<<: !:$: t1 : <<(: ,:f(:<3Uf : <ff $:f&:=<u"t$@jV@ ȣ(:Fȣ,:<3:d<:1L$@A A :Y ::Ph:5< ƅx9t&y h8%) VS5`<h&Y  <uWhI3W <ؒ<<Ԓ<<В<<< u2ء<<<<<< P؉+<5<D$8t$8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5<t$PV;hD$$HL$L$ 1x1PPPWR jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$w ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$<D$PVP贒L$@D$D$ 1 G|$<$D$=X3$TD$j=hp&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hp&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=hp&P Ņt$,]rl 04$Q"`l 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H -e dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=<u t11jNt<10<<t Pe1@hR#h& <1USWV1=0<MT$ l$(L$DžD$5<hh1<藈  |$t$f:#j h1</ D$1<hf:#VӀ<tUPPU uTWV貀 <WV裀t7j L$QP/ x#L$9u$<;D$ D$uL$us <8 <APQ~ PQT  < tuQhh1<蕇  |$u0<1^_[](<4<4<1Ҋ+~,u"1t$L$t' t" t΅tAL$=P<uP< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=,<u#0<<tPsQ <t <1^0<<tP?Q <VtJT$1Aj<ƃ=,<u#0<<tPP <t <1^t ,<t D$,<1@1USWV D$,L$(l$$~ )$1H$`t ,<1A\$9|ωL$ tgp9tX tt$ PDR t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$0<<tPO <D$,L$$ ^_[]f11f11Ã=T<u /t(X<11hh<PjNtX<1<T<t P譆1@hR#h&7{ T<1USWVT$1=<+\$0L$ D$D$|$(D$5T<t$8S݃ l$,D$ D$D$t$j SF* \$1 hf:#V|E|$tt$(PP u~f:#WV{EWV{t^j L$QPf| xJL$9uAE;D$ D$<u/hf:#V{tj L$QP%| x L$9t[ T<8 T<APQ~ PQO  T< tuQt$8S誂 E hQ$V {EthQ$VzwhQ$Vzahf:#VzEHhf:#VzE /hf:#VzE$j:t$ ( 1@|$ u<1^_[]WV=T<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh<hX<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=<u+<T<tPL$ L L$T<D$$tˉ01C؃^_[<T<tPK T<PPhh<hX<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=<u+<T<tPL$5K L$T<D$$tˉ01C؃^_[t <t D$<1@1fUSWV\$l$t$VK PVW UJ PUW SJ PSW t$ VJ PVW ^_[]WV t$uRt>DžtA=<t ^_Épxj Ph"{ ؀=<u1F1=<t(Z 1맋5\3X #QQh&PփV USWV1ۀ=<t ؁^_[]Y D$ |$GSSPh<jW&u < < <r1H<#1ۃt2u3hWh& D5<~ȍQ2w$'<PAu <?$D$-\3eW h?`#L$Qh&PՃ<`3@<d3 <I9@h3 <I9@<<<<<y<p<g`3 <A9~WH`3O<Fd3|t%ƍC!t2)É$)t*<L$ <$)PD$p xPh<7 =<=<WjD$hpj Ph"腺 5\3O #QQh&5\3O #QQh+&PփM 111{PZDWhV%M ESWV 1L$ |$ ru\95<s(>tGǀ=<u.;=<rN;=<rD< DžtVjWL =<t^5P 1ހ=<t& ^_[À=<u1Ffu]pxj Ph" 뺋5\3aN #QQh`&PփJL NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95<95<H_ŋ <!9r؅ <9s9s_< 8!9t.M9wI9rE<8! d3!9u!=<=<<Rf ʼn9rPVU6!  8!!ōD$p <PVL$D$PVt$8 <Pt$jUVfthŋ$L$Ai Qh<=<=<u=<!M 1=<tM^_[]t$h<O=<1GDu3t몍D$0xhj Ph"ڵ 5\3K #QQh&PփI 9U7)SjZP)MPjSH :9/ $)QjZP)PjS\H tƉ111USWVˡ<!9ta)‹ <h t u9=,$)<l u=<OE$)ÍFu\wl3'xD$X <PWPW=<N V<5<w(' w3'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ7}-E $ut=<tGV^_[]ÃWU VjZSF vjZv mF VjZS\F V t$=<tt ^É01ɉHHj Ph"  ҋL$SWVȋ<!9t+)֋ <| u 9t%)D @A Qh<@D^_[USWV=<t^_[]þ#VVVh&\3VhmS#h"h2&\3 &=<u &I&=<u&X#=<u&RQPh>&\3V&=<uW&"=<u(T#}%=<udn$Z&=<u$VRQP\3\3$ <|$gfff̉ҍ4މ劄1#GO wһ#mS#SUWh]&T$t$|$f4SUWhd&\3\3$ <Ggfff̉ҍ<߉劄9#FN wh#hmS#Vhs&T$\3$ <|$gfff̉ҍ4މ劄1#GO wh#hmS#Wh&T$\3$ <|$gfff̉ҍ4މ劄1#GO wҸ#PPWh&T$\3$ `3|$gfff̉ҍ4މ劄1#GO wҾ#VhS,$Wh&T$VVVh&\3USWV΃=<tPt <3!1Pcǡ< <!)ȉ9r1Uc<9tEuótP-<!1PPjhjUPe t( <t$<= <=$<-(<1ۉ^_[]V΃?$< ; (<v$1u$<Ɖ $<^USWVP<<< 0trƃh'PLF,=<=<4$t|n011FEEh'PـEEC<(9r:5\3OC #QQh&Pփ=<<11<9s[ $,0EEh'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEh'P< <s <)ÉE;ǡ<<<(9r$^_[]5@ L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9<s$5<!։Ņ9<v6J Љ  ȉ  F1r{@p9<sBJ Љ  ȉ  F<< h3u%1I#5<!֡< d3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPUR tPUb$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=<t=<uVj1^_[]VhU; USWV5<1!-<t E<1-$<E@;(<v@uW-$<E@$<tE3t,ÉE uUh<w=<t"=<t!<E-<^_[]VhVjS: USWVΊ <T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S*~VS]SD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ <^_[]1USWVȋ5<!) <L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh < Åk jS <W SW<<;-<r ;-<1WWjhj\$SU t\tV9tRSPG uE < j@\$S0\ -\3~: hmS#Sh&PՃ=<1lj1<4$9v(< 1QQjPjVQ @wg1=<jXŋ5<!Ɖ)tPX<9tut݉<$/<u1]4$D$x Ph <tA<$ <C 9r09$v+jSV# SV7<<uɉD^_[]B7 V< <r!1F<u. <<F9r^USWVP $1N=<1!׉) <D$)ot +t=<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWV6DGWVe;_s_u.G WP=<u.M,t <-},^_[]jPRe 5<^_[]USWV@׉9 <95<jV;<u >9uPV;<FjWV *1ۡ<t  <8$<H@; (<v@j$<H@ $< 3H <HPh <,<9rWV裳 u=f8 j@S0 -\36 hmS#Sh&PՃ=<9=<u]<t  <6$<H@; (<v@u,$<H@ $<t=<p xPh <l@^_[]9<u)<<64 fl3øl3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á<3gD$t$P\WVL$T$ ‹q~y ;q~ t 1~9 QP>T ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'W& tF u1^_ËD$t w$Ÿ'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V) ^D$ 3DAD$ 3DAWVD$ ##tƀ>tY%{3 0DPWVh&h3N ^_Ð1|$w L$t9tø3f|$3Ui#t#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PSe `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P- t F;'tm'D$'D$'1FthPt$$V Va! Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-0 01H^_[]Ë' r ,$'t u‰,$''<$t9rPQt$ 1t/<$t9v=0 |fL$n&9 \(v3fL$&9 (vx3føÃD$L$L$ L$D$Vt$ t$Vh3O h޲"V?t"/ 0kPhD$h3J 3Vj 8VV/ ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t- 0 - 1$^ÐWV|$ W4' tFu1 ^_D$ftL$Qp'1USWV$п$$ u VX  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#; ף4$Y(}111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$,<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$ ' j F H @(N]_?[\;^r~uFF,<,<C><% ^q{t|~F~F ;^r~uF,<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF,<F^9րրw t$rI{i9s <$=3]D_\,<$t~uF F,<,<Au~uF ,<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF ,<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF ,<F"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF ,<FЉL<$USWV t$ ^h.\u/;nr~uFF,<,<EMŁ'$~]$L'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF,<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF,<FωωD$$xt~uF ,<.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF ,<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF ,<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF,<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=<3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u,<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA ,<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F,<FUSWV\$1=<39v1@(ϋF,@jPv(V t|F(N,QV,fH~<t}3Dh <31҃9v1B <33Dh1҃9v)1BuG ,<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF,<,<-<^_Ã~uF,<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF,<F1^_[]É؉D$&'t$t$U u Us t/uՃt~uFG롋$USWV 1=<39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytSp'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQG o^_[]SWV1G9Qs7ӉjRq tF^~uF ,<F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=<3|$ r3GtD$WT$ou]t$S\ |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋O >M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ s ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ M ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V @wj/VM 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh* &jPh8<8<ø%Vt$1Ʌ1t э^fVY^T$ws^ÐUSWV[(l$,D$(u1T$|$;D$ T$$75]1PW EZ PW V1PWޥ b PWƥ tj PW貥 |$D$ tH=1PWy u PWa 61PWI i} PW1 t PW |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [E$ @$ $ ,1$9r 胼$ t+$ $$ FhPW)X D$D$D$j1҉$ xfD$4D$d; /$$ AfAfIAQPRhWOt$VPj $D$$P&1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ VxhPWV j:Wz D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP賎t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.qPh$P$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R RQPUh$P]$$,$ 9sL$4qPh$P$j$,$o9sD$l6$,$/9s狄$ @PQh$PR$$,$9s狄$ @<h,$9suF9snF9siF9x|$B$ y ,$9s%NM9D?<$ @<L$|I t$xjhQPRt$Ph$P$$,$9sL$tWQPh$P$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ ,$$ |$jj Rjjt$,$ q$,$$$49s獃 ,$$ g ,$QPh$P$$9s獃 ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP pRQt$Uh$PuD$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@ l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P`$,$$_9sjjjhRt$,$ ;$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F PQhW迹1ɃD$D$ D$1 ƞ fffUSWV`[ht$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r蝡  l$8D$UPj tCL$HD$ QPVW t2V詟 t+jPj 1ɃىK' (jD$LPV (l$8 0jUjn ֠ 0`^_[]fffffUSWV< [D$yXXD$/Xty$/dev: jP5t=ƍD$4PhFtHV軂 V t|$4l$8$<D$ oD$ $<T$$!PhQRV=D$ t@D$D$D$TKD$C pT L$T$ t$FR 9t$D$0l$WJE?tD$pD$ jjR# tkD$tJt$PD$P`  ut$D$Pk uP ujjD$P k6 8[ iŋ$\ $X $T $P :)tt$ P$` tVjQo 1tWhgtQ轀 < ^_[]ÐSV[ÊL$t$ t$ t$ PQft+8 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[t> A 9u8jj5 t P 1 4^ 0ǃ ǃƃ t* 01^_[ÐUSWV[E$01 uut!j/V8h uS tƅuJ ƍ|$ VPQhW=r艜 ?h@V#ǍD$ jPW I D$$WtLD, L$Pjhjjj QD$(Px Ƌ<$t'Vu D$8 t 8 L$^_[]ÐSWV[ u*PF6ƃ $tj/Vf uA Ɖ獃 VPQhW褲=r3 ?t" VP tEFu7hh%@V  hVPiB > jj\ t=jjj} !ƒt"e PAJ 1ub 0V 0^_[> 8#uVt׉ ƐS[N>[ÐS[.t$[ÐUSWV[u }誙 D$<$蜙 t$u$$D$P/ut=k<T$JL$|D$x$L$x$PQm$$$Pt$mlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PW- 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $ \$ 8u$$>$0։轎 D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ\b|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRnѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6 W8G4jjdv6l jjdRPWPGLjh'v6ul W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[ËL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[ |$GtB#l$%t$Pr9t!G t7t9uӾ^_[]ÐUSWV[ÛtC#l$ t$P9t!G t7t9uӾ^_[]ÐUSWV[+tC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[øt$0t$,  ǍO VP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP7tG t@/t;L$uЃt'D$ t$j2…<$uNt$0t><$9tRZ PUW >&t1<$W9 ^_[]fUSWV[{t$D$hEt'1PV6t%D=u1 u VPj=D$@ 8^_[]ÐUSWV[|$ D$hEt$1PWe6t%D5u ^_[]ËD$@ 40tMGi D$jPt$V ŋD$18txi r"u## uKB"tt$ a_4$WPjуH WPjSV[ͣt$ v_v TVK^[ÐUSWV[ÈD$,8tD$,1퐐8@ujt HƋ|$(W F$"jUF D$ D$,F>O D$Pt$/1}nu1ɀ}ouL$D$j=U2 tǃ|$D$,t1PU%4tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jgŅ8 t 4$V1^_[]Í UPjUSWV[ա$4$,wf 0xjPU uj:U1 jPU] tKt$}/3t$UhV jVPUV P< t$UD$P,R|$ jjWjjV2mt$ jjWPjV2t$/D$PVǍ+D$t$jDžjt$W,V uj$4$4jWMtƍD$Phzd@V#G VqD$(Pt$V uP$0>H$0VPW  FD$ GL$ jjQPjR1tqVUW  R8d 0u$0X"d 0kd 8uj/UBŃt$ $0UW  c 0~QPWh  111c 0u$0P$49  11,$j$4V$4WjUP^PW^st$t8HPQ薇&,c 0$0P$4  1,$D$PUb 0^_[]Í,$UPVW,z1b (JWP$8$8yVCfffffffS[ûD$D$ $L$T$jjPQjRm/yD$[fffffS[[D$D$ >$L$T$jjPQjR /yD$[ÐS[D$D$ ?$L$T$jjPQjR.yD$[ÐS[Û$L$jjPQRayD$[fffffYOT$ucÐS[t$pSWV[|$Wt$t$? 9r` ?WVPj^_[ÐSWV[ì|$Wt$t$ 9rA` ?WVPj^_[ÐSV[]t$  ƅuPPj^[ÐSV[t$t$ ƅuPPj^[ÐSWV[ܚ|$WƅtucWPj ^_[ÐUSWV[Ûl$|$UWdƅttu}UWPj^_[]ÐSWV[L|$Wt$EƅtuWPj ^_[ÐUSWV[l$|$UWt$- t^ 0UWPj^_[]ÐSWV[ì|$t$W#zƅuWPj ^_[ÐSVP[lD$L$T$$RQP: ƃuPj^[ÐSV[t$t$t$ ƃuPj^[USWVP[ژPt$0t$0t$0t$0t$0jt$4=: Ɖ׋,$t1Z] ( t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ZPt$0t$0t$0t$0t$0jt$4  Ɖ׋,$t1\ (Zt$,t$,t$,t$,t$,t$,Pj ^_[]fXߗL$"wÍffffffUSWVHXD$0T$ht$\L$p|$d1ۈD$4<uЋT$`l$l4$T$l$D$ L$D$D$D$ D$$D$(D$,|$L$d tt t$\ %ju%#jo%#jxt$\l$L$t \$0WPURV \$0WPUjjr~D$ |$4R|$D$811|$<,L$4L$0 GD$ 8 O3L$8 `|$4=RL$ ;L$s$=D$L$ ՃL$ -O? G<@ |$4fu  t$ T$։t$81 tl$81 u<@* '  |$%O?1ҸGD$ t1#T$#t$ |$,D$ D$(;D$s $,D$ D$ wӉډGD$|$,L$ tL$(;L$s $,L$ L$ ;L$s $L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ D$ D$$D$(D$,T$ |$)\$<$\$0WRT$ RQP ؋\$0Pt$ $ڋ\$0Rt$L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ t$)$\$0VRT$ RQP;D$s $T$L$ t$$L$ )9v" 2L$ ;L$s $#L$ L$ D$9l$Ds$D$L$ ݃L$ L$$D$(D$,T$ t$)R $\$0VRT$ RPQL\$<L$D$(T$$)9sqT$@f\$0WRD$ Pjjk\$Pʅ~D$ |$\$0VRD$ PjjkT$4ωD$ ;D$4s $>L$D$ T$$D$ )9v"D$ ;D$s $#D$ D$ L$9s $L$D$ ݃D$ D$$D$(D$,T$ |$)v>$\$0WRT$ RQP;\$0VRD$ Pjjj1҅l$D\$0WRD$ PjjjT$@~D$ t$ t$ ~!‹L$ s1|$,D$ tVD$(;D$s $,D$ D$ Xt$ wx;D$s $l$L$ \$$L$ )9v" +L$ ;L$s $#L$ L$ D$9s$D$L$ L$ L$$D$(D$,T$ |$)vH $\$0WRT$ RPQED$ y|$Q ;D$s݋ $L$D$ ͋\$0WRD$ PjjhD$ u|$,L$ t@;L$s3$ >"\$0P L$ ;L$s$#1L$ 1L$ T$t$$)9v" 2L$ ;L$s $ #L$ L$ T$9s$ T$L$ L$ L$$D$(D$,9s$ T$L$ L$ 9v_r $D #T$r= $D /T$9s$ T$L$ L$ 9vr $D #T$t $D uD$ H^_[]ÐS[jt$t$t$t$t$8[fS[ފL$T$ Pt$t$t$[ÐUSWV[Ø|$$t$|$0t$(aD$ j/Uj ,$t| UPt$ WVt$8IuUN 8uFt$ t$Pt$t$@t$\t4L$ʁtPD@t1t ʁPH^Ë6u吐V^[D$t4L$ ʁtPD@t1t ʁPH^Ë6u吐S[~[t$0[ÐUSWV _H[D$ T$$сtHD@ t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jPZ1 ^_[]ø񐐐WVZ]ZD$ t9pH@?t;:u@D ^_øS[Yt$0[ÐUSWV0[Y|$D:D$Hx,p-L$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|-w|ut EGDT$H@$01JƋJrc1L$'0L$D F9t3ujT$L$@$t뵉P+@t1t$Dt ȉFHFLNDL$D$ fD$fD$D$|$Wv|WD$ PT$DJ~iB1T$DJ4$9}L~J,4$<119}ƋOD1tQD$ P/D$D@jR W0^_[]USWV[kW8t1l$}t'uUW^jWV1^_[]ÐUSWV[ W|$t1l$}t'urUWjWWV1^_[]ÐSWVZ¬VttL$pH9@?t;:u1PDQAP|1t$:^Y|Rtqv^_[øSWVZ VD$txL$pH9@?t;:u1PDQAP|1t(:^Y|Rtqv^_[øfffffXoUƀ ÐSWV[LU|$0 2, 2 2t 2 N \ N$ NT` NX N\ N`` Nl4 Nm Nn822,22tG G$\GTGX`G\G`Gl`Gm4GnWG1Ƀ2QP莟G GdWW ^_[ÐUSWV[ËSl$uPŅh4j61ƋD$L$dž3Ndž2dž2 3ƃ fFddž2dž3 h3,V 5VU2@xpu xhdž2jjjjjjV&FjjjjjjVFVbZVPjjjjjjV F tdjPVGVNV% VlGHt 3t VdVK@Z2t Pe2tuc29ʼnu3V1^_[]ÐSWV[ǃX <ǃ\ ^ǃ` vǃh #ǃ, :ǃ@ 'ǃD #ǃH #ǃL #ǃl -ǃd -ǃt _ǃ |ǃ oǃh -ǃp -ǃ <ǃ >ǃ *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW{ 1 QTpQTtQTxT|=u^_[]ÐVYN1 T$tpqttqtxqt|1=u^ÐUSWVP[jN l$j+GG(ujjQP uPjhj3~7cQPej>dh j 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!QI jS[=t$j[ffS[<0t$ [ÐUSWV$[ø<|$u@2t PP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(P萱tjjP诖 ,GT PftjjP腖 GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PƣD$$<$$u$Ps HuǐuU PMD$$鐐<$$u$}P Huǐul$Ut$V VXUO$|$~"14苮;>|vVm^_[ÐUSWV[å3fǃ h譝u$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$j T<TV$2@4tV} =wlj<$hVt$ Vݞ VT 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍPjS[10[ÐUSWV [1|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ PGGMIAG GAE3t4\10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ\10vL$Eǀ3뤐SV[í.0t$t$V, t V^[ÐSV[m.t$ t$t$V t Vr^[ÐSWVP[+.$t&T$t$2PWj $^_[ÐUSWVP[-1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[ -T$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[%,1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[Ø+D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RWŃuRG @tG 8u=D$3t.\10IrD$ǀ3G @|$tmG  f Hȃ  fftVW=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)\10oǀ3g 룸Pjj Q jSWV['|$WכƃuOG @tDm 8u:3t)\102oǀ3^_[ÐUSWV[['tt$339}3AP3t' 333343;33PQRP聎 33t331^_[]ÐUSWV[Ë&tt$339}3AP3Mt' 333343;33PQRP豍 33t331^_[]ÐSP[ý%$tT$ 2Pjj $[ÐXo% tT$QT1øUSWV[6%TAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhXto DHDHDHDH uǀD$ FF^_[]ø;Pjj,PjjQ踴 j>YP袴j(ffffS[n#0[ÐUSWV[H#|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQpuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|t1fF9vʋGPt$wW"W1^_[]ÐSV[!0t$t$VL t VN^[ÐSV[Í!t$ t$t$V t V^[ffSWV([I!0Wt$<2WV0^_[ÐSWV([ !t$8Wt$@2WVd0^_[ÐSWV([ 0t$ t0D$ NV$~,$VjPRQWVD^_[fffffS[N3u1[`3P3X[ÐSV[ 65tHl` @m41^[ÐUSWV[ûl$Dž2EHtȍ43VP迾 tGEHtVP蛾 t#Dž3`41`3 󥋍d3ʃd3ElEm2 ׉󥁥2fDž22 󥁥24223MQtPjQò ^_[]ÐSV[}3t,ǁ22313t%HtRjP3 ^[ÐSV[3t,ǁ213t1`33 QtPjQ裱 ^[ÐSV[]3tl13tB2t223 QtPjQ ^[ÐUSWV[3t13MA:te3t3tLfǀ2fǀ2fǀ3Qt3jQR uNMa82t2`33PtQjP ^_[]ÐSV[ý3t 13tEfǁ2fǁ2fǁ3Pt3jP聯 ^[ÐSWV[<|$G=3t4 3tG2t223PtQjPݮ ux11;3}:tt3PpT^_[]ÐS[NT$t$t$ [ÐUSWV[93|$0t$,T$ $uXMDH@utl$4D$ Ug 鐐t$ D$PL$ QD$ P萆x)t$܈tL$9D$)<9u AT$)RUat( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[Ø8D$ $4VjPj誆tSʼnt$UmbƅtMD$ $t$UD$PVntT$t$$V Vr^_[]ÐUSWV[|$3t P 3~/11퐐440;r0;3|4r3ǃwwLJ3j0jk4tW2Ht<@xX3~3<P<72@HX3@$4Ƈ31^_[]ÐUSWV[ût$3t P3~/11퐐448q0;3|4p^_[]ÐUSWVX8t$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wa 1Ґ$t$V|$(WD$0P聀t$$ԃŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V讳 $4D$)Džu |$ $tR1VT$ 蚊 4$)tWj Ve T$L$ (^_[]ÐUSWV`[814t `΋43t42NzRЃPWVPV蘳hk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WY PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PRD$T$3;4}D$PRjQD$PRjQ踦Nj$D(PD$$L$ ;47&ffffUSWV[;|$$D$hjjUĀ t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U~ D^_[]USWV[Ë|$$2t$Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$Uc 1^_[]ÐWVY-D$T$ t$w4  p@^_fffSWV[t$V~~tyы9uv07hv,,h9p9p 9pt PݡgVg1^_[v4g9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P*gffffVXnt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[î|$uT$ L$O[ø[ÐS[~|$ uT$[ø[ÐS[N|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[ü|$u8t$D$|$% Ɖ81^_[øVX^|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$uML$\L pE 9|$uӋD$HD$X|$ |hD$ p}$$@D$\@GE!ȉGGfGFfD$X~GtPCdG맋|$LG9ɋ$Ql$ l$9}]G,L$T 4p$f~y5GDfFVw|ctLGHFGLfF;o|ăG(L$P I ;~$Ut$ D$\0WL$T ;OT$u7G8 $48u D$X|$LWhGO(T$PR ; ~ GPt$ t$\6WdD$X;GTt$O,L$POW(у@ W2D$X()$W D$Tl$PD$XE 18^_[]ÃO, T$P O,L$X 4pUSWV[Õ$F$$$$AX11ɉFXhXș)Չl$$;FTu0F8 u*$1D$F9|ȉD$|$FD$FD$1|$HL$ D$FN,D$1 $l$ ^UT$1 |$HT$(D$$D$ jD$$Pt$t$$D$,P$$)~"D$HPVUD$P=]xNjT$u<$D$;D$$|$H.V $͋tp $E;FTu;F8 HV`$E$σEN,1 $n@ƉׁuQ_$H($$P; } $P ; ~ $$xD$ t$H$ u$$fd $xHt |$$B9u$R%1^_[]øfffffffYt0 I8t u tHAøÐYD$t0 I8t u tHAøÐX tPtaAøÐX?L$tPtaAøffffXt1HX2I(t u tHAøÐD$t1HX2I(t u tHAøÐXot @@øÐD$t @@øffS[jt$ [ÐUSWV[|$tyG8 tsl$ 1tiWD$W$jwPWL| UW4$t$W0| 98uj Lz48uG^_[]ÐS[Nt$02[ÐVXtT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVXtL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐX?Ht t1ÐXHt t1ÐS[t$0[ÐUSWVZ¨|$(QL$,C@D$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prq` _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|WHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqpk_ ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|VtG9|델Kwl$9\$}!GPjVWp9uGt PW 1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[0[ÐUSWV[|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZŽL$1~t$ ~9J$u9r ^ÐUSWV[KD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[ʷt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [ht$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ T$L$ Aq D$t$jVPt$ ^[ÐUSWVXȳ$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQFDE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ël$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Ht$D1Sl$HGL$ED@8t EHmE(ED$dǀǀǀPF, $jW!F0|$|$@F4T$l$DL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y|$4t}\$\$0$Pjt$8T\$ D$ L$H HD$8;Hϋ@,L$4p` F\ fFVh !k\ l fNl 49D$8;H|%T$t$t$ǃD$8;h}pD$$p|$ OoL$AD$$jG, 9;t$u 9l$ut'9L$D $jUt$t$V$T$ BL$$ ABAc9dOfɺL$Nff|#udt$T$։D$,)jVD$ PRPfL$D7$|$T$t$WL$΋D$)jPWVW#t$_D$@f|$0ut$It$t$,Qp0QjP-ɋ$Rd0PjQQ f~$~gD$@u]D$$t$Fh2u&@9u%$PD$<0l;\$6>v t6>vuD$@tt$ t$tNFy$j=D$@$ $0jQ Btdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐l$;|$ ,0t$l$,L$HT$4;|$  E;l$0ŋt$ T$4D$D$(l$@}D$D$(@L$|$ t$9T$9|$D|$T$ЋL$ 9ȉD$ D$ AD9p p p $Pq|\$I BfBD$ ALfBt9zAD$Rq|<\$uD$DWD$D$(T$D$(x;p ut D$PD$1r.1p $Ph V\$ ǀw p $PQRX\$ D$@p L$Pt D$ D$T$)։t$L‹t$ )T$()l$,7|$LD$ pPD$)ŋD$@H0t$T$l$ xpuHt2t)|$ "T$t$>l$ ;WT$~Hqt$t$$Qf 0UjPG jjjWVdt$@UjppG jjt$jj9@t$ QIfUjP}G t$D$(T$L|$ )T$t$T$L։t$TI,T$DD$D4|$0|$4|$D|$(D$ <D$H49;|$;t$D$ @,\$ D$hx6ƋG 鍄p $h QP \$ ŀ=rv4l$Gp $h WP E$h Wl$ Py \$ w荋p $PQw? D$PGD$H$Qjt$HVP\$l$,KD$@, /D$H$QjVPƂ\$L$09΋t$HuD$ @,tϋD$T$49ЉL$0D$4D$ H,et1L$|$ t-L$ $jjQRVt$@$U4b $0$QjP'D\$ D$l$ )jjD$Pjt$0HUPbl$xpuHt2t)|$ "T$t$>l$ ;WT$Lt$|$$WQ"b 0UjPPC jjjWVt$@Ujpp)C jjt$(jj@6D$ PQaUjPB |$YED$4D$<(jjWRVMD$@ɉ|$0tT$t$9rtK؋$PQ8a0QjPfB |$jjl$(Ujt$@HtlL$ QP`l$*L$l$t$$0WjPA D$l$|$ l$ t$L$$0VjPA |$4ll$l$,|$$@VjdA ul$ t$-?$jjt$(RV$0t$@$Wj A\$ ul$,ŋt$$@Wj@ ul$t$UjH@ |$ t$|$,t!|$@UjH@ u@L$ IQjp0%_ UjPY@ jjjjt$ |$$0$VjQ @\$ |$4l$l$,@$Vj?\$ ujL$ ɋ|$t$y8UjL? D$ t!t$,@UjL? u@L$ IQjp0%^ UjPY? jjjjt$0@@p1t$0QjP%? L$$jQVjU\$bHD$ $jjt$RVh$0t$@$WjH>\$ uL$L$ T$9Q|$0$VjP_>\$ |$4l$l$,@$VjL->\$ ut$PQhrR9 $< USWV [Ø{D$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [h D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ0) @x H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j Pox) @ltQjP%( F t3 j Pox) j |j m  ǃ 1;  $l$*ǃ ;  @@ltWjPV' yA t`j t$nx )ȉ }u D$8o@@lU8 LQj `u ;  "UjP& ; ~U   @@xuă tjWmx) j띍 ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$lx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$Jkx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$jx) j f ; ~nUjP" ;  @@xu̓ t!jt$jx) j룉PS[`D$ t# PQix) P1[fffX_Hy8~DyD~>Hlt htðuu냹tt u1ÐXO_@ xÐUSWV [(_AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21CdD$L$ /jt$5[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[ZZL$9 ft$9|$ 9l2uCUw$-4$t$skwp|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXY2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY;W|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[ÛVL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZUL$x?9J\~2D$t$|$ Irftf>vf1^_[S[~Uǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[TT$L$l2uI~w-ssw!ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXTh2ÐUSWVP[St$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[üQl2tu6@t!|$0QjP (!G@f@d^_[ÐXOQf@dffSWV[,QD$ yOQW~ ;O~ t Q WP4WV^_[ÐSWV[üP|$D$OQW~ ;O~ t Q WP3W^_[ÐSWV[\PxWt$W^_[ÐSWV[P|$Wt$Wx^_[fffffffUSWVXOtLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j cxL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vrx;l$tl$l)"PFx‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KЙ~ ƃQWT$H ^_[]ÐSWV[<>|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[þ=  jt$t$t$P1[ÐSV[}=  jVjt$PJ1^[fSWVP[;=|$t t9t QD$P"L$QjPWq^L$N|$kK)l$kK) #;#i)PUpt;y t0q$t~fuUv9u1 q  ^_[]ÐUSWV[h;D$$L$t@1D$D$>D$PL$QjPWN]L$kL|$kC)l$kC) #;#i? )DPUNt7q tAy$t+nuUwu AHy^_[]USWV[H:D$(L$1҄t@1D$D$8>D$D$PL$QjPV-\l$-?L|$ ) i)ʼn) i)k*${*$lj*SiŠ)ǍLPD$Pt1D$HP<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WP "uVEЃ^_[]ÐS[þ8t$ t$t$ [ÐUSWVH[È8t$\TlD$P舢ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UZL$QjPUYL$ȿNt$kK)kK) #3#i)PU$D$$ ED$j=UtƉH$$D$<$|$W\L$QjPWXL$Ƚ-?Lt$) i)) i)K*$s*$Ɖ*SiŠ)ƍLPWD$5tcL$f <$|$WL$QjPWWL$ȽkLt$kC)kC) #3#i? )DPWtD$EPE!D$HDY $$D$VPUEPUuMPU]PUEpbPU-tBPUtrFPUteLPUtXr6PUu^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$菨L$uD$ 9D$ tf, UQc,$t'UWP|$BUí4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQVv $4D$ H^_[]1|$t4$1USWV[V2hgWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$P_ 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV](-2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[Ë+1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[*L$ T$D$$Pj [ÐUSWVX*$1h ։ͅu4$ u'$h联 5 @0t$E4}0u"$hIE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,#E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $T*ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $+$t"A$|t+H$D+$1$uՋ$1ڃV$0-!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,膚RE,}0M4T$$V$0PRQg1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PqP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$d1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,覕rE,u0M4tڍqu4 $ 1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,肔tRE,}0M4$V$0Pt$QhE4E,M4},$1^_[]ÐSP[T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ÍT$ D$$1Pj [ffffX_L$ÐUSWV[8|$(t$ l$uPaƅ>l$$uj軾hj贑L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4y9Pk1D$tGuP|$(x |$(tF|$(mV|$(Phht@U t$t$tL$t RB(JtR{dP蹒tjjPw IA(dP萒tjjPw IA1t^_[]ÍWPj zVSVP[T$L$D$tRQPVƋ$t P.^[fUSWV[Ût$|$t$jt0ʼnVU|$T$VŸ2Pt$t~Pt$tk7Pt$t[=Pt$rtKCPt$[t;JPt$DuA1 @VK^_[]ÐUSWV T$L$[=ǃ QPlŅt'}/u{L$$ t$  [P0/P<PVGuU DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ “V`'uP1V='cP.$|$ $~:s1퐐Nt:t됐tÍMwUPW艰 D, L$$ t$ [tu/lP~tGqT$ PQhR0~)T$ L$$ t$ $~t$ $:uw1퐐Ot:t됐tÍMwUPV良 D, L$$ t$ [tu$ $ȁ ^_[]ÍZ USWV[l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%b\$L$ A ZAthhPP+jj!(G(hhP'|$ Gt\$h(jP|$ "\$jh҉|$ G9ouG)o\$UD$pΊ|$ Go\$UVP踭 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PCF$ދ\$P(~ F$D$\$jWGF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|VMt.)9uUt$VO t6u0,1(V9ſuUt$V{O ^_[]fffUSWV [øD$48H L$@ 1퐐/t <,tEPxUWP聦 .,v3l$4uWEED$\$cD$D$|$j|W(tD$4@ T$L$ t17t<,t\$RT$rD$PwtDl$VWQ膥 Ut$Pt 1<$W Njt$D$Pl$8uEW|$WV  W茇D$D$D$ Džt$j\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$Uu\$8C k$K($fC K(K(|$T$ t$4P f>p1\$91\$-4$K\$PeD$P輅D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q薄 ^_[]USWV[ D$t uy|$ 1퐐/t <,tQL$e$Pst2ƃ$UWP 4$t$Pk 1^_[]ÐUSWV[ |$ t$FN,9vtU6}uCu;Urt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[z|$ l$YPWuLt}D$x@ȃǃtVot$ U贾)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$WuPt$D/WaprWuPt$D1TL$4xT$$s$tntfuσ1} t WPVo l$ E|$f>t WPVM }t0EfEfF}WuV! f},t&E(fE,fF}(Wu Vߚ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[K|$ t$FN,9vtU6.vu]uUU+ktHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[Üt$FNy9vtW6uuCu;Wjt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|UɢD$tL$j|Uqt L$U=rUPt$P 10^_[]ËD$tPL$ =r "D$t+P辳L$=r&QUPt$T^jjPrtt$ $@ 1D5t <,tFPhD$4 VUPx D5$(L$tSD$HtJ11t <,tFPL$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0k$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p k$D$t$HjjjPjfWjQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$ $ ftGt @1@WG(f hwUX =wb, Ƅ |)ƋtVPUX 9vD|ŃƋGtVPU[X 9s D|ŃE$^_[]ÐSV[t$ tav[fvPfvEfv :fv$/fv,$fVf19 uǃ ^[ÐXO @ÐY/ @uUSWV[$(E$$4D$$0j:WztHjQP萠 t0V$0W  NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UP2V <:t$EF<:uEl$4$D$D$OtuP0^(P^Hǃ,rD$Od1$$,PQhW t" ǃtm,Oj j,(,)XPY+XPPF^tj/V-t|$u1$jPRQVp'1T$$jPRWUQVG VPjESV[mt$ j:VvwtHjQP tt$V[1^[ÐVYT$փ1u t^1(^USWVH[t$dl$`L$\D$Dȃ= u(<$yL$VPj@QT$tLT 9 $ƅtID$\WU(R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\(Q BDŽ(DŽ t $;D$Du ЃH^_[]/LUSWVT[x|$pL$ll$hD$P= u( $t$ u!L$WPj@Q/t$t$ T$Ijj צD$Wt$  $t$j 讦9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ ;D$Pu T^_[]JUSWVD[(L$`T$dt$X}|$@uM u (t9ƀ'RQt$dPj@W tRQt$dVΊ M;L$@uD^_[]JSWV[l|$=uj u (tVwl1}tL!( tDŽ(DŽ WQ^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=m1T$ vPQj@Rjx. VPR4 bIm<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1胥E;D$Lu^P^_[]Ët$d( DŽ(DŽ (,$1,$FS[>D$u& u (tɤ-[P[ÐS[D$u& u (ty-[t$ P€[ÐSV[Ít$ j:VotHjQP= tt$V-^[ÐSWV[,|$t$j:V1otHjQPؔ tWhVU  WhV ^_[SP[D$ L$ $L$ƒu& u (tM-Qt$P  [ÐS[^D$u u (t1[P~[ÐSV[ t$ j:VntHjQP轓 tt$V肢-^[ÐUSWV׉[äRsjj uD$UWt$ \ t$j L19tG4$(  DŽ(DŽ ס^_[]ÐUSWVL[D$D$H1,<jU( u} t @u D<@u^(  DŽ(DŽ D$;D$HL^_[]Íl$ E< us{Uɠ8|$jW(! u|$ u}Fu(;  , DŽ(DŽ Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:# D$t$DRL$D# A @`? S19<$# D$D@ @`ƒ?S91# D$D@ @`Ń?+S9# D$D@ D$@|$`D$?S;|$  ՋL$#  <$‹D$Dp# D$L$ D1 <@4$T$<`Ń?|$_u+S19QL$ T$D $L @`ʃ?|$_uS19 l$ D$L(D$<_D$$D @`Ń?+S19 ՋL$ T$D |$_$D @`ƒ?S9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t41;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3S|$D/? SD/ ?SD/D$S/T$T$L$ t$ ?3SD/? SD/ ?SD/D$SD/D$L$ < SL/ ?SL/ SD/D/ # <$<$:USWV[%$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# f3Df4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# f|$| t!qtAD>1tBD>׹@# fD,|t.tkŷ< s݃1@tt# tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# f|$| t!qtAD>1tBD>׸@# fD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ; 1ttD~t# f  fAB{f w~4AB{f w~4AB{f w~4AB{f w~4AB{f w~4A{f wʼn41 @tt# tlj瀍 ; 1ttD~tf$Q{f$A# {f$B# $u1 @tt# tlj瀍 ; 1ttD~t⍃f# 0p+QP+QP+Q+u# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف,gр3ʉрUɀʈǃ$ ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځ  $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ J΃ $  ˠ ˤ $ F/ 4$l$T$ L$ Ń4Ơ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[])USWV(]D$<X%UUUUʁUUUՍ4P᪪Š Ť x   $ x   x  $ x   x  $ x   UUUU $ $؃Š Ť x   $ x   x  $ x   x  $ x   T$H l$ $ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x   $ x   $x   $ x   $x   $ x = = $x   $ x   ȃx  $ x   x  ! $! x ! ! x  " $" x 5" 5" x # $# D$@P1(^_[]ÐS[+D$1ɐȊt tT Tt t t4 uP1[ÐSV[êD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[àMD$$D$DD$@D$9\$6D$L$T$@jjPQjR*MqD$HPj M"ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPԿD$0Pjm\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjmt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]'USWVd[u$|D$<$` $ hjD$@P DŽ$@D$V $@8$u H$@D$ $@UVljD$Plt;uHCWPcnKWPKnuD$:WP-nD$UV艙ljD$:#jPWAm D$,u:|$$@PW#x$@L$,UV/D$l$0O t$\$UVD$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V.1$xUh$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-PQRÓ_h$DUt$@VK j jW hjU hj$P D$@hjP D$<;$`u`d^_[]D$RWD$t T$@PQhR l$ $kfffffSV[ýD$ h`rƉPW)Ɖ^[ÐUSWV[xl$0jD$PU6h thh`) $)D$j PU֔ $l$1}$K1D=t<$t h`tt$,fō4& 4$t$L$QWPjbVԍ & L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(Vf4&  & !&  "& jQPR ;8& #& $&  %& jQP ;<& && '&  (& jQP ;@& )& *&  +& jQP ;D& ,& -&  .& jQP ;H& /& 0&  1& jQPS ;L& 2& 3&   & jQP  Ƅ;P& jjt$8 ^_[]fffffUSWVD[è|$\w Qt2t$`tD$@jPV$ NjD$@9t8ttD^_[]t8"u tr7D$)D$ D$D$ D$<D$8wD$X$2a$WQjP0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$D$ tKWV(tD(1t$_t$ SUJT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[øt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[މjt$t$t$@[ÐS[îjt$t$t$[ÐS[~jt$t$t$[ÐS[Njt$ [ÐS[.jt$ h[ÐS[jt$ H[ÐUSWV[t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[(t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXOL$Q##wÍ&#ÐUSWV [|$(l$$t$ D$4:D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[~D$ hPt$`F [ÐS[Nht$t$Q [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[ýD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[XD$pML$LjPt$lv D$h|$df$D$VP L$)L$D$PVWkD$ |$$v=D$Lt$.D$lp8L$ QjjV* V |$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V Vu |$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VO V |$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>V V |$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7ZL$R)уtuÐWVt$  r!̐cw^_fffffSWV[+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[P$$N$@r8hUtE\EXETEP$t$tAsE@hjPt Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V{QhVU< hV1;$u Ą^_[]USWV [hNl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPD 1 ^_[]ÐUSWV_L$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$zL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ Wc hj$P, g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVT D$hWD$$hPD$;$xu D$e^_[]|ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[(;|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[k9D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*|E E(}$uM$뉾1^_[]ÐUSWV[Ë8D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*|E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp](7$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$M$4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$($$FQ? T$‰ً$|$D$G<uD$ $t# $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? n# T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E}BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍#FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N i$FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Qc l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj #&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B I#Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?}ፅ}GPGX GTG\GG?$L$u aD?#FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  $FL$Q? $FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$$$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't$D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=$$FL$Q?P$`#$NL$Q?D$T$ ߋ t$$$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $xUSWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP薩 )t]D$)WPu8 }43M(U,E4E09w)RVPN E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[kL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU, F4n0)Pv8U 1tN0^_[]ÐUSWV[t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[øL$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RrT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$($L$($É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+ T$D$tq01t ^_Átփ*tUSWV _ǸL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[Øl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[X|$$ $w9>~NQǃ8wH̎l$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw | o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw z o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw x o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQw F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw w o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQvL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw v o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw t o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw t o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw s o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq q $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq o $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$XH$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv ^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv d] n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv \ n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu X } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu 7X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu W } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu V } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X,ÐUSWV^L$4t;T$8\$0Ӄs3I͉у1&Ӊi913,ƒT$4zR13,ƒT$4zR13,ƒl$4M1ʉ3,xT$  1ϋL$ 3,Ã1ؐ\=13,\=13,9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3,3,3.,3, $3Q,3,3,3, $3A,3,3,3,D$ $3A ,3,3,3,|$D$ $3A,3,3,Љ3,|$|$ $L$l$11D$D$33,3,3,3,3W13,3,3,3,3G13,3,3,ȋT$3,3W 1‰3,3,3,\$3,3_1ˋT$ )3,3,3,É3,ϐÉ13,W13,W13,W13,W13,W13,W1Љ3,O13,RЃ^_[]ÐS[Þt$t$t$ [ÐUSWVXh$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$,1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐUSWVPX$T$tfǃvEt $,1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[ޯt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX/ÐUÐXT$J r ,ù)ы,ÐS[þD$D$ P[ÐS[Ît$ #([ffXoL$ T $ h, | 0 |8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_۪T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$PAL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$,PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$ܰ~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +d)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX;\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[ìt$xƅt|$7Vc@G 3P ^_[ÐSV[]t$ )tt$P@F1O O^[ÐUSWV[t$ԯtLƋ|$$l$ $P?D$PWU1 1urO(VSu WO(^_[]ÐUSWV[{|$GtE/D(U8]wU:t#V譡=yarau D$0VSN1^_[]ÐUSWV[|$GtE/D(U\wUt#V-=tcidu D$0VӞ[N1^_[]ÐUSWV[{L$A1t3)D(U6\NjD$pU4t D$8M0^_[]ÐUSWV[l$M1tMuD1V[uVt(WJ=yarauD$8M W1^_[]ÐUSWV[ël$M1tMuD1Ve[uVgt(Wڟ=tciduD$8M W{1^_[]ÐSWV[9Pt$ t$ ./ t6D$t7<$D8WZt$WtD$ 01LL^_[SWV[ùPt$ t$ . tFD$tP<$D8W`Zt$Wat,VԞ=yarauD$ 01" LVqK^_[ÐSWV[Pt$ t$ . tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"kKVћYK^_[ÐS[~L$T$ jt$t$ [ÐUSWV[FQƋl$$P:D$PUW- tgVD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6eJ 4SJ8V4u 댅t D$ 01/J^_[]ÐS[NL$T$ htcidt$t$ [ffSV[t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[˄t$t$#_P=loobul$VEloob^_[]ÐSVP[lD$Pt&Pt$t$` D$VbD$1^[ÐSVP[t$t$Vt$t$` D$VD$1^[ÐSV[̓t$t$t$!^VP8^[ÐSV[Ýt$t$t$]VP9^[ÐSV[mt$t$t$]VPg9^[ÐSV[=t$t$t$]VP9^[ÐSV[ t$t$t$a]VP':^[ÐSV[݂t$t$t$1]VP7:^[ÐSV[ít$t$t$]VP:^[ÐSV[}t$t$t$\VP:^[ÐSV[Mt$t$t$\VPW;^[ÐSV[t$t$t$q\VP;^[ÐSV[t$t$t$A\VP;^[ÐSV[ýt$t$t$\VP<^[ÐSV[Ít$t$t$[VPw<^[ÐSV[]t$t$t$[VP<^[ÐSV[-t$t$t$[VP<^[ÐSV[t$t$t$Q[VP<^[ÐSV[̀t$t$t$![VP=^[ÐSV[Ýt$t$t$ZVPg=^[ÐSV[mt$t$t$ZVP=^[ÐSV[=t$t$t$ZVP=^[ÐSVP[ D$QP0t&Pt$t$\ D$VD$1^[ÐSVP[ìD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[LD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[~D$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[Ì~t$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[,~D$QP.t&Pt$t$Z D$VD$1^[ÐSVP[}D$QP.t&Pt$t$IZ D$V輒D$1^[ÐSVP[l}D$QP0.t&Pt$t$Y D$V\D$1^[ÐSVP[ }D$QP-t&Pt$t$Y D$VD$1^[ÐSVP[ì|t$t$t-t&Pt$t$-Y D$V蠑D$1^[ÐSVP[L|D$jP.t&Pt$t$X D$V@D$1^[ÐSVP[{D$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[Ì{jt$.t&Pt$t$X D$V肐D$1^[ÐSVP[<{jt$-t&Pt$t$W D$V2D$1^[ÐSVP[zt$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[Ìzjt$-t&Pt$t$W D$V肏D$1^[ÐSVP[[Í&&b%PQjtRSWV[lPD$0Fu9' W~tW 6' VPJWFuFt PV1^_[ÐUSWV[OD$t$x t4hjWV m tUVjt WV$n1PVo^_[]ÐSV[}OL$T$ 9t9r 1;q u4rЅtItRP1^[ffUS[OEM L$$D$e[]ÐUSWV [NLlPQh' Wy' l$UVtPvcWM ^_[]Ét$W6j 肸thʼnPUc|$GEOM,$EVW|$Wt(PbV̀4$p1l,$UW<9uVMG'4'&PQhMR US[åMEM L$$D$e[]ÐUS[eMEM L$$D$^e[]ÐUS[%MEM L$$D$e[]ÐSV[Lt$ 1t9u Va^[ËD$@$ÐWVYLT$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZKL$1t91t^1^ËAQ^ÐVZ¾KL$1t91t^1^ËAQ^ÐVZ~KL$1t91t^1^ËAQ^ÐVZ>KL$1t91t^1^ËAQ^ÐSVPYJD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYlJD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYID$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYLID$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YHD$t9u@H@ty1ËT$ BÐSVPY|HD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYGD$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY\GD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYFD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y?FD$t9u@H@ty1ËT$ BÐSVPYED$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY|ED$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYDD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVYDD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX/DT$t9uBJBuy1ËT$JÐSVYCD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPYCD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY CD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY}BD$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXBT$t9uBJBuy1ËT$JÐS[AD$t9u L$ t9t1[QP*Y[ÐVYAD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYNAD$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY@D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY@D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [S@u t1D$D$ D$~N~(DN+t 0tV-usD$WPv$ T$ D$1ɿ9t8"yxuRD$j\?D$WPv{$ T$ D$D$9T$rF8"u<WD$Pv T$ D$!Ѓu 8"ttIjPVl tu L$e^_[]ÐS[î>' jP5q' PQ_1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[Í=D$0' VP菿V1^[ÐUSWV [H=t$4NswD$8t'@t#d@uppQj WjUVEZ tWVWWt UVI[1 ^_[]Íj'Q'&PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[><LlPQq' Pn[ÐS[;' Pn[fD$w sÐS[î;D$ ;D$uPt$t$+| [1[ÐUSWV[h;D$ t$tP+D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋ܱL$qD$ tL$9QWPz 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋزH vHN1 =tP w싔\Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í(''PQhRUSWV ]Ũ8D$ \$$p1}<"$N<\u< $1ۃރST$$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍB('('PQhRUSWV0[u4$Du wtj0f11<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p(D$(D$Ews 搐<<}jt$W tfjt$W tS(jPW E $AEtLt@<-Eu<-u}>u$h\t u94$10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U莪D$m$hō(D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[-jt$ [ÐUSWV[,$j܁$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPj諓UYtjVU_^ |$t'jjjhjt$Pg|$t-$U~jWU^ WUkTVUkCS[þ+jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[M*j@aƅtCpPV>jP5^F,F0F4F8F<^[ÐUSWV[)t3Pj螝tjj@ѓDžuUEOj@趓1t=pPW8>GjP]o,w0G4G8G<1^_[]ÐL$WUSWV[()t$1p9nUH]N4 Džtbl$~4<$tC1퐐F,[^_[]ÐUSWVP[&|$oU[1tIp9u?$jj膚t,HWs;~$9uGD$t9u L$ t9t1[QP3[ÐS[jt$ <[ÐUSWV[l$}t^_[]j@ޅtƋ|$pPV^0jPOF,F0F4F8F<}(t7hztL$7PUrV`0bUSWV ։L$[|$ *?u-wG"}MG]jjWU -(jPwwt,ut$$9tjPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'tjPWX t4jjWG t#jt$(P6t$>t1t$$-U. ^_[]Í,,(PQhRS[>Pt$ [ÐS[jt$t$T; [ÐS[Pt$ [ÐUSWV[ët$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(B),)(PQhjR7Q蚒GP5LW腒1^_[]É.(,)(PQhhRI/,)(PQhyR),)(PQhRS[^L$A4tPQ4I,Dt*Pa,[Í))(PQhRM))(PQhR.USWV,[D$@xl$DuVK}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,VJPt$D54^_[]jj tt$ At$DVL$*L$ql$$9.|$FPQF( PC[ÐS[( PC[ÐS[( jPeC$( PQ菎1[ÐS[ÞD$L$ PQ[ÐS[nD$ t$P[ÐUSWV[;l$}tQp97uGWbDEtS90uOH<1;M uM;H4w\t @,4ȃMW.D^_[]ÍU*+(PQhRU*(*(PQhR*(*(PQhRSWV[l|$wVCGt$p9uG@WUP juDžt!PW> Gwo 1^_[]ÐUSWV[X l$19}EuBM1tDm $t: $U&ut^Ut$D$P  U;1$D$jtt"WPt$ED$E E^_[]ÐZ L$1t 9tËA ÐZ_ L$1t 9tËAÐSV[- T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[ D$1t 9t ^_[]ËHh t( $tDUst؉Ut$P薡 ąt<---,PQhRc---,PQhRmZ L$1t 9tËAÐS[D$t9u L$ t9t1[QP: [ÐSV[íL$ t 9t1^[ËT$19Q ut$tRVqI ֐USWV [Xt$(>t~(t  ^_[]ËFPjQvPgt҃~$tD$jPv  ʼn$u 8"tD$N N$9u8"t=--,PQhR1jPj N,$Uq7ǍFPD$PU tcD$;$uZugjPV tD|$u Wց1,$jDqƅt-PVF~n W虁t W臁D$$0USWV[y1D$4$G=w ՍjAPV؞ r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[D$0FuFt PrVi1^[ÐUSWV[èl$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Íj'-,PQjtR:SV[L$t$ 9t8V 1;Q u.FtRqPVB 1uyu"^[Í--,PQhR跿--,PQhR蘿ffffSV[M|PQ6|$ u@( 4( V^[ÐSV[t$ 1t9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[nD$t9u L$ t9t1[QP[ÐSWV[,t$~uo~(tiŷjPvvMt4( !ʷjPvv*t1@( |$|PQf5V7^_[Íz.c.&.PQhRýSV[}4( VPƃ<( @( VPƃH( 1^[Ð1ÐS[D$L$ yt0@QP`[ÐVZL$1t91u T$ t92t^19^ffffSWV[Üj@hƅtEPWV4>jP2F,F0F4F8F<^_[ÐUSWVP[(t3Pjqtrj@ hDžuUxWj@h1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[h|$1tvP9uloU1O4ƅtIl$44$t*1G,D$tP9u L$ t9t1[QP [ÐS[jt$ [ÐUSWV[l$}t^_[]Ët$j@^tdǍPVP^ 7t$jP(G,G0G4G8G<>}(uL$UxUSWVP[**։ $|$?uwG8]u<GcjjWr tCw jPwwt,t1jjPUt$t1U^_[]Í1{1.PQhRR蠱S[^pPt$ þ[ÐS[.jt$t$t [ÐS[pPt$ [ÐUSWV[t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%/m/.PQjmRQlGP}&Wl1^_[]É.~/m/.PQjkR3I/m/.PQj|RS[D$H4tH4[Í(0 0.PQhRѯUSWV[ÈD$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W`%$WO%pPt$0\ ^_[]jjdt\,AD$0t$PL$T$rL$9Al$ F9(u:G@21PQhRtR2>21PQhRUɄ21PQhR6R221PQhR221PQhR221PQhR٦D$t1S[~jt$t$ [ÐUSWV[E$4$0$,D$P+ tD$$;Et$L$QL$QL$QL$QUWP$0$,u*PD$PWUV tr$,$0렐4$t$$8$8V t8|$ $,l$$0D$$1;M@MI$4t*$4$,$0PQjjWUV u1^_[]Íz2\21PQh#RS[îD$P[ÐS[ÎD$PP[ÐSV[mt$ vV`^[fffSWV[<t$NtFt\V9wqu QP[tFVL$z~ ^_[1&3 32PQj9R>3 32PQj:R[3 32PQj;ṚSWV[|t$t$|$PWtu^_[ÐUSWV [(t$ F|$$3$/wзbg\tbwtRt$jD$PD$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðj'32PQhR腡SWV[<t$~ t 1j Vt ;~ r^_[ÐSWV[|$t$t0t*PVtuj Vm^_[1SWV[Üt$F|$uLPVujVm1^_[Íj'32PQh$RßSWV[|t$F|$uEPVtiu]jV}1^_[Íj'32PQhERӞUSWV[Ët$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Íj'32PQhdRcUSWVP[D$1ɅQh Dt$7jI1Ƀ#hH$GGG wtHt$WՃj W=tjW$$<4PWtiu千4PQWq tDj Wt5D$h VPW`tj WZ7hXW_X $ȃ^_[]ÐUSWV [Õ$($$WtEPHx=ŋ$$t$t`?t[W%t.H|/t+1]ߡ$,9/;9sfD$ .t$ V近H r茡?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$d tYjLPLUt$ t*l$ WU $t1$t$2$l$ à8t$h t U裠8蜠8V}V茠8$ ^_[]É,$9tG9t iy/t)rD$ UWPs D, ,$S[^jt$t$ [ÐS[jt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jDtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1544PQjAR^#544PQjBRBUSWV[T$t]D$ |$L$tKutUtMtM L$$tEU5TL1Ht t L t L |$$t L2 ^_[]Íf5V54PQjZRXffffUSWV[D$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PH-el$ QRVWt$t$t$ t$,t$4t$<0t$8t$dV4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$[fffffS[Þt$t$jt$t$t$8>[fS[nt$t$jt$t$t$(>[fYXZQ̀QQrS[3t[fffffffS[t$t$t$t$ޒ[ffffS[t$t$t$r= [ffffffS[î1;D$[ÐS[~1;D$I[S[^88t ja1[ÐS[.88t j11[ÐS[88t j1[ÐS[88t jя1[ÐS[Þ88t j衏1[ÐS[n88t jq1[ÐS[>88t jA1[ÐS[88t j1[ÐS[88t j1[ÐS[î88t j豎1[ÐUSWVX{L( ?) R4X( ѐ>t1 @u~1ɍX( >t 9u#;T$t$88PQj7RhfSL$D$ t9tEA󐐐€tuuuu˃t@Au<€tAt9AtAt9Au΋D$[fS[þT+ Pt$t$h [fffffSWV[Ìt$T$(с wdp.c*?&b"Au-ta lsw--trN-ywNс@txuSsF-- trN-twNсtxuSsF--trN-twNtxuTtF fF ^_[Í 8׍K8PQj9RUSWV [t$ ejVy:$?1jt$V; Ƌ4}:|$l#D$,D$ltBL$4$t$$UDx u͋$|=uU:9l$}q)t"uDur;MDMDMD MD9u?1 ^_[]ÍPm88PQj>RpwffffUSWV[e$ÑL$(qL$,(L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í QPjS[NL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[t3T$8tOl$@to:VPt$DR999PQhRt멍:9Ս9PQhRmt뉍:99PQhRGtT$HkXODH@uyD$ j PW $T$y8"u,y"y0oIWPVQt$HT$ 9L$<lȸD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)<:WVPQt$H[11҃^_[]Ë$T$|$(9ыl$,}T:|$09Njl$4}o:UWRPVQt$Tt$T 맋L$8fffYϲi̟mNA90̟%ÐXL$̟ffffUSWV0Xx$t$DL$H|$PL$%1|$L$WQD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$VH T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ '1$#q0^_[]Ë$:::PQhRk$:::PQhRjL$XUSWV0X$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPUA T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U 1$j0^_[]Ë$:::PQhRdL$XffUSWV<[Øl$X|$Tb D$\}  |$T  D$u D$4tǃԟǃ؟T$PT$$9L$$T$,T$0\$|$ <$D$(\$؟ǃԟ|$ l$XL$1L$uПHD$4;L$$D$T4П>-u FD$,Пt$0E<+<-~؟L$ ԟXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő؟<Пԟ؟ȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$؟+ԟ|$ /V؟tԟuԟП<-u ~П4$<:tkE$<4$P61L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P芉 $? t/ǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^WПD8t}:tjWPWx:L$T$,ПL$ $_D$p7П:t%j=R/@)D$Cԟȉ $؟|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$V'SD$\(pD$D$ 1T$ $ $.T$tf\$QURS uUR $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8: RQPR \$؟+ԟL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:t9RQPЅ 1L$\|1uD1 <-t<+::BtD8tD$X8:tRPq?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:taRP辄1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8ПD8t}:t4$PF $E<-t<+u:}:1<: :N;A;;PQh_RYwa;A;;PQh`RYD$l]\;A;;PQhaRY|$T;N;q;;PQhRkYa;q;;PQhRAYN;;;PQhRYnN;;;PQhRXfffffUSWV[T$t$X+ ǃX+ ;D$}? 9-u7yI\+ t8--?^_[]Íj-RX)tǃ\+ --N;;׍;PQjRRW(;;׍;PQjSRWX+ \+ ::tlQR(tXx:?u'1x:tH;L$|鉻`+ T$?u?ܟ::N[;UPQRxǃ`+ ?tqc:D$8:E?ܟ3Z 1^_[]ÍK==PQj4R RŐSV[ t$ tjjjV0^[ÍU==PQjARQfffSWV[ü|$t$t1hPWV0^_[Í=`=PQj6R\QfffSV[]t$ tjjjjV蜑t^[Í===PQj0RQfffffffS[t$j t$t$[fffffUSWV[ˑt$|$tBjW/~G0t ujW1^_[]Í>=PQj/RFP띐USWV[Kt$|$ttft7Wt9fh L$f@Hx$p,L$ H(L$$HDL$(H U1^_[]ÐUSWV[Ȑj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$\ptptڍpuft?$L$ut: $fH f@xp$L$H,h(@DpH TW 1^_[]ÐS[ޏL$ D$T$rRQ0P [ÐUSWV[Û|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[>D$t$t$t$0P [ÐSWV[ D$8pP tWփ1^_[ffffffUSWV[ˎT$l$t\tE0~-},t xr }$t jr2U 1Ƀ^_[]Í[>֍$>PQj;R*Muc>[>֍$>PQjo>PQj>PQj8RKyc>>>PQj9RJUSWV[|$t@jW*GHO~ H0 WAjW+^_[Í ?>PQj7RmJffffSP[mD$ L$T$$RQP([ÐSVP[<D$L$T$t$4$VRQP&^[fffffffSV [D$,t+8t&$P?D$eD$D$ t$ex9~??Ph?FFySNF )PQj,,^[ÐXOL$x9~Í?Í?fffffffUSWV8[L$Xl$Pt$LD$4ut |$Tu^@VPJ@@VP2@@VP@@VP@@VP?AVP?)AVP?PAVP?tAVP?tAVPr?fAVPZ?XAVPB?JAVP*?9BVP?6BVP>qcBVP>`BVP>O` t9uuh/l$t'j2pU0 U@QP { t@@?PQhRFL$h@F2@@?PQhRE l$PQj2UbU;ƋD$XtPUt$\ ;D$4u 8^_[]ffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[||$t$t2F)F31uF FF^_[ÍCCBPQjYRD뭐SWV[ |$t$tg~uP\$wGN Qt4CACBPQhRB~uр~|$^[ÐSV[̓t$ t ~t/F4CVCBPQhR~B~uN .wu^[ÐSV[]t$ t41~t^[ÊV u.wL$~9|ԍ4ClCBPQhRA먐SV[t$ t~t0^[Í4CCBPQhRA~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[L|$t$t@1u6T$L$9w"QjVC FfFF^_[ÍCCBPQh.R@뜐SWV[́t$t>~u/L$Fy |y|9IL |F1^_[ÍCCBPQhMRL@랐USWV[Ht$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍCCBPQhhR?CCBPQhiR>SV[t$ t"~uDNu;V9r1-CCBPQhRy>~t^[ÐSV[mt$ t31~u(NuV9rT$x 9v ^[ÍCCBPQhR=fSV[~t$ 9y ^[ÍOD;DDPQjTR=אUSWV[ë~t$|$t.l$tGMϸwG)o >1^_[]ÍCcDDPQjbR:=뱍vDcDDPQjcR=또USWV X~$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQW>D$0 28t p׾$VPUH 7+D$p)t5u+VQA$RjP= 7D$)smH1 ^_[]Ë$4CD֍DPQhR;D$4$DD֍DPQhRO;g$D΍DDPQhR!;D$a$EL$EՍDPQhR:L$USWV[{l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQ9< D$ }+$x)t6u,WQARjP; l$}<$)s8O^_[]Í4CD֍DPQhR9D͍DDPQhRb9렍EL$EՍDPQhR69L$;SWV[,zt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú94CDDPQhR:86DDDPQhR8)뒐SWV[ yt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[14CEDPQhWR6DEDPQhXR6VL$t"T$ tփuQ^ÐUSWVP[Êw|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP7 D$$L$(l$0O}^_[]Í%EE$DPQhRl5T$L$8D$4VUJEEՍDPQhR/5\SWV[,v|$L$1uLwt?;t$w6)w*t$uQRjQ6 ^_[ÐSWV[ìut$|$D$Vt$P  ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [Øt|$$D$(t9D$ L$,ň̍tEL$jEL$D $t4EtM9wEM )9w+8t;9rt$t$ht$ 2d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[Ìst$|$D$VPt$  ^_[ffffffS[Nsjjt$t$t$t$[ffS[sjt$ t$ t$ t$ t$ t$ [ÐUSWV[rD$$$$$ $$$fjt$pPQj VtND$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6't&6P&WPVQZ D$@t%h+ hPV $0$$٥tbōD$ PVAx\#D$=uXUTL$ QPxED$$t $;Au=D$G0=OF1CFFFh- UWBt$Vl$E;$ļ^_[]$$$$U똍FwFEPQhRƍ[FwFEPQhRqiFwFEPQhRxYUSWV[h\D$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[]USWV[[$D$$D$hP1$S$k$$UhhWDD$ D$$GƄ4$$$UhhWCj Wt$X8D$1$0Uj t u뜐44 w$ |Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&PT$@|$L$ t$֋$^D$PjL$Q$&PD$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP#+JtD$Hɋ$@tD$$L$Q$jPɼ؅$U$Z1$$׋$$Pu\~$P$ 1u7Yu,N$P$ t/t u $Uhh$$Wq?11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύ5G%GEPQhRiF%GEPQhRn[F%GEPQhRVsUSWV[UD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]USWV4Չ[AUD$$0qƃl- l- Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/ul- HPRQj14$D$;$0u4ȁ4^_[]ÍFHEPQhR{hUSWV0։[aS$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1P;E;$,ue0^_[]ÍFHEPQhR$THHEPQhRxBfUSWV[ØQ|$,D$(/D$wl$GQjP[ G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#HI΍>IIPQj`RD$,H$$t$,F $)ʃr#pI>IIPQj}RF$)N)!r s.^_[]ÍF>IIPQjCRJI>I׍IPQhR!몐USWV [Ot$ ~Nƃ1 V҉$t`L$FшT$?r?鍋m1 $j@UPQQ\$+m1 ~t0|$>L$:$u m1 uL$>͍ >T$1ҍ1 -9si$:FU;L$s>t 9sE.9r9s34$Fh9s맋 $1 9s$m1 ^_[]fffffUSWV[ûMt$|$lUl8PPWVEUL^_[]fSWV[lMt$ W!PPV W^_[ffffUSWV[Mt$tLD$F$V~nF1 PUWRt$t$QjV($^_[]ÍIIPQj3R 듐USWV[ÈL|$,L$T$ |$l$捃IUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]ÍIIPQjBR [USWVH[øKl$`D$ D$D|$\SrE$MUu}m3JUWVRQt$PjD$JPo'$$^uEJPQ+jjjjPVpƍ.0VjjjjWpƅQUVjL$\غQL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$ uj!%ƅtXD$XUPF1LXƿF ƿLFuF ;D$hu2l^_[]1ꍃJJJPQjhRnJS[nAt$ t$ [ÐS[NAt$ t$ v[ÐSV[-AJ1 jPVm D$ jVPjY^[fD$ȉty!fUSWV[ø@t$0l$,D$tjuj)谪ƅtRUP1 ƿF ƿLFuF(;D$u6^_[]1ꍃJDKKPQjFRur螦USWV[?$ $$P'h@Vl1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ i|=P$Pt$k ƅ~.V$P$P |) us84$la8|$$uj)袨ƅ~$$QP1ƿF ƿLFuF(4$Wk|$;$u^_[]1蘥胤S[=jjjjt$t$[ÐUSWVt[è=$D$p$U$$U= uj)uƅtXD$\UPk1L\ƿF ƿLFuF(;D$pu5t^_[]1ꍃJMKKPQhRG^fffffffUSWV\[è<|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍKKWKPQhRKKWKPQhRh$ffffUSWV[X)t$0l$,D$tjuj)PƅtRUP1 ƿF ƿLFuF(;D$u6^_[]1ꍃJFLLPQjFRur>USWV[Å($ $$Ph@VT1$|$$ $ u#D$P|$W2P|$`l$d$$ʃ|&jQPt$ |=P$Pt$S ƅ~.V$P$P` |) u84$T8|$$uj)Bƅ~$$QP1ƿF ƿLFuF(4$W T|$;$u^_[]18#S[~&jjjjt$t$[ÐUSWVt[H&$D$p$U$$U uj)ƅtXD$\UP1L\ƿF ƿLFuF(;D$pu5t^_[]1ꍃJQLLPQhR[GfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[ %t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPȼ 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPl ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW2 ;D$u ^_[]tfffffL$$Yai qyD$A(tQS[ Rjj#9 [1ÐT$D$ Zbj rz $z(t RPS[Ø jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ Rjj>8 [1ÐT$D$ Zbj rz $RPS[þ jRj7 [Xt@ffffffSP[Í D$ L$T$$RQPo[fffS[^ jjt$jT7[fffffffS[. jt$t$jb|[ÐS[ ht$t$j/|[fffffUSWV [ t$ D$D$$|$jjUVjWr1D$D$ $jjUPjW;D$D$$jjUPjWD$D$$jjUWjP˜u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRA1u ^_[]ÃtOw OsҍHPmL]LPQjw ^ffffSWV[t$(WjV xqN|$,t?r$td$D?r']- d$!L$jWV ^_[fffffffSWVP[;t$wtB+5 PQhR*x>L$ $5 )QVWR 5 PQhR5 = t@= ^_[fffUSWV[Ët$D$D$I@t NQw 4ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]ÍSMJMMPQjbRCUSWVX[8D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ÍgM`MMPQhtRطSWV[|$t$t5$D$ WVjjjP菊1Ƀىȃ^_[ÍPmMMPQj:RaffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[Èt$(l$$.PT$(18D$8tP) skt4)psD$(8rl$ ugPt$ŋ$t$b覺0?sD$8tP(Wjp4$&#t$#b01UPt$貦ŋD$G6"oD$ G = = D$8tP(G^_[]ÍMMPQhR*MMPQhRT$(#(qÑ;jUPQRVj%USWV׉L$[â2jeV譄j+V蠄t-1|$WjPj%eyFu<$|$1jrV聗tRCb $UW`ft1j'^u%赸07\!wQ!虸01^_[]ÐUSWV׉[÷= tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[t$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$賣ŋ$t$]@0D$8tP9%W m4$t$01UPt$QŋD$G6oD$ G = = D$8tP$G^_[]ÍNMPQhR诰*NMPQhR腰t$,|$(T$0VWU jشUSWV[Xt$8$8tP#= t9ut>mt9uu+$8tP#褵h1V_Eu= $8tPy#|$jWu ƃu F8tU$ktt$^_[]ÍN NMPQhR6fffffffUSWVH[(D$`|$\t$$UVPWStUVt$aǃu.薴8ujD~;$} VPaǍD$9tLVHjA$jD$Pnct&UPt$hW\S{D$$oH^_[]ÉƍaNUNNPQj>R!fffUSWV4[D$\l$HSt$XoL$`utu&u t덻tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ tL$ V" 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$艠Ń|$jt$ RUl|$tUjt$ RPU|$t>jt$ RP>l$t%jt$ RP%tjt$ RPT$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQGщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPƉр|$ul$эN4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0w0腟L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$QwL$,T$$ QN4$Qt$(V0WRUt$h-$[4$|$2jjdQU衝ыT$,t$$rN4$Rt$(QPVt$dVt$d 9wijt$ QRDщ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRޜщ9}T$ 4$T$\jt$ QR譜щ9}T$ 4$T$\ijt$ QR|D$ ы4$T$\B:^oNPQj8R~D$lN^oNPQj9RVmfffffffUSWV[E$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]ÍOύONPQhR=>USWV։[1$$F t%G HO =r贪,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ} D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÍOONPQhRl[OONPQhRB4O(ONPQhRUSWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRV%IuD$t @ t$?D$ h |$t$($/lPVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVP'I)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPdVt$FPRVF^_[]ÍOONPQhReUSWVYkT$tht$1BtBظkw+4tրztЃːt *u1^_[]ÐUSWV։[]F,F tvZFUPOl$~D$uNtQjPQD$ L$$t$ F1퐐f$t=tsAuE @u1$P-$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu觔$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YOmONPQhER詋M lt$10TD$/ Njt$$E @D$uPPUu 8t E u;$6Ĥ^_[]ÉNjt$몍MOONPQhR]OONPQhR躊|OONPQhR蓊$cOONPQhReOOONPQhR>7OmONPQhERL$ OONPQh/RL$1USWV[T$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍Pm΍NPQhR萇O΍NPQhReT$8O΍NPQhR3T$8ffUSWV[%$$c$$tu裌1D$$tŋD$3l$ !h@PD$(D$$D$ iL$L$\QPhtYD$|$D$0t$\ d$<0fD$PPjup] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPh{PWuk uh0D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P@ (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$1PjPv u|$1D$Wt$8Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$5PjPD$p =jPD$p D$ |$t$ztG$`L$tZ1PjPq@ jPD$p /1ҋ$t5PjPD$pb1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8蝅< 肅Y1D$ D$l$t)`D$D$\PjuV |$>8|$ $%|$tySjPu> |$t&D$u|$8|$ $tt$Dtu V贄t$jl$ Uހ 1$u Ur:;$uEČ^_[]Ë|$|$[|"PPOPQj_Rn~y&S[njhjt$t$t$[ÐSWV[<= t-= jhjVPt$$t8= 0jF= = tP(= u^_[ffUSWV[û|$= jjj蠠 = l$> tUQ= s = t]1i = 9> wHt Q8 > WC(= t$UWP = u 1T$ Ɖ^_[]Í{PoP7PPQj u> jP[0xƃ> 1> t > 1W2^_[ÐUSWV[K W> u> jP/x5ƃ> > Uq";D$wUt$1虁0W^_[]ÐS[þt$:.ƃ> [fffffffUSWV8[Ãu }D$D$L$$jjPQjR*NtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍPPPPQjERz*PPPPQjFR`zffffUSWV [XPP1t\ƀ8tUT$D$j PV tŋT$t|zt)PVPգ1ɿkP&wAD6@ʹ &_u@9~ $ QjPE,$$QVP%T$t$$D$ t AQ> RUPjQ!L$ t>> ^_[]ffSV[ݹ,> u*ǃL> ^u!PV<,> tt0> VP!1^[ÐSV[mǃL> ,> tP89^u!PV軙,> uVP1^[ÐUSWV [$ǃ0> ǃ4> ǃ8> ǃ<> ǃ@> ǃD> ǃH> P> ,> hhU)D$ 1Ʌ$t$lL$T $t$ @> L$l$<ǃ0> ,> hhUD$ L> t$P.Wj\WVO t8t剃0> 8#tj\WVwO t8t뉃4> j\WVWO t8t뉃8> j\WV7O 68t牃<> ǃD> ǃH> j\WVN tD8tPD> j\WVN t8tPeH> h<> |$$W'# |$O j\PD$ P}N ǀ8tWuku͍UW mthYUW mtTUWlt@UWlt,UWlt@UWlQ@> E5xxMf l$<$j\WVM 8t牃0> 8#j\t$VdM t8t艃4> j\t$VDM tOǀ8t扻@> @PWk"<> PWktbe`<> D$!QL> PQ @> l$tэ@QPxku8> <$j\WVwL t8<$tPD> j\WVGL X8<$tPH> t$t$1ɋ;$u ȁ ^_[]SWV[t$ǃL> ,> t P۟&^u!PWc,> t*t+V0> Kju䍃0> WP/1^_[ÍPmQNQPQhRWrZSWV[Lt$ǃL> ,> t P &^u!PW蓓,> t*t+V4> {iu䍃0> WP_ 1^_[ÍPmQNQPQhRqZS[~,> tPfǃ,> [ffS[NL$T$ j@t$[ÐUSWV8[t$PT$$t$,ZT$LXD$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$  Ѓ L$R|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V"2D$Pt$V ID$ V1D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$hQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|GT.TSPQjIR&USWV[gl$L$t*t$1Ґtuщ )4@tRjP' ^_[]fffffffUSWV[Øft$$|$(9jVPƿwLjVt$,3 t$( D$l$,L$ t-|$,RUT$T$t .l$(RRl$(T$tX$|$  tQT$ <$EFt PF tT~tE1t(0F t((F t( ;~s F @ƋF PF,t PF4tPqF8t PaVX^_[]Í%@rU;UPQjKR{?e{UrU;UPQjMRP?efffffffSWV[<\t$HWDL PVAnW؎^_[ÐSV[[HV趎DL PgmV螎^[ÐSWV[ü[HWuDL LL PQmWT^_[fffffUSWV[k[t$l$VvZVt$[1u<$Vt$r[DžtpU7t]wtуUPyt u막t$~utQ=^_[]É1ԍPmUUPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xs-VkV8VPQhRqVkV֍8VPQhRUSWV [øPL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PLutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2V8VPQhRG ^_[]Ël$ u렍΍V8VPQhR7΍V8VPQhR S[Nt$t$jt$ [ÐS[Njt$jt$[ÐS[ÞNjt$t$t$[fffffUSWV[kNL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(ƉDl$Utwn$Nj 0Q 1L utjh=xʼnL 0ƃL LtMjуL @1t*n$FLUQj Pa)|$z^_[]ËL )USWV[LL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(襶ƉDl$Utwn$Nj 0Q謸 1L utjhʼnL 0ƃL LtMjуL @1t*n$FLUQj P'|$z^_[]ËL )USWVP[ÊKl$UHNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$ t0L tuR:t!jуL tiE$SL uj(6ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[ÚIl$UXNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(Fŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[ëGt$|$ tЋL t61=tDtPǃL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃL D$ 1^_[]ÐUSWV[ÛFt$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[ÅE$tA$1uh~ƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[Bt$tD$tdPV$xaa1ɐ΍,?UQ薷t&UP$y.w 8"tV 1^_[]ffffUSWV[+Bt$VL P"L ƃL X tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1 ^_[]ÐUSWV[ A|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í:\[PQhR@]"\\[PQhR6USWVP[ @|$t$t#l$ t?tajUjW^_[]Í:.\[PQhR빍7\.\[PQhR}uPm.\[PQhRWxUSWVP[E?$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lho$p $L$1xjjjU@|$ `\PQhl$XU jjjh@Ujh@6,j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$PmH\[PQhR6$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPưT$ )ʼnl$‰$L$\$(l$$|$ t t$ht$,D$l$ tEF4$ٵhD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$p؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUq5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPޠ Wt$DUР t$$t$ t$0襳/L$0\$|$8T$L$ D$ɋ,$tt$T$,fT$Ћt$ 9v8)PU謭|$u(U2A|$ |$L$1|$ 04$0rL PGKL P(!L L$ <$14$聲$lyD$0P|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$V(D$xW^t_WVP UUx~1L$ ȉŋD$8L$D$8B\$W蜱 |$ t$GdUU |$;$LP^_[]V0WH"\L$0\Ս[PQhRYL$,8\L$0\Ս[PQhR&ꋴ$tL$,7\L$|$0\Ս[PQh R|$L$,PmL$|$0\Ս[PQh R$|$L$,Ń|$ \$t t$b4$)PmH\[PQhRL$|Pm\[PQhR$|Y\$U辯|$ t\$t$nb\$t$0藯脛X4L$ÐSWV[ü4t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í:H\[PQhR}PmH\[PQhRVSWV[3|$t$tGtiL tPQǃL ǃL ƃL ƃL WV^_[Í:S\[PQhR_u7\S\[PQhR9pS[>3L tPǃL ǃL ƃL ƃL 1[ÐUSWV[2$,E$$$(L uL ȋL u!^uQ0 L L t%1L L PQ1t $D$uz1L VMVvǃL L HL @M^uQPBL u<X1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$V`tfVSǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$VǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPYǃL ǃL ƃL ƃL GV)ǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL C^\[PQhR$<E7\^\[PQhR$<XUSWV _Ǩ.T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u6 (FPUvtL$(U$W ^_[]Í:h\֍[$PQhR|$"\h\֍[$PQhR|$|$(Sh\֍[$PQhR|$&:\֍[$PQhRa$"\\֍[PQhR0USWVY(+T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd脔t]ƃdNJD$$ƹdEt#<:tu)FdPW&u`)nu N$UWt1L$$8$q\\[PQh`R$WK^_[]Í:\֋$[$PQh"RYL$V"\\֋$[$PQh#R!L$|$$&\֋$[$PQh$RL$:\֋$[$PQhR$"\\֍[PQhR}USWV[{(l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuP F(N8D} '~wF^ FPB^ uWv$Q ItƒN ~?:V|@uH)ƒVԋ^ ;FF$BBQWP uvvQ K~?:uFV;~t^  ^ q8u^ dF,;8u e^_[]Ë^ S[n#0t$t$ [ffUSWV [1#} F FEFUVzRu)ʃԉF:FJFx9u0RuO N ;Nue^_[]3fUSWV0[Ã"D$(}PQXL t$M L$ML$f|$ L$T$|$QRj WPGBuOt$ rF|$j WPb u0O L$FD$D$ PjL$Q2 79_t$} urP tgM9uWM % +]QPR}Wu19r"y";L$(L |jjP@ PVJD$t$L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V| uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPuf 1ɋt$;D$(u ȍe^_[]ƆS[ ]jP;L h P>P [SV[L hVt$t$t$%t1^[fffSV0[Út$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[ìt$|$jWj VW) jW踠^_[fffffffSWV[\t$|$t P-^u=^PQ ~^_[ÐSV[ t$ tP肴FtPzFFFtPgzFF^[ÐUSWV[Ø|$(?u ^u=^PQt$$olD$t Uyjjjj|$87p$Gʼnt$Put< t< tt$Wut Ń1WO$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ PI D$ L$ 8ukD$ $FD$,t$UtmŃzAA jj t$t .$ tEt@u%&``L^PQjJRE@NT$RQjjjuЃ>T$u-``_PQj[R蟶T$,$ t|$ tEtHHu0j`Q`׍L^PQhRH|$0EHHPVt$0t$0WRUуt 0$^_[]Í`__PQj}RS[hPt$t$t$t$t$S[ÐUSWVP[êl$t$D$ $ t t@8u'``L^PQhRG@8QUVwЃt 0$^_[]ÐUSWVP[l$t$h$ t t@8u'``L^PQhR赴@8QUVwЃt e0$^_[]ffffUSWV[Ët$l$ø+PQWz t"t$ VWh eWjjPTU軉PQW: t$fffffffS[jt$t$t$[fffffUSWV[l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]ZUSWV8[E$L$4L$u$X$PD$u$P| $$Pt$Pr膸 :T$$EjPgD$tk|$jWkgD$,D$ tND$1ɅujWDgt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWx9!xt19)u|$T$(l$);$Pw|$$XD$0P.ƃjP!ftQ$1 T$|$$T@uX$L$0PVQWt5W3D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ ‹D$$t $uCr.0|$1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V| DžL$~9t/;$WVQ袆L$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j}|$l$t$D$PJgt$ >gU5gV,gl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$ft$ ft$f넍aIaaPQhR!aIaaPQhRaIaaPQhRUaIaՍaPQhRr`daIaՍaPQhRGꋌ$hRaIaՍaPQhR2aIaaPQhR<aIaaPQhRxQUSWV[D$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]PUSWV[Kl$ |$t$t V 1L$1jUWPV^_[]ÐUSWV[l$$|$ t$t V躞1L$T$jUWPVp^_[]ÐS[îL$1jt$t$t$t$6[ÐS[~L$T$ jt$ t$ t$ t$ [ÐS[>L$T$ t$ t$ t$ t$ t$ [ÐUSWV[L$(T$ 7t$T$L$D$L$11jUt$,jP`xD$Ƌ;D$u ^_[],OUSWV[xD$(L$,T$$>|$T$L$l$L$T$ jWPjU1xL$ȋ;L$u^_[]NUSWV[|$t$t V辜1L$1jUWPVp^_[]ÐUSWV[ë|$ t$t Vn1L$T$jUWPV^_[]ÐUSWV[[|$t$t W11jUt$$PW^_[]ÐS[L$1jPt$t$t$[ÐS[L$T$ jPt$ t$ t$ Q[ÐS[ÎL$T$ t$Pt$ t$ t$ [ÐSWV[L|$t$W+uuGكs^_[!t_t$t%< F F ^_[ÐUSWV[|$ u ^_[]l$ t$WPut t- t(W9utPWP u뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVrt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉr$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWqu#XDxuGws>4$$^_[]ËD$4  !rfUS [E$D$D$D$PQ7D$e[]fffffS[Ît$ t$ [ÐUSWV[U$$%= uRl$`]4$>Kƅt9w ‰ щ ȉ  σWl$u3TƉE}M(tXPIZ$t1ƒYL$,PP@T@,p@ @J@@ @@D)D$ QD$112fOH|$4D$,$t$Wl*t$$UƋD$H(L$tXP,HǍHTD$t17YGPPUQu w,L$AGG GJG GGGDD$ GoD$PfGt L$y|$1l$9l$^|$4l$trV$$M(tXPFt<$tM1QE<$twWPWut$ >WuV2WU)WYHP@T@,MH@ @J@@ @Exf@H u"jh@P EuM(L$ uEQV8O;"baPQjRÚ1^_[]ÍO;baPQhR耚USWV։[qG(u/nPFJt0fD$9j|jU, Exl$FJuЃN $t6UQt^负8Uv9u&蝟f )UQt(~8~ j|jU诛 f Ą^_[]E%===@EM $N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHG D$ D$4L$ $Љj0)t9D$"D$ <u 豔G OJ裔D$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P8ōG UTD$t1 .YMPNQPT$ Rf u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRC4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$H1-]baPQh1RLD$u‹.1F)EHftf },$FtpPCu|$t$u N)$xDuW@8/tOF(uIjh@P( tFFU$U<$u~yljF^_[]FUSWV[[t$tf8}t v$>V }t!v$v$v$BVBWZ^_[]ÍbbbPQjBR趆vfffffffS [ëhPQt$ t$ ,$ [ÐS [kt$Pt$ t$ ,$ [ÐS[>L$T$ hP[ÐUSWV ׉[T$4xtb=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWV#2=u$"كĸTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[L$T$ t$[ffffff̀rS[ôt[̀rS[Ôt[ ̀rS[tt[SWV[\|$t$t-9t!t F9u1^_[Í &cbPQj*RfffSWV[|$t$tt1WVj{^_[ÍSec-cPQjBR藃uύSec-cPQjCRt뮐SWV[l|$t$tt1WVz^_[ÍSec-cPQjBRuύSec-cPQjCRfffffffS[L$T$ hPt$ [ÐUSWV(T$ [òL$<\$%t$@|$t;D$<|$"v+61t$ \$VP-t\$u<+t<-t D$1 1ҊD$L$L$T$ t$t$^[ffffSV4[ t$hjjjPVt$Xc+ut$Pt$Pt$Pt$Pt$VR4^[ffffSWV[ìt$tFh`V1t+ju+0W01^_[ÍPmOcPQjFR'뙐SWV[,|$h`W1t-t$)u譄8VU蝄81^_[ÐUSWV T$[ÿE$ j()ƅF F8$8t j)F$jPD$jPW xl$ t3unio3$$n tD$ u Ƀ8a$nfsu F t$WV tK薃8菃8$8tv$v$[9v P9VG9V81E;$ u ^_[]%SWV|[i$PWn_1t?#D$=@u$jjW: t1jG ˂|^_[ffffffUSWV[l$,E D$ƩtT$t |$4L$0L$u8uEV'E ?EED$t$1D$ D$1$1ɐw8l$|$Ut$62l$)ʼn$ jjj|$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[Tt[USWVTX8D$|$tt$ht&L$ptCwm\$|\$dMdPQjxRv뵋\$ڄdMdPQjyRv$vl$l1 D$͉L$4A\$P!gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$ڄHMdPQh&RtV\$dHMdPQh'VtdPQhrVt$xbt$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWP \$R#1T^_[]Ë\$ڄdMdPQhsRg$\$ڄdMdPQhsRg$LUSWVTXD$ L$pT$htwL\$ m ֋\$ dMdPQjxRg$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ dHMdPQh'VOedPQhrVt$x/e$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVPC \$ Q1T^_[]fffUSWVP[Z|$88tqw$G$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;WuUEuu u EtctUxFUM u9yu)փ9|)U1 qu |$ly u%E \[ [ $1ɉȃ^_[]ÐSWV[|$88t'w$jWw$ jW^_[ÐUSWVP[Ú|$l$B[$8[88t>u$/jUTƅtF PVWY. u$*jU!t@ PVW&. 1Z8t uZZ $tD$ 81^_[]fff̀rS[ôt[ḃ̀rS[Ôt[SWV [yt$ |$t[D$D$4$ Z0L$jjPWjQ '1uY9 u Y01 ^_[ÍPm.edPQj񐐐9t uD$))t8t)Pt u+D$ P%G^_[]ÍeePQj@RQD$(SeePQjARPD$(7fffffSV[ݑL$D$T$ y9eRVQPU6Q4P 1^[ÐS[~D$y%9eP PQj@R;U P j@4R P [fUSWV[t$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JSNfePQj?RO눍SNfePQj@RaOq1^_[]fffffffK̀rS[Dt[USWV [(t$ РD$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV]x|$0||$4РD$Pt)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$轾^_[]Íff[fPQhYRJ[USWV[èt$D$.̉)ōР$P3t)1ҋP<Pt14$譽D$^_[]Íff[fPQhRIUSWVP[ÚРWStI010$9r$9r$i0mNA900W޼^_[]ÐS[t$t$t$b [ÐS[Ήt$[ffSWV[ì|$t5jWt ctVW(1^_[ÍPmgfPQjAR8H몐USWV[;l$t{jUt=ǾtUWUt1l$UPt$ L "19s#MM8^_[]ÍPm gfPQjVRGaffffSWV[||$1t,|PWzt |$t=t=tƉ^_[ÐSWV[,t$t-VW tPW V^_[ÍYgLggPQhRF믐SWV[ü|$GPtƉx @VP1^_[ÐSV[mt$ t%VPMt L$9H 1^[ÍYghggPQhRF뷐USWV[D$01t:>t41 |t$t$ t$ W< uD$ <=u.|$$ 0Q 9ttD$00Q M9u;4Q s|9v9tfPǃ0Q ǃ4Q $jWPe J0J8uyPD$0t$ )$jWP  J0J8u4)  $PjQF $0Q L$4Q ^_[]ÐUSWV[h8Q t8Q 1t0DtPVt8Q Hى|$jjD$P tE t5jVt$ F:8Q tVt$VSŋD$0Q 9tP8ǃ0Q ǃ4Q 4Q UjP\E ^_[]ÐUSWV[K81tR/tL,t4t$t$U9 uD$|=uօt D$1^_[]ÐUSWVP[ʃ|$1||PWtfƀ<=t^tR)tI1 $ $lt+Vt$U79 u|5=uمxD$8.1^_[]ÐSV[PVƅtG0^[ÐSV[݂PƅtxG0^[ÐSV[ÝPֶƅt8G0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[ØD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[ØL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[}T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVtGPV|tۍGPVˍtʍG PV躍tWV詍묍$hlihPQhRm4ClihPQhR[FUSWV[[_t$|$Gt/uTot^REwnd1o  u-GFGFFnFn GFG    5CyihPQh$R.iyihPQh%RiihPQh RGFGF^_[]ÍiihPQhRS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[\t[v̀rS[\t[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[\|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1GTiiPQj:RU]iiiPQj;R1VAUSWV4[%[$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋxl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFjl$0PQjU!6U$\9ȋ$QU$`- FfNAQPR$`U$`51Ʌ9$Fx$P$T)iPURQw5*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LAQPR$`$`4l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$cjPQ|$W$`Uu3t;$Tg$P$T)D$D ]P|$Wt$L$QR"3L$)D$D Pt$t$t$R2L$)D$D Pt$t$t$R2L$)D$D Pt$t$t$Rw2L$r)D$hD Pt$t$t$R>2L$9)D$/DPt$t$t$R2L$)D$DPt$t$t$W119D$F$PED$1$1D$ ]D$cjD$׋D$ tD$ $ 1QPt$t$UI1H)D$>Ń19t$un 1f$PL$$T)fv fD$ jVQURt$0L$ ;$T$٥T$0L$RQPWt(8WD $\9vpD$0Pe;fǍj$0PQhWC0W$\9v QW$`O %1QW$`5 D$0PXeFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtP`Dž $y+aGjT$ PQhRx+= $w89;$(w))΍L$ WQPF D5%D$D1D$;$ ^_[]ÍYJjjPQhR FJjjPQhR $$bEJjjPQhRh ; fffffUSWV[UN$8$E UPW`E 1Ҩk4$$4$0$,uRUz]-VU]t9~uۋ$0tPv Wu*ft#Qv$4ƃ1ҁD$D$ƉffD$D$hVQPPt$D$L$ T$PQVRu`m9t$D$ ff9|$$0$4t*G9D$D$u_GRQPp uEt$WVU(`24$1E u U[;$uЁ^_[]1ҋ4$E tfffffff̀rS[TLt[USWVP[:LPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pgx8^_[]ffffff̀rS[ÔKt[SWV[|K|$t.jWG=tjW^_[ÍjjjPQj@R fffffXKL$rÐSWV[Jt$u8ljjPQhrR VCtF~tP*^_[ÐUSWV[eJ$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W#tGotP ܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$>n3njPQhfRF HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RZNjD$$fxxt$ T$@>P]fD$>P]fD$>P] f|$fD$f|$"D$<$$!|$hVWt$8RTYgD$D$$fxxVT$@HVtNjD$91%L$L$PVt$Và 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$8VWP$Pj%Ϋ΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WM]mPt$t$t$DQ$Pj%T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FPZfD$FPzZfD$h$!Pt$ Vt$8WSVfNjD$$fx$!xVVAVm=*h~L$L$t$L$L$|$hRQD$蕀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V)<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V請L$tL$8$tYt$`~l$(u2D$4t$%Ut Q+yFPVt$`)L$8uBff#V01l$(E;$%b%^_[]QUǍ@m΍6m׍jPQhROm΍6m׍jPQhR$%]l΍6m׍jPQhR.KG΍6m׍jPQhRl$% lύljPQhR8$%~ύljPQhR$%MTu?WVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[f|$F$ jPŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P ^_[]ÍlmjPQhR@mmjPQhR\|$FmjPQhR/USWVT[& 1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4lD$ D$$L$j L$Q諜tL$t$ t$Fe t tt,…tt$ Pu$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"R tT$GtItu܍ljPQhR=T$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1mmύjPUhk RlmύjPUhl R~USWV T$[r L$8D$ l$4"t$@jV1]F1t 1Ƀt Du`1<$L$D$ Pl$ U,1mPU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ P 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UQqGt!D$881<$;D$ ^_[]ýW3t‹GwtP܍l͍mjPQhR;KG͍mjPQhR l%njPQhRljPQhRWnfffUSWV([å$H$<$$E UPM 1U4$Um$DUtڋ$D0W蛽t4$DptPWytu뗐$@tP$Hp Ej$DWhH1$@T$t.$@3T$D$1L$D$=wu4$T$$L$%D$&hRWP։L$4&t$$DP D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$ET$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$ZET$L$ ut$t$$LUPmnnPQhR_kfSV[]t$ t,FF#EgFFܺF vT2^[ÍKonPQhR밐USWV[t$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ 葛 L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVP3^_[]ÍKonPQhR(oonPQhRUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW> ;D$uY ^_[]ÍK3onPQhRK3onPQhRҸu`ffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$X1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RLRWjP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W Pt$l$ Ur t l$ /D$D$<F\$hPW& |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR>~T$ \$WjRT$ |$L$F t[l$Et Nj,$U \$Wt$T$ R} E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$w}T$ L$E E$\$l$TU_/4$U_$L$$9sD$DQ_1ɉȃ0^_[]D$D捃oooPQj]R豣W\$SV[ít$ t V=_^[ÍooPQh/R_fffffUSWV|[Xj$1tGljPWJt)l$XD$\|+Wy Wc1|^_[]jjWjjUj#KW8t҃LD$ l$<$D$ƅuUW#뚐USWV [x|$$(rl$ NBCD3EB 3M t 1 ^_[]Ë|$,jQ 9quJٝ$mD$=pD$4$vt$D$<$9L$HL$D$ l$RpD$$$˸$`$ttl$$;%`t %)l$ p$D$D$`it$L D$0Vvt"l$ p$D$D$ it$L D$0vt"l$ p$D$D$ht$L D$0ut"l$ p$D$D$ht$L D$0ut"l$ p$D$D$`ht$L D$0Vut"l$ p$D$D$ ht$L D$0ut"l$ p$D$D$gt$L D$0tt"l$ p$D$D$gt$L D$0t$t"l$ p$D$D$Yg`t輆|$4t4z~wL$DL$ D$pD$,$t4tƁ Ot yI uD$4$D$5L$@L$ D$pl$$$莵 Ɓ Ot yI uD$4$D$U5L$T$ t|.t;L$$} f.^_[]USWV [%$ $$ $ $T$hRVQPr 1xDǍD$P~L$t|.t=fD.t$(Q$;$u ^_[]0USWV[k|$t$Ft)l$PUItF u1t^_[]øuUSWV[l$|$yƋGt!9/ttO 9ou UPV( 1ɉT$t ^_[]ÐUSWV[{l$|$yƃt9ot0 uUPV^( D$tD$t7^_[]ÐSWV[|$xu Y 1t Q 9yux65x.?x&Txx$xOx^_[ÐSV[t$ uYj(PVu youYjVQj(PڠRuY^[ÐUSWV4[Ø$D$0D$IuD$HL$j.QPjJ{xT$PQj.jR_y$tEL$PQVT D.0;D$0u 4^_[]*USWV([t$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$/yy֍xPQhRtːUSWV[õ}PfD$|$D$ D$POlHHPPFy0ppp RQWjV}$r D$ƀe^_[]USWVP[:l$CPU.2PUpPUPUpPUΈpPU趈PU螈wjPUT# 1uRXMDHt? yj PU x8u$8 L$A.&L$0t9^_[]ÐUSWVP[êl$ PU艇txF u6p{jPU7" 1u[XMDHtHwj PUҕ w8u $8 6D$t8^_[]fffffffSWV[̲|$t$jWPGHO~;G~ t H WR評jWR^_[ÐSWV[\T$L$Bpr~ ;B~ t 2~: RQH^_[ÐSWV[ |$(D$$u$PfD$D$D$D$ jWOG0u ǀD$PWCjWQ^_[ffSWV[|aHt Jt @t A ?t/t5Gt E49s%{u{jQjhRE4M01U0)E41E4u0} MU }$"u uD$ E HM HL$HM xQZƃE t$ 8zV|$Wt$PQjdj$$+W2[ 9E4?PWu0> E49s%{u{jQjhRE4M01U0)E41u;D$ !u E PU{PL$ Qjdj$+WZ9E4B?PWu0w= E49s%{u{jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu0< E49s%{u{jQjhRE4M01U0)E41u E a{PQjdj$+WY9E47>PWu0l< E49s)\${u{jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\${u{jQjhRE4M0QU0E4AD$z`/}$D\$u 1M QU Qqu It$z\$QRPVjdj$ +PX\$ 9E4<P$ +Pu0: E49s%{u{jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-{u{\$jQjhR\$E4M0QU0E4AzD$#M }4E0T$WP=;{E }4;E0 E4u)\${u{jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E a{PL$ Qjdj$+W/V9E4:PWu09 E49s%{u{jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu08 E49s%{u{jQjhRE4M01U0)E41E E P+E Pt$ jdj$+W+U9E49PWu08 E49s)\${u{jQjhRE4M01U0)E41M AE  L$<%\$L$ L${L$u{L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu0(7 E49s\$jt$jht$,D$(E4pE ;D$8}0L${T${T$ u{L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-{u{\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru cE a{PQjdj$+W`R9E47PWu0H5 E49s)\${u{jQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$_{VPjdj$+WQ9E4H6PWu0}4 E49s)\${u{jQjhRE4M01U0)E41|$\$E L$ L${L$u{L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu03 E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E zPQjdj$+WO9E44PWu02 E49s)\${u{jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0q+ E49s)\${u{jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-{u{\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\${u{jQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$LPQjdj$+PF9E4:+Ƌ\$P$ +Pu0h) E49s)\${u{jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L${L$ u{\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$$UD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$ L$L$ {L$u{L$$+р਀tsRPt$ jdjVD9E4g)PQu0' E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$z|$X\$PVQj2jWC\$9E4(PWu0& E49s%{u{jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\${u{jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\${u{jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\${u{jQjhRE4M0QU0E4AE MU \$VWu,P}$E a{PL$ Qjdj$+WA9E4&PWu0$ E49s%{u{jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu09$ E49s)\${u{jQjhRE4M01U0)E41E E ;D$%L$T$T$ {T$u{L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0Y# E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-{u{\$jQjhR\$E4M0QU0E4Au E PU{PL$ Qjdj$+Wz?9E4-$PWu0b" E49s%{u{jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0! E49s%{u{jQjhRE4M01U0)E41u rE E P]E E PHE zPWVQjdj$ +PC>}$u E E PE E PE zT$XPWVQj2jR=9E4"PWu0  E49s%{u{jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W=9E4!PWu0*  E49s)\${u{jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0 E49d\${u{jQjhRE46*DD$E4D$W\$L$D$L${L$u{L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$3\$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0o E491\$jt$ jht$(D$(E4  L$D$L${L$u{L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$~2\$9E4mPt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu06 E49-\$jt$ jht$(D$(E4\$A}4E0)E4u)\${u{jQjhRE4M0QU0E4AC}$n }$ba{PL$ Qjdj$+W[19E4PWu0C E49s%{u{jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s%{u{jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0K E49s)\${u{jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\${u{jQjhRE4M0QU0E4A :{g}4+E0-E4u)\${u{jQjhRE4M0QU0E4A}3}4E0 E4u)\${u{jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7z$+t$z$ +f@======2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +rz4w|$7z$ +r|$7z$ +rz4|$7z$+Rt$z$+2|$7z$+2z4|$7z$ +r|$7z$ +Rt$z$ +DŽ$ +====2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +Rt$Vz$ +Ƅ$+=fDŽ$ +==2|$7z$+2z4|$7z$ +r|$7z$ +rz t$>z$ +rz4w|$7z$ +r|$7z$ +Rt$z$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L${L$u{D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9*\$9E4(Pt$u0Z  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$z\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L${L$u{D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$Z(9E4M Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0  E495\$jt$ jht$(D$(E4|$ D$f E4w)\${u{jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u >E M4 U0B  ru0M4B\$QVP"  ƋM49s)\${u{jQjhRE4M0L$M0)D$E4z|$)D$L${L$ u{\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P肨 PQjdj$+W%9E49 PWu0n E49s)\${u{jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj诈}0W$ƋE49s,\${u{jQjhRE4}0}0)E4E \$u4u0PjF}0W*$ƋE49s,\${u{jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\${u{jQjhRE4M0QU0E4AD$zw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L${L$u{D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$"9E4Pt$u03 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\${u{jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u 蕱E M4MU0B  ru0M4B\$QVP  (ƋM49s)\${u{jQjhRE4M0L$M0)D$E4|$t)D$L${L$ u{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\${u{jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u E M4U0B  ru0M4B\$QVP\ {ƋM49s)\${u{jQjhRE4M0L$M0)D$E4|$)D$L${L$ u{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\${u{jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u 7E M4U0B  ru0M4B\$QVP ƋE49s)\${u{jQjhRE4M0M0)E4sf )E4w)\${u{jQjhRE4M0QU0E4AE4D$E0D$|$)D$L${L$ u{\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\${u{jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$*D$,;$p+u ȍe^_[]Ë\$USWV [et$,|$(D$ .ʋ7l$Ut$Vt$40RQ4‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s)D$D$Q@(D$ 9s${u{jQjhR)))x ^_[]1))lj${{u{PQhR#뽐USWV Չ $[dT$8D$4 D$L$D$"u${u{jQjhR|$4QA$93<$779$x{D$D${D$ u{D$0t$4QEAt$jPt$ e tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u${u{jQjhRMQUA+<$-&&D$4L$D$ ^_[]ffffYaT$4D$#lpÐUSWV[Ûa|$ l$t$~Jt$~2UVax(ƃ|$tލF9wȉ9v%(+t$^_[]ÐUSWVP[ a|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }?%(^_[]E ffGftC,$RWGxǃ9w,$)xD$ hHGftf,$RWf 8 9Xσ95,$)5|$ oGwtc,$RW胡 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [È^|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$." ^_[]Ð~34$U迟x(ŃtߍE;$wMȉ;,$v K"(+l$xD$ h,h,L$H(ht$0Quu]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5P!(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[[|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.! ^_[]Ð~34$U/x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuuU}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XXY\$|3|{PQhR|$Hy$M|3|{PQhRh_$USWV[XVl$|$ 1XD$$1D$EDA@u<=%jAPt$F 1҃|$ t;|$$* $D$ 81냋t$ tXT$$9+ $>;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōi|{PQhR|$ >|i|{PQhRt|i|{PQhZRfffffffUSWV[ûSD$$L$1w|$ u Ce0|PUWVt$(t$(QRo3 X?SL$u<ÐXSL$w1USWVXRD$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$<}|PQj>R;\$}}|PQj?RUSWVP[Pt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í} }|PQjgR1fffffXOD$pX txҋ9|Wy>TWPڋD$+D$pyȲffffUSWV[Ll$Uƃ;D$v(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[uK$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]腱ffSVP[JL$t$D$T$ $xRQVP&x9rQRQPY ^[USWV[ËJ|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[ J|$t$l$tt$$PW%t^_[]VW t W LJWVUF ͐SWV[ÌIt$|$jW1Ƀ PVW ^_[ÐUSWV[KI|$tt$O#PW$t 0l$VW/ t WRLJWVUM ^_[]ÐSWV[Ht$t5|$r#u#jV#tjV$F1? ^_[S[nHD$tL$ ttu H1[ [ÐSWV[Ht$t_|$G?wSD>1RjV"t3jVU# tۃtjV"t jV/#e ^_[ÐSWV[ÌGt$tAjVq"t2|$jV"wsf~ 1 ^_[ffS[GL$T$ hP[ÐUSWVT$0L$@[FuD$\VD$ Pǃx\$D$t6F=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$L$D$@$<$D$D$D$\$$|$,Vt$8PQRW9ǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\J$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$xt$,PVD D$,\$YPV`uD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$H L$8@ t$ D$PuQD$L$  \$QPك̸`؋|$8tWA\$t$ t$wًD$݀Dr{|$tD$t fD$zl$z߼$Xl$t$X$DŽ$ ߬$u{*1T$89T$|$DŽ$߬$|$tDD$!=w2ݜ$$$)$$݄$\$ \$PD$ Ƀ|$8|$u <$'${|$8؋D$Ɓ\$`|$ $L$T|$D$\$P\$PD$L$$ݜ$$|D$TЁ uD$$|$ |$D$݀Lr^|$rD$r fD$xl$x߼$Pl$r$Pt$DŽ$߬$|$8t\$`ݜ$$$)$$݄$),$$$PD$|$ :\$`\$L\$PD$L$$ݜ$$$|$D$`9u~|$pT$p fT$vl$v۔$l$p$$ڤ$|$8u% u D$݀dL$݁T݁\؋\$WPt$Dt$ 8t$,t$vS$tR6D$D$ـw|$؋t$MD$D$ D$ۉ؃t)t$4$ݔ$$D$$~iމjL$L$dt $ݔ$$L$$ʉ)كD$(NNONt$@\$Lt$(|$L$lt\$(t$HԉT$T$ T$@\$9t$,PVtQD$,8("$@\$PPQV  $DD$$@$D$@D$,1ɋT$01؁T$D$ $$ݜ$`$dD$D$ D$|؁|rMD$$)ɋT$0t؋t$()ƋL$ $1 PD$gD$$,jK$6D$p|$ D$D$ D$ |$ D$|$ D$D$ D$ |$ D$ D$8 $t$DD$5%=%D$xu x\$jPt$ D$P'D$xu x$%|$8t$|$tB#D$=w2ݜ$$$)$$݄$\$8\$PD$8$$@|$ D$|$83i4$k(ٿr1Ƀ|$ 9.=t$|$ ؉|$ t$؋D$Dt|$ tD$$|$ D$$\$t6WZt$Nt$ BV9t$-"T$0L$4tD$,$t؍e^_[]ùk)ًD$$ $u=t$|$ ظ#D$|$==ppL$TtJM؋t$|$8t$<$؋D$t$D$X$t$|$ I\$P|$8|$D$%jF)$DŽ$܌$K(T$$ D$$|$D\$b$V|$t4D$%jw#F)$DŽ$܌$,$$uIzGD$D$$&D$xT$$t$|$ ؋\$Wt$t$ Vt$|$$؏и$ݜ$H$LT$0L$4QAL$4T$0"7|$t%=s t$؋\$jt$D$t/\$t$ t$Oكȸ~D$t$YS[+L$T$ t$[ffffff̀ffff̀rS[ä+t[̀rS[Ä+t[̀rS[d+t[̀rS[D+t[USWV[(+|$l$ ED$t@UD$t#:D$ut$UW u1^_[]fffffUSWV[ë*|$l$URWG9U6W%M;OuLtF&t;tu5t;tu+t;tu!tf;tutf;4u u1^_[]Íz}m}0}PQjCR }m}0}PQjDR}m}0}PQjERS[Þ)D$QjpPZ[ÐSWV[l)t$V'uE|$WuO;r$vtuO9Nr w1^_[Í}}0}PQjeR.~}0}PQjfRSV[(t$t$ u1 ^[ÐUSWVZˆ(t$0~: $D$D$D$D$D$ D$1$ ك˃>ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS['|$   >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[<&D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Í%t$ >t0VS 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[$D$ L$t9u[Í~~~@~PQjpRS[~$D$ #L$t9u[Í~~~@~PQjpRtD$t&L$tu1u 1tÐS[#L$ D$Qss)ǀ[Ãuu ǀ[Í~~~@~PQjpRS[~#D$tL$ t 1[[ffUSWV[;#j O1tQ@@jjPPn (8t(W膝(^_[]ÐSWVP[û"|$tcOGQ9u0$jQPm >078t  G $GT$pw1^_[Í~~~PQjZRySWV["t$tRtC|$t3~t-0蘜~r4;~rPlVc^_[ÐUSWVP[ê!t$t@F$t*.1tt$Vt 9<$u1^_[]Í~~~PQhR(뜐USWVP[*!T$J $Ћ*1|t$Wt94$u|$ l$tWqE$F;$} $)Qtu<|uprP $كU|vx ux P t&D$j.PWV!tl$t $x D$P製L$QRPD$PWU  $t!QDl$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PVL$t$(cQt$@Ff$w-j4D$0$D3V3]mPW|$t$8t$HQj%蕐T$T$@t$$P6tt$6Pj%X$D$@9F f|$0u D$(8gt$|$u$L0V!ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRQo l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V蚮=~ $!D$1$D$$1D$\$|$$Rt1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<贬=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPH 4$ql$l$$T$8)ƒ)19s@Qq詻1$X;$(,^_[]Ë$LnRPUŎ 1‰(@m6m֍1PQhRfOm6mT$$1PQhR9T$4z?|$4\qUSWVT[$h>Wt1T$ T$G j(_¸hl$D$D$ D$$D$l$1|$ D$ l$Pt$ VNlǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tSPWkt1ɀ8 L$L$D$D$L$ t WPCtT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍPQhR]PQhRBOUSWV։[_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUx$T$ E ulD$;tM WE=t܉t$L$4QPt$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QP8L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR'WD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQVD$e ߋD$)D$UYu E;D$UOstjU|İ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q6VE0EEEe jU{1뙋t$uyb)EۍRPQjGRRPQhRD$D$ D$NRPQhREtfffUSWV [øt$@|$4u->FD$FD$\$jt$8x1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$D$ 14$O>D$ ^_[]Í}gPQ1܍$hSPQhRAqSPQhRJSWV[ |$t$tt9h(#WV ^_[Í$hSPQh?R证uǍSPQh@R艁룐USWV[Èl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í$hSPQhWR謀L;SPQhXR肀%USWV[xl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í$h+SPQh{RL:+SPQh|Rr%SWV[l|$t$tt4WV^_[Í$hGSPQhRu̍;GSPQhR~먐SWV[|$t$tt4WVJ^_[Í$hRSPQhR~u̍:RSPQhRn~먐SWV[l|$t$tt4WV^_[Í$h_SPQhR~u̍;_SPQhR}먐SWV[|$t$tt4WVJ^_[Í$hoSPQhR}u̍:oSPQhRn}ffffSV[mt$t$Vt$t$t$~>.u^[ÐS[.t$t$t$t$t$J[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[޺t$ t$ [ÐS[þD$t$ P[ÐS[Ît$[ÐS[nt$Z[ffYO ÐX/L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$;PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$4w;t$b\Gn߃^rxo;l$1\,, $* wkdT$Ɖ*t$i $* wi (Ћ4$ Wm;|$Yȃ|$ U(!Ћ$;PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$+{(^_[]Ë${ᐐS[>jt$t$t$[ÐUSWV([|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ rp0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[~L$T$ hPt$ [ÐUSWVT$[Bɉ$t$4|$ |$0t=D$0|$ "v-h1T$VPT\$u+t-t$0u#D$ D$t$0t@D$u20u- ht$t$Pt$k[ÐSVP[ D$L$T$t$4$VRQP5^[ÐSVP[̟D$L$T$$hRQVP^[ffffffUSWV[ÈD$|$(u-|$ "8u D$ L$(A0u ǀy$1Wl$,uP.7 E})Elj4$|$t$(VBU~6Wt$(V'7 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2atL$L$ ) $b(D$(H @^_[]F @4$utD$t0ٍ܅PQj@R\D$,cUSWV[˝t$l$|$ jW;WUVt$ jW=^_[]fffSWV[|8 8tf c8PQ( Džu:jUt.P( JGGG ^_[ÐS[( PQP[fffffSWV[üt$|$daWV0 ^_[ffUSWV[Ël$|$_+PQVz| t"t$UVh eVjjPT-W0PQV:| ^_[]fUSWV<[$T$PE$8FNt,$ @QP0,$NolȃFFD$$ gD$$Vj0 , Pq1Ʌ,$t$ D$D$D$ D$PD$TǍt$8jWPhVw=hV\`D$t}ƍ,PVb`tGL$T$RQWЃ D$ t2L$t*tBLpRjQPV"-,$V D$;t P_D$, 0 u QP4tj0 t$|$|$|$ |$|$l$l| |$||$|40 ,$t, t$ jQP!1Ct$QD$t*L$tt$t$уD$;t P_E;$8u^ȁ<^_[]Ík^&PQh~R&X_^&PQhRW8S[D$ L$01l[ÐUSWV[øt$,INtRQPWu~1 wxD$D$ D$džD$D$$ t$u;~F4U|uFDtt$auFDtu&u8tMt$ 7uFDt4$!uFDtt$ uFDXt$tGj t^_[]Íkw&PQhR)VUSWV[+|$4 118 t5D$0jt$4 9rԋ8 <.D5tDot-1t P<9tGGP$GT$JRWOk؆&PQhR)U4 !1ɋ8 I `QP" t84 Il$u}ml|44 t 8 1^_[]ÐUSWV\[øL$||$x$+|$x8D$8tvƉD$XW@ tgi9t uD$tL$HD$@ @ D$ W9$u8;< H< u(!D$D$@ @ D$ WtD$PD$xD$<pL$iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF :-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F :-00u҉u 11Ɂ<$)ȉ ^_[]USWVP[8oD$tQՀ:D$PtHǀ}:d$j"u1ɉPgDž1N 9}m>dNhPpBǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[ m88tĪW:ƅ~102jj!jPu W^_[ÐSWV[Ül88tĪWʠƅ~,102jj|!jPfu W艠^_[ÐSWV[,lhR=ƅt(T$jtV081^_[SWV[kt$08Vix08^_[ÐS[îkt$jt$t$[ÐUSWV8[skM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3@ 11uPz,R[ H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uV+T$iFH hFdNP(}m^1+dF JыV+D L\$jhY`QPZӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$-1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[jh8}tlPQ $_ u` {Dž<$}t+ĪPIƅ,$~,01K ,$|$1jPUjW/DžuĪP^_[]hmP` 蚜QWFUSWV[Kg88t ĪPyƅ~+01Rl$|$ u1jP UjW[DžuĪP^_[]ÐSWV[ìft$|$PQ6@ 1WP(t [ H(^_[ÐSV[Mft$L$@ t$P'ttp[ H(^[ÐUSWV[et$8 8t8PQx_ u` DžtA,PQ@@ 1UP't [ H(^_[]htP` xtW듐USWV[+et$|$l$PQ豚@ UP&ttp[ H(^_[]ÐUSWV[ûdt$l$8 8t<PQ4_ u` ͙ŅtQXl$PQ@ WP%ttp[ H(^_[]h/tP` $tU냐USWV[c88t(ĪP ƅ~k(0z|$1jPt |j&PQ@ jP}ljՅuĪPv^_[]ÐSV[ ct$D$ t|"PQ苘@ jP^[ÐSV[íbt$D$ tF t|"PQ @ jP^[ÐS[NbD$t@ PN[ÐSWV[b|$t$tF PQ蛗@ WP^_[ÐUSWV0[õaD$($,ɉ\$9ΉT$y |F 3&D$D$l$jP$PP$PW*|$t ֋|$ωjD$P$PVV*ʼnր|$t |$|$G D$ $DG~$,\$PjQ! G>D$Hm~{ р,uhF7dN-00tƄ,T$L,T$벽\$$8D$(;$,d0^_[]Ã|$61D$;D$!D$D,$DD$ iF9D$ u1t$*1t$~ D$ F $DD$$9|$tD<,iF9L$ tdFt$ dF)t$L$$ډ1щu1|$ F T$\$jD$P$PP$PZ(|$u.T$jD$P$P$P0(|$ʼn֋|$T~\$XSWV,[é^|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ PQ@ jPo|$x ,^_[ÐUSWV[ ^T$D$t$>O<4lP~;F~n|1ɉ)qt"T^_[]ÐUSWVP[Ê]88t+ĪP踑ƅ~"0 u1jPI4$t$|$t6BR lP~;yQi|1)΃<$uĪP^_[]ÐUSWVX\L$, $|$(t$$D$I4`P4~V|$ D$9׋|$(}=~_l$,qʅx\$ T$-D$ |$11 ¸u tF9)ǃ,$$^_[]ÐUSWV[ø[88tĪV܏Džt> 8 ujj}l$(D$$$t$\$@ `PT$$1iyT$ 9T$$}?l$(~fqʅxދ\$T$:T$ 11$ utA9$$)ƒ$\$t$VŎ$^_[]ÐUSWV[UZE$$fBt π?:t ?:uʀ/\$ uuPW%tjPW t)XD$ ʀ/\$ u#GH/t/1.tt:L0.uL0.u.|0/uD$ |0/u /u\$ m\$ hW-D$?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrL$\\$ PWQ D<\h@ W/uD$HhPẄ́ ,D$(W$dNL$<lPD$8l$D$L΃D$D$'D$0D$`T$a |$b L$cyρ ω|$,D$\T$] |$^ L$_t$ y ρ ω|$4D$dT$e t$f L$gy΁ Ήt$D$hT$i t$j L$ky΁ Ήt$D$lT$m t$n L$oy΁ Ήt$D$pT$q |$r L$st$y ρ D$|$2L$4y D$m =b Z N F : D$,. =#   T$ ZD$\$DËl$,T$RA,9D$( D$0 D$tSD$tl$΋\$ L$H)T$(hT$,RVQ7|$'L$  Ƀ RD$,l$t9` D$4t9P $L$L$HPx D$D$uT$ 1|$t71tLT$ ׋\$t$ى\$9\$D$u.W w O$yn΁fW w W w W w $y G  ΉD$Ƅ>T \9}$9։$D$Ƅ>9T$1>4$<t>n l$m^9}$l$9u1t$t\$ \$\$ l$ $A|$1l$كV N Vy с с4$dFOiFWN 9hF9ʼny\$ l$I 1҅t$Q˃1rO̓1$t$>8dNT>8eNT>8fNT>8gN9ut$l$t(|$<1t$./9uŋ\$ 1 \$ t$1ҋ$ƄfNfDŽdND$@1ɋD$8D$01ۋD$ /9t$DT$0jz T$09L$@<L$\$l$ك|$u/V n NyńfV N V N V n y N  ͉ ʃt$ t0 ֋T$ \ ƋD$ TyӁ ӋL$9l$|$T$999^T$@\$ l$$@1$ƄjF9t%|$,tҋ$jF1$ƄkF9<|$4tҋ$kFЋD$xWe}t$D$(0WC}DD$y$,$L$(OF|$H ;D$H| ,{$XD GL$I\$ 4$F\$k $`1D$$|$ D$$`9 4Ƽ|$~'1D$<\$ VPtt9u|$L$)ȋ\$ PV"L$wՋ$< |$ʁdNPVRω D$ƄdN8D$9D$$k {|.;>:;>u{O߿$iK$\D$1$;T$|$lp Y I|$8,~;uM}|1ۉȋ|$p$~L9t }}'tDC;>{{eCl$U1Ƀ1ɋSrs̼  hFdFSrs  hFdFSrs  hFdFSrs  hFdF9at6 ́ 1ҋ,$s~{<ы\hF$dF9u؃{t1D$l$E;$uD$^_[]Ë\$ 躲USWV׉[LtK<t0鐐€Ѐ r<r Au)ōF=T$H\$B$D$D$0OD$,~ T LL$,߉ ɉT$(D$t$l$ 1҉L$$tQL$L$01ҿxPL8t8l8t;L;l;L8t8,8t;L;,;9T$0uƋL$t4 RdPhPlPdPhPlPL$IXPL$0\PD$\$l$ t$D$,D$,D$(D$0D$\$NfG0t> $<|$HL$1QK>GGD$D1+D$HdFLJhFLJlFLJpFD$O dNVUP Ƅ7dNL$DeNQt$ Vl >D$Ѐ rՀr quϋT$)T$|$DG=Yt <,t<;$D$HD$P9ua<;t<,!T$T$x\$8,T$d\$8l$ D$DD$LL$AD$HD$X؉dFǁhFD$PD$T؉lFƁqF$pFfǁrF11ɉt$Q<$t1;kd)ui)$\$i8p/9T$(L$,} $qyՉt$f1Չ|$4|$T$(L$@l$<$D$8t1)i)\P(\T$(w = ףi8Ql$<L$@pD$8@$p 9ՉD$,|D$8p‹D$89Ћl$ $MT$T$P\$k\$T$1Č^_[]ËL$D$49|$T$`͍T$xt$XlljT$dt$TXl$t1,$,i)\P(\,$w  ף\$i8Q9D$#|$\||)9I|$$D$4D$<t$@l$<$D<$t<$p;D$(t$,|;L$\t$>>t$l$ D$4L$$L$<D$@L<$Dp;;L$(D$,t$|1D$ $T$#> $l$ t$L$ t$L$|$$D$$T$4T$<D$@p3|$$u;|$0T$6D$`-G|$L$$Gu;lFpFhFdFGL$L|$ol$ t$L$+L$8L$LfGUSWVՉ[7D +t -u 1̀Ѐ 14ɍ4qЁH̀Ѐ rׅiu8:H̀Ѐ |1<ɍà1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށƔ1i4Q9uB ^_[]ÐUSWV0T$ $XQ>D$T$Dt14@lP~YrJ<$9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$98l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ˜1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[.7` PQk_ [ÐSV[6@ j}tqj^[ÐUSWVT$4X6D$UE1yY\$t2ډ‰k<)x\$$t$$<\$$\$Q T$QT$ QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[;*l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í ӇPQjFRq ӇPQjGRj|$$b: ӇPQjHR@>ffffUSWV[;)l$t$|$tU6^_[]Ír;PQhRʐUSWVP$[(t$ ` U[t,jʒtPx $Hp ,` ,` 17"@`  xuxt)txu8u밾U[^_[]Ã듍;PQhRKUSWV[' ` D$ PZ(` ,` ,` $0` L$`b L$ǐ|$$tD$$9G t GtO,`  tGwЃ GЋ,` 9t,` DžuZ(` u';|$r$;|$s<$$<$C<$1(` t$ Y(` u#t7WQu^_[]ÐSWV[Ì&t$ ` W9Y"@`  xuxt&t xu8ujLu $p@@ ,` ,` 1WX^_[Í;PQhRIfffffffUSWV[å%$$$$$tD$$DŽ$DŽ$ $$jPW$@jPuXDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPRhr]PQjQRAT $ ;$u ^_[]踊S[$ht$t$Pt$t$7[ÐSWVP[#D$L$T$t$ 4$hVRWQP^_[ÐSWVP[Û#D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[[#t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV["L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[}"D$ L$ $XQPRv[ÐSVP[L"D$L$T$$XRQPV`D^[fffffUSWV["T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQK֍ PQj=R:׍ PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]Í? PQhRL$8AffffffSP[D$ L$T$$RQP[ÐSVP[ìD$L$T$t$4$VRQPA^[fffffffUSWVP[jt$|$PV1sht$t$ K x=|PsLfF FfFfn vF$F,F(F $tjjjV|^_[]Í_PQj>Rq)ffffSWV[l|$t%jW聼w jW}^_[Í݉PQj;RfSV[ D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍPQjL$aD$D?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P \$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $DXD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $4xT$ L$D$n6 D$0 L$ I $4T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P謈D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$4D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q֘,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$Pt\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$ $PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $8BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$ $PQhRUD$뀉׋$8G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$ $PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$(B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$ $PQhRBU|$뉐|$UD$xT$ Ӌ$(Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ`t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P<E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $POL<^_[]þUSWVP[ÈD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [6D$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$J$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }TjjD$܋lT$\$8t$<EΉ7tƉP1t?D$|=WjP0 )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[Wl$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[Cm|$hE t$p |$<$ MM$Uhjjl$l$܋l|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[àEx\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃Ը܋t܃|$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ظݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃ܸD$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQUm)$t?$L$U.$1xL$^_[]þTx0ffffSWV[t$|$ty8L$tu1 1 ^_[ÍPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[ M1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃Ը܋t܃|$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك̸|$tT$L$؃ظݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nك̸D$!؃|$8=؋كT$8؃ܸD$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[LD$1r 1 9vW<t8Ɖ^_[ÐSWV[D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[]D$ PHpR=^[USWV X(T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[^FSVH[5D$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQj.D$$D$ D$D$D$D$D$jPj-\ j[j[S[NjS[.fffffffUSWV[ t$|$tK1tt (h1^_[]ÐUSWV[@}uuI!\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋxt$(PV'T$4D$(YPV'uD$(D$D$9L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[]c |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[sbu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[Ëat$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX`ǀb ǀb fǀb ǀb fǀb ǀb fǀb USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[|_D$H~( 1u 9r1$PƉ^[fUSWV[_L$8?tPÑ wc t{c ?u1>PƅD$t/Fn?tPcFF ^_[]1?tP8P d )ʉʁ oΉPoUSWV[^t$tbF!r VO8}t3W譐}Fc c tW苐c c ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[]l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UuE!r\U_18}$P]}T$,Bc c ti4$5\8}th$P1}Fc c t14$$c T$, c D$TG^_[]Ëc c 1␐T$1Ɂsrr@r"y(6s@sރx @tS[^Zj,tL$H@[ÐUSWV$[(ZD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V?Ec Mc $t#VȇD$c Mc $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[hTD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [óQE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[N$t|1q15UPQjERx P$1D$jjWk{ ʼn$tƒ9tt#D$PW6to#D$=uT9tVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[ÎMt$t$jt$0[fffffSWV[\M|$t@jWqGHO~ H0 WjWR^_[Í!?PQj=R 럐SV[Lt$ t%FHN~ H V^[ÍnjPQjIRy ffUSWV[{Lt$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) p1^_[]Í ՌPQj>Rw fffffffSWV[lK|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0hG0ǀǀjWG GG:V PQj8RW f  ^_[f̀rS[4Jt[SV[Jt$ t;F0u ǀVNuFH^[Í]PQj;RfffffffSWV[ÜI|$A8u%GG Ⱦ uuL  O @G0taW@9t QG0GG81t&WhG GGfG u WG t'DV}ܷPV|GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍύPQjJRSV[Ht$ tF Ш u Vk1^[ÍٍPQj;RSWV[Gt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWP趈6@VRQWPL^_[ÐX/GL$AA A AAAÐfffffUSWV[F$u hj萺1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVp VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCoo(1V艼(1^_[]14dž$j$֫tJp0$rPt_t u8~)1 9}8tQ豹݋t P\lV茹t81^_[]ÐSWV[ü>|$tOWB^_[ÐSV[}>D$ p|$s t.jt$ 1dž,dž,^[S[>L$tAt[[ÐSV[=D$ p|$todž,1t$t$^[ÐSV[}=D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[<l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNC"׍PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $w~Pύ"֍PQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[9|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[X9|$(o(o(OG0!D$;G9} $wD$D$ P!$L$L$D$QPt$荠 $L$QjP t$U$D$ Gjwr $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wi ^_[]ÐSV[8t$ t$t$ #F,;F(~#F0^[ÐSWV[74aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrΎĎPQjbRrUSWV[x&D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]ÍΎĎPQjbRPfffffUSWV[{#|$oEtjPu7 EjWu,EtP輝E EtP蛝DžDžtPtDžDžUQWHVP^_[]ÐUSWV[x"|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[m!D$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_ D$tL$ P1\1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[8 L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$ΎĎPQjbRT$(L$?ΎĎPQjbRZT$D$ΎL$ ĎPQjbR*D$L$_yffUSWV([D$i |E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$|D$$t%ht$WP+ $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j=ՍPQjXRgꋌ$!1Ƀ8cfffffffSV[=D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[D$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]ÍɏPQh<R0j$jU0 볍P"VUSWV[$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4X8D$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$sPQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$sPQh|RƐ\$T$\$ΎĎPQjbR蕐\$T$\$sPQhRa\$T$\$sPQhR-\$|ffffffUSWV[|$8D$,hEtjPu_ E wJrr G&E(uI1GPT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZcΎĎPQjbRɍIΎĎPQjbR虍w8ΎĎPQjbRn;E,jjuK[ ǍΎD$wsZtvG GtfAjWu\ jVuZ DžuEĎt$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tΎĎT$ PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPFE EE($}fu E(jQt$xsB tt$t$jbP臈эΎĎPQjbRdD$ΎĎT$ PQjbR8D$T$ǍΎĎ֍PQjbRUSWV[|$l$t$FtPCF FF($nf~ F(^_[]USWV[æt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7ΎĎPQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU ҸˍΎĎPQjbRR!fffffUSWV0[Cu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍ΎĎPQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$ΎĎRQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ ΎD$ĎD$$D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$PPPPP |PxPt@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^L$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Þt$t$t$ [ÐS[nt$ t$ F[ÐS[NL$T$ j[ÐSV[t$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[}t$ tAtj@PV{D FPhjPHm F@FDFHFL^[ÐS[t$t$t$ [ÐS[t$ t$ [ÐSWV[̫t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[MD$$&ydḰ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <m 1D$D$ D$D$L$8T$jjPQjR8tD$8m D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$0vL$L$#L$?FL$NL$fL$~L$őhjjjPQRCD$L$8T$jjPQt$R7L$81 uHjPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR6t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR6D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$R 6tD$8he^_[]fffffS[ [ÐUSWV,[ȣl$@D$D$ D$$D$(L$ D$QPjh WI1|$D1҃|$H1‰|$m 2m $m ,m 4m NQ;WvRPTt,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [èT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[øL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[è|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[t[̀rS[Ęt[S[ît$ t$ jt$$t$$t$$t$$t$$  [fffffS[nt[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[ø$D$D$huLET1}8XM4tI$P|E8*$$E4E0|$ 1D$L$j`QPu8VR(ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$||$ W L$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U@ !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PW h$PW U|$|$Tt$h$PW |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP= t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP* t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QPw t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tPBA$$t Q"$($,uWPl t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP: t$$t$$tP?$$tL$$s.SWV[|tM΋uA~8t:~4~"`N4F8 I9rPF8^_[ffffffS[D$L$ AQ jQ0 [ÐSWV[ü|$t$t+jP6 tH  W6,^_[ff̀rS[Tt[̀rS[4t[USWV^$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLX(D$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq91pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[gthGt tww$Ѓ gpNjPQw蕡;u<tww$Ѓ 4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[LoD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[nt$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[n|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPgT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍؒPQjGR(T$4ؒPQjHR}(T$4USWV[{i|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW<lP=W"1fu- O @1jW^_[]ÐUSWV[Ëht$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]Í%PQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ft$8uN uRt8F0t~@9tRIF0N FFfN ~u VkN u1uVVF11+NN^_[Íd.PQjTT$B=sD$ DP[Í@[ÐS[ST$B=sXDP[Í[ÐS[îST$B=sD$ DP[Í[ÐS[^ST$B=sXDP%[Íf[ÐS[ST$B=sD$ DP%[Í[ÐS[þRT$B=sXDP[Í [ÐS[~RT$B=sD$ DP[Í([ÐS[.RT$B=sXDP[Í28[ÐS[QT$B=sD$ DP[Í:[ÐS[ÞQT$B=sXDP[ÍD[ÐS[^QT$B=sD$ DP[ÍL`[ÐS[QT$B=sXDP[ÍV[ÐS[PT$B=sD$ DP[Í^[ÐS[~PT$B=sXDP%[Íh[ÐS[.PT$B=sD$ DP%[Íp.[ÐS[OT$B=sXDP [Íz[ÐS[ÞOT$B=sD$ DP [Í[ÐS[NOT$B=sXDP@[ÍX[ÐS[OT$B=sD$ DP@[Í[ÐS[þNT$B=sXDP%[Í[ÐS[nNT$B=sD$ DP%[Ín[ÐS[NT$B=sXDP%[Í&[ÐS[MT$B=sD$ DP%[Í[ÐS[~MT$B=sDP[ÍĖ[ÐS[>MT$B=sD$ DP[Í̖C[ÐS[LT$B=sDP[Í֖[ÐS[îLT$B=sD$ DP[Íޖ[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[4Kt[D$t8t9@€tuuuuH+D$ÐffSWV[J0t1jWQw t u1^_[ffffffS[nJPt$t[ËD$ĭ1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[ËCl$$t$|$t9t5D$,tL$ z91Ʌ1^_[]Í$ ͟PQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[ýBt$t8D$ t|$tT$t121Ҁ9 11^[Í@͟PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[õA$Љׅtϋ$tkRWPQ$$$4UhVH$yPVj3l S[.At$jt$t$PUSWV[A$$$$LЉՅt$ tk$RUPW$,$<QhVt$Lt;l$VPQhUJPUj5k LtWD$ hjP' D$D$DŽ$DŽ$  L$VPQj@L$;$^_[]ǃL[PL҃¿+w狔tу̃ǃƒӥS[.?t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[ê>D$ D$D$$jVji m uƃm tjljj0jVji jIjfffffffSV0[ >t$̀rS[T<t[S[><|jPt$t$t$[ffSVP[ <D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[Ä;t[PS[m;[fffffffS[>;88t3[Ë[ffff̀rS[;t[S[:j1[ffSV[:m u#m V>uP1m ^[Ðfffffff1ÐÐ1Ð1ÐX/:PÐ1ÐÐUSWV,[9l$D|$@o |ƃ =sdfo Fw%$o =uɋo 뿐o QUhWL$L$뀋o |$@l$Dt1o t& 9s8u+po ?ƃo #D$D$(D$$D$ D$D$D$o D$o D$ o fD$o D$D$Uj(P׃8^_[]ÍPQhR]fffffffUSWVX7$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$D*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$F8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$FD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$FD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$ޢPQRt$4K0 D$D$D$t!XPjj Qm180D$W议htD$tXVPQ uV3D$D$4(f8y0D$t$W8YPQRt$4E0EP2D$1ߋ] D$480D$t$W蟭ޢPQRt$40D$kt@\$ XKWjj"PөM9\$ WPuud>u|$ V1|$ EP]wm4scD$t@XWjjPGM9\$ WPuu=EP1]`t~D$D$D$ cMTtXPjjQ躨uV0D$1D$D$D$1D$D8ut L$$ȉƊFD$<t1D$,<tL$,CD$HE D$ENL$DD$<D$$t$LS8EP/|$6L$u/D$46D$ߋ]t$L{D$lL$lQ$QP] x]$:FuQ<t <uI$f;Fu;$;Fu/D$f;Fujt$H$PV] tu/]xusEP.FjhPP~ D$EN|$t$,VEB  Et$<ƉL$ QP_[jD$$P$P$$L$\D$XVt$$P$$L$dD$`jD$\PE? ;D$$D$fD$ fuPVE@ sL$ f)fL$ uωueZfD$8;u~5D$D$tX`PjjQFEfL$ f }\$ PWE%@ fL$ f)fL$ u̓|$|$ tOEHL$8Ef)fL$ t6=rP$PE? ~L$ D$M f1D$uEa XWjjPVM9\$ WPuu8SD$08D$VoTPQRt$4D$t$@D$u`!u(X!PjjQ蚣]D$u a t-L$@U9ȋXQPuuV 8|$D$„u%uu,+])D$@Puuuu t$hуuE˅R@u*]C L$h9L\$ ;D$00)8D$t$VPQRt$4]8uVJ*߉D$D$4yD$80D$t$W|GPQRt$40뒋Ճb8[0D$t$W1PQRt$4'0D$4ߋ]D$4 D$$4$4$4$4U$0R&U׶=r,j$ G;$u;^_[]Åt|.u|$GbUPQhWf,hffffffUSWVX[x$L$p|$lGtG,t$x9t$|89ePVt$|UQ$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$AxnNj$L$|PQF$L$xPL$QE$ǃ$fB$) $W 9$A A L$|PQ|E$L$xPQaE$PjlE$PQ5E$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPr@ƅxՍ7Pj D7Pt$D7PjD7PjtD$ 1۸$IUSWV[l$ |$t$D$@tP ) l$$FPj)CF|PQCfFD$@ u1ftP VPCVj{CG fffG )^_[]ÐUSWVP[*l$0t$$T$ |$D$@tP T$$։)͉ $9L$(B99t$4D$,WPBGPl$UBGUVP誔L$4 )΁r&Ӥ¤PQh=RCL$8QP_B+l$ ^_[]fffffffS[jt$ [ÐUSWV[$ $D$0$jUAEt U uEEEjeU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhetkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU;@D$ djVU :PpƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w 01҅tމ8D$ Ϲրwr tt$$D$ ^uPd tPǍ$WhhPE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #Fj P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w A< vhQt$8 ƅ_SPt$NnD$ kc$< t< H$< w&8A< vhQt$V襇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tQPVDa< D$<@@@@ @@D$@D$8jj5Pj j$PͪD$PD$;t$ s E$EtJ;P EDt%uH`PWu퍃aPgPrftuV[ML$0 ;$u ^_[]VUSWV[t$xPdžft91 9s)tQDŽͅtMtt|%X9utxt PWidžtPidžf^_[]ÐUSV[Euo jP,_$D$F$FrWfF e^[]ÐUSWVx[cEL$ L$puo D$jP^D$3D$fGt$VjWV VWGL$ ;L$pue^_[]zTUSWV[t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[äD$Atst$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ j PV¡ ojPV訡 &j PV莡 [xj PVt &ljPVZ   jPV@ jPV& j PV IxjPV jPVؠ jPV辠 'jPV褠 0j PV芠  MjPVm jPVS $`FP5d$/FP|Gt^GddGtAPt$'F Pk|GGt˥PQH7< < {$H׋$uۥt$0UP $lP 뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]lPV-T?r?D$PVt$y D$L$Ƅ|$lPVS?r?D$PVt$Ry D$L$Ƅ($H^_[]ÐUSWVx[h$$l3o h3o p;o t|P9h@GtP|x$D$D$%D$ D$D$D$DPjjjQtOtt.DT$,p t{NDDDDD DDPp .j3,p tǃPp ǃ0p ^[ÍUSWV[Kj0_3ƋD$F PB3FF(Ff~FF,,p t 0p 1ҋL$9u<0p F(,p th0p 9tF F$F跋(,p 0p rLp R4p Dp p 8p ^_[]19u뫐S[ÞQPR蚦 j SWV[lt$8,p t30p 9t^t,8p 4p zLp ,p t70p 9u 0p ~t v@V@^[19uΐS[Nt$?[ÐWVX-L$ tsAQQBQQAA,,p tD0p 49u40p 4~Lp v4p Dp p 8p ^_19uSWV[Ìt$trT,p 0p t/<t)8p 4p zLp Ud>t=G0p Dt,HLp @4p Dp L p 8p ^_[]ÐUSWV[[|$1l$|=|/j0F-ƃx hh@x@@@(@,,p 0p t.9tRt#8p 4p zLp Dp t$ lPQjS[ffffSV[t$ tjV]f jV_^[ÍǩPQj5R}ffffffUSWV[Õ$t&j$$PI$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjr蟌Njh$t!A3APjhjjUt{Njh ʁʀ $4$jjjVod!ƒu.8u$$! P΁(p$t u|! D$$Pt$]-D$| $WRPt$m @ &l+3((ɀ GGDG G GGGjjuH tTP у1uP VPuJ $tMtH! u?jUu.b(W$t 4$=(1Ġ^_[]À!SV[=D$ pFtjP6I F!u^[ffffffUSWV[ۺt$ D$hEtjPuI EwL$8uL@E(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUa !@uEIBj7uH 1WUƅur}$O^_[]ffffffUSWV[kt$ D$hEtjPu#H Et}^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPUG !@uEj7uG yUSWV[Èl$(9s$QPp-D$ L$t$;t$,w D$,D$1;t$t$jt1tK{jutWVx $$t$jD$PVU7u&<$Q;t$,s!^_[]ÐUSWV[8L$,|$(19D$t$ity;D$touF$WV+)L$(žϋ$Eit ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$6L$uu D$,91^_[]À!USWV[t$(9s)QP*$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Q v $jD$PUVf5u;l$,b1 !^_[]ÐUSWV [èL$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,4u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[۳t$D$xGtjP7B Gt\u^D$tR;wUjPW, t=(@PUW 1PU72B ujG(uw^_[]ÃtRG$jPW tՋ(@PUW? 1PU7A uG$ 1랾뗐USWV[øD$$L$ l$DA4DtFPUL$(>A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍OCPQhRoL$4T$0^ΎL$ĎjPQjbRioL$T$0zOL$CPQhR6oL$ffffffUSWV[+t$nEtjPu> EjVtE 1t u1@u)&d1Ƀ Vt^_[]ÐUSWV([ht$@l$<}GtjP7!> G ujU誌0 81qujWjjj V 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[{|$ t$tGw#jP_"džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP!t2MQUQRP4 EG/1^_[]ffUSWV[H|$$G,D$$jj79 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$ΎĎ׍jPQjbRi\$8=$oD$L$,td;l$tX14Eju7{7 t%MLH4jP7N9 ;l$uoL$1 Gw)f_ ^_[]ffffffUSWV [(|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RU $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍPQhRgT$믐USWVhXȨD$|$|G =tŋ\$jj$WO{$jj$W+\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$wo ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WwO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhTRAbT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhRa끐USWV[ÖD$lAB9w}) >P2Q' D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p jL$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$ϫj1PjN `1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V1Ʌt‰ D$0L$ЃVhPl[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$ PQhRX\$T$ D$4@USWV[ÈT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UxT$ D@jf!P=tfOtfO1 NjJDHjWPVVi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$PM L$,1T5MGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[zA =tl$$G)B fT$L$D$ uf͋t P],$Uj|$(todž(dž $FDGjRPVgtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PV}f t׋@f8u$dž wSWV[Ì|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[6T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQD$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[t$0l$$D$jPj |$dŅtUEfxuftDfA |$H9vjWPVtl!|$, $tt$L$E,$ύL$ WQPVD|$u( t u~$!jUWjV"^_[]ÐUSWV0[Èl$Lt$DD$,9EvHD$PUV D$$D$D$ D$D$$ED$(D$ D$$ D$ ,$T$Pl$H9¹)QUV [|$xD$Ptu,$<1L$DD$H9,$vPT$RQT$ ,$uBj)N|$9s6WVt$t$ jRl$\U0ƅ|$1f9l$s*yL$)ɋT$zQPRL$ fAA)fAfDy$΋J L$ LDr2PT D$D jV0U 1|$;D$,uM0^_[]jRD$L0, ׍Ύ|$ύĎjPQjbR<|$ fS[}1 uOƃ1 tt%<9HuHP 1 @[fffffffffffUSWVY|T$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[ |V'jV ` VP|^[fffSP[{`b u;$ `b jjPQjRVt<$ t ǃ`b [ffffULՑܑnnnnnnnnnnnnnnnninnnnnnnnnnnnnnnnps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20260325090945Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrormore than oneexactly twomore than twoFor RAID level %d the number of columns must be %s. usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V]'' is an empty string is a shell keyword is an alias (multiline)... for: is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260325090945Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSKBytesMBytesGBytes%-*s %*s %*s %*s %*s %8s %s DeviceBadCapacityPriority%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %*s %*s %*s %5.0f%% Total%-*s %*ld %*ld %*ld %*ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform commandunterminated regular expressionexpected context addresswhitespace after %sduplicate label '%s'\ can not be used as a string delimiternewline can not be used as a string delimiterRE error: %s\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthundefined label '%s'unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] %lu: %s: %sfirst RE may not be empty\%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freearg != NULLdisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemoniseSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.3.1 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 starting%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: send%s: waiting for an %s addressconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceEXPIRE6EXPIREalloc_argsRECONFIGUREdup2 %ddhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with itpid %lld failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too big/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeincomplete truncated typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nametruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTDEPARTEDinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: %s acknowledged RELEASE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist