08P%i'&<  '%iQP''`'$. $.%i'&P@@<@T 08P%i'&<  '%iQP''`'$. $.%i'&P@@<@TU %i`'$.yA%i%i%iQ$f %i%i%iRA%i%i%ieA%i%i%ifA%i%i%igA%i%i%iA%i%i%iA%i%i%iA%i%i%iA%i%i%imKpS%%i%i%iX`hpx$%i%i%i (08@HPX`S$=%i%i%ihpxP${%i%i%icQ$%i%i%i (08@HdIA%i%i%iC%i%i%iA%i%i%iA%i%i%im<%i%i%iPX`hpx\$%i%i%i$%i%i%i$>%i%i%i$%i%i%i$s%i%i%i$%i%i%iA%i%i%im %i%i%i$%i%i%i $%i%i%iA%i%i%iA%i%i%iA%i%i%iA%i%i%i$`a%i%i%i (08@HP$%i%i%i$%i%i%i$%i%i%i$%i%i%i$%i%i%i$%i%i%i$%i%i%iA%i%i%iA%i%i%iA%i%i%iA%i%i%iA%i%i%iA%i%i%ihJI,R~#LHG3'^T@DYMUe#ې]sS6|Wؘe++RK r7cі:Qx5c' k{}D]8k&KXfJam!$. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4PP%4 (p"p"pp}$22xx TTT,,}$22Ptdp(QtdNetBSDKwGPaXU SR ffffUSWVP[O.t$$ujPjjj̊j0F $ux& Q/tuITuk;(s(9rD$t PI2P:2;s9rHP 2$06v@ P+-USWV [ÈN.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]USWV[ûL.; s' ~*u.UE9r^_[]SWV[lL.;s9r^_[f$SW&L.5u1ƃ5$tЃ tX$k_[SWK.4uYƃ4$t|$X<$kt(?t<$ktЃ_[WVD$0tP>tKj/Vt@Ƹ!q"&PV t&uVhp"hp"h3 5^_`SWVhp"hp"h34 1۸!q"&P CPrFh3j f?whx%h34 uh3j 7?j )D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5t3 u$1^_[Vhs"Vhs"; 5p3hs"j\wVhs"jUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S& tutD$D$$D$% D$t$@N D$l$hx3hm$)D$ @l$0tD$Ph$)j (D$  |$\$4t$,s$L$)L >QPhu"C) D$  L$s()@L$L bQPhu")L$ D$  s D t 4X&hu"(L$ D dtPh v"(D$(@9XU>\$D$T$T$9tt$N9BD$4X&5p3h*u"t( 1h^_[]t$|ht"3%WS$h>u"h[u"jeU5p3hyu"jzt$|hs"5p3hnt"3$hu"jhc 5t3p u15p3h-v"j$SWVPD$Hw#t$>8&Wt ub<&$h"s"Wt N1AQhc5t3 u 1^_[5p3hBv"j菧USWVP|$t$7Dh>s"WV, fu l =p3u 3)u p3uhAs"Is"t p3hjQOu t3u 5p3hRs"Ih{"u3$(&SUt uUh{s"j聦h[s"j襦$NPVS& P\V 3PhVv"V( Vjjhv"&&hv"h3( uj5t3FuWVοVx&tuVhs"jĥ|&^_VPΉj PQ̢ x $9u^Vht"j若WVοV&ftuVht"j]t&^_USWV\$$103 ,33 3sVj=Pmx<$hjjh@&U L3H F H L3VP3uL3t;#=t%{ L3##=uthRw".L3tttjut!tcuL3H ܏3^_[] L3jVhv"W Whw"4$hv"4$h"w"jգhlw"hw"D$L$011PjPjt$h{$蜎03,3331PjPjt$hw"l33hw"jQ1hjPPt$hx"8331PjPPt$hx",2tVjL3u$1PjPjt$h)x"܍33ËD$ȏ3h:x"j跢1hjPPt$hPx"融ԏ3Џ3h\x"j胢L3u$1PjPjt$hsx"d03,3ËD$83hx"j?1hjPPt$hx"&D3@31hjPPt$hx"33fSWV3t/ 33 t53)փ>8F u롨333 3 33;,3 03r*jU333 3 33^_[á3 3 t 3 3hR&hm$j'hR&hm$jhP&hm$jhP&hm$jUSWVt$|$6q>$r#SjSVW趨 u=3P]ȏ3u,ȏ3$̏3؏3h&Ahx"ju؏3h&1QQPn ̏3y 5ȏ33 3 =,2rď3uhNy"롡83u#<383y"H3h&1L3HH3h& hQP3n <3yJ1L3H H3 hP583Q <3 43y 58333L3utS1V 33393rZ 3t= 3 ,3@ 3t# 3) 3I ,3 3ujg3 33Џ3 ԏ3t @3 D3t L3h`u;5@3 ,3=H3 D3503VP5<3W L31Vh3fhjghjX53535 33hԲ-,2`L3t%`3X3 d3 \3;3 3ss$3 3tQj QjP ؏353535̏3P$ xd53-31‰1 3 3=3 3X3\3=3 3L3 ȏ3xPhm$ ,ď3u6؏3j53535̏3P  t5ȏ3hm$ܘL3 33 33=3 3X3=3 3\3CL3s 33=3 3`3=3 3d3u@s)t33H 3PQQJ 33܏3=3 3j133133hzy"jsPhm$j薛WV܏3=t=H=ju <N3 3 3t;,39щ503s))Rj53V 03 ,3 3 3 u\5T3=P3 tJ5,3j53 03 ,3 3 33ʉ3)Ɖ=P35T3 t jY=<3uH3jPu m8u*H35<3Pt^_ho#jchy"USWV,3|$,t33(p‰D$l$|$,u N3 xT$ T3P3 t!H3jQP5<3R !ƒ~t$VSh3 $~ D$ `18D$ Z T3P3 ʋ-33t>5035,3QPe33h3l31T3P3T$<$t$ 3-3l$13L$ p3t3D$11 43t,3u#3583h y"$#T$43L$ AD$)ʋ$tЃ|1@|p9@|5P3T3*,31 03T$1 uKh3l3I$T$ 33)ѣ3 3503-,39p3t3$ t 3)PQ53趡 3133 33 t(p3h35t35l3QPVRy tjh$%j3d$^_[]583h/y"583hx"583hx"j583hm$j-USWVt$(|$,\$$Uh3j+d C4WVs(P( 8jUjd 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"j蕖V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$hm$jVP^9v V膡VPQ訦 t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV3 3t/jh2#jra 3 3tjh2#jTa 1t$PV脦FȺMb׋ 3-։+3D$H 3iى tL$ 1FD$|$ 5t35p35l35h35d35`35\35X3hy"jdW,WPWjk` 33 t?ƒ ʺ%t#RQPhy"jd|$4WWgPWj` |3x3 t?ƒ ʺ%t#RQPhy"jd|$4W`WPWj_ t$ 33 t?ƒ ʺ%t#RQPhz"jd|$4W WPWjw_ 3D$=3jPt$ t$VgÉiL$it$V)QPcRPVSt$Whz"jdt$@V$V=PVj^ e^_[]EVt$;V!VjfUSWVď35Џ3=311C؏3W535̏3P$ MtgM3u5ȏ3hm$詍؏3W535̏3P$ ݅~ď3t )u=3N{T,2rOH,2d5Џ3 3=؏3 ԏ353jVP5̏3W !ƒt^_[]hQz"j辐5ȏ3hm$jܐWV43uD5@3 ,3=H3 D3503jVP5<3W !ƒuuJ@3 D3ti11H35,3535<3P$ ~J;5@3D3r,f @3H H3Phm5<3Q xw^_xof@ H3Phm5<3Q tD;5@3D3s5,353h3 3,33 03 t583hm$j臏fUSWVX $p $l 7,h$r#j:jl6hkz"WS H-$&333@33333333u3i33S 3G(3; 333$333,3=03-l =E=3u =M= 3ui $X0>Ph#h3_ h~"'0Ph#h36 h~"N^_[0Ph#h3 hYI&hN 3uá3u tjwGjFUSWVj%Ƌ|$11K< @u=l3t?jj5x3  5x3:p3t3l35x3UjW= A)߉np3 t3N F5H3q0\3H3-p3F t3j0菱Ph#h3 hYI&Mrh "]1Ht3p3(0MPh#h3n h"'0$Ph#h3E h~"LV1^_[]Vt$5H3q0F\3H3^WVL$ 35|39})=\379}>\3829~vRO9G9~-82X3~ZX3΋Nu#82)Ou9~82RN982 |3u 3uu82^_É1jDjDVT$X3t=X31X36X3t@9uхtX3uhN%hK1^SWV1ȑ3t3j?Ћh"a."tWmt|8/uWh4"Wh@"h3' 3tLPUt$hg"P`x31ۅu@W,H53hm$ uj"jtM"PJV ^_[Vx3tAPcxGx33t!P53誔31l3t3p3;53:0_PVh&h3h"I^Vt$x3t3P3t!P533Vjh 3hЅ3 "x X3X3\313@=ujuSVL$D$ T$t$33533~A23BI^[fV13333PwsP>ff3Fu^SWV53953t$3Vjjh3ut=333jjPPUth"hm$[H303@u3=3V>tVPOG~*h "53r0h"hm$G1N1Nyh/"hm$G53~3H 331H^_[Ë 3u!T$73313xD$Q331HSVփuU303@u񸠑3jjPPiTth"hm$G3 3 33aˍ3)Qh3Pm 3303@u񸠑3jjPPSth"hm$FVjjh3^[Vt$ 3u3313x 1H^USWVh"VƊtx<0uFD uh"hm$$EGuȿ|w WjPl 1T L ш @u3hjV: P@1Fth"hm$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$T& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPX3 t uh@"XC^_[]eC$tX38u@X35T3Nj-T31;-P3M1WtÃ=t3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-P3|1MV31535đ353535353 3u 3uu ^j:jq;V53953}3I3P53tC533 3u 3urufL$3r53 1^0Ph#h37 hYI&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P 3đ3193@u 9uđ3SkH3 t$$PPh,  $ @3| t %܅3ڃuh2#QUuhq"QjD$P 4Ë $39}=3]39|A‰T$R53 NjD$3=3 3u32$@PSWx =X3?5ƅtH3VPP,+ X38uK=3뜣đ3Gh2#5X3zt:jPDžZ"x Q:? ^_[]Í|$G0lPh#h3 hYI&> 3u3utj8t"j&7WV 35đ319}'3FىDuw9@u1=đ3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEh32#PlUT1h32#PÅt*t$Sǀ}!u?SU=0PUh&h3#h"=eSvx(=3uWh(v"h3 5H3+t$0r0藡PUh&h3h"=^_[]USWV |$$Wơȑ3$t3D$\31-ȑ3-t39-ܑ3t\$=H3t$ gDž~w1135̑3Y6tsH3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=ȑ3t!ɀ"9u t3 uh3PY9¡t3Ƌ ȑ3Ӏu1A9|$t $ ȑ3 t3ܑ3t )) 3u 3ut j4 ^_[]j3USWV1|$=ܑ3t WrGHOHt uG `-Б39}̑3V39rFU5̑3-Б3̑3 3u 30u t3F8W<1ۍF-Б39~N3 ̑39wUQt7-Б3̑3 3u3uhtk̑30 F(0MPh#h3n hYI&9 33j2G @utL̑30 Fȑ380ѝPh#h3 hۀ"Y9-1̑30=t3=ȑ3  )Ɖ^_[]js1USWV|$?!uGh"Pet$WI,VPÅt2l$t$ US NjD$8!u?SF=0PWh&h3h"{8mSgx-=3uWh(v"h3 t D$ )@ʼn3^0胜Pt$h&h3h "8^_[]USWVPl$Uƃ=ܑ3t1ۅtf;l$ `1V$th~;-\3u=t3t =ȑ3u8 GWPt$ F x4EEs @6;l$ |=ܑ3tt$$$^_[]USWV|$\$l$19t[=ܑ33t UPrUPOFy20WPh#h3x h#"61^_[]USWVP\$5X3FEx @u}|~PVq6tjؑ39~l3ԑ39SP={gƉؑ3ԑ3 3u.3_tO5X3;^_[]Ë5ԑ3W5X3V蔞 . ,1xщǃ|$uE@3| /5ؑ39$~Z39V5ԑ3zzcÉ5ؑ3ԑ3 3u3t ԑ3W5@3U ,$+HPS5ԑ3D( |$tM1BDžhZ"40=Ph#h3^ hYI&41 335ؑ39} ԑ3|$N3ԑ39͋|$|MVPCyt05ؑ3ԑ3 3u 3umua(/ Y0~Ph#h3 hYI&4 3t13uj-j/,SWV11ԅ3H ԅ37hЅ3u8܅3@%f܅39uЅ3H Ѕ3ÍF=39~Y39wW5@3x=3@3 3u 3t @30u t3F <3C0)Ph5"h3J h@"2%܅31t @30@3X3^_[0͖Ph#h3 hYI&U2 3u3u tj_+j*USWV\$ D$1tt$hR"D$ l$1uHD503J 03;@3у  (3Q(3;=D2|h(3h}%7O1GD5 | <\t<03H 03;@3h(3j\(3H (3\\5tjj ShW" tVGW")Ȋ`"03J 03;@3Vу J (3Q(3\$ !003H 03;@3h(3P.(3H (3D50 03Q03ɋ\$ ; @3h(3P (3Q(3D50 03Q03; @3h(3P (3Q(3Dh(3Qt4 03Q03; @3~;ȃ t3 (3Q(3D$F9h(3Q!h(3P똡03H 03~(3H (3 h(3j 1^_[]fWVD$L$L$$$0f| $ |r13hi"t$t$ d ot9EtzS3ǃxtostypfl =3먡3  $)D$|$ta$8-uW3D$|<3b3S ܑ3D35$L$jjQthj^1Fh6VMVjBhWj3h3ƅux'3|$t$8t$0|$t[h3hq""K$8u h~"_-j葞u$h3hp"Jht"--y =3th3h#h3 3tPhm$h(3ѓ xt` @3| D3x51gH3QPP M=83=3h3hq"Ih":,jl%܅383hZ",%܅3΃t0h3hq"sIj51583h3hq"MIh"+VǜQ=3th35<3h"h3jrjkPh&h3 jD=3jPunh35<3h"h3f$j0yjt$8!$h0h3f uh3h#h3 jL$ ɸ!3Phht@jء x#$r@2D$ rD2ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!hB#Wְtj/WGth")1^_L3H3P3T3x>L3 P3 T3P3 X3;t,uQX39;uH3빋 L3| L3P3t9tT31Ƀ USWVP3X3DJ@t t@X3@DJ@t uHH X3~Ã=w$0&=D3!h;"  !=L3" X3A1Qptntl  Ӊ X3A˃=L3FP”^ U X3@߈\$ ̀1ۈL$QuH X3H1KDB@,Aǡ\3 L3  Pj  5\3j$1  ˣX3@̃=83t=3y=L36DB@jLǡX3@1Hptntl   ˣX3@̃=L3DB@8!h'"=L31Hptntl  ˣX3@̋ P31PptntlN  ӣX3@̡H3HQPN"X3@1Hptntl%  ˣX3@̍H X3 P3 p1Pptntl   ӣX3@̡H3PPv X3A1Qptntl  Љ X3AˡH3PPH-T3P3=L3=P3 9=\3 -T3P39 9w hl" H3PP X3A1Qptntl  Љ X3AˡH3PPl@ X3A1Qptntl  Љ X3ADB@;h" 1ЍrЃ sO覶j hX35X3L l3ww8"%h3 X3:o t!gc ptrP  A X3< b=d3Ho1H3PP9 T3-P3 =L3=P3 9=\3T3-P3X3@1Hptntl  ˣX3@̃=L3F1Hptntl  ˣX3@̃=L3h" 1@T3 H3AQP2 X3<j hX35X3J @2荴8"h"N@2 X3x w =L3\3tP30h 5& X3x A =D3u;.5P3O1@T3 H3AQP@ P3jPP>X3x  1q1ۃ=3Ƀ=83 ˃hN% X3x  =D3u-5P35T3 5H3g X3x ? =D3uL-5P35T3: H3@;\3?7H3-X3x =D3u , P3IQ TX3x =D3u,T3 P39QPnX3x QVP X3y F( X3y 1 X3y P5P35T3g X3A1Qptnt lu  Љ X3Aω X3y  P3\3=@29|PRQ 1=L3u \3P3 ǡX3@1Hptntl  ˣX3@̉X3z !D3SPhAX3x  1@+33uF%X3x l =u<2=3t13X3x =3h3h#h3 X3x }*x1Hptntlu  ˣX3@УX3x 'ܑ3G1P3T3X3@Hptnt lu  ˣX3УX3x =33u}%|$Wt"5P35T3QP';\383X3x ==D3uJ)=33u5P3Q5;\3)83hW"h"h"l3hN%l31< *5 X3y qtp3@Pp3@P'=3h%+X3x )5\3j 6'(Y$i*t {菨8"m}@X3L3;tl1@lN@X3H3.t\30$)%1ɀ/QPUơX3:@X3H3P35\3^$ 3@X3TY@t@ uu+$DA@1^1I-tЍ Ir膧j hX35X3~= $w W8"tN؉^t-t!u*H X3@P ƅx#X3(N%"P^_[]9tN%x95\3}1NUSWV|$l$H3t 1; \3}hA~I5\3tPVP[tMǃ=t3tj jsW1PPPWt$$Ҝt#H319uh"^_[]ËD$ 3DAuĥ"43SWVD$H31=D3t(X3;C1 8 X3<; u&@3| u;.u { 3StXáH3tPFPPjq ƅt-9u83 3;3uC*@ 3u 3u!u#^_[1%܅3jj=L3t T3 P3L$D$T3 P3~9 1; \3hN%BUSWV\$|$3SWj t 9\31 3um[CPƍoU}ǃ=D3t V7F7~\$\3-H3831 3u 3u u ^_[]jjVPX3 ui5|33V5x3S;5|3x3 3 3b[ 3DQ@t/@X3DQ@t@ u uh~" 1jPX318!@X3$tp3@P5p3x3$X31ɀ: t$1ɍr5X3q4$X3: $uP@ƅtj5x3b<$h" F&0KqPh#h3l hYI& 1 3u 3u u^j jSWV53}Z3W53UQti=33 3u 3} &3NT$1\uZB0tFB9u^_[20WpPh#h3x hYI& 1 3uË 3u tjjUSWVPD$9\31@P0t$"4$91S肻ŋs 39~Y39V53 P5533 3u 3t Y3sUPqs {;$\153G9~Z3 39VQzO533 3u 3*t 3f8 t$t$VN5H3353taH3PPj tL831 30;nPh#h3\ hYI&  3tU3uZtCj连0mPh#h3 hYI&l  3t ȃ^_[]á3tjD$ 3DAuĥ"' ËL$<3u3 31USWVP\$P3;\3|1p-T3M39t 9tVUj1 tk9\3$1#VDU9ơP3CPSj t,V$9T3~+US) 3ySһUǻŋ>EEp $A8GMi T391P3)@أH3=D3t W6U831 3u 3u u^_[]jjSWV=3uj貽L$ɸ!3\3Pjh"h"Hy|hK#wMtkP舌=Yà PAtGWP|3/tf/VMed.hDhup5\3jh"Vj=3ujL$ɸ!3jh3USWVPl$5T3'Ƌ=P3T3-H39ʼn) u)E1u1$3E@3V}tzP蘹t_H3PPj DžtO833H3u 3u[uE6MH3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~X3L$F$ 39} 3V339|BVPI533 3u 3! X3 u1C1E҃!%=3h3P轉Ɖ$ 39V39V53I533 3" 37 09L$]939|WPH=33 3]9~[39V53OH/533 3u 3yt v3 X3 (E X3QX39\u=QX3I ( 3G (E,$s X3L$A X3 p3y 3)9~_39VPiGI533 3u 3 33| p3A(EAp339r X3L$A X37 33/ X3QX3 ( X3݀ (539}p3R3p39|KVPyFt]53p3 3u 3S53Pi p33D$1!Pb0ePh#h3許 hYI& 3 3u!u#^_[]h"qht"gj'jVj:tL$Qq p PIH10dPh#h3 hYI&n1^V3t.L$19 3u3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h3?XWV X3 td< uh@"1 QX3I t;8t7P1ǡ<3t?=`3u6Pq<395<3h"R5<3j+9<3tV`353WP/f <3t.h'h3QPD5<3_I<33/0'cPh#h3H hYI&^_USWV=X3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-D39}=@3M3@39|KUPBtYlj-D3@3 3u3uyS5X3Wkf 5X3=t3tsj jSWme0bPh#h3& hYI&1 3u*3u(tjh$h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17uX3 uH3E#tX3 uE1^_[]8uPX3HЉʀπwR胑j hX35X3{' 1wU8"uh"1gu@X3ErUSWVX3H X3H%u,8Xu'X3L3h"t18u=P39 L3L1}5P39~[39V5L32@#5P3L3 3u 3\t YL3 X3QX3 u (\t u^X38uTX3H X3 L31< u0=D3u't @3| t %܅3ىX383L39|NWPC?t8=P3L3 3u 3uuuw5H30L3M1IQ0v^Ph#h3藪 hYI&1 3u 3uu^_[]HX3,j'jUSWVPL$H3T319P3}%H3ȃ Eh"Kl$ H3PUVPt$$KǸ1$H3PPT331S̪áH3tP芬EPPjM Ņtl9u 3l$ u3ue$H3P3+T39}yFH3@H3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=t3tj jvS肮vލD$jPjSuqt1t$ED$$D$1E $A9T$ 4X39Ɖ $T$~c3t$ 9V5T3<\5X3T3 3t$ T$u3=t3tjj RS藭T$=T3RSW__ 4$D$D$ X3 $9~bt$ 3$9V5T3^;5X3T3 3t$ u3=t3tjj t$(S=T3t$SW^ Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuz&D$)D$X39~V3 T39SQS:X3T3 3u3|$~#D$$ D$ ud$th"$=t3\$tjj SV賫T3SVP~] T3f |$%C<0YPh#h3= hYI& 3t e^_[]Ë 3u tjjUSWVPt$ =H3T$-L3E<\<&I,$D$h)X39~Y39W5T38=X3T3 3T$u3%$9C T31F9uEEπ;D$$,$L$l)X39~Y39W5T38>=X3T3 3T$u3ml9}C T31F9u,$y^=X39}T3_39|W5T37=X3T3 3tT$ 3T$M 0E+L3;H35X39}T3J3T39|KVP7t)5X3T3 3u 3u^u`I0DVPh#h3e hYI& 3u 3uu؃^_[]jjfWVd3 `39|ld `3j Qh\3)  tJPUPh#h3١ hYI&@5\3;1\3`3kd3L$t$T$ =\3@Q葤 \3d3RDVu\35d3@LF5d3\3^_SWVd3d3r9 \3@<u|L19tWW:9ud3H3H2\3L2^_[USWV=H2=L2=d3t 83H3$\3D$j荣3d3 \3ÍS4R4nr@44v\1L1 [ \3\1l1sRt6,lmL)1 \3t)|?wt)LI1 \3t~l)}L1 \3,u44vL1Y \3l1}w4R4Ӆ HA9~R\34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=D3t׫H2H3$H2L2\3D$L21 3u) 3u&tj\h0"$^_[]jlUSWVL\$d3覹h@"4E"tNjt$`hP"SV# fttu=l =߃u 3r|$L$ D$1@&ڃ"D$PrƋO9rPSt$ s tu;_Յuͅu t$hy"-|$dD$ Du$$1Fl$?uSt$ hU"jL$j QP, $;Fl$|1ƋD$8u&1zPUy!Uhm$jD$ th"jNjC=m@!sHQPW xs{QPW x4$Uh"- =muqB dut\$fCShmWZ HefD$t$Shmh=m8@u֍D$Phm8@W y?60Ph"ӍL$fqQhmW 3Uh:7#D$ukD$Ph"hm"S T$"h"T$"h"03H 03~(3H (3 PhP"kh(3j 虞t$8t$8t$8t$8t$4h"Șt$Ht$Ht$Ht$Ht$8h"觘t$h˄"薘t$ h"腘j諏F~Ph*"h3 j茏SWV֋|$t "?t$"VQP8 JB803H 03;@3h(3j<襝(3H (3詜(3H (3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hQ".thc"Pouh3hg".thc"Pfou hq"jhc"hg"Q 9(P u h"j.0 D$ u h"j@t$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$ș&l =$뼃4t6맃dtket/1@D$S'=l =umWt$3nXh"5l =KD$71@D$$+L$ 3 3T$uA3$T$uȋ$D$,jj@RGl$L$ $tL$ $L$,1ۋD$PkCEu S" )St$PʼnD$$Q" UXkl$$T$DtIL$ىL$$U$E L$)QPR! 4$kEuED$ush"h!%gu]hޅ"bh"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vhl3t$ t$,QPRmOt$ d/yj=l3y h"|$$tQt$(jVjhSWy h"jVjh5l3zWy h""h"fǽt$(1CUVSwD$P9WUVSw5l3%Wt$,%1L$XAAA @D$HPQSu =h3u'l$hD$h8jU& x ul$uDžy hS2#1O~fVS5l3 [ VSt$V[ |$h5l3l$0fE<u1xu@hWj uhx8Zx18tƉjjUx tD$68Ztx8tEVSt$ x )bw8#Th%|$l$8fE=h3ul$0fE9EjD$LPj |$@f9fGfGl3G$jVU tQf|$<tٺtf|$4t?l3L$0u+fD$<=h3ufD$4 w8t$>Nf|$Dt1BuNfD$Dh|$u%j t$kh4"jt$j蚆h#y+uhx"Ph9"h3jlPD$L$jQ5l3C XUSWVA1K8uSt<։1A8Љ4DAtt;L5rSh"j? 10hu"WV|$x$t,WDWHDWDW4Dx uWLjtw\wX^=29}5PBt852WVh"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUD$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"*|$PQt$t$RhB"j2.C$t&8$\T$XT$H|$RQt$t$Vh"j-$L$l$8h "h"hh"WUSWV u|$W|1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h"j -NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPKl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hRj,PScD$HPhX& |$0hRj,6S%tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh"j +^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh/" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 3333353D$D$TH Qq T$T$ t$t$QShR"jx$ 11KL$0t.SSPhމ"jQ$V53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<9ؕ38D$D$ tD$tD$|3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP "PD$tD$t$t$8WSP "PjM!tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhI"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L 33tt94 S.8|3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Phw""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh" Qh"jt $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPp;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhg"je1gD$4$DŽ$߬$D$D$D$@$߬$ l&a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh̎"b11ҋt$  t<=33$T$p$1߬$$$߬$3333DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPj31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh"W $PhD$(X& yNHHL$ L$tL$L$8]:u*t$ tD$PhU"j  ,uh"j|  uh6"jh  M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@h8t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW2NJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP  ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhH"jWT$$BRt RPRPVWjt$$Vh"t$$k,PUD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j( D$,|$D$T|$XD$TPhX& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =p3yh"jme11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](d&[$t$ D$L$9Éʋ|$S=p3tQPjWhF"j]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh X& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QtMD$XD$TPh]X& |$t$t$kL$,9 $ ?t$/0PVh#"jD$,]|$t$t$t$L$$QtXt$|9|$11k,D(t P;|$}L$֋L$]t$Qit$D$,TD$, m4$yD$,`14tPP2hR&j<,u׋$e^_[]USWV3tWjjPOt 39u 34t0jQx!=p3h"jt$3xi8tLPWhБ"QqV`tPSh"WMj=t8Vh"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 213Iu顀2P,3 2~ t1@,3@9uUSWVD$921A9|G2SCƉ<$~ SjV( 2D$~Q1ɡ,3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5,3G5,3$2^_[]V$3 3D$D$ p&T$ t$ 253t$T$L$D$\$ $_"UD$^Vt$FtN H N tNHNfr v V 3^VD$`sH) 3 3 3HtP4BPQ@@1ҋ3v9t3,3rh"jtp4F@3^USWVD$T$#25,3tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"#USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv /F V>3 3 29|[5$3tFNu (353t5FNHNFy F4VPV3@31@j@PJU1@P;F ~4D$F(^$F0^,n#2^8,3 ,3t q4,3^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh""Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H 3N^,H 3 33H@3P 3 (3H(3H4I,3H89t;tprp,340,3t4F ,3H^hD"h="h4h" USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv " fUSWVP|$gh&sd&G4$O,52w0VPww D$0^_[]USWVPt$ffh&sd&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jN8p 03HtƒQ 03@ 03^_WVt$ 43F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv  v^_USWVPT$|$:%483\$ 83$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4831ہ=43| t Pt<3031t 98t@^_[]Ã^_[]`V15435@3hVh83 503^ft$ t$ sjY3SWVt$frLN4F,=2~0WPvv 1h&t\fv4V1AN4F,=2~0WPvv 1d&1;NuN^_[hr"|1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS#$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FFqF ݈F F$9D$4toh4j腸lj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݘ"&_$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthUW1$2L$1 QWPUSVh4jÍD$(Pu S/ \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu PF $\ E1PU\$tE|$8t h"\,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"\\t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"l-B$  $ V)19tQRh"(- 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj" ,h(3D$(u KHKpStURQPt$DljT$t h")Zu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k D3VRhЕ"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$wL$tI9ȋt$ tPQ$$h"讋1t$\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttr|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ r,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DD3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW臌ƋD$0T$UWkƋD$0 u$$$UW0ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPËERP賋$GW #RP螋ERP莋$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPzt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP<|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP规 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP |$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP聂$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP|ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVdD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"[USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p nA L$H SjQD ^_[]fUSWVL$T$ BH3ulF1G&Uh֚#m,$03H 03~(3H (3 h(3j u q1^_[]V3PPh"VVjjhԞ""@&PhB#h3\&ujUSWV׉΋*h"U &tCt[PUjhhL3s 5H3L3t2H3L3WVS5L3P^_[]Uh{s"jG5H3hm$jeUSWV$:$D$VuP# 9$j uP 1ɉ\$QSus Ƌ88"u11F9Ή$<$|1ɉQSu >f ËD$8ՉS8"u !t$$Vhyd5L3a tbVh"^_[]jhș"7jh".uh""$h:"hT"$p hn"h"j$05H3h:7#jUSWV}E phK%VBFh"V,h%VSD$(P5L3{Z#D$0= M$L$A1yyy D$Phwd5L3 D$tG\$ D$ L$|$j \ljL$ NjL$IuɉNjD$ D$|$uhjԓD$v1111O w+Ow?u$L$A1AAA D$Phwd5L3-  \$tmt$ NL$,D$(H3D$FD$FD$ FD$$~D$(PJPWt$,t$t$t$hΚ"+ KuD$1D$|$Ynhxd 5L3R5H31111VQRP5H3h@"hxd 5L3> H3LQhq"ww ww5H3h"hw_G|$9w  jPQ5L3!¡H3tNSVPh"Wt$ 5L3]J =$9t\"QV*h(3ٴSVPh"7xكT$;r ZƉ[|$?e^_[]jj{5H3h"lhI"h*"h"h3 jQh"WV$u>$jvWr s'Wh{dЀ5L3 t^_jh˛"j{65H3h:7#j1{VPPhtd@5L3L $t%t5H3h"$2"u"5H3QsH3$$w"w"s$r#QPhP"I H3$$ w"s$r#QPh|"$ H3$$w"s$r#QPh" H3$$w"s$r#QPhȜ" H3$$s$r#VPh"^5H3h"jzWV$u^Vhzd@5L3 tH$D$PWVh6"^$PwwwwVhD"<^_%5H3h%"j|yUSWV}D$Phd@5L3 tzD$Phd@5L3^ u5H3hx"&uH3$|$\$ t$jVSWVRPSWt$h"e^_[]f5H3hg"jxSWVP|$uX|$_hq#S`ƅth"SLu+1Qhwd5L3 t ^_[75H3h:7#jAxUSWV|$0t$,1@d =3$1ۉ؉D$h"WV qt\$te+$9531|$7wWh|d5L3 D$ ;D$t-i9l$sUt$!ƉD$l$묅hhPV[H3L$ $r#t4#RQPh"|$ t\ư1P`VvvvvQPh'" G;|$ ru5H3h"v$t1^_[]W5H3h"jv5H3hǝ"jlvjeP|$u1Phd@5L3調 H3tQhN"XD$ 0Qh:7#jDvSWVP|$t$^h#StDh32#St@h"SttT$da3 D$dD$ tTj/S+tF1;tٍT$d#3D$dD$,t>\$:t$1\$(XD&@&h(" u1\^_[]h"hY"z3=\3uj=d3l3`3X3T3 T3Yh1"5l =h "Ph"jnX3=h3u th"0"`3 T3t uh"t=2uh")ǃ|u D2j=x3|$\G1PPL$lQPjW蘡t2t$dyt"1PPD$lPVjWlt52=x3u4$P52Ou#$=ux3h3 d3 l3 `3=3 ɡ2=x3t&jQP; 2u[52h#jhh3QP艄2y"8h3h"23=x3u'L$dQP=52hE"h3hrdAP 52h"hh3hedA52͵ 52h"h3h2"h$$t(hQP52hO"$$ƒ 3>s1@![Vs ) ȣ3333? 3 3333335352=3=3?wd3h3=l3L[Vl3?h3) d3>r$r$d3 333u 22]u1hQP 9 2u253hm$f5292jq52|V/v3u Vh+"8 11h3t1A1A1ۉL$@1h33 3h3=P3u#3d33h33l3 t$\F|$LSSWSjV=t$Lcu3n 1QQWPjV y53超352j/VQt@UUUU)ʹ3333!!сis31f3t!ttb33cԋj3 t3x31n3‰ |3331 31AhQhp3'S i-p3=3 / t3ًx3P+==w !r%1H$D$ ʀŸw1D$ $}ȹj3yt\3t  u31I $L$9 p311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$d3-h3=l3x3D$t3t T$$T$`3=t3uu 2; 37=X3lP3_hW""E381uh"%3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRdPSt$@t$,t$4t$<31K1Kޅ`1PPPPPP =28h;"1b38LFu=X3uRh"%tajhݼ"&1 "WjWWWP+h"t҉3u b3=h3u`3u l31g=h33D$tD$|D$h" 631N=t 蹵@ 1u"WhVVWP+9tigfff։f5633L$ȃjPrD$ u h"j7]h"= 1HL$ Ajh"1۾83D$3tB?t=kWUh"~ 3L$ DD 3$ D$tD$D$ u53 31p3|(.tq<(tk{PWh" x3t3p3t (BD$,T(2D$ TL 3$3L$ щtT$ 3T$D$,F9u߃|$~O1l$GVWhķ"v T$ L D3$3L$ tT$FЉT$9uT$1۹շ"VWSSSP)T$ ‰ $DD$Rw`3=ue53$@D$ $#D$u D$ @&1$L$19;ta $Ȣ43=`3ud3ul3u h3=X3t83~ h"3~lhנ"]h"=`3u1I3 3t h "]h"t3o3e$jt1 43j3t \3t3$ D$ 43 u=35p3x3t31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 43|$E9u KD d3Dh3Dl3DL /3 3WQD$lP> D D$EFI 3EPART3M u#E1M1 uu Wj? ;Et 11=p3t } tu$u SVRt$hR")Uh0"P ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-3~x p3 D$ D$x35t3D$8l$t}t ։t$(tb3D$D$($r#D$ 31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=X3t-t(WPh" L$ T$8St$,T$4$tD$XRQP` XL$ tC=u=D$8L$XRPQ` l$0$$L$ *D$ D$Xl$0|$$L$ tW$=T3tduD$P $OD$hl$( >-31ۉl$(-D$D$DT3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$x3 t3533D$t$u~t:t  Iuh3 щ $ l3t&=u53օ4$u 53GX3ti3ȨuhF"h%/3tjT3=u)3Ѕ$tN3=X3u"Ph{"0hF"Ph"t 3 =3uQ:$$tz%tz%13ti)3х $t4$P53h"!=X3u53hX"1t"1`3=u )353^_[]VPD$ L$ $QP@Mh"ԅ3H ԅ3~Ѕ3H Ѕ30hЅ3!Ɖ t9tDԅ3H ԅ3~Ѕ3H Ѕ3hЅ3ƒ1Y^h;"j>USWV1=|3˃y CS t 35311 uY1ɉNVt11@5C C"t&"Ph"): h"j1He^_[]SWVP$2;2u+x3u"QhmdP y h#911h3<=3u;53|- 31Puh"V=3~e1p3111 t3x3Pt,p38C;3|h|"9Sh"9$2;2u+x3u"QhmdP y h#8^_[USWVP։y1ɉQPU{9 1O}t#Ë$8uP8"u r1^_[]USWVP։ϋl$=\3T+p3 3tú$r#tl$76PSRh"T$葻7St$h̲"xD$7UPS\$ Shݲ"S7PUSh";77PUSh"7PUSh"7?PUSh'"77PUSh8"輺7PUShI"褺7?PUSh["艺'1PPPUt$(SRh"`^_[]USWVˉ1u=p3h"T$$8$43|$͉)uh$r#Wh4"Y |$Z)uh$r#WhW"? D$|$j3:i3h3 g3l$M?>j3n3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$d"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"許 l3h3D$HL$LVSQP譇D$T$D$PVSUP葇D$|$ D$@VSPWuljӸ1=2ƉT$ L$@PVt$QR9PSW|$LWVUl$lt$,t$,t$(t$@h"ְ,hЅ3jdh<3" |h#h<3h<3\$ $t < uC{ - 3DAu<-j D$$Ph<3: D$$\$ h6&SQ=K|$(@D$Ph?"S@ $ϋT$ t։t=t$hB&S@ t't$hB"S@ ct$ |$@D$1=2ы53jVWR蹅D$ՋD$D$D$D$D$$t$t$D$$  T$3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhl"衮<3Vƀ;3t$VhF"q 53D$,$t$P։ω,^_[]h;"j_.USWV΃ twttuƹ"^T$(|$$+3уD$ ;t3"L$ x3|.|$,T$0 3|$9=|3|=X3u|$4u 1^_[]Ë-3~} ʉ$9twp3|(tk t3t( T( (t1+39\$ \$$}2;T$}#=X3u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉf3tt  $tt ^j3 t311 x3t$ -3t$|$$|$}p3] ʀ|(tP t3t( ;L$T$|L( (9Ή} =X3{|$(t ;p3KC x3t3:"1$t=t t3 x3S"=X3|$(535p3G13333|3x3t3Ɔf3t$ |$(Pf393u85p3&G13333|3x3t3p31Ƀ|$(T$3\$1 53n p3|+D$Nu p3[\$j53t3)؋ p3P|$(t$ hhj?p3VfǀU3L$ x3D$t3ƋD$$ȉ5|333113up3=X3h""u"}"=X31|$(9 3u85p3eE13333|3x3t3p3Ju UPQ2 31|$(tD$t3D$x35|3=3^_[]h"j(WVp3t^ tڋt֋|҉tΡp34 3 QPV02 3ƀ^_USWV T$L$3@hPhp3  3p3~Cx3t3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR{1 p3;UjP覊 fDŽ;UtZF , M ;M;MU;; t3 3T$)ʉUL$  31 EE=l3 h3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M3 ^_[]h:"j4&WV1=p3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$ln!1Kl$ 22uhUPzQ53P ;2u[jVW52 n!1Kt?D$H53#$SUP^ 52V52; ;2tÉ؃ ^_[]h׿"j($USWV$0$,1@D$l$D$D$ $1h"WV+ suMj U5l = ál =8=L$90誊8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-3)1<$L$jhQP4u:h3hedAPHl =>3@9l$| @@f>3UjDž\$ t|03H 03~(3H (3 h(3j jh3h(3 03H 03~(3H (3 h(3j 諧<$ D$tt$r#t]"Ph="ġD$f<33Waf<3gdWPVk xnu)D$PhwdVj h"h"V1^_[]Ph"25l =h"jP!4 h"h"Tj0ˆPhj"h3苣 jUSWV\T$3< $S,D$9d$ՉjRPt$ VDj11 Sl$UV 9 1U\$tL$j@PQZ 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4H&h"ԟT$l$ >31ɺT31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$H3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf >3ŅtMaQ4H&h"轞T$ t tuf f111H3|$ L3P3T$T3U3fV3l$E<$g\$ttXaQ4H&h7"/ ;B Q4H&he" <$\$t4H&h"<$l$!F1D4 "V诞 w,hP"V螞 w0hc"V荞 w8hx"V| w4h"Vk w"@D$Rt$UWQP $71w8$Ћo,1lj1l$DRWt$>"P@PUaUD$PShG"$S袜$#a0QShU"$Sv<.Ǡ!w4`&hc"Phk"SH  w$Ԣ&5h"_<t$uM55h$r#RPQhr""555WRPQh"Sћ7h$r#h"S輛 "55RPQh"S蘛M8tDƔF1Ph"Ss F;E=L3L$y"${0IJPWt$h"jL3{<|$\$W4$0Wh"h"S4$u h"jF j/PFt|4$4$/jmUSWV\$ l$|$t$1EH3gr&L3P3h"WV h~n3itVnL3Ѓa~.btCdT3봃otBs\3띃NuSl =H3X31=P3P3mjSh&5l =tHPdEuA3)ރu4t$$V41ut$(t^_[]hn"jfwPh"h3茔 j$"=P3uD$ D$@"H3t $P=\3u %=T3u "=X3u $@P0h"h*&jWVPh32#QKt1ƉPjPW臜 Wnt jPVhP^_ÐWVt$|$ VWKmt$?/tWhc"蔛Vh|"膛^_WhN"jfWVt$ |$7_WVUSWV $$l$WVSU$ $ hU3WhXq"$uWVh4"jGD$@tF$j$hx&hV}'V$$$h="jUSWV$$$$D$1 h)"SU $D$D$1G$D$ȃ 1$<&N|w5l =Ft|$`N|Z5l =Fx|$Cj$hh&5l =H P 5l =UFp<$h)"SU V3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hn"jpWh1$jGcsPha"h3莐 j@WVPt$jWV"  9u9t x^_Vt$h"j Vt$V[t@^h#V^Vt$VWt@^h(%V|^WVPt$jWV  9t9u x^_Vh"jT WVt$|$ VWsit$?/tWhc"輗Vh|"讗^_WhN"j; fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h",1VWt$ t$MPX:1@PPVVu4u0uNË\h4h&PKF }D@u hhĭ& hhį&S&F }D@\E,CEht%Vrd\$tht%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$x~D$x|$D$xt5Ph"X+%t9\$t h."?+\$xD$x\$D$D$ 9\$~\$~tSha"+\$9|1} t h"*hW53h"誔}4xME0;E4ru0h"*},u,D$D E4t h "\D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$">(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ W'\$tt$1F9tWh^"'D$ 1tt$ tЉ|$TB7D7R0'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"3Pr |$)Wh"3PS D$ $L$t$}D@tCWH&1@9tWh}"E&L$G$D$$|$tD$|D$P$\$hT$,T$ T$WFD$(+D$L$,L$ ʃ{1QPWVgth:"jP1F\$D1VPSh@"TD$XWVPS*%|$$u1Ʌ|$t1ɉAw1@|$Phn"}TD$tt$535x35t3t$\t$dt$<535|3Q5l35p352PWt$L@ƃ|$4tVAKUSWVӉ $@;|$j W\$ SZ Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ c:8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"jUSWV31F/WVUhm"WVjh"WVj!h"WVjh" WVSh"WVj+h"WVj;h)"WVj$he"WVUh"WVjh"xWVjh"gh"WYTWVj h"HWVSh'"8VHfD$t1B9| 2I 213Iu顴2PE3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjV>4 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5353$2^_[]V$3 3D$D$ p&T$ t$ 253t$T$L$D$\$ $_"O$^Vt$FtN H N tNHNfr v .V% 3^VD$`sH) 33 3HtP4BPQ@@1ҋ3v9t33rh"j[tp4F@3^USWVD$T$#253tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"O/USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 29|[53tFNu 353t5FNHNFy F4VPV3@31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh"-Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H 333H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^hD"h="h4h",USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv L. fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv|, vv^_lUSWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3]+ 53^ft$ t$ j>SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[hr" 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR腽׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS購$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"y$USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP譸3T$3D$M u1^_[]USWV(t$F|F|F M}F F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݘ"j$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthŐW1$2L$1 QWPUSVh4jyÍD$(Pu S \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu P $\ E1PU\$tE|$8t h"fh,$SotU[ ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"gt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"8B$  $ V19tQRh"8 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj"7h(3D$(u KHKpStURQPt$DljT$t h"eu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRhЕ" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$L$tI9ȋt$ tPQ$$h"^1t$\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ _,[D$ p D$D$D$,$D$ 1,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$D3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UWljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPSERPC$GW #RP.ERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW芒Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP̐|$FV D$t RP诐|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP7 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP蚎|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QP袍L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv m t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QPQ1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jLCƉ t,UFtf^81FFH1|$<΋t$  3uN $3NVfF fFLtt\$XtD$ 7Dt1dL$DpTt΋D$HT$LуL$ L$u\|$h|$l){uD$tt$ L$4D$tL$@ 1 uWVRPoƸ L$9|$0rD$ @dT$D$T$R1RtRPt$諒tPQVhz"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"j]@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ $3 3uPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp 袖 ^ hjSo V^_[]h"h"hh4"腼USWV l$4E}0I\$8u tȉFSt T$$RF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt1^/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$ "袵\$8u;l$L$4A(I,WhT$L$$D$ 臞 l$u L$4A(I,T$L$$D$ P \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$PF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$PF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWXƅuWhu"jX$$<$4D$Phd@Ur tj1OLVhedAU) F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h)=%t$1 Sh"U-w CPh8"Ux C Ph"Ux CPh"Ux CPh"Ux CK,C,Qh/"U}x C0PhD"Ukx $@D$t P 1-Uhzd@$<W t1 VhedAW hjU迹 D$ P$4{8D$, 9L$tL$9u0$S11:8tx$0h"0Rb$11҉ $ƅ*ŰPh_j PUc ^_[]$0h"jUUSWV81ۍD$4ShPSul1NtAljSPSWuWn$uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS h32#Ut.P:|$"V(t!Uhm"JUhS" 1OUh"l$D$QUPh%W赓tPUh%W螓iD$$Ca2=ouV\$R&V{Vh$( ]hh0"Wa ƃaT$,"V1u\$ىjW$( h5" VT$"V$$ h"V 4 ^_[]1ىj=ߊ< t< uGjh#W k2$( aj2WP` EKu$( 8~y$( 1\$ىj(Sh$P-R u$PUh" "j2PWR` E2$( ;(|V\$8"V$( @VwT$"Vg$$ hc"h"?uD$ $PUhw"SuU豨<Shh" $( aPWh"Uh>"$( x?$( Z1ىjPySh$PP uSUh"q j2PW^ E2$( ;h||$jt\h"@PUW $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W葏L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR V腦q襶8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh#V[ u<^Ft t u^F t tW*PWV tt$hU  u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPhm$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh32#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@Pٌ t$$$ىh"rC< t< t< uS?=$<rLjShD"Sh`"&ISh"ch"Qt$<L$D$D$L$ oP`XtXljo 1tX L@uH~vCtTjhhn" V"$^_[]V  )UjS] D$ D$ CD$CD$C D$C$Cl$Uh&r#V_ u D$CV薢)1$<;obD$D$PSh" =USWV$0xjW`ƅ~F$0h$1jU`~4$hPa C9uЋ$4h32#SǍ$ىhR"$0St| uƄ$ $0ph"QUD$$0qh"QPىD$PUyPUSn u׋$0EED$1ɍ$D$ $PhS/ D$PD$PD$PD$Ph %SCD$L$ T$ ыD$E L$ T$ D $A9L$D$uPhh"h"E}Sh"h" Sh"h2"E $02t$t$h"$@t$Ph" |$W}~14VeG;}|VGe1^_[]USWVD$(}~;$ ~VE pSV $PjVWjS`D$11D$D$D$D$$D$ D$h<"u Vu+P H5$&D$>j 5l =P3V Cr,3밋l =$PCrj hq#V(R ىVvSB1PuE$ ~S4VQ $PhjSPt$V\uVht" ,Wh)"jCÍD$LPSu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV躋 Y8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQkt $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPXs $Ph"Phr"tM"PSh"蟾 .1$P;$h"Shrt$VW"9;$PVh"L|$$Vh"3h"jhr t$j!=,3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQp $PhV"Phr"1~~;$1Fȋ_&w &QPhX"荼 G`;$X|΋$\>9rh"$`>ߋN8_&w&PVhX"* `Ouet$$P\$ ZSh"h"$P\$;$PPhU"ʻ VܺhE"Sh*rt$  09rh"h"$\>$Thl%\ Vsh "$X~:$\1j h_F$V胓 "tQC`;$X|j ~-h2"W$`>VG`Ouj $X1~$1:t @`9u9u$\Phs"艺1@\D$,\$H|$PS$hjVɝ L$,9F Vh"VhrW h"F0Ph"F0Pv,v(v$h"j h&"C$Th"迹Ph"h"Fhu'%VmD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"Q$PtPh%8h"+$Tt*Mbi)QRh" j $XqPSh"̸ ]hJ"*$X~n$1Wȃw,\"$`&L$7"!""_& 8""PRhb"O F`;$X|ۋt$~G$`>G8tu #P_&w &QWhb" `Kut$h"VhrP>U"tj"P1t$1 E$`$d $jj ha$QPjVmyjhb$VE V$`t$Vh"O$XMbi)QR$\VhD"$|$|$|$|$|$|Vh"޶ $\uM4#1wh"-L$!r "$PPV虶t$h"!11҉4hӀB9u$r#t4#QPt$h"@=,3~S$h1h #!1PQh" C uߍ_ j  rt$h"Vh&r@t$S>#;$PtF""tM"RPt$h"蓵t$ USWV`p׉͋$tph"S腎,$tSÃr t1C1|L$PVQo Ou vu hu Z$1hoVW] owt1$0 j2t W C F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"W@B Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jh{%SD tVjh"SC tBjhTR#SC t.jh"SC jhq#SC u$D$D$h"PhrWh"PhrW=,3t?|$"t"PVh)"q |$u$4&VhD"R ^_[$oWVƿ3Ph"W´ Vh"W賴 VhW"W褴 Vhx"W蕴 Vh"W膴 Vh"Ww Vh"Wh Vh"WY Vh"WJ Vh."W; VhO"W, Vht"W Vh"W Vh"W Vh"W Vh"W Vh"Wҳ Vh "Wó VhA"W贳 VhX"W襳 Vho"W薳 Vh"W至 Vh"Wx jVRhQ0 t^Vhm$j0WVPΉ1WPhPPj PQ~ u^_Vh"Qjq0USWV։ωl$PU\$hjS“ E9C Sh"ShrW VhH"ssss ha"ss3h"{""t"t$(Ph"软 t$4t$4t$4h"褯$t$Ht$Ht$Hh"脯D$8PhN"q$t"Vha"T$4&ht"6$h""Ę^_[]t$ t$ t$ x tt$h"jM/USWVӉύD$(jP.A1t$`FFF FFD$h$r#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP1D$HD$PD$P |&5p&|$D$ fD$ l$ \$Tl$+D$Ty1|&Phm$j($PrT$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$К&ݜ$ܼ$D$pt$t$$߬$К&ݜ$݄$T$xL$|l$xК&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<"ShrQ3h["֪h"UhrVuh}"貪t5|$d} r"<$c!r"P^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ H u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$  u$8`D$1@$C`Mu΃<$t $`^_[]t$h"j)USWV$,h@"kAE"tŋ$0h"LA."t \3~?-|$h"VS0 M~%Hwv$(& L3L3ǃDt*Mh}%5l =衫X3u5l =M4D3nNRt 03j W5l ={% `3L$9&-l =2<343832j W5l =$ 2L$9]`d3@3}H3nPK3tW~P03ujj~'QPh7"j@'D$كL$l$ umt$nCl$ 1  ut$)KL3h"5l =h`"p5l =h"` $L$L$GȍQw[sV?P}PH2-G A6PGu$t L$-AGL$AL$$j=H3u"hh"h"h"h"h"h"h"h3JP$WrPh8C$Ws bU*yŃ=83u#3MIрK=<3u }8$V+ƹV])uV+W&$VVY+DžD$u h%"Xul$Vh֚#h3> Vh}%h$ P#W(yl$`t$Xt$T1ҋ\$މT$̓=83u3MIрs6=<3uA}t']h$%S,sthB#SsuWH(Ņu{D$TƄ ML$XE|&hP$ Ph>"h3CD$+hP$ S( ىV1 D$@W'$WpPh$Wq $'h3jjh"L$WTpPh"WEq j)$WpPh"Wq =<3tVh3jjh"(L<3$WoPh"Wp 6WKTh3jjh"K<33h3jjh$"K83ꍬ$U$PBoGV6o)1;$v7$5<P{3$Pn$$1Ehh3jjh" Kl$WK(_D$h 9jUPAL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=<3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h$%Sjt jhh#Si t ;/u f. Gf./WhSh9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSetH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 3H $s-t$$tHfHxt P2)1^USWV=<3th(3jjh"?jj9#tvƃ=<3th(3jjh"d?31GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=83tV$Ph"h(3融 ~uV7dV'%V`v v"@3F$5@3vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=83tW"Ph"h(3[ W_1l$$ttF9u t G9t$$&Qt$hE3h"h3<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"h3dEuFufFFV!|$WP`WV&N=831ۈH3D3|NILD3hD3_L3ǀD3|NAMǀH3EFNDt$hE3h"h(3谊1N1@=831ۈH3D3|NILD3D3W-_ǀH3FNDǀD3|INOW_L3ǀD3|NAMǀH3EFNDVdPt$hE3h""h(3C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=83#~VPt$h/"h3~1t$hE3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=83$ WbPt$hE3h""h(3躈Ut$$t$$|$$WƀH1@=83ىV_bPWhE3hU" |$u V[v vY@3F$5@3Ut$$t$$WDUt$$t$$W.PZN1@=83t-ى,VaPWhE3h""h(3ɇ؃^_[]S1H3D3|NILD3t!hD3T\ǀH3APEǀD3|ONTt!hD3.\ǀH3FNDǀD3|INOt(hD3\ǀD3|NAMǀH3EFNDƀL3t(hD3[ǀD3|MODǀH3ECHGƀL3[SWV=<3th(3jjh"73=31VWftmxtg 3W sJX tCf{u7=83tSPh5"h(3\ S\S [빃;=33k5@3tc~ tWuLfthS"W Z=83tWRPh5"h(3څ Wy\W9 륋v$^_[SWV=<3th(3jj hk"6@3tS@31{ t$C$Su[SFuՅu5@3th"VKYv$^_[USWV=L3R<3utDh(3jj"h" 6,th(3jjh"55P3t$G!jj#^ơ3;333,׋-P3WV]Ɖ׋ 339sAWV2ÅuWVh"p\ SPh"h3Q c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"h3Ƀ:KP39tPt$ ZU-P33;333^_[]USWV=<3th(3jjhS"\4fx3jY9T jj\ʼnT$3 3PQ\D$5353J\Ɖt$U9\ʼn$St$p\Él$9$\$3 39ˉs6fx3j8DTk D$;33rM\$ -P39sI3953s9-P3tS P3E9u3 39\$ 3 39ΉsZWVÅu h"YSCPh"h3ˁ cWV[Ɖס3 3911 uU9t$D$ rIWV<Åu h"|YSPKAc9-P3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5353fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=<3th(3jjhl"1FtVPXfvu݃=<3th(3jj h{"m13=31ҹ$RL$QtMƋhtDEt9VP|$ Wf1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=<3th(3jjh"03=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"h3~ 1^_[]fUSWV`=<3th(3jjh"q/53535\3h."hh2HzL3  |34|3^~4$D$F h3|$\$ 33T$,L$(53t$0=33\$8|$4=3|$t=4uFFF%)Fu9rV9=<3tJh(3jjh"*F <3t(t$h(3jjh")F <31V9vtRPh"h(3x <3th(3j N$ 9̓>t9߁^_[]áh3tPjt$t$T)uù2WVIAfF=t3|Cx3)f35d3jQh|3(u5t3F1|3PVQh =x3Ft3^_ù2Qh/"l4\8u"h"hr"5\3hS"h3pwjkWVjh2X1t)h t 8@ W^_V3 3t7#|3=@u%o>3 3t|3!=@t^USWV$$$ $jhWVX8,|3tE1M1 tmjWVS$8jWVS$8t$Sh}%hVHrVJ$ p3U Rh5p3DžtGh$%PLtSh"h3u 5p3DžtGhB#PGLtSh)"h3u 5p3[Nj5p31jPP6<+^^$DOGrhPD$PhR"h3Bu:hPt$V $(j7V@ p3u D5p3Nj5p3j1PP6;+^^X^_[]SWV׉1jPP1;+FF9tX\$)yWh"h3t %؉jQP6};~tF hP6 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFh %PYJ;-33rv=83tUh"h3s \GP1=83t:Ph"h3os %1=83th3jjho"L$1^_[]USWVD$$Ps{D$x/@th %QDt1ƀ81Mbi)|3H1ًP1 t p3P RVVG5p3At\G9uGSVP*H t5p3Džu*h %D$P|stƀ8MbE^_[]USWVt$!M1 tFjhRW3,|3t(E1M1 tm`ƋU R^_[]ËD$0脾 USWVX=<3th(3jj&h"t"L3 ߉^_[]USWV|$u h">Wm;( 4u`Ɖˋ-h3UDžuh"z>-h3)ً( 49w؉9vlj<( 4|$( 4WSzn^_[]USWV։ϋ\$ t;=33rVWh#= - 4 4QPVW'{s LK$\=83t%[$tC1K 1 uh#S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W9( 4( 4$ 4F$5$ 4^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$V9( 4( 4^SWV|$t$Åuh"V,8;^ty^C Fs j/W&GS8( 4 ( 4W W8FV86P4:1ɅF fN^_[USWVd=<3th(3jjh"s=H3td|$xh"Wcƅu0G0Ph5"h3(c Wh6";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$| 4~L1\$ 4 tAD$t$ jjSeG 49|͋ 3 $53T$|L$<q$Q Aip3t3QA 33QA`3A$t$ Vjj(QF @t3E0Phc"h3` t$xho"8V%5h^_[]USWV$=<3th(3jjh"e1PPUk Džy0D0"Ph6"h3C` Uh"88D$,PW'!y0D0Ph"h3` Uh"7$jSƅu h #7SVW耫 xD$j(PWl y0@D0ePh"h3_ UhH#{7WOL3RrD$l$t3=p3,$1Չ1 9$h3jjhj#jj5353 4jP  4u h"6PjPh$%HĨ^_[]fx3D$L$ t3p3D$L$ 33=03u t$(6t$pPh#S6D$ L$$ 33L$T$  4<) 4؅~ڋPh#VH U=83t584h#h(3H h3jjh!#84D$QPh8#h3xHP3=043$L3 1A $t=<3tPWh= #h(3@ =4 44(4hQV8 84<4^_[]t`3 PUh= #k s-44hh@4U $0Ph #h3&@ j4USWVE3fx33 3D$ =H3 $=d3|$t S\hS芌pt$t$VS0 t$ SCdމøPhlP jWSVj t$ Sh#3=2S9t @Sh#h $=<3tSh#h(3A= =d3t S[=H3u hhS 4=D3t4h4Pt$t$V54v t$ 54脌Mhhlh ~jWSu54q =D3tR4\$SSh4P ut.ǡ40WSPVh#h(37<u1C=H3D$ D$t$tD$ P54_D$8P54L=X34$t$t$Vh;"u $443D$hhlh =4$t$=d3t S%ZjSh4 1ۃ D$ D$tD$ PVND$8PVNt$t$V \$ SV~jWt$Vj=X34$St$t$hDz&)=<3tSh#h(3: fx3PPP 1CQ=<3tSh#h(3q: 5353S 1C=<3 Ph#h(32: 0PVh0#fx3PPP D$ D$tD$ PVMD$8PVM=X3t+%|$` $t&Qt$t$t$PV4$V*0OPShe#07PSh#h3W9fx3PPP[ 1ۉ؍e^_[]4$54544$V%tfx3PPP  D$ D$tD$ PSLD$8PSL=X3D$t4$t$t$Ph0"S4$Sfx3PPP WV449s0΅t54,V4tlj54@=481=4=4535353h4 #Vh #h37^_USWV 1D$ 33$L$D$ 43D$=3u h#=3Tt h# H4ȅwEA H4 $ L$u |$~D$$D$D$E Ɖ=l3r11F؉Ét$p3D$tkHL$ D$ 2 9D$ tP$ PUD$ $L$=2~bD$ tP$ PUD$ ;$D$D$ u $T$P$ PӃD$;$L$|$L$D$ +D$ $T$P$ PӃD$|$ߋ$t$9ø$L$$L$=t$|$|J|$~CD$ tP$ PUD$ D$ L$$P$ PӃD$|$~=D$$D$D$] t$|$؉AF; l3^l3)|#=83t)Ph#h(34 l39})q3tL$al3FƉ9|׉޹3 uC$L$|4=3R=83t58453h#h(3f4|$~53h#O =3u7f=D3y-=l3~1t$ljG;=l3|3~#H4hL4>Fte^_[]áH4fD$ 4L$ 4}Ph4讍QPh453h #h33j(SWV|$t$48;4vhK #b 484WVP 4^_[53h #h3$3 j'USWV$$=<3t$h#h(32 Z$ $(މ4$9{CKQPh"hl$U.=<3t CU342h#h(3h2tUCKQB+{))σ#WRL$ QP$(CKQB3{))σ4$#WRL$ QP$,kBCKQB;k))΃#Vt$RL$ QP$,t%=83$(tqUh!#h(3_1 \{$(u0jh1#D$ P輑 tFjhl#D$ P褑 tk=<3th(3jjh#9(jtzwC@D#P$Z6C@D#P$C@_#Pj$$!C@O#Pj$$M u_{C@_#Pj$$!C@O#Pj$$ =83J=83t&$r#;$ t#Ph#h(3/ =<3th(3j :^_[]SWV|$t$=D3t4WVh4P =H3uWV54y t^_[Ë53=330PSWVhe #h3.jf#SWVt$=D3t4Vt$h4P =H3ujjV54!ƒt^_[Ë53=3308PSWVh #h3V.j"V3tufx3VVVC ^PD$L$ $QPh32 XH8I 9! ':(#V=4t114Bu11Bu=Iu1@'535353Ph #h3w-1^SWV\$j/SatMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=H3uhVx=<3t.u Ft#8 $4jhh($4jP|((4u 5 $4 $4($4h,(4hQ@P: &$xH&}&x#5$$4 PVt(E u#<$x"VPh#j{ SWUjfPhm$j艙V3Ph#V Vjj(h4#<&8&hB#h3} uh3jj'h]#b@&<&hB#h3? u1Fh3Vj0h#"V|$ujhU 5((4 u*h#j觘SWV |$t$ >h#WEt9hNp%W3t'\$j SWO $ 9uy6h#U$~h#Wt@hNp%Wt.\$j SW D$ 9uyvh#j蹗D$PhU5((4 u ^_[2h"#j诗SWV |$t$ >h#WMt9hNp%W;t'\$j SWW $ 9uy6h#U$~h#Wt@hNp%Wt.\$j SW D$ 9uyvh#jD$PhU5((4 u ^_[:h.#j跖USWVhE$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"L tjUh7#8 tG99ufD$u\$ tR$,4jVh% EjVh=# 4jVhB# 5\$ D$7f@jh0uht$Vj P5((4D$^ރ9tD$j@hK#P ߉tD$P=DaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VD defDectsDuVjh#P V58(454(450(45 $4h#Et2tR}jh#V IH}j1h3#V[ #}jIh#V6 `t6Wh"Shm$qUփOut$ۯ h#A^_[]1h#jLUSWV}\$j S5((4O D$t"NuD$Hj@PjSPhy#j$j$Vjj5((4rF=tPh#D$D$ D$$fD$t$j VE 0 9 1L$81qAQQ a A j QV5((4-D$t$ *jh#E p>  D$ @L$jhtjPjQ5((4h#h(3D$t$H1D$`D$L'Ƅ$0VhQ`5((4 $j D$tPS |$'y9D$(ȋL$;D&|"@D$Ph=#h(3j PD$$<JD$ D$ L$jhtjPjQ5((4~e^_[]ÄtH<t<u'5 $4h# 5 $4h #h3  P5 $4h#h3hE#Eh#j菐E 0h#`USWV $ ~($ 1j4hT#S ?C9u1CCJt$LUPVG CJjh'UVjS5((4~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P58(454(450(45 $4hX#5 vL$D$$jh'hVjS5((4Ffȁw$VhU VhU ƅtL$D$jh'h$PjS5((4]$f1Ɂw$PUhWh#<Wh#5vL$D$jh'h$PjS5((4$f1Ɂwh#C<t$ t$ 1؃;D$ D$4ƜF>|$Ń &h5]&hy%k  ~y)L$h#D$Phd#VD$P H PpRQhj# tVhs#^h#2^VD$P H PpRQhj#k tVhs#X^h#1^USWV$Gh4&Vh Vh#  r[h#O yj h#O,@tPh'#O, tPh7#GȅtPhY#GȅtPPhl#p O W hVbVh#LGtPh#6$hVjWƅtVh# j t)$1@9}$݀B jh%$V.B m(4W`PWVB VlD^_SWV։ϡ,4H ,4uhh,4-4h2#h2#hS7h"S tZÉ 2#t$r#h,45,4Ph2#SY|@h,4? Ph3#S yh2#Ph2#j轪<|.i< $r#t4#QPh3#Ss t Sjj!hA3# Sjjhc3#Rp,4tSPjhm(48h-4{u;hdVjS$1WWV^_[WVP3#=`(4u%T(4<u3#P(4u3#u"hm(45,4Wh3#j蛩j2h4#H!=X(4uh4#2!=L(4u6hhh3#=A xjh3#P? VA-4Wh4#jQV.4h4# jJVRjG2h 5#  `(4uT(4ujj@3#u3#3#u3#$=d(4u D$@3#D$=h(4u 3#=l(4u 3#=D(4u "=\(4u $=P(4u m$L$ @(4uH18hl2#WPV@ w8Vh3#jԧ `8Vh3#mj=X(4u hl2#Vjjh-4h=4#fUSWVƁ l$]1EE EfE 52UJUjV xqjhyt V/ y 8uh52hCt V  xBt1PP~u51F FFV<)Uhm$hp5&h<5# hG5#h35#jzoPh\5#h3 j+fUSWV<\$T|$P$3 h5#SWv `~$&\.4уAtVMu\P.4D.4@.4p2a\#X.4T.4듡l =H.4L.4`.4v<.4k}3=`.4t =\.4a-@.4<.4 t =X.4C)׋ P.4 5H.4 D.4tuu @.41Et$T$t h2(31d.4h.4hyƅt 1GL$ 11PVWWj!D$tvh32#Ps1-l.4UUhl.4UPP4t6À;tىPMS袉UUhl.4UW4ÅuW &t7~ D$G UO=p.4Ã<^_[]h5# 5H.4hm$jljhC#PhB#PhB#PhB#PhB#PhB#PhtB#h38jUSWVpT$ L$$$t.4ƍt.4D$\D$`$14~14L$XL$H)L$L)L$dtMuI|$ tB1\$L|$H$r#t$%L$$ L$D$ \$<$D$v%D!F9t$ uȋu] }trOl2|$ w$r#L$L$dL$L$` $D$ D$y%$%w$r# GD$t$ D$LD$D$H$D$v% ދ] =P.4 2=T.4tD$14$"!2nD$14D$t.4$5#KwD%$ &D$$$6#GG0O4D$L$$6#b$6#6# 6#6#D$$6#LD$,G@D$$-6#1%24$r#D$0pu?t$24<$D$$r#yt$<$D$6#x'%ىШpu:|$t$244$x|$4$D$6#xكှ'%] yBD$t$244$}xD$4$D$6#dx'%sBD$t$244$5xD$4$D$6#x'% sBD$t$244$wD$4$D$6#w'% sBD$t$244$wD$4$D$6#w'% sBD$t$244$]wD$4$D$7#Dw'% sBD$t$244$wD$4$D$ 7#v'% sBD$t$244$vD$4$D$"v'%sBD$t$244$vD$4$D$7#lv'%fyBD$t$244$>vD$4$D$7#%v'%sBD$t$244$uD$4$D$%u'%}tQL$ D$h$D$1#D$ 9|$t$244$u|$D$hD$}4$xuD$0D$D$24$86#LGHtD$$I6#5G(D$$S6#"$ 6|$,u=D.42t|<.4uteXu<$L$$T$ <.4u t GX@r9=T.4uD$t.4$"GXHw $C#$.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$14$t.4ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$茘D$(u;<.4 d.4Y=P.4LD$t.4$s6#3D$(M I"$8&|$D$ D$D$$$ o_8D.4ZG4D$hL$$T$ JL$0$pLưD$81D$D$D$hD$ t$D$0D$D$$$蚗"4$FD$88 D$h$o1uG0D$$6#|D$,-1D$D$D$(D$ t$ht$D$ D$D$$$ 14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$趖D$(D$4$D$t.4D$(1ɉL$L$D$ t$ht$D$ D$D$$$U{4$D$D$$fn`1D$D$D$(D$ t$D$ D$D$$$D$($D$t.4S1D$D$D$(D$ t$ht$D$ D$D$$$衕4$D$D$t.4c[iF D$|$D$ D$D$$D$ D$D$D$14$t.4V8 D$($Bmt31D$D$\$ t$D$ D$D$$$ܔ&A1Ah2$D$t.4D$6#D$ @D$0t$h1AtD$h9k4$1}^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$lT$<1Ht |$t$ $苚T$#V: uC <=%:l2ShV>#$t$މ|$=h.4t2=/h.4D$(2L$, T$l$hPRht.4QWVEjMD$(t$=H.4|$t'3@DJ@ut1ɊTAu=L.4umT$,$uWjSt$8^|$=X.4p.4`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVh14ht.4у *D.4T$,$VW1VSP5D.4t.4C$P&D$,$D$(D$=H.4t +1ۉ\$0\$&\$'D$4SPV> ljӉT$tD$p!Ѓ8"0ԑPVh&1<==L.41$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R葍[A1OD$D$1D$ D$j=QUD$ tOAL$ \$ h+#V豳t=j,SAL$D$"h+#Vp21۰D$t$h%VNh>#V8NhH]&V"gh/$V h;r&V.hN$Vc |$$i \$ Ct$ɍQw1$x&>a΀-% plj\$ Cut$BT$ҋ $)|$4C1ɉQD$PSs D$ D$ 938*8\$ L$ D$D$W|$h#S蚱Dh&S脱;hYf&Sn7hG#SX3h#?#SB'h(?#S,D$t$ |$@ 1ɉQD$PSP D$D$ 9؋t$88|$;1ɉQD$PS] L$ 99։D$蚾L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sht.44t2h&B#v 1<==L.4 ڍt$81 D$ \$phjSht.4PVT$ROc$1BD$L4JD4`L$p$QRSRPVĉX.4 T.4u1$Pb$w &Qht.4hA# h.41<=4 j=V.9=L.4 j=VT$81 D$ t$ hjVht.4PRW,b\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP蘈$ht.4h B#D$49t 8VhMB#S1JD$ $$Qh@#,=X.4D$t$=D.4$D$D$,D$\$(V耫GC@D$p9Vh_B#30XPt$hA#|$oQhA#=X.4D$WSt$h?#VD$ 81ҸD$ |$\$ Cj"$PK_ÍD$pWVPSt$ $P\$ E $t.4jt$tS7 $t.4jWV# -0CPht.4hA# BX.4 T.4$Pht.4h&D$ $u1@t$2|$ Qh?#(11G|$1\$ tpupthh#QkD$ t$D$t1@L$ ɉ%t>#PQ^Q|$t 8t1j t$ 2n4$`St$hM?#FQt$h?#7.l2m2L$ L$ ف$K{8P|$W膖D$ t@j QS}_ D$ ;$|$8tQtUL$4 T$hjRht.4QWt$] l2T$ gL$4D$ t.41ɍAD$4tT8`T$ Q$QRQPWPcX.4 T.4T$Jb$w&Pt$heA#t$L$ $d$ r $3 $tu¸G#t(?#PQh@#|$D$u |$u |$TF1@]%t>#Pt$h>#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/A#T0yPt$hJA#|$L$lj% L$St$hk?#{D$$d&1ɉQD$PSw L$ 9t 9St$h?#,D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$t.4jVPM D$h|$t)811FD$&|$t.4VVP  D$'$D$8|$t.4jVP D$pt.4jVP UD$1=X.4D$44$Vt$h?# Ph>#=H.4he^_[]4$h@#ًt$D$t$$t$SI@9s Vt$h6@# S!@D$t$|1ɉQD$PS/ T$tD$pD$ 9t8u跳8 St$hx@#Qh@#菳1ɉQD$PS ƋD$ 9t8t}St$h@#St$h/?#D$t$։D$0L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl># jj-Pht.4h># h>#hxA#hA#ht.4h6#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS}1Ht$L$ltT$d;WuT$h;W(u QU ŃtD$ppPU! D$DGXHr PeoXd^_[]USWV$l2048t.4t 04/04Sht.4{tWt.4މ)ˉESQ|$ W螃 DW04V%V?fǀ04/SUl{ut.4Uh04Q%,^_[]USWVhT$D$A7#&1Ch04ݟD$ CL$;rjt$V舁 ufD$jD$Pjh04V t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP_Wt$h!7#|$$j@WVP_Wt$h17#jGWVPt$=h2qPh"W5 H.4t5l.4Ph=#5h2D$$PV5h2 p.4^_V΅tO耮Hw;s1<.4 d.4teZ0}Pht.4h=#M Atʡ<.4 d.4t"$0I}Pht.4h& u =H.4t^jUSWV=X.4ˋ}T.4 \.4 t u tth(3jVuy}ti=`.4|}t j YMO؃thD$VuP蛀 t$UtuRh"{5p2Rhy% bD$VuPE tMD$PVh=# D$VuP t+t$ t$ Vh=#V]D$ s*P? D$L$ r!QPhC$ rD$rIPh&r#QPh $xt$hM$}u h=#j e^_[]PhK&USWVP=X.4u(ˋl$ D$$|$5T.4 \.4 t u^_[]Åtth(3jt$Wx܅`.4| t j m$^_[]uCuWt$h"  K4$~DN1ۅtPh#t#=`.4uPh>#9t`.4C뿃u,h=#'t+ORh"#L 딅t~=`.4|t j ^_[]1ɉr $~1Ph#C9ur4$h9>#j tuQh"`b5p2Qhy%G IWVD$0L$41|$VVRWQPut)L$$<$ug`.4 \.4tT$jjvB1A8=T.4uQh"t$t$t$ t$t$h!;#^_Qh;#jAUSWV<.4 d.4=P.4|$(|$4`.4 \.4t{\$,1PPQPSWut`,$tYU,MtLƍD$(1QQPVSWtt&$;D$ut.4jPwVj]aV_]D$8tPht.4h];# ;w1D$$&Ph;#Ph;#Ph;#Ph<#^_[]UWV EMT$ 1|$VVRWQPtt@u|$ D$L$ L$D$`.4 \.4tT$jj Z1APT.4t!u.=p2D$PwPWVh0&QPhd$ t$QPh&<#謿e^_]Vh;#j?UWVEMT$ 1VVRWQP3st+M|$ `.4 \.4tjjj1A`T.4u5p2Qhy% T.4$h t$t$ t PXt$t$h3<#Ѿ e^_]Qh;#j>USWVD|$huI=<.4t@D$$1ɍT$QQPRh;<#cqD$pt$D$(1N\$$SIJŋD$d\$ 1ҹt(t$ RRVQWPqD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2VhC<#j\$DSC`.4 \.4tىjj(A=T.4uSh"mw$w wwwww ww7hJ<#C,D$tM(9ʼnd4$1A1AUXD^_[]Vh;#j"<USWV$$|$$u1D$1ɉQQPRh;<#4$$t$VGtfŋ$L$ 11RRQUSP$otO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=<.4tM<$1\$t$Whl2RhC<#jSdL$$jjV G;<$|u `.4 \.4tщjPV=T.4uRh"n<$~/1t h#UttVh<#?F;4$|j Ot$VĄ^_[]Rh;#j8:USWV$=H.4t  $D$\$1ɉD$QQSP$Vkmj0LWUULt3j Lt$S$UK艠8W$h<#{ =H.4vjG11ۍL$l$ PSQU$Vltct =X.49$$D$\.4 `.4tT1΋$PjU$h<#1Ʌ7_l$ 11΍L$AAQUD$L$PUh<#jdQҶ$WPUV to\.4 `.4t$jjPDH1L$AAQ\$SZD$|$PSh<#jdW`$jPW Ā^_[]USWVP\$(|$$1PPUPSWIk$PfC1PPUVSWktu=T.4u5p2t$hy%% $ $ r/1۸$r#WwwPh<#C #;$rj 1A1AyVDS^_[]Ph<#j7UWV0EMT$1|$ VVRWQPCjt0M|$`.4 \.4tT$ jj1Ay=T.4uQh"%1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$<#õe^_]Qh;#j5USWV@$ @=H.4t Z$ Vq@ƍ$ h jUИ h'%V t}1ۍ|$1EfSWV蜹 L$99=z  h'%j$ƅu$ 11L$RUPQ$8@$8@dhtIt =X.4$,@$@\.4 `.4t.1T$Ph X1Ʌ1ۅÍL$MP~$@SPUB U$@{PtW\.4 `.4t$ jh V0$ PjPS S P@^_[]Ț8"tD$9t 8uVh&=#Vh=#j3h=#hm$j3USWV \$0|$,1PPUPSWf)4$ ?1PPUVSWf=T.4ut$ h">rt51t ttt ttth[=#裲 9uЋkT ;$tl  1L$D$Sjh"Y {t+1:LtPh=#3 G,;{r܃TD$@TL$9uj +VN1A ^_[]ht.4hq=#+USWV }=H.4t D$ toh=#W辊tcҘ1ɉt$QVW T$$9t8u記8,Wuh=# =H.4jj11CL$ t$PSQVuudtWt =X.41=\.4u?=`.4u6L$1J1ыT$1 u#MUPj h=#1ɅRaMUPjV tK=\.4u-=`.4u$1H3$3|$ uMUjj h=#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVh<=#SUh#S t9VL4$Euuh$r#p:Ɖ$t^_[]hH=#hC=#j/hH=#hV=#USWV\։ύD$ jPj P褒 1u0D$F|fD$Y|Uh=#j D$ P蒭$L$D$ L$/Ph#j D$ Pj[ $fL 3/LA .sD$ L<u\$ SjPj S E9[|$ t D$ PVh=#Sd^_[]WVth΋u\~8tU~4~`N4F8 I9rPJ1F0F4F8FXHr PlJFX^_fUSWV\$(34,34h(C#sP\su ,34fhq"P諆u 34jp034Jmx &蹶'?c.5(34芓hq"PEu m4=m43C#t]#l$PKrt Pu|Qߋ<-t<+u{uNh} &SȅtGSM16kh8C#q434t8u)h?C#q434Pqt 434#hFC#}q834Pqt 834OC#1=<34tjh^C#~FP7֛j觛N=034u0j_`ujjB=`34t!=m4u=34ujhuC# C1FVV7=0m4uh#503Ru\~jhC#B jM50m4f:0BuK@D34@34!Ѓt4m4H34Bzu=m4t0譚|m4jS=m4u TL34=r4~jhC#u j j 6GWVt$ y5P345P34T34ut[<|=\n4t=h34t|2'V1Wu=WSBVWV|$ W@jPk?tWP茴^_t$t$A?tjhC#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9l34<p34U5`{4al=34u t3434U=v====,=XAf2 t34i343434F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f <D$34D$L$d$ 34 34D$D$fD$ D$5`{4Pj5`{4^ l34,^_[]VPhht@jo t1hC#ktP$t$uչЉ%~34hC#rkt(P\# 34 342 34 34u.hD#!kt P #Tƅ~534hC#jtP# 34 34 34 34P^V[tP=?4t1H V^PL$$341Qw$& D#M(uMf34 xD#4D#+D#"D#D#D#!D#=YÉ$D#/uf34'D#uf3434WV׉vu1=?4u WV3^_SWVPh*D#iPi1Ʌ 2h%ui{N&t?4Qh34t?4=D#t?4Vy )+#?4@D#?4CD#?4>&?4#?4FD#|?4q"y?4@4@4@4 @4@4@4@4~ |n4;4p%@4t<湿#$r#$r#t @4d#gtlj=$@4ID#Od34LD#>XD#t (@4iD#!sD#t ,@4=m4t8=34u/湄D#0@4sS&4@4=0@4u 4@410@4$r#u 4@4$r#$8@4t8u`348@4$r#⹀R&q<@4=?4tt8u`34<@4$r#r#:@@4t8u`34@@4%$湇D# D@4t 8t1@ D@4$r#1H@4$r#D#%VWWhP@4hL@4q#v&V5P@45L@4hX@4hT@4HR#O%V5P@45L@4h`@4h\@4B&O%V5P@45L@4hh@4hd@4#;tlj=l@4#mp@4 2&A#$r#$r#tơD@48t,<$1QQPĉ PW:<$Ww@$hD#t@4|%=2$r#u$r#u$r#D@48t2<$ 34IQjPH PW辪<$W"w@$4#S>x@4# tÉ|@4y#$r#tƹ"=?4u$r#t‰h$r#Ɖ5@4>u HK4^_[É$p@4z8{lV t<0 1=?4u Vm^USWV׋t$$\$l$;Et*+u(O%$r#t D$ L$M^_[]USWVր9tMτtC1@4 2U534W谂 @41@4U534V蓂 ;@4|ut$`34^_[]Ë (@434USWVL $։ύl$ D$?hD#WT)?SWU4X D hr VU $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$Oxt$4hr VW^ L^_[]Ë ,@434V=m4t =L34=m4uF 0@4340@48t!4@48t=?4u x@41Bh34=m4u @434b=(n4t (@434H@4=m4t!=34|1Fj 2F;534|^Ë |@41B^ x@41B |@41B=@4ug=m4t =L34uN=(n4t ,@434=m4u $@434=m4u 4@434@4Ã=034"@4Ë t@41BY @434Ht$j5D@4葄 1B)=m4tË l@49t34 =m4jË @@434 8@41BV=n4|@4tx@41B5@4t-F=?48@4t<@41BV^Ã=?48@4t<@41B^_%@4t P@41B>@4t h@41B'@4t `@41B@4t X@41B@4WVD$ #=$2 lj Ƌ T@4j" \@4j d@4j=@n4ttV$ L@4j5@4^_WV|$ 1Ʌ<+u OL$ GWfp-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$(&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%VDptrL$PQV t4uRL$xD# $x2P D#T$x D#$x D#w^1JD#^aD$# $2  @49uVD$ T$5$2! щ щ! ‰ 19^Ã=2thD#Ë p@41BSWV@΃=2tt@4tVsntx1Cj S*VGVmSP_GVh%P @4=@4!VhD#j@WWZ@^_[ËD$@4WV92t#֍|$RQjW輓1B$52^_ÃwX&ÉfUSWVPt$ P!уtRPtt jhD#jhD#l$$\$|$Q t^tY9uE} 4u ;Ճt(ˉ $19u tC ;$u~2KՃujh%E#t jhD#jh E#D ^_[]1ۅs IQRP踒fVt$t=2tjh9E#52^á2xy=@4uE @40@#4@u.@4jhNE#?t P{4t2P25$34/$34V1N=@4t9t/ @4,@wB$@(@1҉,@Ɖ^USWV=2@4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`E#1@$qQ52u 9D$}@4럃^_[]USWV-@41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5P{4(@4@9@S @41JЅt8=@4u/@u1u0@4@ '[WV@41t[@t @4v @44@0@{!уt RPF1G)t P{4t^_USWV@4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH@49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë @4t$@(@ ,@1HUSWV5@41H(@$@9t#H1ًP1 u,@;Hs Dn4%D$z9tG1؋O1 D$ ~9 $tG#G=m4t @t2x9 @}lh jF$tH @1HGG7FGF8~FNOG Fx ~,@;GsN+m4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@FW!ƒ5@4@@2tOD2Q@u;G  )RQ@w u&@40@4@&OD1@l$1tʼn$yjhE#1=,34u 2x~OUQP 5@4@@o<$t0@D$4@=@4tU=n4u#L$ Qhm$ n4j2=@4t=n4u q=P{45@49>tOOHO@45@4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhE# `K41H^_[]USWV@4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2á@4@u1I4@0@Ë9t1JQQ 9u@o @44@0@1@@(@$@,@PPP@S!ƒtjhE#81PPjt$S!1WV@40@4@!΃t@@9} 0@4@^_SV\$t$ 534({@4h8@j@4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVR!ƒt@4 @4@P534vz@4@u@^[SV5@4@  ˀuH9tPQP P%dž @vv Hu5@4@uE u@5@4dž@tV$1@4P534y^[á@4t@1fWV|$t$ t=@4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV1:tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$r#jd:hJ#lLh B4hB4h$B4h0B4\$ -uF :tjhJ#]jNbt'.t5B4bt0:wtptcu+$B4F&jSh B4 0B4jSQ ,uF B4B4B4B4B4A4B4B4$B4A4(B4A40B4A44B4A4hoJ#J1tPh?J#J1F$2VhJJ#Wh@4P(hSJ#dJVhaJ#Wh@4P ^_[h{J#>JPJj3,81B thJ#Jƅu&hJ#IƅuhJ#Iƅt]hH#V{u6hE#Vzu$hH#VzuhH#Vzt1BE#w1 3TA ruƀ@4ƀ@4ƀ@4@=u=@4D$@4SVt$ A4M1ۅuDA4;1Cu12(u!=m4u2 1ۅÉ^[D$@4ËL$=r!=@4tP5@4j hA4蹁'@4u A4A4uA4ESCA4Ãw@@4uQhkJ#VPt$ u A4ESCuw @4u;Vt V5@4B$A4xPV@,@@4uPhkJ#V5@4j hA4A4^WVD$L$ =@4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=@4t'~3P19wKS>~-19s2C,9r9v)CK$SUPuF8AUVo ɋl$u9tSv RPt1|$jjSOF ~.EFE0uE^_[]VTJ4t";T2t1FVh.uD$ L$PjQ课 $T$e^_]Ë dJ41; LJ4|$(2D$ $X2D$D$ $Uj $Pt$Wփ ShUw S;C1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=,34o=82u=h2u =h4P1TAPB@PjVPwvWB|8QZtQL8h"WqnÉ4$pu1ND$PV.x#D$ =uhVuh4K#a0tPKƅdո(2Ex uָX2Fx uhAK#h#S[m T$Zi]VUhUK#S:SA4$VW[WVĀ^_[]SWVhxK#/P/tt;^_[&h#VAC1ۅt+hrjjx J4J4$t,tV#hj:} =P{4TeuYÃ=P{4e4΃eJ4~o6/=J4u #=J4 t t =^=J4;J4Ct}.CЃ jS&ed~hJ4 J4J4=J4t J45=J4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=J4iJ4ihu%jjS\Fc`$H&=,34 %t#-l25J4=ES[jUY  xSJ4H݃t =!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5J4 hL#9349p34934=J4SJ4C1Ƀ J4J4ῃ5J45J4J4/U]VsWWr!2@*=34%J4J47`n4J4h#jjJ4J4n=,34 5T2J4 }hK#J4 _gh%y1PPv`n41; J4J4 J4HJ4J4/=,34 J4%hL#1PP9349p34934؉ك u. u.S莍iJ45l2J4%aih%{jVyJ4J4 PZw J4 *J4уBЃ@*? !1҃ ƒ!D$Z=J4,934t 9p34h 934W jhM#j#t$(VXOVrlp1BsRtM&=34=J473J4ЩuJ4Mj5<2ùe=P{4Iv_*-t%+q1҃¹) J4J4S\B D$t1< J4D$ D$ PD$PD$ P萪 J4tjD$D$-<{|Q<`ʃ=J4tR D$HL$@븃@J4|$ ^s 8eBJ4emhL#1PPL!ùe934e9p34e934e e 1?PS1FP@/J4Ph$r#5J45J4虤 1;5J4J4|J4J4n蔰VVA 1;J4J4  J4J4|\34'M1PP5\34 =m4 J4 t|7ػT 1;J4J4|J4J4蛻=m4J4u' J4|5J45J4PJ41QQm1;J4J4 J4J4|\34|C=m4u5J45J4P1PP5\34A J4J41҉3P5m41;J4 J4|J4J4m4聺觮5J45J4DT5m4JJ4NVhL#h1PP5 ùe934e9p34e934e e /йSE*re|褹ʭN4J41N4 m4 J4m4 pn4 J4pn4h^C#Cjjh+L#J4݋5J41ɸd9 jhOL#=34t>t5J4N4J4m4J4pn4j)eD$t Pj{@eJr蘬 L$Qhm$1;J4J4|J4J4)O=m4J4u' J4|5J45J4zMJ4jjP1;J4J4|J4J4跷ݫjj蟷ūD$<3D$PhK#=,34jhK#VR J4J4m4 J4J4m4J41ɉ J4|J4J41@Pe(ejhL#e1;J4J4|YJ4J4 諶Ѫ=m4u5J45J4Ljj- J4J4ʃEݣn4c J4J4n4J4  J41; J4J4 J4|J4J4q j5<2?J415J4"5J41;J4 J4J4|J4J4 j5<2RCiJ41D5J4=m4t5J45J4J1=W J4iJ4me534V?P/V$J41ɉ J4|J4J41@PuGjhsL#J41ɉ J4|J4J41@Pk 2V_e!ֹe5m4RPyJ1A诳է J4J41҉AQPcMN4NnN4J4>X`hL#r1PP?ùe934e9p34e934e e S賁+̲1PP5,n4n豲צ1PP5,n4jP#'J4J4ؽy蟦=m4t5J45J4Gjj5J4d:0ؔJ4J4艽*Pjj5J49; eS贔D$D$Ph M#{豱ӡJ41ɉ J4|J4J41@P"etbt3tFu j11A; J4J48L#|$r#L$Qh@L#11%J41ɉ J4|J4J41@P'"e11A; J4J48L#|$r#L$Qh`L#je534<h#P$5341=tjhL#o5l2J4nvh%1SVUh蠻Ag5834rSPx]n4 34݉J4 J4N49‰}J45J4)‰N4`K4en4 34J4 J4N4`K4i1J4J415m4QPHFjhL#H3D$PhL#d ։u=J4tJ4 J4J4e,5J45J4tI~V8JjhK#bUSWVP趮ܢGVD$1Ƀɉlj щ N4N4@4=P{4uH9ljD$u21xUUjn6 9-P{4u;=N4N4D$t@4 P{42t8teue^_[]USWVPӉơJ4uJ41 r4$0utV4$#J4J41ESWPO áJ4 J4 J4tu1Fx` sKu j]j%u0SW5J4 áJ4 J4 J4ujhM#t 4$4$^_[]WV=2u=m4t =L34u袬׮t D34@34!ʃt]5H34QY`K4u =2uP5m4=@4m4@4u _BLE5m4=@41jPPB ^_SWVJ4߾E%t#J4/ V+=J4u V@t hM#t u%%P1\K4PP^_[V蛫ơJ4"~S.#V$^%=,34J4VPujh?M#  tY>!t J4t P8 V!J4=,34MJ4.h3M#qF<+t< t 34t Q V菛34/7E=,34V蜭h9M#Pt% =,34V^XJ4^(N5J4jF5J4jQP軯^5J4V5J45J4J473J4J4PV34h3M#h$r#r^SV J4t s7J4ZbJ4shEM#iJ4 shPM#QJ4 sh\M#9J4thhM##J4 shrM# J4fyh}M#J41Ct$‰sShM#jVAVJ4CuϹ"t % sM#Q\K4^[fD$=@4t@WV|$ Wjeƅ~WhV\& ^_USWVt$0l$(|$$t U,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD @4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tWh t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f J4 J4 J4 J4USWVi $AD$)< u?FP貛^tP(9~qN#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2hM#htjPV jhM#hM#h%tjhM#hM#hjhM#hM#h%tjhN#hN#h^Vt$ t:j jN tL$HΉp J4J4jhN#荞^Vt$ t:j j tL$HΉp J4J4jh4N#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVR 1H^_[]hYN# t8tMjQP[ ƅuhK#t98t4jhiN#P/ ǍEjPW W iUUUSWVP1F=,34jt$辌P#19jV n1PPPS!ƒJVWS <$S/11 ?$:81xM'x+xG1O|E(|n|dȃ|$J4tJ4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S1N^_[]4$ |t|uVP11xtɉSWVhJ4t$b<ƅui\$hJ4e5J4PShK4I5K4P|J4tJ4hK45K4p^_[ËT$ J4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=(n4ÃB1ۃ=(n4ÃCɍH9 34~Pj#|k`K4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=(n4ÃB61ۃ=(n4ÃC%|$mu934~HPj#j`K4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$P V0ʼnP D$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWD V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQet1=ln4ƃtEuG%t|QhO#hh/&AVhm$6a Eu ?=u Qh"P#$ u 覣!ƒtVHQhP#^Ã=ln4t$34tPP&t534ËD$t534PF$1PUSWVu19534O34t_jP%=34tJtWg%W"=34u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =m4uID$xAPt4D$8\$PhN#FًT$WVt$j 1@t=34jWd$534t$V$t$534g$534$h@34534#X34t$ t$ ۨn4=hn4111P{4D$4PD$,$jUuWP *W謻 U~ڃ,$C^_[]SVt$ h#V 1Ct'h^C#VthN#V1ۅÉ^[WV$ VtVWVtWt^_USWV 1=n4]=,34Pj\h"L#1Ƌ|$ 11@L|uM@-u)Fh#W')1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$PW "S 1tXt^~u1O\$$D$jPWk uQD$P4D$(0#^jhP#4|1 ^_[]ÉOVM;t;VM1|$rɅuŋD$(N#1O;PrS& USWV=,34t^_[]j荈hP#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhP#U{PljD$UVdWYS\$J,8jUHrS\$SVUPd4$> S5 \W# V=L V|V$}#N@ |^WV|$=m4taPW}1=m4#D$=W]*jP`qWP%hP2LPW }x#D$=@{WjPqWP%h@2V'w WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj534# QPX|t1GL$ T$34K43 0K41@ u,L$3 t'sujjh(4$jw!уtjt$WRPS#^_[]Åt34HPjytm=@4tPay1u11FUvUVRPVjv!уu P{4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 34~&111RP!уtF 349| 1 3419^fVt$tsVGF9534u#1=2tu1Ɂ2tщ 34AF=2tH dK4v  v ^ ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tádK4USWV\$S@Nj522tv W6WK |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@dK4VEESËnU9Ë\$sU蝫 SKeFW舫 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P質 w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=N4jjPWV^_USWV,T$Dl$@ظBӃ=|n4t  n4t0K4 @1)ʉ|ЉjSUQP虊كQP4v=m4tK uu|| t u+| t uP{4ttP{4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tP{4ǃ݃ tkwRPW v=m4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N N4 CfN =N4=m4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1m4l$t$1E1!1M,^_[]Ã=n4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdQ#c^_[uƉס34HPLi11 u^_[8iWV!Ӌ 34It*QRP4 34HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhR#bKy1V[hVjRPUo=m4jusj'hD$ jhD$T$l$ !Ѓtd9}\34H94$SW!уRPvlj9Љ $A34H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$341VVjt$t$PY95m4^_[]1K16-XK4-`K434H $)QUjSWP(1K[6=m4tf"g15`K4SW=g34HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9tK4QU#>$4,$tt=t|<9tK4|wC^w \$D$ShU#jWn$4,$*U#f9tK4u+9tK4}9tK4t9tK4hu_G t t1"~#ut|\tt t tL@?3~|$j=W贮9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuU#$r#6$4t$ t t_G칒U#$r#$40tUPStuU#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVrlK4^_[]SWV׉Ή5pK45hK4h}U#hS=w )WVRQlK4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl3 t^xK4xK4yK4JtGtO GO xK4yK4l3 txK4uxK4^_[]ÍZ w6$'tEGЃTZ$'btPeu>fxK4랄tGOm>2#놃>4#w>5]&h> 2&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]xK4yK4d   >xK4 xK4 yK4zK4~K4RhU#jhxK4`U#xK4_t>$r#vVhU#M4P+t M4ƒ"hV#蹻M4Pt M4V#jVLM4jVLM45K4h N4hN41$N4PҎ $uHN4^1|$áPN4TN4SM41N4M4 M4M4 M4M4@M4;M4|1ۉXN4\N4`N4dN4hN4lN4pN4tN4xN4|N4N4N4N41HTN4PN4h N4#hN4$N4P $uHN4[USWV\$0l$,1=m4uSUƉסn4 Hn4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| N4=n4tU tN4N4ZN4M4M48n4 N49}QN4ƁM4 M4ك=m4WV^! tt$j VRP)NV1 4n4)~$N4r5N4ƂM4 M4Iu܅~+1ɊT 5N4~=N4M4M4A9uסN4H N4ƀM4 M4N4XN4^_[]Ë n4t 8n4=m4t14n4@V5M4M49}9 M4<u"M40Ph N4 M4M4F9|Ӌ5M45M4N4XN4^SWVt$\$u$D$0j?oP/=@4t&v!Ss1҅ SVqt1҃Pn1҅t$StM4~- M4Vt[uM4 M4LV3Zt M4t> M4VtV[t'i=@4tVs1҅ƒK1JFVY# @4#@4#5@4#?4‰^_[QY# @4#@4ʉ# @4#@4áM4N4XN4N4áN4M4N4XN4ËL$1wQ5M4X1SVt$ 1ۃw)V5M42uV5M41ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1V#9u!B1@uDA;1A+u%uVt1@^ÃwV5M4?u߸ع#L$1uj jE1ɉHH SWV=xN4 u|$t$\$t-1 |15N45N4tm1@Z ugxn4t m4uU=pN4~+N4 N4\@N4pN4xN45N4=N41xN4=@4 pN4%=uaN4PN4N419RhN4bmhN4mN45N45N4N4 N4H N4pN4u"N4N4x,1WV=@4t N41At^_[ÉШu-%=tS0lpN4=N45N4뢋N4 N4N4pN4USWVӋl$,|$(hN4=m4N4uBu>%j jzC1҉PPN4N4hN4hN4twQPl'UWS N4xtN4PhN4蔅1N4hN4u+pn4tm4A\$l$͉=@41؋5M4M4hN4Rk5M4UWS% 65N4? N4N4PV軄HN4@$N4VP诅V荄 HN4AVUUUЍ@@HN4dN4 N49}oh N4藅ơdN4 N4Y$gQVlu&M4M4PjVPmlN4$#5M4N49|M4l$ EVjUek L$ )v %uhN4蚃5N4 N4 M4; M4 5M4|tq=M40jf jM49u"_l$\$u4Шx$_l$\$u$5M4 _ ‰$ u*tn4t =m4uKuG ڃ^_[]@4m_uiud1UWjXN4+N4 t3K491J$;K4} qɉы4K4)t _M4\$ PjSi 1EL$M4) M4PjS`i ǡM4 M4tW4V)XN4~ZlN4t\ [5x3)Й)֋$F UWhu% N1hN4E1-hN4$_PdtUW ]@4t6=m4t-QdtQd UWl $UWS t1@1^_[]SWV=N4~4։1N4Pd VW u C;N4|1N4)^_[Ã=pN4~N4 N4pN41WV=pN4~N4 N4mpN4|$t$ =xN4uu 15N45N4itb=n4tYdN4349XN4|`N4XN4\N4M4A34 dN4H9XN4} n4 j n4 n4jf=Hn4XN4tLN4tBx dN4 349}; j,XN4P dN4 349}N4ы dN4 349|L=?4tC?4„u0=m4t't4|$t- 1j1j 1j5M495K4 uM40M4^_V=m4uajm5M4—tMȺj9D#Fu=N4u"Ⱥj>V#Fu^SWV։ˋ=M4GM49=K4 uM48M44D$ XN4; `N4~~ `N4M4\N4 XN4^_[SWVM4 M49}1T$5M4ׁtu Ӊ M4@9|^_[ËD$L$ M4M4VD$ L$=tN4u=m4ttNI1҉ tK1GN49~M4M4+5M4)΋ M4 M40 ~^tN4dN4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8P{4u/K4H9| Qu@M48GO1H^_[]cS M49t M4Mtۉ>?SUSWV-K4\-jSqx jSdx DžtVtRU5M4V+ M4UPW U~ 5M4~ 5M4=M4K41t W~ 1Gt V~ ^_[]USWVL$D$ʃQPO1H…t$=K4M4D8OlV tnP{4uc~M4>-K4u@M4 (I=K49rHŠIJM49s=K4)\8OVà uQL$ t M4t=K491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V)} 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15N41KN4|EtESSP t衴N4@ԋ=M49=K4 uS1Hte1ɺ|3:tWAuN1|31I:t?@u21|31I:t%@u1|31I:t @u^ËL$H1Ʌx 3USWV։Q茵@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=m4u1@$5XN4+5dN4~1; 34^USWV։L$|$0\$,ЃtlN4!t6tC؃T$RjQPWSQ=Hn4=N41ۀ=|N4tw4$|N4 HN4ىȺVUUUЍ@)I(N4~4,I(N41E 8Vt$0j* G;}|Cu4$SG N4tf N4N4!Ƴttt$,9} 5N4=N4|N41ۃtQM4 M4T$ 1ۅ~&L$ PjQ\ M4~M4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1EdN4;N4uXPN4#TN4uD$,PN4=TN4=N4~01 N4 8jG;=N4|h N4tXN4;`N4~<$~`N4 M4 \N4$XN4~1 ;j_G9udN41;N4uD$Ph N4tM4 M49~~51ɋM44*1 M4444A; M4|١M4) $ dN4M4 dN4; N4~( n4 jdN4HdN4;N4؉^_[]WV|$t$ =m4u1WVP PV WVt1@1^_ÐN4H ȁg4r1g4g4N4g4g4g4 g4 g4g4g4g4g4g4g4USWVL$0D$,l$$g4$g4g4t-9Br }$r1z3|$( Hg4u$$rg4t :=g4g4g4<$:rBJ jl$(jWg4tC:g4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?g4t_ )ϋ,$]}g4tg4tV+BJ NF=g4uW-g4MEu$9ˉ|-g4],$ϋ=g4t sKӋ$JHJ^_[]USWV1=m4tD|$(T$$!t3|0g4g4=g4t'9PH }=g4u11CŋE1ЋM 1 u ]u,g4g4h4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}P{4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[P{4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSth4 11؉^_[]Ã=h4xÃ=m4u `K41m4Ph>V#4Vh4xNH h4d|@h4* g45g49|jhVV#z5h4^USWV|$ l$1Ƀg4g4tKC9g4g41 g41 5g4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9P{4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RP{4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=34~%GW8É!Ѓu O;=34|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhQ#2N41111ۉu WVSU1PPWV+P{4u Ɖ!ЃuN4^_[]WVT$D$ =Tn4t 5Ln41)|щƉ^_fUSWV t$ >-uF(s7h%+V+h2#+艣D$1S6]+S)S\^Sw$SL!jy WZ$h~#À8t>tkV聪tmSʼnD$ݨ$UѨ $ȃ$jP'袷t$PSh%t$Ut$m  Sa'Ņu>tVhq"F'U1U{m jl W#WZ 1FVJ]V'D$$t*P*hoV#y*/j ))3`K4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhV#.1N\$h"S4h%Q)SH)h2#;)3(1S|&S[jj 诳1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS|jhV#1KtL tGf;t=ËFHN~ ;F~à tQu VSV1Vj IJ1GWZWg%e1=`K4VZ^_[]fSWV1h41K4t 5u'#ar'G__ _Gt PRj GF6u^_[ËL$ 1ɅV-$t:m4'W.t7^uM34m41(m4$m4,m434 m4m41m4 m4 m4m4t Pdg m4Fu,~1S薺PW豺Fv-g ^F~ ^v;34t PNu VSWh ^_[ËL$t@;34tjhV#x)1HËA QUSWVD$T$1ɾh4=349~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9m4u (m4$m4uUSWV\$SκƋ m4t@PPV询um4 m4e Dž m4We u^_[]USWV=0n4|$,t$0h#W l$(m4$m4!ʃtWj UQP" m4um4 h#Vtm4VU,m4PhV#W[u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=349Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft Pbd  $FQF^_[]V=,34tjhV#&dt$D$tt/uKV$34;m?u7=2xCjh3W#뵃=2x%$34QhZW#l&^jhW#jhNW#{Vơ$34t Pc VޣP$34Vlc 5$34蛙 ^3 34VD$$L$ t tC8.@L$$Vhf&Q 3>jhhW#3xxPhW#j VV覝||P|0tB D$0PhW#;D$$Vhf&P >t.jh~W#1m4L$QhW#$^ãm43V3x$ 341Vh@BVPRQ_m4^VD$$L$ t tC8.@L$$Vh#Q 3>jhW#3xxPhW#j VVm||P|0tB D$0Ph+X#;D$$Vh#P >t.jhW#1n4L$QhX##^ãn43V3x$ 341Vh@BVPRQ&n4^V|$u%t$jVt0PhOX#N#^V|$u%t$jV؇t0PhlX##^SWVD$L$tP0m4p=,34tjhX#"VP>PR Zt V踘)X!ЃtV谕5m4SW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t P_ VӟP03Va_ 03QhX#!^V|$uJt$ =m4tV34-4m4h %_V_h@^^WVD$t t0t$r4l7=tDMtGhuXF 3Pm4r4Qhm$5!Emtwt su!FF3Fr4Fr4F$37R^ V^_D$u5m46Ã|$"7VD$Hs^\jhX#7<3V)h$&PhX#hX#Vy;3xu'hY#h=Y#haY#hY#hY#hZ#h7<wVȃ=@n4utjhZ#$FVPMy0PhZ#^_ÉPhkZ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;K4~K4A9s } uE9u9t},u E&| t3K4+|K4x3 ^_[]WVD$Pt t*$TV處PVLD$ps D$ stopD$Tab =t3|i1Gt$rVQfD,VA4K4h&r#P? G;=t3|VD andD theDen t$V5x3hZ#Pw? 0Phm$D^_à D$t t+uyL$tJQtQytWjhZ#Mà$2L$%2AAD$Ph[#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh`$QVP46h#V螕t5>t n4 $ n48n4tP9n4#L$Qh[#O ^ËD$Hsjh5[#/Åu <34Ã|$u=(n4D$u =,n4~GT,n4ÃD$ u)=4n4| PhF[#4n4ÃD$ u)=8n4| Phs[#8n4D$u"=Dn4t=34t*!ƒÃD$ t t%uCD$ 3^u2@t+$3"3P7Qh[#V D$,L$(t tC1ɉ Ln4 Pn48,uT@L$,t$VhǓ$Ql >tejh[#Ot$5Pn45Ln4h$jV0Ph[##t$D$,VhǓ$P >tjh[#9 ^ãPn4Ln4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G`n41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&\#1QZS`n4^[ÍD$Ph \#҃=m4=Pn4=Ln4Ë m41 34+Ln4t$4Ph}]#h8m49 8m4USWVl$,H \m4t&AUjQD$}ol$,7F]$$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}]#h8m48 8m4FVEŅ8D$EH$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=m4nAL$,9 ItIT$uWoD$,74m4j+o2Ph}]#8m4V7 T$jV%D$,|$?+34t PQ GP 34CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WQ |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh`m4P \m4I\m4^_[]É|$|$ u D$Phc\# D$Ph\#͉-\m4ōD$8Ph9\#uA0h|]#j*h`m4ŲËI1Ph]#j*h`m4課USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph]#=j UQ xt-u)%tt0Ph]#1H^_[]SWV9toӉQ賊@jP ljtG\$=n4t <\u ~t F <$t)\tPSet GFFuD$Qh]#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$`m4Ph\#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hp#3rtP~31@USWV\$(|$$1E=n4uhn47?n4`{49<$l$D$l$ =n4t=N4t=n4u3=n4ubPjD$P D$tD 39PaHD$=@4t=dn4tft$,SW! n4=@4u"t1n4@n4| j=y!辒8谒8#1Hpt9=`{4tn4[1n4D$ D$D$$PD$Pj 9=`{4t P{4t, P{4n4^_[]øjhn4藿UVVe'Ve^]USWV\$0a SV,jUVSh:7#UP ^_[]Vt$V` uVh"p#hn4=, n4^USWV D$0щL$l$ |$$t$4PWUl-ƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV -Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S,׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP9,Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRW+i)$l$D$ ׋ $D$ՋD$1PPU\$SY+ыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP$e^]fSWVPP{4t `K4Z1n4WP(t>1C4$$n4u V WSCu ^_[S=r4tr4 \$3=r4r 3H 3r4[V53n4t(n43VP53 9t `K4^Vt$53^Ã=r4tr4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRV|ي,p#O u݃|$0xG-Wt$8薰 ^_[]USWV\$8T$0t$,11|$GUSRV{ي,p#O u݃|$0xG-Wt$8' ^_[]SWV|$(L$$\$ 1Ѝt$F,p#NuxF-VQگ^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Px ƃ^_[]WV t$RVQ t|$P3GuVax^_9Hw @sÃtP=USWVPt$|$r4V<$=n4uԇTh=?4 pV#Vt$ P]Eu @448JMp;534| `K4^_[]VWj .^_[]ËL$T$$r#PPh=p# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFur4^_[]WVt$|$ zt!3Ph\p#PhVp#$r#PPh=p# ^_WV|$t$ t%WVra7ft=34 `K4 j Qu jF^_fUSWV\$l$=m4u<؉%t1Uu1GWP?[PW1WPPUVd[1 jj1=341Ƀ=H{4HPVW!W Åt!Wn: |$t8jhtp#'D$ tP.bD$ 05: D$ 89t V: ^_[]Vt$tPa69 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQz ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u sD$E ʀ[} m4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø_&fL$tt"u$ 3434HI 34Ir4ʋTUSWVD$T$ 345r4|1Gll\G9uTD^_[]SWVD$L$534r4|F|\\|N B^_[á34~Ph5r4} USWV 34; r4r4th!t 1G31K;)1G1I4:tl!GtˉPo6  34jQJƣr434r4~PhV2} !t\l^_[]USWVPL$\$As 3411H$(u341@$1r4<#|tZr44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$r41H; t$z|#=34|O1;Ll |C9u^_[]USWV 34~.r411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5r4A1G1֋l9߻rB9u^_[]ËT$34!х1A9Hhy'*r4=m4't'P r4h5 'r4h'3h' 3hh'$3USWV \$4z4r4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$d'=m4EQ-s4C$ىË $Fw$'#Fw}$'X!уj WRPBBtDt L=m4!1534h#P o1sTu~-h^$PuYQA tLу|=RP螽1 $1=z4r47f1=N4u ÊCCs|,v, l,uȡX34!ƒtظ:,u534资j W5N4QTу 345Ln4n9|$ V534534蛅PtmƉV0 +1+5Q ic+Ɖ!уRPUVz4=r4H8 z4H=r4wA534kP豄 !уRPaٹ Ln4 34VQRPvig 434534,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/1534Mj WP j W1P9;"@|r4$r#9 z4t r4$r# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5m4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5m41=m4tȉt 3r40AX34^5$3'SWVQgNjz4عz49r Ѝz4WVSC ;z4;^_[VQ!уu$x 34H9}FV!уtt^^Ð1{4{4{4{4WV|$ =XK4t5{4tZ=H@4ta=34|<1W!уtRP虆Ws@G34H9|vu{4覍5{4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=H@4=XK4t4$=34|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$34H9|u $u^_[]Ã^_[]鍌^_[]T{4K|$th{4m={4t1={4{4j jhp#"V΋At Pg* FVC^h{4SWVt$>t_w ,* W#* ߅u1F FF1H,{4({44{40{4^_[h8{4SWVQ1u(\$|$8{4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-8{4Vt;xH|p$x Hȅu^_SWV|$t$u;8{4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=n4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^{4U1tHt$ !t Q9y}1I(t(t$=|n4tT$$1={4uȅt^_[]h{4{4=|n4tUWVjW7!t"j]jRPWV je^_]Ã= {4u m4H{4{4d {4Vj5<2t2{4jVx 1F=|n4u={4u@11N^USWV(U ]1Nt$ t$tr:tm1{4PSi( |n41 n4t)1V5{4h{4 |n4n4ttxq @3{4 |n4t =n4tj)|n4u={4t{49{4J\$tP1ػ&!Ѓ1ojhp#D$Pj@t$>SD$$PL$Qt$Tt$V>L{4$u:4{4 0{4!ƒt&9L$L$|D$;({4D$,{4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d8{4T$X/ t$i t$ ] \$(T$_CtN4$jjD$xP$Pt$4t$5{45{42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=|n4u?h{4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ N4L$N4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$N4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8N4`K4t$ t$  }tEL$L$H1USWV8=4{40{45,{4({4D$$8u=L{4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}4{4 0{4ȉT$!Ѓtsu!9t$ƄuY,{45({4;t$T$$|@Ut$ 9D$ЉʋD$4$K4@Eh{4h8{4}!K4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># {4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=,{4({4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$4{4 0{4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 0{4D$4{4D$$({4D$ ,{4e^_[]1JЋ4$|$9ωL$}@D$ K4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=L{4 USWVt$h8{4tH>tC\$1EjU1GGGUSxLL{4G=L{4-5L{4t~'V uL{4`K4^_[]Wp USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5{4jjSt$DPV5{45{4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@4Ph{4oUSWV T$(\$$t$ 1`3PURS0)ˉ<à uVhm$3Zt$|$u u)u%u!1ɃtsQl3Ph"s#Yt Dht#I^_[]SWV \$ hSh@r## uPths# ^_[xEhShq#o# 4$٨t t$ɨj Vhs#뙿 hl W=53t$S jWt=|$Wn[9uR1Vt$74$LjShs#VOWV|$ 53j/Vt@jWh'Q#QV$W^_1@4Pj<ÊD$03J 03;@3~{у ts (3Q(3jPh4hq#" th4h32#PZt:j53P? f=3u54Ah(3Qb]h4hPr#WUSWVt$81GWh~z"5 4蛤 1-4hn S;D$h܁4SD$U Wh454葥 tLtFPFuf=34tjQPV Pkjt$4l$0joD$T$1D$EHM~EHMU.ڃÃ=4uf=|3u0Iڃ% tM 1f=|3@ ЈD$P D$ƒ t|f=|3Qq f=|3uf=3tT$j \$Ct,j Cu\$T$f=|3x댉\$ 넻 $f=3tD$ @D$ Ph%r#sUڃf=345l3jW54蘣 4 4 u61=d4#$ |39uj5$t hs#Rjڀ tf=|3u j ttFPFuj5ÉU+t$j8f=3t'+\$|$f=|3)r#tbr#WSP jh454T h4jjc (^_[]USWVP\$D$jP54 f=31=45l3jD$P54% Wl9=4ttػ1FU Phr#SKtMVh{454- =45l3VD$P54象 W9=4u^_[]WVjPhT4hyr#% t ^_h{4hT4Hrhs#Xы {4u {4Q[h32#PUtAf=3{4r#tr#PQhW(QWhr#V \WhPr#fRLht j64USWV$03J 03;@3у  (3Q(3t$hVh@r# 1GWh~z"5 4ޞ WS6Wj6h܁4Sj  Wh454 x>jƉ׉Ug~*9u$h(3QVEhs#11f=3tj)RPhr# jh454  1h4VW  WV<5Wj15^_[]j54WX1Sj4SW4VVhr#jPSGUSWV$03J 03;@3у  (3Q(3t$hVh@r# 1GWh~z"5 4 WS?4Wj44h܁4Sj Wh454 x>j%Ɖ׉U&e~*9u$h(3QUEhs#}11f=3tj)RPhr# jh454, 1h4VW6 WV\3WjQ3^_[]1W54%j54SgWj 3WS3VVhr#{NWEUSWVPh t#|1GWj2Wj29MtDƅtZWc9uht#|1Vjw2Vjl2 ^_[]h3Wjh#hr#Z1Sj>2SV/2-3j/Ut@SQUJL h3WVh#&hr#WWVPjhL$5 4胚 f=3t%53>t=4V$PVWT 1FVh2#54= |$VW54i ?nu53hr#L ^_VPjPVhs# t=(4u.5 3V7yVh s#Lht#{P^Vt$j5 4^VtVhs#cLht#zEjwCWV5,3t)>t$=4V#PVW? j%j{VhVh+s# V3t$3jha$5 4ܘ 3u3$3%3t$3t$3f=3t53t$$53f=<3RV#t~"Pn3t$3343t$3j3t$$3f=3RV#t~"P^WV,|$8V54h~"W#t! $#4 $ 441GVW54 h4Wj8^_WV,t$8W54 h~"V[#1Ʌ#G OWj54S8^_V1Vh{t 54 jVhzt 54k ^S\$1u0jP蘘[ESWV|$\$1FtCWPt1^_[fUSWVl$$144l4%PhP3hmu#t$4U1I~1L$$D$=48O>HЃ sX 4HЉ5l4jhP3hmu#t$4UC߃ufH1K$ 'l =4뷃EFl =jh"S  jh"S  h#So!D$QPuVl =hS%S?!hi#S)!zh#S!$_=4l =p41@D$<$XD$4=4l =j/S 4k<$$YxD$ P1PhPjPP5l =0  l4L$ !P5l =hu#Qz\x4؄4|4=l =W&*Sh%h4t 1@1H1HD$1@$D$~1HD$$3)t5|$L$(4hZ%VOt5p4x4؄4|4 Vjh*Vj]*VjR*VjG*45l4hiv#j V\DV4$jh(3N#wl 'P_ D$tu1=4 1A111ɣ<3 333=4t 3=x4t5l4 uW6uB=x4u5l4 u3^_[]xVh%v#Hh}v#Ahnv#:hv#j5l4hv#!hu#hu#hDv# hu#hu#jh3jj@hv#j;h3jhhv#jb;fUSWV,|$@h j(W^1ۅ4=x4h4Xu.j 1=|4ȍPUT4jU4x3=4u?jP 4teQ4Uhm$˿4WŅ?1GVj'=4t1O,^_[]ÉVQ=|4uL$ @Vj54. 1Vh t 54h  Vj='1@4jh4WfWVP=P4t 5L4t$uhny#ƅhy#t8/u33y# Pa Vh3P蝷 8%1 '9uQPt$ x 'uڃ=l4u%hl4h:$t$w u l4%hԄ4h3%t$R u Ԅ4=؄4j:hy#t$脶 1Ʌuǡ4u'>/54jV445Є4x4؄4=l4u l4%Ԅ4Y1ɉ ؄44t=4u4t =p4lj:h`^$t$轵 1Ʌ 4=x4u64t=؄4tP541x45Є4j:htR&t$X t 3j:hHw&t$7 t 3j:hS>#t$ t 3j:hb#t$ t 3j:hϰ%t$Դ t 3j:h~#t$賴 t 3j:h#t$蒴 t 3j:hU#t$q t 3j:hb%t$P t <3j:hg%t$/ t <3j:hh"t$ t |3j:h`^$t$ t 3j:h#t$̳ t|4j:h #t$讳 t 3=4u 43=4u 43܄4tPh",4tPh2"4tPh(w&4tPhs%h4h.z#t$觿 u 4h4hr#t$肿 u 4h4ha0#t$] u 4 545L4P4t%j,V>tA1ɉ54 L4^_Vhy# Vhz#hsy#j荽ttu$Vhy#Hhy#hy#GjS4fSWV t$ |$6Z3T4yX4\42`4"h4z#Pd4VW8=|41h4SW 44%4%4%4fЁ4 ܁44f΁4ȁ4h4jSn h4h4h4ht jh z#9d4tz#Phm$; 4 x |AEjj54輊 xPj54褊 hz#ju h:z#j腻1hNz#VWg vtHЃ rt+vhZz#Eh4ō HЉl4봡3)ǃG<13DHu0W5=r$hhmz#`hr#jSGhWhp4 ?t GG?up4p45l4hz#j V9 WjWjWjWjVtuhnv#h}v#jh(3Mhz#03t t4 h#=x4t53u,u5=x453{53hz#j衹Phz# WV/ƿ3Ph:{#W; Vh_{#W; jc0=$4th$4htj jSWV53t>u+t$4t Po Vƣ43h#Vtsd4hi#VtahB#VtShI%VtehS%Vt13Vh{#W: WRd4$11ɺ30 ߈4Bu^_[ñ1WV,|$8V54WVWVX#NF=|4t L$f=3t D$#$d$d$ wfD$ f=<3t $Vj548^_h4jj SVPf=3tjTwt$R 30utztD$=d4„u30u1f=33몈D$< t< u>jV54z f=3t|$ 4#t$r#Pe`u 2 <3tu 3tt A8u1f=3t 3DAt 3DAD$jV54 f=3D$P;5/h4jj; USWVt$D$ $1=(4h jAD$1CSj/h4SW Vhm$5h,4JtWD$ h4jj t$jUj=(4uD$ 1;$ȃ^_[]Ët$$4$ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3_ eȋL$ < U;t$ KD$ V1FVj55(4h4#"cVh,4ISWVP3\$ x3t%\439u Gt+t' u9tpD$jP54 Yـƀ_r`4^?t@آa4b4 `4a4h`4hm$3PW1^_[Pԅ3H ԅ3~Ѕ3H Ѕ3$Ѕ3 t1Ƀ=d4!YXD$_r`4^?<t@ a4b4 `4a4`4SWVT$L$D$=d4ut1<1h41F9uRQP1 yE8th%f^_[h{#USL$ \$1B1t 9tA8u[VL$`4tSA z#8t6u(^@\VPt`4)ƃuf^?݈@`4^VD$Phz#F2=x3x3\4Ft3_r`4^?<t@ a4b4 `4a4h`4hz#1_r`4^?<t@ a4b4 `4a4F t*vPh`4h{#x1\4~ v 7^ÐWV1F4VW54i~ VW54 ^_USWVt$jV54w  uD$41؍oD<jV54N D$< t r֍,f=3t4t P u3D$y1D$h}%P34tD$y3D$nD$jP54{}^_[]1f=33USWV1GWjWjB VW~Vjs4fC4CfC 1l$jjSS~ ~}D$tvjh454~ ~]4Bt8StGWuG1GW4U54| WUl$54} 1f=33D$hU54} jO2Ɖ,<=d4  A9rWD$Pj | f=34tyf=3~g|$_r5,3Pt. 4YSQ;Y~ڃ tZG9r QR4l$!y-8u!PWjl$UV 1Eh@H1jf=3t4t Pj%fSWV3t33^tPtF tFFu҉5 3h{#hW+,h32#W0tRVhW8 t4=h4tWh{#M-j WtWV7%%3^_[USWV|$hNp%W j Wj=Wt@C@uShH%Wu S6ÉXj?W1t0tO@t8JSs?!tOYt@t QtWh{#",~5=3t,3Ft = @t t~vuك=4~h4#:Z4^_[]SWV΋4C!w\C4؋ 03Q03; @3h(3j %14 (3Q(3 X4#|>Wأ4NI$ 'Wh"#+4@4N Q1f~ @403H 03t;@3lh(3j!i0l4v Wh{#* `Wh"#*4@4N tEPP4V(3H (3!6hm$<*4#|4h4#X^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n{#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhH%S>uW 1@WTpljR1^_[SWV31t8ϻ3WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$ 'n tWUtjPu U WQF tQfB t Xth{#V*N 1?!9~ t~ N 9tF N^_[]h{#fSWV,1f=3t h|#'|$Wh~#(+t%th:#(|$ D4$ $ 4hW͝ uW$ 4h:7#9ō$UhP茷 tʼn-t4=h44hPU l x4u%t#P5t4hp#h|4Pu5t4h#p4uG=4typ4Ć4=Ć4tVĆ4hh4Qp4u7J$ p4z$u+hh4Pu,p405t4h#Z:u5t4h#E=l4hj$$ tk 4u$ thO#h4Pu$ thn##4=$ D4h45t4hր#p4tpp 0h# h4uG4O#tt?##4V#@t$r#QPh$#e 4tPhc#Nh4uu+ l40Au*h# l4 |# l4#U#hh4u Vh##4=u#5x4iu5t4hρ#5g5x4ju5t4h# 4tPiu54h#j l4Au$ th#=@u54i4$ th#h7#hq"h00USWVt[ׅtf΋ 't# 'tVPt%]uWVh#_$ jl4^_[]hփ#h˃#hh#h˃#hh#&PPPh#h3l4t@t hh4ЃjFD$t@0h@##1h1#h&#hh#D$t@0hy##1h1#hl#hh#jD$t@0h#S#1h1#h#hh#4USWVh#&#15]&, 'Qhy%h3 't*tu6h3jjh#h3jjh#h3jjh#ǃ#t#FKrh3j %^_[]USWV39u1Ht$Vhht@P V$PPftхu! $h#" 'tc D$5]& '0tBVؽ ;$ݸǃ#D$VPhy%h3D$#uh3h2#蛆^_[]fL$t11f3QBuh̅#h#jTh#`WVD$ tRt$tX|$t3fPh#kfPh#Tf1@^_h1#hم#j` h̅#hم#jah#USWV @$ @F~  ߃| RQhن#%19ս|*Ձ tRQh#J  1 @^_[]û l$ WWSUPi9tmv hB#踑$ =Ut%tv h#"hjU 1$ PPQhÉ11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPPwT$ L$D$19عPh#ch Pv tOPSQhO#6$!u$!$!j?PQv t$h#KQ+PQh #$ "u!$ "$ "hPQmv t|h#$ QRPh4#]h1#ht#h8Bh#ht#h91h#ht#h: h#ht#h;h†#ht#h<h5#$$j@P$!PI Pt$$"P/$$ Ѷxl$$ $8v+)t)+8uHJRQPlu t h߈#Í$  tL$(SUP l$ 1rh$ US{ |4ōPUSJ < ߁WjP N1\$ PPh; tB=NýjPU  9g8t ]8uxS8u2N1 T$ PPS 9ǃu8!8u<\$ShmdvT t*h###Wv h9#v h,#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSPc9u!D$=жxt9wwF̓uv hB#A v hk#ST$1uD1Gu<jUPSvb9tu&v h,#h#-1^_[]hPv h#h1#h]#h h#h]#hh#h]#hh5#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ PF D$VUPW s DD$st$s 8D$ s <D$tf4$l$4U 'pt_uh#hp%hl$h3 'h#h3 uh3j B 'D$l$4$sf@8tD4$t$xV++@S PSV+ \$$Vt$S?4K1D$0D$,D$(D$$d$sD$4j@HP襛 st$st$h#' t$h# t$h# t$ h# t$th# L$9 't uQhˉ# 'h׉# |$4tD$4Ph# |$ gvVD$PU# 16D$8uT$Bg)QPR}o th:# 1@^_[]USWVӉ͋t$V+ 1Htkt$t$VSU}_tGUZt$t$VWU_9uVSWn t'WS  W= 1H^_[]W, USWV$$$|G8-t 3$D$ 1FD$h݊#WSj it 1< '39t9At&9IuJuiu3$tHPh[$ AtPqh# 늡l =A뀃Dtou&t$ mt$dl =$W$uQ 1t$hWV  jSV豽 $FWPP uhT)&VhiP u h#j薊WYT$< '3l$D$G_HrY7S_hjD$*PA ft$fD$CL$fA37SPhjD$&P ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$PN \$ $ sh͏#sh#s h#sh.#zshO#jshr#Zs h#Js$h#:s(hԐ#*sHh#s,h# s0h2#s4hR#s8hl#sXf|$rL$I}#fw T 'L$T$ t$"VRQPh#h#h#jD$f=313hjD$$P fD$|$<3fD$ $T$3hm$]H$( 'L$f|$u#tn#P!D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPhg#~|$ujMjPP菏 jt$t$ V! VhiWr u hK#D$(|$ u,$PD$D$,$|$ 1hSW  GG?t$>hSD$$P G$0hSW jl$UWb whΒ#"h(3Wh:it$V uO j.h(3jBWh:iVM u Cw8)|$#q#P0$rkLPD$$PQ $<1|$Vhے#?t$kL4t4D 'h #h7# 48~1D=PG9uh#O04 D$4!4"4#4$4%PSWRQt$hM#4(h{#444,40k<SWPRQPh#O4`h#;h#.4\t h&#t h+#h#f/4d6|$1A t$t&u/7t$t nu Qh0#FL9Mt$ $t$qVOP$t$RVOh#Ph#h3 jaUSWV։1hUS jWS7 sUPPt t'Sh9iPn tVPOĔ^_[]hT)&h#jUSWV׉1hVU jSU踲 }VPP tAUh:iP uGPhO#{1FSNĐ^_[]hT)&jVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phg#^WVhJ#f>r1D~Ph\&GH9|j]^_WVhJ#ff>r91D>Ph#K 9} j:TG9|h#^_WV$fGjRW# WhiVt t Đ^_hX#j'~fUSWVu }6hh$r#jݰ h#VW訅 Hw$l '44ԃBu|1PP5l =z 4불444444너44sjh(3K_4S3=3=4u.1L$A AAAQj jK =444444ޅ31O=t4$3tch#V@t^=4ukjjVJ ƅD$ PV莿D$(!=<\$yB  ޅ3u1PPV;J Ɖx\$463=t454PL$QI ƅ~E14VPSNH i)u5454t$hI ƿy54hm$Vw 4ޅ31O=\$t$9ȉQ0JL$54u ύD$ PS-54r*Vl 4Vh# 44444VI3hm$xv 43VdI3h۔#ˋ$B6549vPh#h36 1@4$;Ѕ3t=h#Wt1#=4u32#PWZ;? \$Ѕ3\$=4 1$ӋFHN~ HVRƒ =4u u u1G1=4up=4u< u7 =4>h$r#h֔#h(3 43@t>$@$Phє#h(3ڃ 43@ t_  =403H 03;@3h(3j$  =4x03H 03;@3h(3j^K:=4,03H 03;@3h(3jMڃ(3H (3$(3H (3^03H 03!;@3h(3jI (3H (3I (3H (3M03H 03%;@3h(3j-0ڃu!(3H (3-3DPuW03H 03;@3~ƒ t(3H (3h(3Rڃ03H 03";@3h(3j^ڃuv(3H (3^?tЃ@Ӌ 03Q03; @3~ ȃ t (3Q(3Vh(3P=F @t54hm$q 4f 43@uiЅ3\$t V!(Ѕ3%܅3Whm$cq 41;`h(3u 4e^_[]hy"juh$fUSWV$$0Eh$r#j躧 11E1D$D$D$D$$׉jh 3h #$VpQ~Hw@$ 'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jl =$ىY1ɉPXuG 3$T:-u"j9uzuI 3 u 3)t u <$u|$uM1ۋD$Ã<$D$ PtD$ $4u9>WuTWhQ#D$u5t뢍D$PWUu!Whk#Mh#jr$1 |$ $jSVI4 u hC&P=1u8V1CHHf wy$'|$uhUn=Åu뼋ss 脨 PVh:7# |$u.jSUI ss M PVh:7# 1F $tCPpQ7|$t KP;AmPsT$Z|$Oshm$m1F7hD&jq*PPh|#h3jofUSWV$$61h$r#UQ -4- 4-$4-(41Ch#VWy e'H wu$H'(4- 4-$4Ńo'fil<4뙃prvD4oa 4044%$4- 4-(47 4-$4-(4,4 44484048444@4u 3)ǃ=@44u-tX1Ƀ=(4=$4tL$H=(4=$4= 4= 4tʉT$4H4j菁L4P聁t$lVUhH3} 9rUhp#\hH3 H3 @3QT$/u>t$|9A@3A @3I3vy/th#h,#jnt$ D3Dhu j= 4u$PhH3gP$PhH3Pu@68uT\=@4u=4t@$4 (4t3D$ P6 P1#$=@txUhH3D$ P6ZPu6hm$jm#D$=@u4 @41ۉ  t1ۀ|$/uhH3h#.t9Ur|/u (IHr IH9/touɉt$P P4USWVT$juQt. P7D$1t$CHfw?$t'ss Ѣ PVt$ h:7# Psh#>|$(5D3C,H3)=|5TShH3h# t$V771Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$hB#QT$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3hז#t$PV(h L$@3@3=I3vx/u H@3= 4tD$PhH3MD$PhH3/MT$KP3Qt$31 u@T$(3Qt$$3q u.shH3h#[ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h# 1Gt$#KPqt$1BD$ $'=4L$ QP T$ 4 @4sHtbffM T4QT4T$ T4t$/D$ !=@8fushR#jSt$ V@ 1G)=4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=04t$tjQ\T4H T4u$#D$=uYjPV=uB#D$=@tM19t<1jA ŋ9uU{Vhm$j[ PPh#h3jNUSWV׉΀=p5tj}$hVS5i =w6Sht)$ PQh%WSR9?A *!=\5u)!L$QVЃu#D$=@`Vhm$V1C؍e^_[]Í\$SW=u#D$=@=l5u"SWV<u#D$=@=p5h5>/uD$PV<H#X$hSWg W7et?$ VPh%hWD$PW;a#t VQUD$PW<Åp5WVE/PVNt@\$L$/PW.t@L$ Q\$Su)D$ )=|\$=`5u=d5h(3{Wh#h3 ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3薰É؃t9 t4ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3Vƒ߃Y=X5u#D$=@uWlWu8=p5u WV(\5 PWQVQ(tW#1ۀ=t5$u5VPWh#Vh3jj h#ۊ9D$t$QVP躑 Ƅ fDŽ$.$$PQ>9\$4$9|$ t#t$WPg$ D$Ƅ fDŽ$.$PQ8$3$$3$ $3$$3$  WVhm# fD$L$TTPQ7ËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP輮^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPV^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP芭^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP$^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP辬^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPs^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP(^_[]USWV |$87h$r#j# j%t7D$Phht@jM uD$tL3555du 5t$41۽ht#WVZ HσG$'51515555155555낃wț5̛5^ԛ5Oܛ5@51x5"55@155555555 5=5t 55ț5̛51V5Gě5ț51C+515555551551@Л5515555؛5551M55rx5c55J155545155553D$=5u=5u =5thD#gtPL3=5u 55 5L$$ ȉD$5 55 x5L$D$ ы5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uhě5j@5ě5 ě5=5x5tL$t*t,uw kL$t;t=u^ R= K =5u==5 t/T ($ !" =5u=5V t 5)θ0 =5u/] =5u! =5u=5A t 5t1AT3U4|5 ^_[]7Ph#h3 j}USWV΋\$=5 t1PSR ~jPS%1ɉ=5tW L݉t$=5D$WÉL$ CHHf$'ks PUh:7#E |5{Dt{T.u =5tw=ԛ5uL=5u%sh՚#?1TSh#L|$|sh֚#5VWB$ʼnى=5ut jSW# WÅ0W08u ^_[]jhD&jKWVD$ qH1ftYT$zHftIf t$f tf9t=5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$d5D$ 5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P蚀 PSl$$h:7#t$X 1@F F|5Z|$dt~T.u-=5t"fu=5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=5t-T$$L$(=Л5t-shK&j $W$D$\l$t$0Kjs薛Džt=Л5tshK&j $UjsΜŅtщ|$W+‹L$@D$9ʉT$@l$ U ʼnD$<9L$<=؛5t/h#sl D$TPҞT$ 9щL$ 1|$PLS  à t$P Ct$ P=؛5t +Cl$TUPUtc ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=ț5tD$|t$ |$ ně5ʃQPRW[$RPh"jVVaD$|=̛5t$ |$ tHVUUUȉD$|$D$<$$SWhC$VUFU$t$hK&VU#Uڜ$=ț5tDŽ$Mt$4t$55=ԛ5u;t$G  GoP=5tuu s hۚ#=5=ț5t?E`Md jj h$r#QPjV[Vsh$ O=̛5ۚ#t#D$ě5U`‹ud΋[QPVR覗RPSt$_t$Vu_u$<p$V$Dh#*=5u3v,h# svh# =؛5tsvhk# E@ %=`u6E %  1QRv4QPv0h #h=ț5t:jj h$r#u\uXj\$S]Sv(h$S %=̛5ۚ#t#u\uXv(P,=5tE(=5tE@E4P^5 5t =5t =5tIME!=$#Dt;GOTQph%hV$3=5tM%=@t룍GTPhm$hVhD$&PV|  t+D"h=#%5 5t1D$"P; 8D0iu PVhT#h3=5tYD$"P 03H 03~(3H (3 h(3j M$8t$SD$"Phm$s렁$^_[]h#j>WVxDtP5 5tC=ț5t@AI t$jj h$r#QPjVtZVh1#^_Ã=̛5H#t;#ě5yNjIуRPQWARPV賽h#j>USWVD$PPu#tƿD> 03J 03;@3~у t (3Q(3Guh(3Q=5tXD>03J 03;@3~!у t (3Q(3Gu7h(3QxL$D$ ρÃ5T$95}`;L$}XD>03J 03;@3~!у t (3Q(3Guh(3Q03H 03;@3h(3j (3H (3 1D>03J 03;@3~!у t (3Q(3Guh(3QQ03H 03;@3h(3j &(3H (3 e^_[]SWV΃=ܛ5t vrh %c1TVO^_[SWV΃=ܛ5t vh %1TV^_[Ã=ܛ5tATPqh%躺 ÃTQhm$診Í` f w5$ '03H 03;@3h(3j@I/03H 03;@3h(3j*03H 03;@3h(3j=k03H 03;@3h(3j%D03H 03w;@3oh(3j|!03H 03g;@3_h(3j/;1@á(3H (3@(3H (3=֡(3H (3%á(3H (3|밡(3H (3/1á(3H (3*USWVl$(}=5tE G=5t=ț5t(DG51 5Í4^69L3} ^_[]{E ;\3~*P55oO tM \3554FMt%$Q  Qt $ B$Iu$ L3șƉșD$$t$D$ D$|$1ۋt$=ț5t( 5 U tt$ ;4$}Z;D$}El$)š03H 03;@3h(3j '(3H (3 MuC;\$r03H 03~(3H (3 h(3j мD$@D$;D$ ^_[]jk3LUSWVt$~=5tF G=5t=ț5t(G51 5Í,C L3-9} ^_[][Gșljș|$$.1E  E;|$|603H 03~(3H (3 h(3j û1V =ț5t(41;$}D$)á03H 03;@3h(3j k(3H (3 KuGm=03H 03~(3H (3 h(3j ^_[]USWV|$=5t_ C1ۃ=5t=ț5t(C=571F  F03H 03;@3h(3j,|(3H (3, +N,03P03; L3} 0;@3(h(3j ,;~&(3H (3 "(3H (3 h(3j 1W =ț5t(4_ŋv03H 03~(3H (3 h(3j 苹^_[]fSWV|$5Wt pSP? t81PWVo Vhm$oVO ^_[ha#Whp#jy3USWV$U蒊4(F$$1 |$1 9$)덄$PSUD$Pa tXǃt-tat$&d ?tL$T$d$.?T$O$E1 $ ;<3r9vL$?T$$$^_[]SWV ΉRQS{a 1t4u t|uHth(3PjSet Vid lj ^_[fUSWV$$31h$r#We WTD%$ D$D$ hZ%SV9 mu05l =ItChP$WM 뼃pu D$ 뭃u 3,uk5l =hQ#j}1#D$=@u.$VtP< 9r*th#j.|WP蚥 ty/t AƄ/@L$M$D$S蕅|/uH9tx/@tj/SNsޅt@V\L$rSh#蠸1A $'@PVt$ 8 ٍ$Ct1@$Mg4$̤gPPh#h3&j謤 5USWV։π=5ujVCt~VW#t9w8uR\$@SVt{SW9Whm$1ۀ=5VWh" VWh#D) w=5u=jW[CuWh#H#D$H=@V@=5/jVCD$@PVjWBuD$1Pt$L D$2x $r#tu%D$1Pt$\1Pt$`VPSt$D$BPhǛ#h3}#D$H=u}1PPW[ t$HhV? \$D$$5(5VCVh#'1C؍e^_[]ÉVh#h3˭ ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3YÃtH tC ԅ3I ԅ3~Ѕ3PЅ3hЅ3 ԅ3 tuÃ߉1ۃYM@Vhm$&'$$5Sn6 (5t$|$SPt$  Å11S5(5t$H 9x߉= 5t{\$(t$,l$( p&$$L$$D$ l$ |$T$ fT$l$\$l$T$ 5RQPVSt$(t$(h#h35$5$55(5t$  Å6|$W\$S&t$uVh#%SD$hL$l$JD$pBD$tB D$xBD$|BRWtVh#[%t$\t$\W  8tVh #*%#D$HD$Ht$\$ \$D$t$Phm$$VtVh#$t$S1V$5$5t$t$ЋD$HPW|tVh #z$$Wzt.8-t$Vh-#G$ WNtV|$Wt Wh#H1ۀ=5DVt$SWVP׉>jWP\ t$t-hH#hg# hH#h[##1@^_[%tPhH#h#Ա >jWP t$th#h#%tPh#1돸P#=5uV#H#jWVh} &Phq"SGShm$"jo#jVh} &h#hq"WWUSWV8`3t P`31054585<5@55 3it$L$L'hjV `3Vh#0jG`3hhVA `3<5hjV `3蛌Vh7#0jͳD5u31`3D5d31t~H5ttja`3D5l31@5`3D5l31@DVh#0jE`3tH5tj`3 H6tQ`3hL5PhxCT5%= ts=`=@5D5hi#j許 Y5D5hW#0j膲5`3w`3<51HPhm8@5`3Xm 1ɅA @5-555<5ˋ 3uG6G63v$`'=G6=G6>1jSS5`3l!ƒuh8f@5-555 a1H 3 3=5Gt =}r t~=G6G6q˃u#=G6tPWUV ~jWUV tw߿(=G6u G6~~=3|318^_[]111RSWV։ωS8#3D$t,t\$W384$t$ ctjt$7'Q#1@jt$7#1PW74$t$jSVVx^_[h¥# hѥ#h#j`!VP=`3x=H6 I6t}=@5ut= I6tDH6HQP~'Q &514585$Pj E5@I6h#5H6 5H6nY=<5uKhL55`3cu4#T5=u"5 5u5D5<5= 3w=H6t3~ jP5`3f3~jQP H6 I6t4=@5u+5H6hM#f I65H6X`3=45u 85tP14585H6t3 H6 I6t'= I6tGH6HQP~Q 5Pj 踤 I6H6tZ5@I6hʝ#xuC5H6 G6G6 u G6G6jhQPtRPhϝ#V;1V5H6W55^USWV= 3(3t3D$WO+؜5 ܜ5 u1@1ɉ$L$=H6 3\$5G65G6h#hS腜<$t$W5G65G6t$h#RPWh#hVG$VSh#hW+}WtPW}tf=5t]t$5`55\5h#hVߛ$Vh5h#hW进WvtPWj* 3u_55<$t$WjVs$hI$RPWh#hSe$S]Vh#hPFH6D$=3O5D$ #D$5G65G6VSP$5G65G6VSPG6 G6 G6G64$t$VPQRr$h#RPVh#hS蘚$S]$QL$Qt$Wt$$hɤ#hPd$t$VsPVj "$PW5@I6h:7#t$ e^_[]V~=@5u(=|3~h~V5`3 |3~^VȜ51=@5uE1jVV5`3dxRP5`3o y1hܝ#0jd 1N^Ã=@5uh#jI&1=05u5@I65G6h.#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSUg ~)t^_[]WV5|3=@5t$t$5`3d ƃu*~345;5G6tc5G6tU05L~ 45?5|3x53h#j, 1ۀ53hl#0j^_USWVP5|3|$l$1ۡ`3$WUt$o ƅ~)tދD$9uȜ545!|3@5Hs-58 uc1h#Vh5|3:~\%tS1jPP5`3_bx})RP5`3m yPb8tD8t:8t0Ty:8t 8u |318Eu |3xt Ȝ5145=Ȝ5uh؞#j腥`tx>H6Ht)t hf#53h#jL 1%h0#j~53h #0j^_[]USWV1N=̜5=|3  3uh#j٤45<u85-@5sg4551jWW5`3`xXͽuWURP荛)jWU5`3`yQu t#45@45=|3:hǟ#Ff@Phm5`3` x|3h#j1^_[]USWV \$$|$ l$(1uu5|3@51jVV5`3_x\D$ljT$Ӄ=@5D$559L$ujRP5`3]_x+D$T$EU,=@5u#|h+#0j |31N ^_[]USWV~=|3$(~$$~@5t)h[#j蔢I1u)1ɍ|$h~W5`3G 0|$fGWhm5`3F^ fD$D$Whm5`3^ \$h~S5`3 $h~S5`3 GfD$D$Whm5`3] |3t1<$uzfD$D$Whm5`3p] f $ G611F$$~jQURы$ʉD$ ʋ$$~) h#b1F|?1jPP5`3 ]xg)y11=3|!h#11Fs1oczh#RjRP5`3\1yK?zhܠ#.3zh#"'zh#zhB# zhl#0jB 1N5|3~^_[]fD$D$ D$Shm5`3\ yyt$h-#yt$h#0j٠SWV VhDI6j yoyhR#0j袠 jVj yCyhl#0jv 1N=̜5Ȝ5=Ԝ5=I6u5@I6h#趟=D5hl3Wjhd3Wjo @5aX#t# 3#t&#QWPA S8 3P#t2#P5@I6hu#h#hâ#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5D55D5h;#sWh#T5@I6hu#Ah#4hâ#'h#<=I6th{#j{53h#5@I6h#ҝhߣ#ŝ|$h Wf|$.|$t+D$5..L$f tWf= r@h,# h#h #Y5@I6h#Fhߣ#9sWy\Whe#̜5|35@I6h# I6 ^_[hY#ММ5t P7+ WМ5t D51̜5|3hK#j|5 3mtt$11Hfhh5Umth5e51Tuh#0j臜 1Ht$f%uh2#0jX 1HVt$VE$utVhF#0j*^\SWV|$$Wƃu[t1~tHNtt 9 tu/tPWt#D$=@t ft1N|^_[USWV1FH6PH{H6P kju Ɖ+㡔5Hw> H6SPh5Q@ 5$ 5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5P]cPh55P) h(3WVh5M<43@ub55 5 5QP.t H6P(jhDI6j xsZ1e^_[]rh[#0jՙ USWV (3x&,3kL39|׋yM1II151PQÅy19}WDu= 3h#j.hh5OÅy1ۉ9|(3x(,3kLSh53y݅u= 3teh#j迗51E$sVh55PH )؍51Eh#ji1IkFL3H6Sh5#1ɉ^_[]USWV D$H6xGD$5$1F15SQ291CH6h5h5P$ H6Qu*D$PUh5Q8 5tu= 3h#j耖t$h5h5% $W1CttUtB:x9u= 3tFhC#j,Wh5Q19uh#j1H ^_[]h #th5Q<t 51hi#USWV1CH6PHH6P yjƉ׃=$H6t/5 3tohl#0j4 e=H6t Rrx7t$t4H6P(jhDI6j lzbV1ۉ؍e^_[]Ít$\$D$5Hw5 H6VPh5Q@ 5D$ 5L$ h5kWeh5duy=H6tSh5t^H6 I6tSh5uh5Ujh5Xt@h5Em55 5 5QP=5/u+?<u"5Po]Ph55P; I6 I6tSh5 H6tpH6|NPWt$h5)6Q=H6I6D$L;85D$P<5Ph58 I65t@t=4I6u Pl= 3t15Hr@tZ tUh5l'9D$X;D5D$\H5?uD$Ph5$Ã|$=4I6ut$h5ÅH6VSh5P@ =4I6uSh5/!؃=H6\$C= I66D$H6HQPQ I6=I6D$L;85D$P<555 5 5QPDy h5j=H6\$^= I6QH6HQPQ D$L;85D$P<5D$X;D5D$\H5OPj ̈ I6D$u5D$ 5L$ QPp5x5 35H6;55 5 5QPh5ji\$=D$L;85D$P<5Pj  I6USWVj/h5jG1Uh5k^t>55h5USZ /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=H601F H6t9t71ho#jێmQHbH6P R=H6t i<H6x t `m#H6 I6t#5@I6h#5H6聃  I6ujh5^t(55 5 5QPu1=H6th5hxuth5lyH6P(ljgSW, xaH6 I6t&= I6t5H6hM#2 I61G*ƃuejhDI6jk ^_[USWV $H6xu d?*1FH6P,H6@0D$ jD$T$=H6jSh59]jh5Q$=H6th5~gh5+th52d5 w's1PP55F $jh5Pƀ=5/u+4u"5PUPh55P =0I6t4$h5Z' H6t:H6|Pt$t$h5s.Ph50 I65h5T$t8=H6= I6H6HQP~dQ cH6L$Qt$5SPD ƉPS?&=H6tc= I6tZH6HQP~3Q 2Pj ڂ I6Ph5%dPj 賂 I6D$L$ʃ|QP  55ʃ|QPxnh5*1C@TPh5Z%c55hR#0jh58ch5)t H6P4 jhDI6j =H6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=H6t cxIxH6PHx11@USWV $$h 58I6S  = u$ /,4ŏ4/t EƄ4/FED$P58I6h#D$=@`1Gxv%xmlxd=H6t exRh5!(ttjhDI6j% Gm'158I6hʦ#j 1GĐ ^_[]a58I6h#0j҈58I6h#뻸 )D$ )D$$h5 XH6 I6tV1=5/5t$PU3 ;D$vh5h1#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơI6 I6tD$Ph5I=H6t5H6h5+ I65=H6tEh5C=H6I6D$D;85D$H<5h5{5Ht 1PP55 $jh5#Pt$h5 Wh5D$P;D5D$TH57wD$ Ph5;I6tk=I6tbD$D;85D$H<5Nh5h5^^D$D;85D$H<5D$P;D5D$TH5h^55hR#0j蕅P5WWWh5!Ph5=H6e= I6XH6HQP~ Q Pj G| I6 D$D;85D$H<5UfG65G6u H6@G6=~| h~Ph #thPh>#j蜃1HãG635D5y x1G6G6 G6G6ʉG6 G6G65= 3u=G6t4=~| h~Pho#thPh#j1H5D5 y xᡠG6G6G6G61G6G6G65~3G6USWV=H6th˩#j艂1I^_[]Ã=G6G63uG61IxՋ=G6+=G6|$\$53UVSWJy)9|11UV$)݃G6|JG6 3G6~H5G6PG6G6;G6r֋ G6 3G6G61)ȉQPx[G6Ɖ5G6 3ȣG6)=G6G6 G61G6G6 31h#jWV1N=3= 3uh.#jy1G6G6535G6Z13~9} G{u'Phc#j~ xI1=G6=G6535G6~ G6 G6G6G6 G61^_ËD$L$G6)ʉG6QPR!- USWVu ]1D$ D$ D$G6 G6)ȉ9؉| G6)։ G6QPVSv)ЍT$RPQ 1ID$L$ )G6 G6|~ G6G6)ЅqxUtX G6G6D$9ؿ|‰G6)ظ|D$L$ 1H1@D$D$e^_[]V1=G6535G6~# G6 G6G6 G6G6V1xC=H6t/x&5G65G6535G6~G61 H61H^VG6;G6v*5G6)QjPS 5G653^USWVt$G6 G6ƒ|]; G6G6}O1h#W}=G6=G6$-G63 ( G69)1 -G61ۡ31PUK;3tS1G6G6SG6 3G69)QP륉G6 G6Nj-G6S5G6U) +G63)USG6G6G6 )VQS) G6H6HttH61O1^_[]É-G6USWVP\$1~cl$G6$5G6<$)"533x3ǡG6$5G69|WUV) 5G6)11H^_[]USWVPD$~Z\$ G6 $5G6ŋ<$)Dž~9G6$5G69|WVS( 5G6)D$^_[]ËD$)USWV\$ l$؃|~G6D$=G6t$)#534x\ơG6D$=G619|VQWD$ P =G6)Éظ|$1H$$^_[]USWV$  $x$|$D$|= I6t7P$t0y#T$ hW#0j.{$|r G61NG6)ȅ53  G69غ|PQ$论 ~|)à G6 G6ظ| uXP$/$3D$8$3L$4 $ h#jUy hx$ h#j5y LR$ h#0j z'R$ hW#0jy111o^_[]USWV$$x$|$$D$x-D$PQ.t">R4$h#0jny L$|L$1$p0L$1G6 G6)ȅ\$^ G69|4$ST$ RT$RPQ$P~R|$ =0I6 G6tP;CJ G6)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=0I6t% u!$9$t4$h#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$= I6$4t1PW,y#$PhW#0jQw1HD$sD$$P$<R,4$tOVh#0jw $l$ l$\$ 535G6W輶 lj\$11ËD$ 9D$D$D$G6}$4$t$ L$ QL$,QWP$PWP$@ ى9u1535G6$<2 ljޅz11 ͉$03x$3|$ uRD$$P$8%+$3D$\$3L$X $0<$\$t*Wh#<$Wh^#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]N$0h#0j8u1K<$M<$W$4h9#0j uUSWV|$7t6|>/u/1N=G6MWh#js G6.|$tjh Wƴ V $=G6G6_Sh]#VPd$TƅE<$8$S x<Sh]#P$5d$ywL0=$I6t5H6e$hg#Vjs15G6$ $iLQhF#0js1N^_[ÉHUSWV|$?/tGj/P~ƳUWu/Fj/VPƅuhW=,I6t$$W jWy3UW%u%D$ PW)jUPWV/Fj/V1ۅA4t*PWIt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P+yu~JWhx#0j r$tDPքyJ$h#0jq$ 1$G6^_USWVD$Et$$^߅tP芲y>JWhx#0jpq=,I6t<$8$W 1 (I6tt)$($u7=G6uj0G6P"G6G6!UW 3  3t%1PPL$H$X$T$W$tJSWy!WISWh#0jpW^$u 1$G6^_[]WVW1uA|$ t$t$W< t(5H6HWh#0jp1N^_Vt$#D$ PVt%5H6aHVh:#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U= 3t = 3D$PVtHVhխ#0jKo_= 3u&D$DL$HL$$Mbl$L‰T$= 3u'D$PL$TL$D$ Mbl$X‰T$WVt6G8Nu} u&WVurGVh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVhì#jm 1HjW |^_[USWV׉L$]D$PSt6St$蚰thnF0wwS tՃ} tL1@_1=H6uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h##Vj6m1He^_[]ø#D$=@u%h$%S7tS0S} DESh#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=H6t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $t'5@I6h#26uu=I6tlD$PUǿuZD$ !=uHhWU ƄD$PW胿uD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$覬 4$U[iCL$ t uu$UFD$y)Q8=$I6us<$8$U xZL$ A$Ct$Uh!#0j3j1H=,I6t2<$8$U Uhg#Wji1ɡ(I6tt1Ƀ$ !($t($t$$5@I6hʝ#/4jUxN1=(I6= 3= 3Uh|#UhJ#j7h 1OD$PUlx=1$ ?#D$ PU1@=(I6u;L$ ($/At$h#0jh$ PU1@Pt$6UK 31  3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW胼1x1K=H6t މ|^_[]ø#D$=@u5h$%W21EtXWyĉ#$t Wzy5H65#h@WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5I6I6 I6I6L$T$tI AQPJ DUVP 9t_L$ xZjPUQ!ҋT$0y@oEP Džt<$\$MQVPG D$8+$T$0)+|$$>hg#jJe*>t$8hu#>t$8hW#0jf1O ^_[]SWV1|$tQ\$1OjWWS!xjhG6Sx y%u##\$|>SV0je^_[Vt$ xFP蕦=H6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(轤 ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$(xE$($\h#<hW#.h#j%c #<$(hڮ#0jc1N|(^_[]V=I6tG6=I6tG6=I6t@G6=G6uh  G6t01x&=H6tDyh=#jhb1N^WV H6tPȞ1 H6H61NG6t H6tqAH6uj1ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3,tN;43u1tB G69G= |+H6xxG6 PW1t-G68j5G6hG6謕 H6&1^_SWV|$tR?tMj tSƋ\$W +H~ </u>ۉ^F=G6t%G6p!hl#j`1Hh#5G65G61^_[áH6t@=H6tH6= I6u0=H6t'D$$uH6tjP5 H6襪 WV=H6tB5G6t;11G~u)uh#jA`6h#h3HU vu^_USWV =H6u%H61N H6u H6}$ $ $L$PpH6t#HHf w=$'ph1##"phۯ#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p赟 8 H6qhE#0 ph#p j_e=H6t\@PL$QL$ Qpp p09Bx8H6jjt$t$t$t$ph#p j[_ H61N1 $'LJ$Ƅ  LJ$LJ$=H6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G H6 VqP2  H6VqP 5@I6hʝ#(1uH6@e^_[]fUSWVT\$tl$h=H6P($ެT$L$X$1V8$"V<$$$r#$r#t4$tVjQjRD$Ph_#SQ $u2@$%  RPhq#Uh#^|$x$h|#S4QEPD$Ph۳%SQ$Hs Uh#u# Uh"SP S>X^_[]Sj ~[USWV@L$E\$CD$PS{3j9ٰ#|ϰ#L$QPj@t$V6ue^_[]SWVT|$dT$t$X$hS($WVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPSVSؼGu܃^_[Ã^_[鼼USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VH6~1F1uH6h#j9W^ÐSWVL$D$t$|$l =H6tH6tt\^_[}\1KZH6teSPti:tdx:39}j l =@3sPVW3 hVH6:-u/H6ÈH6nH6H6`S6h#3=S6h#h3PK?^_[f1Ã=H6u1áH60h#jV H6t"H H6p0hв#h3J5@I6h#`!u_sUSWVd|$|j/7[ @I6t@l$x@I6h#P>@I6#1CH6I6D$ D$1D$$jh3h#WUHЃJw$@';t$$@$'l =H5묡 3t  3H6 3r 3t c 3P= 3ܴ#\$H6! l =kG6 G6H5I#H5"%3I65l =R 3t  3 3\$I6tD5 3eH6H6LD5 3=I6.H6 Pt$ * NL$ l = H6$LFD5 3D5 3D5 3D5 3H6l = H6H5$I6q5l =[Z 3@K  38l =8-u xD5D$ =H6u ,I6(I6 3 3H5f#H6 3$H65l =WO H6I6sTI6d 3U,I6H6?D51@D$ ) 3 L$ ƒ ʺ3t(3 3H6ƒu 9u , l$D$kL3H6 H6 @I6q"1$jh83hڲ#WU裿/~HЃJS$'43ƍHw$l'TI6뫅!l =H5 3I6|H5$mH6@XH6ˀCH61H5f#"H6 l =@Ƀl~mtKotRpd(I6SatDeJ1A ,I6 (I6 3 3 3" 3,I6  3@{pel =D5SHH63 l = G6G61ɉ5l ="]H6I6l =L$hْ jLjh3Q 9H6bl 5l =Vh#Vڇ34I6 I6@5l = i@I6Ԝ5H6H5"%I65l =9i l =E G6NI64I6 $! l = }H6I65l = =H6@H6 3%= 3H6(3 0akG1A11|$<$t4I6D$tGNutNj]]h3#SG1t[hX#S3uE H6H6j5 H6S^ 1AL$y#$]1 H6<$D$h#Sl$\$th32#S@Džu Ѕ31 ðt5hX#Siu3H6S I 1urL$tP؅uAJjh[#Sb uPH6D$t t Ph CPىQO ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#St Wd=H6<$l$S|$; H6, 31ɺ G1Fmفt#u41A 0 3<1A 0 3!5 31ɺ.1!# $ 4u H63=rnFr0s9-3D8I6PM39}j4NxP3@3339 1VV4b x3@39| Qh##j?H 1FPhʳ#V(H V15l =h #h(#jHj15l =hj#hh#5l =h9#jG 3VhO#x%53WV< 53WV< Vh%$é5l =h #0h#jjG!j1mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8Uh3#We1D$h.D$1$h#U2th32#U<Džu JЅ3tkðtAhX#Stjh[#S tj1ujSðuh#Ut Wo=H6Uh_#l$}$l$hX#WI]tjWB\$rt D$W3|$ td^_[]áD5t8uh@" D5t8uD5E"Uh6#j E USWV|$ %UW?bUVNJ00ht$跩tAtZ/UVaUWA488ht$vuIt$h#0jxE1H1^_[]áH6t H H6h3h#膦j-WV31FWVhhv#AWVhh##-WVhh#WVhh#V-USWVPˉjPQ* փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QA$1>tj,VÅtj=Vtmj tdAE0H@H6=H6t H6sH6uh#j6B1O^_[]h(#hQ#h(#j B4$ ɋD$L$01 WV5@I6hh#h36 t(ο#Ph$h36 !uء3H 3~3H 3 h3j 9^_SWVPωPQUt4Ƌ$| tC$S蹿 t'ǍCPVWC DG H6 H61^_[USWV$t%t_݊M\tS8uEEhB#j@Ej! UEƃjSV) t3l$hUVPWUh#j\@SS $EE<\t:uCCU蒽 $AStRC1fGt,PtStgtstp1B ы$J@u $A=H6tZH6HVVo4$y Wh[#ji? 1H^_[]V;VG hy# H6 H61V4$ Whӹ#USWV\$tK;tFjo tLNjl$1pSG woD$G95H6t%H6x!h#j>1Nh #=H6=H6^_[]WV5H6t;11GFu)uh:#j^>6h#h3e3 vu^_USWVH61 l$$=H6Kt(=H6t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=H6tGtlD$@1G8D$@1D$\1GEt$ h #j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh##j59tNjE|$tDD$@t:$t$PVh\#h3)VhF#h3) $t+Et$h PVe 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7CH63WVVj螯uD$L$ L$$VjVjuuD$L$ L$$VjVjLuD$L$ L$$Vj辸Vj#uD$L$ L$$Vj蕸hؼ#舽  y|$ujWj&  WVj  y|$ujWj  WVj  y|$ujWj  WVj  y|$ujWj  TWVj  y|$ujWjv  (D$,WVj Z   WVjF  0= 3t h#0jq1 H6e^_[]h#jY0 hk#覕-=H5u4!= 3u 3ҦtH6h#jӢVt$1@ I6H6#t%#QP/G6t PC1=H6tVf j>fUSWVt$=XI6t38$/>3i=)‹1@?9 tR=\I6t3<$/>3i=)‹1@9 tR `I61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=XI6ujh= XI6#t\u#uGW tjxGj jW$ 衪 />3i=)Ë XI6,t 98t#@u $j٫ t!8h $1(Wht#j9- h#hA#j!-^_[]USWVP|$1N=\I6ujh= \I6#t\u#uGW tjxGj jW# + />3i=)Ë \I6,t 98t#@u $jܪ t!8h $1(Wh#j<, h#h#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh6#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj#S CS>tKt^?tYڃCKt6C;C C})VWh#j*S萹 hr#C=`I6t$dI6X VhN#jW* 4Vh#`I6dI61Whؾ#j** S! h#}VQh#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$Åt>V,FN4A1RQ113W>1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=hI6u*jh 胰 hI6uhN#j1(1N^USWV hI61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EPޤ $$$KCs{ D$C $C1^_[]Ët$ h 3Pէ  1$$CHC1FwCE3е Sǵ S輵 hy#j&1NwUSWVhI6t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh{#jY 1^_[]USWVtI6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u tI6-|I6xI6xI6-|I6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@xI6=|I6l$T$s}ډD$0! umщjt[|I6=xI6 tIjݜ t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,PhX#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=I6u*jh= I6uh#j1N^WVI6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(X t^t$DtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wy h#jj ^_[]USWV I61Kt$/>3i=)‹/uPV_Džj$ tWWܘtN$$QVQ4y8~V Q(y,~VIlNF I6F5I63WhJ#!WhJ#j V Vh3#j ^_WV5I6t~1FI6=(I6u~ t v6蚫 3  3tWWvvvv 6踫= 3t v6ά6b VY 5I6u^_jhÀ=I6u1WVL$T$t$ I611H<>u5Guu%P=I6tI611@^_V|$ |et$>t\jh#P t !3=!3t#h#j|j !31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPhg#j^_[]SWVh1Njh#SWu3h#WBu! 3u9I6Džu91FWSh#Voh#h#h #V WSh7#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD ShI6hI6   PhI6hI6  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ觖 7Ф 1D$ereRPQx ^_[USWV $ $Hw.$' e| Rh#{=I6x1ۃd|Rh#Q1l$ hVU% $ jdPU$,ؕ $$$Hrjtr$@ L$ D /f@ 0 wh]#h#h#h#$F1 $F2 jdPV* fF0 $j j0P@ 4H6 8H6t\H6T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0UM $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h##$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h@#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh#W9 t1H^_jhe#W u(=I6uI6uI6hm#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQb Ǎ A/G<rH )UhI6hI6o   PhI6hI6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPdyEtQQP  ƅ(8$VP>yElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu,&-u~t6h32#VDžu'0 PVh3#jHЅ31FUWt5Ë$rt$VhF#j$_Ft1N1Ѕ3t W ^_[]fVjh%#AxKh"PI6t)h32#VhI61u;5I6V$B=H6th%#h#j 1H1^WVPD$$|$t H6t$I6 H6t"= I6th3j  I635@I6h"W 4$VW Wj O ^_PI6t$L$T$ $RQP| 5I6ΪXSWV|$1N|5I6t,\$OPWS t;j S11t^_[SWVPD$ $|$t H6|$t$I6 H6t"= I6th(3j  I635@I6h"S 4$WS ~Vh Ph$h3 h3j * ^_[fUSWV} u7th$r#j \$1hb$WVx LtPt߃953D$h #藈ƀ8/h#Vushf#Vua$PV_RtKD$Ph$%HRt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V h(3莨43@ujhy"jo:Ph"#h3 jUSWV$$6 h$r#jf 11Ch3#VU,w e~%q~3كrtރvt_xI6ŃV.PtrكRtwftAiI6I6뒃Wt6duqI6zI6lI6I6WI6II6;u39|=I6u 1Ĉ^_[] D$hL j$D$,$SX I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h#QC\$I6EHu]j$8u I6Pj蜰I6a$8tӋD$t$ VWO I6tRtD$W>==I6u%8ts8?ti8t_Whm$1iHtj PWh:7#d +D$@uDI6u;Wh#7I6;;=I6uWڀ=I6utV/tD$%=@t/==I6u uWK W  I6 I6х ˉ4=I6u Ő=I6t@jPt$N- u h=#7P6u8VZ5NjGHHf wO$h'=I6WOwP"{jWVB GG \=I6uWOwP:GHftIfgft9G =I6u P PW}G  Gw~I68=I6uG ?tow 胠 PUh:7# c=I6uO1zuSwD t)I6t 8t18?t'8ut/whm$fI6V4Dž6=I6u =I6tI6ww9hD&jiww 蠟 PVh:7#jSiPh#h3 j4I6USWV΀=I6uLVhM#h3{ h3Ρԅ3H ԅ3Ѕ3H Ѕ301C=I6l$$#E=jR8D$PuE=I6uvVh[#1ZhЅ3Ɖt9 t4ԅ3H ԅ3~Ѕ3H Ѕ3hЅ3Bƒ1ۃYÉ؃^_[]ÍD$x $r#tu%1Pu)1Pu艼VPWSD$Ph#h3USWVAӉ΅:#K1jhV5 $ǍD$PW迪.D$3CL$3 D$(3CL$$3K #D$ =` D$W51PPPW` D$$h PQ  KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWb3 D$L$D$)T$T$ 9D$t;$SVHI6Vhm$fb),I6Vhm$DbWK51@e^_[]2W4u1PPPWP uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW[2 D$L$D$)T$T$ 9D$t11W 41PPPW覮 h j$PW KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW1 D$L$D$)T$ T$9D$tA1W[3j1PPPW Th j$P CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW'2 ;D$t$$P$!PF L$)L$L$L$ |$D$ hS0Wm2|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW0 9D$)؋L$D$ظL$|/W:21USWV\$l$UEtMƊAuA)k')J6j赸UGG SѸGI6tVG t|$u G?J6w|} wq} Wh}  J6u=J6t^_WVt$ J61GZ$'uGPVJ6WVP  J68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5J6^_ÊVF|uܹո ѹ Ǹ É)B$:@BZ$'uVPQhP# fUSWV|$,t$(S脲=J6jLVLt:xIuxNt@jLPj V+1tE@j P)=J65J65J6"1,=J6uƉS;^_[]ù#V=J6)u ^5J6Qhx#*WV$r#|$ |$wL!3 P!3 R6>t'F R6QR6RN@>vuڋ7 R6QR6t& @뭅+L!3@P15XW6VrƉRPhd$# 1 ^_USWV8׉ˋ J6J6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jV jVt$ % USWV Ջ\$$St$$tƉ׃=J6%up1҉  ډD$$=J6&uU1ۉ D$J6 J6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹6#G#*#wSWVP=XW6J6XW6Q5)Ɖ=XW6=!3ttxt>ux&y1ۉSPV  Ɖ_9u$8t*N8u+$t@Z$' t$@u^_[ùT#@%USWVPՋ\$St$gƉ׃=J6uKh$J6 J6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաJ6HwSjP ljաJ6uND$J6 J6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THJ6 J6N"ىWP1Eكra$"ى=J6#ÉJ6݅~hJ6 J62É׃'1HJ6 J6NLىWP1 1J6 J6NىWPÉJ6LJ6 J6NىWPe$É׍EكwJ6|$4t;~l-J6b1A1Ǎt$WSh"jVWjV5J60't1I1@1l$QPh"jU!jU6  ؉^_[]ù#T#J#@USWV֋] $t$ơJ6 J6L$ D$T$uPV֋=J6Ww,l('8t('}uPW ֋=J6ȃ}tً$VPt$ ֍Gwt(';E Qȉe^_[]fUSWVb!3$D$ h#t=etuD$ jR60hJ6GVS?SMUB@P谧áJ6)QPS` J6)١R6pQVPS/-$jhK##ƅ<.u 1~.D0t/ua$Ph$%,tGPV,t6$3D$$3 $ u$$3L$3D$ 1e^]Shb$5t/hb$"uR68LtjR68j*5J6uj=J65"3["3f`5J63"3HQPP"3Q 5"3 "3@u1[h$#[b0 PhY#Ah8#7SWVWϟWP u2\$Vm8"u6W蝟WPקtVLJ6V1^_[Åu̯0~ Ph#jJ6tjPh # hd#ÐUSWVD$ "3fa1Ƀ|$‰tpыLh$S%$thd7#Su 1t$.4NJ]taM\uNEU\rw$P'\0u!11ЃwxAunjt$>"3HQPPe "3Q t$.PN    ȉš"3HQPP "3Q<$t*"3HQPP "3Q 5"3W "3Hu 1^_[]ÁfHh#jfJ6uL$ J6jPV=J6t J6K15J60ppp VPj 95P6t =!3ujVTV{^jpPT$=K6u K6D$ $1APVJ6J6t1It$aVPL$T$ D$$PD$K6jWVP|$t$D$$u4$ WWV׉ΡX"3t L"39ty u hL"3 =J6J6u詪Ph"h`"3 =J6t5J6h"h`"3 t*t$ Wh`"3 x4h9x%h`"3xVz Phm$h`"3] "3HQPPj "3Q h`"3 ^_SWV|$t$\$ISWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$êWY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhG&j hJ6 J6@^1J6J6J6J6WV|$ |t|$wL!3 P!3 R6>t'F R6QR6FN@>vuڋ7 R6QR6t  @J615+L!3@PơJ6PV J6^_USWV\$0t$,|$W̙5XW6jVi j=8"3thƉ؃$1t7=!3u.D$0t Nf $uQVi=J6u"W这j螵=8"3u11EPiWcu J6D$0u^_[]jUSWVL$,|$(!306̓VԘ$'Uw1ۀ=!3_=J6Mjw1ۀ=!31=J6$=J6jwH1ۀ=!3=J6=J6uQ=`T6tTjw1ۀ=!3=J6=J6t  u8V31tu J61l=`T6tUW_j\$0SWh a=`T6tWD$,E=`T6tt$,WK_=`T6tst$,WE\$,SW=`T6t@UW=`T6t)UWyPh#e hL"3k=`T6twww. J6@jw1=J6J6 jwa=J6t J61V谖VuL$,=U6t l=r!3t J6tu u^_[]PNjUSWV@|$T5J6D$$w=*"3tttnTV65XW6P$Ph"#Gtj P5"3[ KȅuhZ#5"3Rl$jU{th5J65J6jm<$t&4$hha#[5"3|$J6\$XJ6-J6j wD$ J6u=J6tSwJ65J6j J6u=J6t]<$t&4$hk#5"38@^_[]j5J6USWV\$;s3=*"3{TV65XW6PP'h"#stj V5"3 vh6#u hE#"3HQPP"3Q 5"3Vl$J6ttQu {tF1ۃjU_|Sl$SP~ tuQV{J6Ju J6u=J6tjsUsV言J6 J6u=J6ttJ=*"3tA{t;TV65XW6PHPhI#5"39^_[]SWV|$J6jw1=!3t J65J6^_[Ë\$1J6u/? J6ut΅tSw5J6J6t"u8J6H J6KJ6jw=!3tru+J6H J6J61 1@65J6+USWV1=!3t5J6|$0D$Pm[thUS- =J6tiD$J6,$\$4>GXW6=*"3 TV6PQPh2"w "3HQPP"3Q=u"3HQPP"3Q 5"3juw  Sw5J6=!3uZJ6t"u*J6H J69J6m"uJ6H J6 J6 J65J6D$P襏 ^_[]USWV|$0t$VR@O XW6jPw+ _1=J61{t'GXW6$pW WuuޡJ6[tZtT1=J6uI=!3u@l$41; u{CXW6Us t=J6u =!3tʋ-J6-J6V譎 ^_[]USWV\$K1t@ J6PSwƋk1OuD$}t 1{PuVy uR J6u=J6t~ jW|$x4$yjt$jux WQ<$t$BmE{t V[v1 Vh{J6 J6u=J6tA^_[]Åx W補0k Phs#USWV$$D$1t$ ,V6D$$U6D$DU6D$Ht$05J6$P辌5J6EXW6L$XIEtH1F\$XljtwuGXW6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGXW6w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=!3t=J6u|$ ~ $@D$@D$ )$=*"3TV65XW6PDPl$41dz=u)"3HQPP"3Q9}j=WeƉt>u#"3HQPP0"3QFPU 1Ո`1t$XtOË$t)"3HQPP"3Qv É΅u$u t(PV5"3 مt ȋN΅uء"3HQPPS"3Q 5"3|$ +t$4~jh,'WA u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$# f=`T6t*fsD$= t=o u ft$}u$D$@f%Lu D$J6jU[qD$,ED$D$tD$L$` =z!3u f|$t$Ut$4r t@J6|$D$D$`t$dAD$,F L$J6=J6tYD$t;=J6uJ6=J6t.t$`jt$hL$D$Hs*|$ # toD$ t$,tJ6.u D$ 1@t$,oJ6=J6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]@W6D$(@W6J6BE<NjD$ J6? D$(@W6=J6J6Y1PPW 1ɅȉD$PPVR6\$pfR6D$ HR6$R61R6J6 @W6L$( J6L$L@W6D$D$hP J6u=J6t$jVB0J6D$ 5J6|$t&D$1f|$tH U6U6$J6h t$8J6H J6=t$L$QPy J6J6t$D$(@W6D$DU6D$HU6D$LJ6hR6R6t$pD$ J6|$Pt jK J6u=J6t=J6u 1J6J6D$@z$jWJ6D$ =J6h!t$85J6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x"3"3t"3|"3@L$D$J6D$pySD$lJ6D$ 1D$T$PWt+J6D$|$D$K6=J6D$$ ,V69t;D$=H* t=7 u)@W6D$(1@W6D$TL$$PQt$u |$ uD$0ufD$D$4J61f|$ˆQP$J6$R6R61@d =3D$J6"3f`4$t$T$$L$tJ6D$ J6"3L"3"3`"3T|$TtD$(@W6J6D$tD$pJ6D$D$tFD$t D$f|$t$lQJ6=J6t|$ # t jD$u"3F t"3)N"3|$@tht$DhE%m $P薀^_[]h#5J6t$1=J6ȍPu =J6u"D$4thB pȅu5J6t$ t$,Pt$=J6uS葕'h#hR6xR6t$p|$Pt jt$h)D$(@W6D$DU6D$HU6D$LJ6D$ J6jPŻ谎0 J6u=J6tV] Ph#xJ6uJ6jJ6tK61WVt$tr|$w$'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF ,V6QjRp ^SWVQ=t1OS jjP= t6>F1"jjP tva^^_[USWV|$41GGG =!3l$0\$S]}J6AjUfjUPCh uAJ6=J6t 4$1CSt$SU\$t$$w J6u=J6tS|^_[]h#VPJ6u1PPVPjh!3X tF$P{J6t.1QQVPjh!3OX tJ6@=PATH5J6@ J6 !3 !3^áJ6SVh$r#ZR68uj21^[1ۈ!3!35J6thB v|65R6 ,V6SSQPVJ6áJ6ËD$ J6J6PËD$@J6 J61J6J6Vt$ |$|vXPh#1@ J69~1Ҁ8cBJ6 J61^WV15J6VDR690t\WzR60PjPfH5J65J6J6@J6jw5J6JWzJ6^_USWV$,V6$j/W-Ut@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVwuD$ %=`uVyjWS ƅuWh]%Wh# Wh#L$J6x J6V|$|D$ p膇J6J65J6uu~9} ~ J6J6^11@1USWV4h$r#c|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#5"3(14^_[]UWV׉΋ K6uj')k< K611D$ T$l$ &D$ $,$<$\$ D$#D$?6u0uFjh$W. %Ww|80uHx.t x0@te^_]fUSWV|$7j/VRu#$jVP uaK$$WV4 Pu 1@Ɖ$m=K6ud$$UVuGn8t8_8t.U8 uPVWt .V{vju$P OfSƒrtt~ K67PSCPVh:7#jSWVt$|$t$VW 虅t 荅^_[Ã|$u0jWC6tR6J6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$/u,89-P!3}@v,; L!3t,WSQL$ >XL$ |9/u 1xAA/D$PL$Q_K6E9u,;E-K6L$Et <:tEL$<:t1ED$(Qt $+ L!3AQs^_[]USWV$1C1D$ 1D$D$D$\$h#Hw5$4'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ R69AR693t$$1CjWtV@wM$'|$t&|$ t4t=0!3x'@ |$uR6H R68u,V6PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ K6/tPEȃw?$'|$u/|$ u&u |$tf<u t$Um묃K6r5"3"3$@th#1@$$$$^_[]SWVt$J6 K6t5Hftfu950!3| P6 9p}Ëu̓K6r J6t^_[Ã=J6t^_[USWV$G$$'o,V6EjWS PqqM䃼$$twhJ#Vht#FGPhm$J6w>PQ^ J6u=J6t h~#D$Ph#/thb#hk#GPhm$Q t*"3HQPP"3Q*"3HQPP"3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)! K63tFWP7qtc6|$tTJ6WWoPSnƉf@@ WP躢 J6u=J6t u1K6^_[J6K6Q4  J6u =J66USWV$$$j/$IturfEE^,V69tth#V觍t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$K}8}8}$ u=0!3x $u  \u =0!3y& u $MƋ$1Mtfyu0!3YL$$j$P 1OD$V`mGK6tAPh#m{t$t-'5K6h#>{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=K6$Nu$=|8t3|8t )|D$}o$E$\$|$$t$t'5"3jS\P$h&VfEo$T$pƋ$$J6|$ÍD$ uj$HfxT$ ufBuω7 J6u=J6t ׅt"G GfEG EG fEGE fEEĜ^_[]J6T$ Éuj$fxE$ufBj J6tbiVjC+L!3P%jV$ij$t3fxu*SVm$=J6V$h#SWVP$'1t8|$$'L$8u%tWPkL$ t us^_[SWVP%'1t3|$%'L$8uWPkL$ t us^_[V%'t%%'jPf@NHu^V K6 0!3trft fuxB =K6r^USWVP\$=,V61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡0!3y x50!31Ʌx $y $Q50!3^_[]SWVJ6 K6>t+fuwWx- ߉?u׃K6r J6t^_[Ã=J6t^_[WV|$D$ J6jP+@ft*fu vfFGF GF GF J6t^_Ã=J6t^_WV t$D$L$ J6fO !3fOPtGWVU J6t ^_Ã=J6t ^_jt$itfxupE%1USWV t$811G$1D$h#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPR6:KBR6*#$1\$ D$4$߅u U='t,]''8uUPhujUNƃ<$t0vh#4$R6H R6(t|h:#-j vAtuhH#vh#R684$t"3HQPPJ"3Q l4$t%Uh#SPhX#+h%#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$'D$j/U?jU#~et0C Ph>#:uhh#Yuhz#Bu h#7t.Uh#3+,V6 t$|$tJHh#_t$R6H R6(ouhǠ$돡,V6D$ FjUD$PK PcN<$u$r#|$te#Ph^#~Sh#pt$ct$1 ^_[]h##ct$r#RVh#Vh#1PPt$  5L!3@PubUSWV|$D$\$=!3tK6H K6 L!3 K6 P!3 R61ɉ K6 K6H XW6SpR6tH R6~K6K6dH K6K6+L!3PaK6K6u%Vjap K6K6sK6UVWK6-K65K6x=tEK60va5K6΅u!cK6R62V'K6K6t OK6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tU6t D$"3 U6D$K6+L!3D$?~uЃtRWT$4$ D$1@D$ wy< R6H R6fK6e$!PVVST$0/>u!y@u=D$ D$K6$R6H R6RK6Q=K6unK6+ L!3;L$~[xuUHK6QR6H R6K6R6H R6K6$ |$D$5ЉD$$ R6H R6K6`T$,H K6>~=u|$ D$ RV"T$4| uXW6R6H R6~#K6%J`T$,H K6 X.`T$,H K6$9Ut$ 8T$4K6+L!3jPHPuT$8 _T$,H K6>R6H R6~K6 _T$,H K68 XW6w_T$,H K6XW6V_T$,H K6$^4_T$,H K6D$$ 4|$tu^_[]USWVt$,\$(=K6tU6t$D$ "3&j[XNFU6D$ K61oO9R$D$(4ʼn|$L$xr8 t@݋L$E;,$r9jWh6&> 14$9u6ɋ|$MED$C݋L$D$(4,$9D$ |$݋??1@$t}tj)ZXT$,JB^_[]WVt$ NȊ@>*u [t?uߋ=K6J6K6u(QFZ9P7YK6NQP5K64 K6 J6u=J6tPK69t31Ʌt AuQP!u=K67vA K66^_Vt$t"K60v5K6΅u^V5K6t1J66Pn 5K6 J6uۃ=J6t莻1K6K6^USWVt$(PnYK6+L!3PmXL!3Gtr}t  KvC#:t /tQ t7=!3tAL$,u8 R6QR6ZO@랃tPY^_[]Ã=R6u ZR6L!38t!P tx PXu$hK#ljPXGËD$,tÊV"'$< t< s4< w*R6H R6~K6ZH K6R6H R6~K6YH K6Gw/u}/uEP USWV,D$DD$L$@9A|$$D$t1Z$'‰T$D$D%D$ j=L$Q;2D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ xV6T$)11GK6+L!3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ uK6K6+L!3=!3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =R6t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$R6H R6~ K6ՍQK6VK6MPK6EK1ۋl$$]|$ D$EÊV"'$< u.R6H R6~K6 tVT$H K6R6H R6~K6 FVT$H K6]EuKl$ u% K6L!3)K6 R6\$\$L$ D$E< w.R6H R6~K6 UT$H K6R6H R6~K6 UT$H K6]Eu1L$ }D$n $Ip$'|$tR6H R6~TK6R1G>L$u0L$ QV1>t5K6UK6ۋ\$uhT\$H K6=K6+=L!3t$ t$(St$ WV-uK6=L!3K6)=R6Sg1GK6+L!3t$PS <$t[1@Ftuրut܋ K6 K6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#d])Ѓ5XW6h #F׊t!#u(HL$IQWP5XW6h%#D$ƃHQWP5XW6hH#USWV5K6+L!3D$J6K6D$ K6D$$K6D$(K6D$,=K6K6l$0U+Q+L!3P-PD$ P$jU3QD$,K6D$(K6D$ L$$ K6K6=K6K6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 J6u=J6tfhWt$ y_8tJ6HD$EEt< uD$C낉$L$}1A9R6} RL$ƅ~N$ R6 FK1:R6H R6Q FK1Ƀ=R6 Q1ɉƋ$|$tV"'$< t$< s< w R6F$ R6FJ6D$ x P D$t P D$tP5=J6$u+L!3jPt$$ 5K6 J6u=J6t^_[]USWV D$4L$@-K65L!3l$)hP?D$R6H R6~K6qPH K6=L!3UEWD$ P[NK6+L!3PZM5XW6W蝛ljӍD$ P]NL!3 K6K6) R6 R6 PK6SWh"jPK6xt$GF9Iu|$"tjVU0 K6A K6R6)R6D$ ^_[]SWVt$|$\$K6t#9Xu 9p ux2jK K6K6K6K6Xxp ^_[WV=K6t$ 95K6~?=K6J6?P =K6 J6u׃=J6tѮK6K6t?9p|J68Pk K68 J6u=J6t芮 K6u9q~)q$95K6~ K6K6K65K6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`R6H R6~K6TBH K6U6"3J65K61K6^_[ÃЃ wOj PV vO8ű$<=tuw~;5R6R6bU6D$5R6ØD$D$‰؃AD$$Z|$ T$L$T$|$,V"'$< u*R6H R6~K6AH K6R6H R6~$H $ K6QK6 @K6 $Q$ PK6$eØt2K6 $Q$ PK6$eØt2H K6R6H R6~$H $ K6QK6 .>K6 $Q$ PK6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GR6PR6~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡴK69tH9u %8/t F$%QuD$;5K6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWVl5K6=J6tt$tWE/Q K6߀xruX@8tB@9tD$P5K6x5K6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W?8@P7WPkj7p K6K6^_USWV\$D$|nOʼnmIWP)|$SUÉpsq9x 7u߅u҉3D$^_[]SWVt$(\$$W7C K6L!3K6P!3R6K6js2R6H R6~K6h9H K6K6+L!3Px6jVP W7^_[USWVt$FPh&r#ĩ"3HQPPu"3|$Q1ۃ|11E46E9uSh#j"3HQPP"3Q|=1C4膤"3HQPPޤ"3QC9u1^_[]Ðhm#辘hm#贘K6H K6~K6H K6#=~uK6H K6USWVP8!3H K6t+u yK6H K6~xhL"3蛤h`"3莤 K618!3~PXK6hSp {eD8t_8!3xLD8#>WjWt !PjjS  h"#68!3pK68!3@1ҋK6  K6@@P t 1+K6K68!3{tXAˋ-K6M K6~ @لtK6أK6="3t$5K6D$p5"3D$K6H K60~^_[]øK6K61K6K6h#,USWV=8!3w J6^t)kU53~D(< t< u 8"3Hc FK6FK6F K6G $9t V  J6t^_[]Ã=J6t^_[]-V K61~^Ë8!3r t ~6u1@1zK6 K6SWV\$t$|$J6 8!3y tja1 8!3I  8!3A$A K6H K6H K6H XtK =K65K6 J6t^_[Ã=J6t^_[RWV$J6jWƍD$PVuT#D$ =uD1PPPV# u2jPV腨 u <$ELF1PPPV# uZV9t:$Ph J6u=J6t菓Ā^_Wh#V1h#ؓVWh#ēV Wh#谓Vt$J6hnn VjjVy |$ t8!3H~Q8!3pxuh/ 8!3A1K6K64!3 J6t^Ã=J6t^馒8!3tL$T$9PuHuáK6 8!3A K6AK6A4!3Aj8. 8!3@1ɉH H$H8!3WVt$|$ J6|$t=K6W/K6K654!3 J6t^_Ã=J6t^_V58!3J6Fx PϊFtPw ~ u8!3VZ 8!3H K6H K6H K6@4!3 J6t^Ã=J6t^U8!3Vt$ 8!39tK6tPu^h #莑=8!3K6t-Ã|$t=8!3K6uK6~P8!3@fWV|$ 9=P6=P6@!3t P袉jh%#f@!3MPȈ@!3hr P=5@!3P6BW9t jjJ1Vj莕Vj胕Vjx P69tQj1P6P5@!3 ?=0d hƧ P69tQjTP6P5@!3Ǯ5@!3m@!31Vj躔Vj诔Vj褔=P6@1VtV@!3Fuh?#J!3^_`<0 hPh#:A<0f h+<0P hPhm#@!3;D$u D$@!3h$r#DR6SWV= P6jQEƋPhm$Ǟ|-1GPhL$蠞G;|ۡ"3HQPPB"3Q O5@!3tJJ6V[V J6u=J6t{^_[h#ۍh#э:0 hPh#貍Vt$ h$r#C^USWVh$r#vC= P6R61FjPlj+P6i5rO@QPh#Q |,PhL$+E;|ۡ"3HQPP͘"3Q ڛWR68tH R6@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 P6M5P6At#~i9:0#I {P6#4$D$D$=P6C1tQ~H$8?uEt$PGuUt$6t #tl#K\$ueZ*t%tS-tU+E#D!3x+;P6}#5P6it #\$1|$ t5^_[]áD!3t P6i #뚽 #SU~USWVP6)i5rO=D!39u=D!3)P6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D!3^_[]SWVt$J6~X1tttG9uމjQuH619}q~5@tu ƆH J6t^_[Ã=J6t^_[^+5P6i5rO@Ph#賈+5P6i5rO@Ph3#蘈P Ph#脈WV11FhU#_>kt!Zu忀ރlt puԉпɁuR6tg8tbPhm$km=!3u =!3u@R6tA5"3jPvW:R6H R6@ujakW5"3 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh 5&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] P6)i5rOC-D!3+9tti-;)t RPh#jl$ Ue\$D$P7#$t+,D$0h#jS0S\$#ŋCt:tBuM ,%Ph#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Si"l$ ō,@)QPh#w0 h%jQR ݍ,P$"WD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁PhL$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =!3$tCt>5@!3螢9t%5@!3PV$=P6~y\$t$1=P6tEt*t t.<$u u/S0= P6u WE;-P6| $^_[]/0 hjPh#膂USWVD$4\$,tl$0|$WUS ƃuW/8=U6tJ6P6P6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1oP6D$ P6$iD$ 9T$tcu tQ=P6t 1=!3uL$,uP9tPtu "3P J6u=J6t^_[]Vt$J69tPl džƆ1z J6t^Ã=J6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hY#5t$ntpuR6D$D$D$t R68D$t(1PPSȑ EjS== P6u|$1P6-R6~6@ P6D$u}t!AH Et{1jPƅt9u ED$u :u G EuR6t Dt111D$uD$P6L$L$t$D$\$l$|$ P6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$P6C$jU9 L$tc|$tNuJD$1rȋi4h&r#jD$(P@l$D$D$L$D$u U D$\$l$t0~Ot)D$P6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =!3u V 4Ń퀉0^_[]h]#{Shz#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( R6t yjPƅt,1tP6)i5rO@Ph#H$t#tH~1i0 tPh 5&轊11G^_[]Ã~1i4hv#腊"3HQP~G ;| Z %PG ;| "3Z;|lh#yh#yV1= P6ujt$ St1+^V1= P6t. P6~$AP61F:uI}^V=!3tO=P6tFD$t+ P6i5rOA1ɋ"3u0VQh)#R^USWV= P6u65P6~%=P6Ft WN P6l$P6~"5P6HI}J6tfiPƋ-P6=P6iPUV ~ ;uKuU l$hnƋ=P65P6i 1҉AJw)׉=P6 J6u=J6tmwJ6fdž=!31P61B|iP J6u=J6tv^_[]SWV\$|$%ƅtt.VSt$W\$<$D$ #^_[$0< Ph3#vUSWV|$ P6tWdW~*15P6J6P6V>V}5P6l$t$t%t =!3ttttk0hWj~Wj~t uu`mul1V脋Vhf@..@.^_WVt$ J6NJujVj 瀾tW5@!3<u%+P6i5rO9D!3t mjVt=tu  ρπtt=ttu ju VK J6u=J6tr^_j 0 hPh#DsSVD$L$ =!3t1ۅ SPje ^[Ët$1҅tހu1=P6u2 P6u) P6~P6:tzt IuhD#~P61@SWVt$$1@= P6|$(1@$r #$h'Wh#bjvu h4V#hu%tjjvjv 1~ hF#21@^tjs%;thi#h$jvhA%1Wvh\#1Wvha#Wvhm#jvu h4V#xhZ#kjvm~ t+u h4V#Ghq#:jv <u h4V#hx#|#Rjvu h4V#h#7h2"v h;r#jvh#jvu h4V#hHi%;h#kFp]h;r#P~tF1SwJhO#.Sw 1> #t#P uh#hb$vh#v#'1D#1###1#N9tQh&r#jWWSxuF x%Ph&r#jVRVjv S h#51^_[hf#hf#jvUSWV fD$ P6 P6l$ 1D$U$u1!" $']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻&!$}D$##} u#$A%)4$<$zT$tvӃux<'t ur>u<'_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<':'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I P6P6 ^_[]WVt$ tG|$t jV~t'hu%hu%jVvu^_USWV$t (P6 =(P6D$P V6t U6V6 $=(P6z1jh'St `P>;Hx@u8/UD$PV苓x D$pL$t 1D$tD$p1ɋ4P690P6K6tH1 8t:tGt89=P!3Z 9=P!3~K65L!3WPVX >?#<=R6l V: fiDle cDhangD ged߉V~v"3HQPPvv"3Q D$pL$t 4P60P6E;-(P61-(P6D$PĔ^_[]fUSWV<1UjKD$hhh UPj<} %9u 9ÈP6j U~ P6jP6h$r#U h,#!3,$UhP62Ct$T|$PJ6P6耺P6P6@fD$PVWVW~=P6 Àu {=!3n$h<#J6ttQu K6 J6<$B=!35=P6(ȃu6襹P6P6R6$J6u7=J6u7"3HQPPt"3Q h`"3tD$PJ6=J6tcg$$=P6u>hK#J't1PhI#QPP[V$=!3u!3 P6t N=P6uEt$(VhS#t8t$PTPV$XW6="3t =R6tjT'kuD$PR6u/jM=!3tFh2#|rh`"3s*1ɀ="3ˆQPj="3u=R6t4!3XW65J6+p$$#uSWVD$8t^J6jP|zƅx jVO J6u=J6tvex"1=!3t=*"3t*"31G ^_[11="3t "31j蜉V3V芉=!3tt*"3u"3^_[USWV|$(V11C=U6tn1=!3u4t0j5"3ujh`"3q!3P=8"3t.te=!3u\1Ƀ=P6 P6jPPi1;tW1R=!3uIu=!3t7=!3t.hW#hpEVuu$u蔆V#^_[]Vt$J6jVxx1jP J6u=J6tcj^Vh#ct1Ã|$|D$pPmmft$葵 tht#ct$t$^ tht#cWV|$ W@PJ tWP(4^_ht#ZcSWV|$P!39~b9J6؃P tr H!3 L!3P!3H!3 J6u=J6t wbP!3J65L!3>L!3)P!3 J6u=J6t?b^_[ht#bD$t L!3) P!3L!3j h#jau D$ H!3 L!3H P!3H R6H R6HR6ËD$J6H R6P J6u =J6aVt$J6H!3;t H!3P4 FL!3FP!3F R6 J6t^Ã=J6t^=aUSWVP!3<kJ6-L!35H!3P6t|F9uuH!3PV  H!3H!3+ P!3 R6L!3=P!3R6tG90uC H!3 L!3H+HH x@WSUP] 5L!3=P!3 J6t^_[]Ã=J6t^_[]S`ht#`D$J6L!3)P!3 J6u =J6`V5P!3P!3R65L!3^V5P!3+5R6P!3)R65L!3^ËD$ L!3) P!3 P!3L!3+D$ȣR6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$V  J6u=J6t*YӁS1rD$r1@xDw@@uDx@D1 uD$r1@uDw@uDx@D1u$r1@uw@ux@L$T$PQRh#i5"3oe "31Ath`#d1@ ^_[]Wh#XWh&#X0 PWhF#XUSWV(f11CD$hr#AR t!HuStau׉\$σʃŻ`'C9t;[ uVh#X1NR6ɉL$|$xtD$ h=#Qte\$ 1 waO11ہ̉ځ Љ ۉӊ€A ru1G11Tt$@1ۄnD$ xjWhjR9ىƉߋD$ \$ D$ |$T'C L$QPZCsP\$3h#f\$ utt$|$ t$|$t$1N11 uh=#f+D$@ jPWt$腟ƉRPh#qf 1 Phw%YfgD$x @ #t$C\$SPr|$D$ tMt L$L$|$t D$D$|$FSP~unjP6]uT$tT$|$T$|$1I1Ѹ1 uh#e FjPWRsRPhd$ce 5"3a "31Ath#`1@e^_[]t$h#Ths"T0 Ph#Tt$h#T0 Ph#TfSV1T$L$t$ |J@u^[SWV1ҋL$t$1@t z:t1^_[WVPt$$Ѓ w,j WV t9t9u1u^_Vhf#TVh{#SL$A1@҃Ѓ wAu1SWV\$1tZStMPh%SL 1Ft5Whq#S6 t"uh~"S t Ѓ s^_[S`1ɅfVt$ |$FR6(!3Ɓ2"3u!3jR6 R6u "3 ="3=!3u't#jtjt!3!3<u="3u !3=!3u!3R6=!3ut 8-u!3(2"3u 3"32"33"3uހ="3R6u:u6J6R6H R6R6jP[R6J6R6 R6t/t_9tZAR6R6Qt R6R6ȣR6R68t R6Ax@uR6 R6^{h<#QUSWVt$R6H R6-t+C11C<-t1Eu{-1Eb USWV1\$@<uPƋtPEu1ۉ]hR6R6=R65R6R6^_[]SWVP\$t$t2uhf%V1C$"h#^Z9x%(,"3u*2"3b#0"3RQPh#^#uȡ"3HQPPtZ"3Q (,"3t"2"3RV#t~"QPh#h^ u.$(,"3tPVtub#VPh#M<$u#1"3t(81"3uƁ2"3u숟2"3h#1 [!3t$Y!3t(81"3uƆ2"3u Z!3@uă^_[V(D$ T$0"39tub#RPh#Lt#1"3t(81"3uƆ2"3u숁2"3^WVt$ ~t)~tPή uv躮 ^_USWV jA R6t_y 8-uUD$$R61R6P  R6y8-@P1F PơR6)J6R6=R6~-R6Ft7 R61NR61ɋuR6 J6=J6J1F5R6P)ƅR699SJ6 R6R6lj4$މt$\$)1*C/5R69rL$ 9v!\$ۋ4$ P; R6w4$ 9vQ9wR6 J6u=J6tIW1 ^_[]h#2Jh#(Jh#Jh#JSWVT$ R6tstm8u'1z:trrD8uAÀ~:u"9u R6QR6 tf R61ɉ R6D5R6>1t6?-u1t+O^R6-uta5R61^_[Phi#:IPh|#/I|$u1PjPPgeJ6jwR68t PI J6u=J6tjH1ËD$Ѓ w#j jPڋ uR6R6ËL$~ND$tH  R6=R6u R6R6R6hR6hR6Qpph #CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$r#h0#Y J|$:uUD$8@?jPh0#Y ^jUh0#Y 1|$D$0)@<Ph7#h`"3V jh0#f1?\$D$01@11T$4*l$Ph&r#j UVhUhb#Y D$EEjUt$0X u0^_[]À|$:uD$8@:PhK#K1L$0L$4@UjEfVD$ 8"31qqA1Ʌ P60PQ8"3p ]t u 1%8"38"3@j* 8"3 u^qqhX#EPD$P6/$aQXUSWV'ơ8"3@tu'tƃ 8"3 x,$@D$t.$x$18uWPtG'uD$tKjD$p4*t6NjpVWPVl E$ht8"3@^_[]USWV8"3@|$u 8"3A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq8"3@@|$Fu6|$uD8"3@ 8"3Ap8 u|$u8"3@^_[]jjX 8"3ASWVƻt u j pxʡ8"3@^_[USWV8"3kE1͋ 8"3x t*P6,PqN8"3@ C1Ƀ8Qs s j@8"3HOH O oKy K9t?U1CSpt ^ShT!'P= 8"3HO@ G 蝯8"3!^_[]WV@t$P 8"3A uyW wWhZ#4t'h#j"Q Whr#j"PQWuL$Lx4t'h#Vh#jPQWUSWV8"3@1u 1=!3tMtݡ8"3@xuUj @jtÉGpj`aC+t8"3@tj,(pƉ^_[]h#8"3t$p0h#O@USWV8"3@$ u8"3@$EŃCߡ8"3@$'$ 8"3APUj já8"31Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt8"3xJjG B u08"3x,u%@Z$'t@/@Z$'uh#jÀ=!3tjjj 8"3H0+H8O U 8"3p0j^@ 8"3QPI H pGu58"3~ hx%vNm|$F8"3xujD$ 8"3Hu 8"3H L$ qx0j@8"3HKH K {@;u.8"3x }8"3x|$ T@0GjG 8"3@t(HS u 8"3@8"3x\$\$j 8"3HK @0Cku8"3x ux,uhx%pjP@<"31ɉH H 8"3Q0PCAHrAAtejC9t jW\G @:8"3@ u8"3@$EŃ!ߡ8"3@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$8"3X0j2x@ 8"3QPI H X t\$|$D$C 8"3APsVL 8"3jj 5jj,jj#jj jjhx%jjjjWV8"3x$G Hs8"3jpW$ uq8"3p(x,u~ 8"3At8 u @A8 @tHA~րxru\tuՀh#8"3p0+p8j@ 8"3QPI H pG .Pt8"3@F 8"3t1^_jjVt$&9u^jVVL$1Z$'tA1B1t AZ$'u^uVt$j@ 8"3QPI H p^USWV |$$tD$ D$$D$l$E1$8"3xc 8"3x0$t $j\ƃF 8"3QVI N ~ut. 8"3IZ$'tAt=t AZ$'u1c8"3H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc4!3 8"3A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(8"3 $+H8N~L$NL$$N @0FEPrj/v詮uG4!3 8"3+A8FF8"3@4 ^_[]jjjjh#L$1Z$'tAt=t AZ$'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;P6}X;P6~PP6I;-u{tBuG8"3x0+x8j@ 8"3QPI H xF^_[F h#lUSWV|$4!3D$=u ?vl$$5L!3P!3R6G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4!38"3HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNR6H R63\F u%R6H R6  F4!3#áR6H R6ƈF t詚=v4!3菚=t h(' u4!38"3HH R6H R6r=L!3)FV,8"3x4!3+D$^_[]USWV$$1҉T$ T$$D$(54!38"3r0=T!'t1$|$ fw|$1/fFn D$j8fNL!3 P!3 R6=X#'u ƒ=R6‹nD>  $|'=R 'u f|>z R64!3Bס8"3=R 'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=V"'fu R6Bn׍MN|$=@01fD T.fTT.fTT.fTDV"'fD1AL$!(ljƒ(M R6FD R6BvNO|$s@81ɃfD T7fTDX#'DfDfD> 0 = R6\G_T$ t$>Hff R6T$ Bf|>D>u6t$觑 nMn R6}f|>  R6BFfL D$$D$f|>tD>t R6Bf|>u D>v R6BW R6B*Ã{t Z$' R6}E+=L!3 R6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $V nMnD.=R 'u R6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDT!'fD R6T$ B1AL$ I) NjFfL R6B) 4!38"3@8xt P6 P6$8W Nf|F\=`4" $"}f|  R6T$ BFu6$蜎 Ft$HFuЖD$$D$ Poſ1۹$'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDT!'fDu6t $艍 FHF R6B赕= t]H\t 'u 4 t =u 4!38"31Ƀxɉ P6$6 R6T$ 'uF|R ' R6F$ V"'$< u R6T$ BT$ R6 cʔ,t$@  4!38"3xDP6?Z$'L$ 3DAD$D$E|$}~V"'f|t R6 R6B\V"' u R6BNf|t R6B1@D$ R6 R6B݉ý {"XŃ', D$0$. nt$T$ Mn R6B1@D$t$CP6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M R6vNO|$@81BfD T7fTT7fTT7fTDV"'fDőL$ uk%=I =R6 D$ wF R6P?ˀ R6@ww R6 x?ɀtw R6@ R6W?ˀul R6GXT$ W R6x ?ʀtw R6E R6O?ʀ R6Gw7 R6x?ʀtw R6E R6O ?ʀtw R6G R6A?ʀtw R6A R6H?ˀa*8S69S6D$D$$8S6B1zZ$'t.R6H R6LjGq Z$'u\KЃ w4R6H R6LjG; ÃЃ D$ u t R6׃Z R6H R6]=Gt/ up}tkR6J R6/#@ǽh#tE%t@Ń:bD$D$$G'#¸U1#,W9uڍ1|$Nf|uf|t Ms@ L!39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|R 'fq fq ƋT$ K6H K6~K6H K6 ډËFD\$D$$G'ƢQ1G')G R6x?ʀtw R6E R6O?ʀtw R6G R6A ?ʀtw R6A R6H?ʀtw R6@ R6A?ˀa2 R6AD$ ??R6H R6~2G:R6H R6~$_1c:B ˆB1=R 'nD=X#'G=R 'tf|cf|.3R6H R6莿5L!3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B8"3L$H,L$H $վ8"3pM tΉ$轁 Nu8"3xĨ^_[]1HE;P6} ;P6~P6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }8"3h$ Ή$膀 Nu=tuS$#$&#4!3 8"3A0$N#u$3#b$|#V$a#J$2#>$I#2V 8"3xt@@ ^Ãx t#P6$@)8"3@ @8 4!3H0K6H K6~K6H K60諄ƃ~0:=F $,'> t=u럃F~t\u^ 4!3@4!3 8"3A0ytP6 KP6$S(*;|u0d|8"3@=t*ʆ4$D$D$R 'Kuۡ8"3@1v u4!38"3HH @1@Q&8"3@-8"3@8"3@&tQ;ub8"3@ 8"3@؅8"3@8"3@ 觅8"3@u:\u?0 u64!38"3@81Ƀxɉ P6P&Bjjh^"A ځVȋ 8"3y8~0 R6QR6@ 8"3Q8rq8^USWV\ӉΡ8"3@D$ 1,$J6D$^+L!3D$$UPJ6$~S"ʼn$S5L!3PE l$|$tD$$J6 J6u=J6t?w4!3D$-L!3P!3R68"3x t*P6PL%8"3@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4!38"3HH s`un=ub\tX`tS4!3 8"3QQ NDt""u$R6H R6~E\E \@ŋ R6AR6@R6H R6ٷEL!3@|$t~Pt$jP荅 D$pŋȅut$ j轴E8"3xtH@1D$4!3D$jNǡ4!3D$Kt5 8"3At$ D$AExK8"3@t$ Ex P!39ًl$踵 P!39~=L!3R6t1SUW讗 )R6J6U|y $ J6t\$=J6\$t 8"3T$ QJ6Nf|u%Du R6QR66@Vt$+t$ R6QR6@~.FR6BR6ȅAJ։ȃՃ\^_[]á8"3L$H0h#W~<$t 4$}x /8"3@D$J6jP!jj#jjVtQ5x N^V 8"3$r#ytA5P6t7t u(@V6V654!3P5P6#^USWVt$,|$0l$U5P!31BW;L!3u(VeG@S69w&HS6 jjV ;D"3~=D"39t V^_Vj 迣tL$ T$5PS60PS6PH^áPS6tT$PS69Pt uPi }USWV$|$<\$81D$ $D$1F5d =53h#WST !1tbhL$Wfh#WPuo1<`S6tEJ64`S6a `S6t jV J6u=J6tF@u`T6>hm$Wȝthv}"W趝t D$1p@|MD$K}h} &W~t8D$D$h# j5"31CKD$D$u}h&# v11 t=t8<`S6u.u h#v VaPhx%  GF@uh2#A F@uu=`T6tk1uu莩ND$E11P@É|$t<`S6tW4`S6h#Ah#<`S6t4`S6 h#{SfPh# Eluh#5"3 Cu|$tE1F-J6D$t P1<`S6D$t4`S6^ D$`S6t jS< J6u=J6tEt h2#11<`S6t:`S68u.u h#aVLPhx%   GF@uh2#/F@ut h2#1<`S6t?`S68t3h#4`S6VPh#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=`T6t61B=P6tbu^1Ƀ~7t@tuH1=!34 `S6t1Ҁ9ƒ (u1=!3B1ɉσu1BdT61t)9t`tbփub1^։PjS9 $u=!3d1@ָb PSt^udT6u jS1D$ D$D$$K?r 蟦 1@ jPj  ^_[À=!3u=R6u ="3=!31@VJ6`S6>t8t6][ `T6r`T6 J6t^Ã=J6t^eSWVt$u `T61ۃÿ`S6t6`S68t+J6SP J6u=J6tdS6=`T6ru^_[,^_[V1=`T6u#`S61A:t2>u `T6r^WV|$ #0`T6u"t$=J6tg=T6u^J6WuS =hS6tӃ<`S6t>`S68t2t-T6U6=!3tu=J6u"虤0^_WV|$t$ dT6uWVjdT6<rjV蒡uƆdT6^_áS6=`T6t1Åt8uUSWVT61GU6Qu95"3u V^_5"3t$WVt$ NfuU6FNtF t0fu^~J6 ?NQPF N)NJ6vՏF FF J6u=J6t V N^_Vt$F t-)t'VfxQPR yNFN F^5"3t$USWVP|$t$j'Vukt~th#VE<k>t!h('V`1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9="3uUWMGHO W]H"WVGHO W3H"^_[]WVh('Qj'Vwit)19<>^_hL"3oh`"3bUSWVD$~@|$l$1SWU t 訝8tF r)~1H^_[]ËD$)D$J6X"3tPR 1X"3P"3 J6u =J6PD$L$ T$$RQP XVPt$t$V tt$ P4$5R ^h#PD$L$ $QP5"3 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+XW6+U6Pqq hP#jhDW6荳DW6SWVPU6'C PVw u,$$w?CGσCGCuhV6Vhq#8 u*$ V6V6V6V6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv t61^_[]ËD$t8SV 躩ƋV6`uV6$P V6|#tu#$#t&h>V6㟉V6t$D$$J# ^[WV<5J61$|$PW!t $D$PL$LT$H=J6PQR 5J6$<^_USWVL$T$tHtA|$9t91Z$'Írjt/9t+1Z$'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U蟉V藈Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh#WV<5J6J6$|$jWu"D$LL$H=J6J6PQ5J6$J6<^_USWVD$ èu|$=Z!3uÍD$PQW Ƌ@J6Nt$݁ uF @SPуF`u vmM F~tuF1Ɏ! s%t É^~U6tU6uV6t j~ J6uk=J6tb[r2j賆XxL$H @ $  $#`uWL `u WL fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=R6u0@=R6tc@=J6tf@=!3ti@=!3tl@=P6tp@="3ts@jPh#,WVt$|$ J6twхVP? J6t^_Ã=J6t^_WVt$ t|$Wv 6u^_USWVP\$J6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=S`S迄UPu< ؉G@54"3S54"3hT!3Puh ~ F1gjt$tV6uQG L$<=u5U6HU62UjS $81F FFU6tV6~@W65@W6 J6u=J6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ J6t8Q12<08uF=u =ut j=RH_F^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVV61tr:1҃Љu8W6r׍P辂ƻV6Nj+t7Mȃu%EttUЃuEmŃ8W6r^_[]SWVV6>tLGu% uwG Gu#WG @tw݁Gg;u8W6r^_[2SWV|$tfh#W8WS9uWhm$V't*tUj'Ws]t8)WPh# h# Gh#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhZ$tUhZ$>=uD"3HQP~ j( P "3j)n~=uGutha\#EU"3HQPP"3Q ^_[]USWVP8W6u)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP1eI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$('1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$裖 t$W19{USWVӉϋu`W6fx@$|'$PWs1ۅD$PV[r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW-1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVWw1ۅTVWw1ۅfVWywVWew1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]JQ9-u1tQyt8ytBÄth#Qmv't1hM* jjh'QhM* jjh'h`* jj hh'RGËD$L$  )VL$D$ 2)u AJ)^USWVPj PV蒣 lj8t"܃ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉=t 9Fup  ^^R9uM1PPR~ōP@rPU|R~ LH;NuS78 #~^_[]ÐUSWVt$(h$r#jN D$,^H $x?-Ok-u)sstdluu~xwGWKÅu"3DHt'1Ʌ Szكh#Eh3DH\ƃ~ƀtVtVOVh#jQރ $hx&SHs1Ʌt:SIu+$891V5"3V|-$K$8ʉT$h} &Wr1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWHu.&|" $4Ph۳% 1@D$l$t jWOj D$PUb ljӋD$9t-ف8ur1u 8tQ#x$r#UPh[#3 1@D$\$ $4h6#1@D$F \$ t$Ph#jJ6PPPPh#5"32jWVPΉj WQa 9u=у|=}^_VhE#jQhr#dj5"3j`WV@hL6K6K65`P>>t)j=W'JthW>uTPh&r#j@VjVhj# Vh"3h~" 3$VWhb# #t&VQhJ# j,ho#hw#q VWh#bL^_=J6t 1K6K6T?8"3R61S6S6R69LS6tj=LS6u"3L"3"3`"3"3tP2 "3Vjz15J6 >CPkAQW1^_[SWV|$t$L''$l&'Vw vVw d_ t"Vst Vw?w0lN@F1Vw q#w lN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uL''E$&'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t. Ã|$. USWVPu }dW6hW6"3f`|j%vDm O1@ 0lW6D$,pW6|$@t$(q%v>%L$ h#V葼<*u C hu#Sp1N .u{*u{ 1HD$Chu#S<1HD$  t$CD$'C`L$&~QF0 $''. D$׋L$ jj D$tfL$tjWt$QPhW6TFu$''lW6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$PhW6wlW6L$ Q0|$lW6H lW6T$ l$=hW6uM|$L$ jL D$tbL$l$tf|$ L$D$$W6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$W6L$\$L$$X8GlW60lW6E ƋL$ cjl |$D$VPt$wlW6lW6lW6lW61  lW6 lW6Wt$*|$$W6 \$$W6W6t P* VeP\ W6҉D$xF\$wZ$('a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~VW6tW6T$t P) T$tW6xW6t P) T$15xW65|W6Љ\$H\tF5|W6X])P0tXM\$u/^t-u#F5|W6벸^tic\$>T$ j5|W6F5|W6{ 31:DYt 7GuF5|W6\$DF5|W6ȋ\$+1L$ jlD$t1L$t5WQgW6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hW6 PRQt$QP  eW6FPR xW6 VjxPn 7sxW6T$t t$L$ t PVRQhtW62MT$L$ t1PRQhtW6.VWhW61PQ*t$P PQhtW6 ttW6W6T$z \trB<]*<0tu$H(' ?$('."'#Eu uSh-#dW6 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#dW6\),ҋ4$u|$ uWh#dW6 ^_[]WVPlW60tplW6=m1ɉQPVo Nj 3#DQt$c#r& lW6+ pW6VQP4 dW61^_SVˡW6H W6 u:"3Prp~r0 P{"3Q 밅uW6)"3HQPPD"3Q^[SWVPlW60t"lW6<'t<"u1B^_[11f l1ɉQPVN lj+t:<-t6 3DAu)lW6+pW6VPhZ# dW6 $ڃ^_[SWVӉQ[ǃArVhK#dW6GPVhW6W D$W6W6ƇW6^_[USWVP׉1PPP膫 ,>U:[@PUQj x$tG9tClW6+pW6VPhn#.lW6+pW6VPhc#п dW6$^_[]WV9t"΀:t9lW6+pW69t\VPhn#ZlW6+pW6Ph#賿D\j8"uD=lW6+=pW6j"m9 PVWhK#~RPh(#m dW6^_USWV\$$8l$}hE j jh('Uzƅu!hE j jh)'UzƅH h] E $T$L}t8|$Y#$L$$L$A܋$L$A Ѓ^_[]É1u h#j Qh#jfSWV t$ \$81?-uGF(8hI j jh)'Pvt0Hu~(u+t QIN4tVP1@1 ^_[Wh#Wh#4D$L$01\WVD$H8PdpjVp$RQ^ËD$x(t2#H@KH@@8+$@#HDHD@<H8"H<#HDɀHD@,ËD$#H@KH@@8+$@#HDHD@<@,Vt$v4fFfF0^ËD$@K@M@PHDᜃCHD`9@,VD$H8PdpjVp$RQ^Vt$~(t D$Ph`t6xF F,^SWV\$1PPhnG$d x ƍC8j,PV V$yTj6PMC8C<C@CDD3\FuC\C`C,^_[WVt$ ~8v4}PWF,^_ËD$x(H8tH8H< H8`<@,WVt$ ~8v4$PWF,^_Vt$~(t0#F@ KF@F8+$@#FD FDF<F8P9#F@ F@F,^Vt$v4fFdF0^ËD$Hd@fPQhl%({ ËD$8P7Ph# {P1QhtPD xXh#j=hnt jaDxh#jhot jADxh#jWV|$D$ 0G@*'Ph,+'luTG8+'PhH,'Pu8GDl,'Ph-'4uG#D$w؃tD#D$uK#؃L$u R#D$uZ#@D$ub#a D$uk#B D$u t#"D$u#D$u#D$u#D$u#D$u# D$u #i]=W6tj {uW6W6# D$u# w %u#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u #D$u#]=W6tj sW6؃W6#wu ##jw؃u*#LD$u1#-w؃u8#D$u@#G#u=W6tj rW6W6O#w %u V# -' ]#u D$u e#Uw %@um#4fD$ut# D$u |#D$u#D$u#D$u#W6tj qW6W6#('tX('|$FTPSh#jdWp,^ u΃=W6tj 7qW6W6tj qW6W6('1(' tN$L :Ntl P#PSQ4p#uFj PVl O8u$8u؃^_[Vhm$jWVh]#jtUSWV f}6W6 }6ƒ }6W6? }6€ш }6W6 }6W6W6h~#t h#t8ƿ2'#PV@tG uVh#j $$1ɉh#SUf P6$D.'X6kj j5l =k ƃuAN8"5W6X6v l =fW6Wj j5l =3k ƃ _%X6j j5l =j ƃuM8"G5W6X6 X6X61A5l =5l =hS>#V>tch$#V>KX6X6B X6X6/W6#L8"tD5W6  9uW6rCjht#5l =hY##Vh#5l =h@# 5l =h'#jbu h# W6t 1ҁ‰$X6}6փ95W6u<9W6u2}69W6u#}69 "3t "3X6X6=X6u\1ɅQx[h# 3= X6t)ͅt=X6ut 1jhh(X6P4} $yh(X6hm$j"=X6u1D$(Pt$K'u#D$0=u X6X61N1$ /' $$h"."t$h#Qh%hVaV褄th"P6$Phm$bX6]6 $=]6=X6p(\6B=h32#tet1@$$Phmdt$ hh#h|tWWh# $=\6u \6 =\6u \6 4$h(\6 T X6 $$1 uWhPh(\6 1@\6D\6H\6L\6tjVh@\6z h(\6\ $RhSx(\6h(X6VW0 5X6VWF5 W7l$t$D$ 1ɉHHD$UD$ Pj= Džy#G8#Bj誠x߉DžV.vx9ujUj 1|$nh32#$PRc<hjh(\6C ^ W"7t $h#_h(3ԅ3H ԅ3~Ѕ3H Ѕ38hЅ38ljt9 t4ԅ3H ԅ3~Ѕ3H Ѕ3hЅ37ƒ߃NyjUjլ hS2#1(\6(3h(X6VW4. 5X6VWj3 h(\6dtd($Phm$Y$P91@PUjUjC PUPh?C##tǍ$PWh۳%V訌D$uh"Z$P%jPh'Q#QQƃu W& VQUWVθ1#0'PV,7t uVh#jG W6W6GW6GW6O1}6t^_^_WV΃=}6 }6t>W6t49t0$#$#9tS>#9tS>#QPh#h 5W6}6}6^_SWV~#B4'4'VSh#h3_;#uj)TVPjj"P th#g1Q1l/'$ =uhp} jj"t$ 1$4F"u4$ 1@^WVκV u1H3 r1P^_V΀=X6u6=W6t t41t)Ph(\60h(\6hedAV xk^Ã=W6u Jt=X6t7X6t.h(\6hedAVp th(\6hrdAVY t=]6ujRh#jh+#jUSWVPύAPjh#h(3]Gw4H4'h $Ph#h(3] (3w(h#V] w,h&#V] w0h-#V] w8h4#Vs] w4h;#Vb] W4O<W8#9tQh#hB#h(37]$r#OHtQPhK#h(3]$r#OJtQPhU#h(3\$r#OLtQPh_#h(3\$r#ONtQPhi#h(3\$r#OPtQPhs#h(3\$r#OTtQPh|#h(3n\<$f$1۽a(3Pjjh#, wVh#(3P\wVh#(3P[GtmÈJ9|6{u;[tVPWh #aD$(ffL$(D$ 1ۉa)D$u!)tPt$hM#qaL$4 <)ǘ΋I<9vt$hz#Ha$N<.”T$9vt$h#a$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#` D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( \6\6t$(L$QhV`  D$ 1h#VtG<$h#V4(1>tYj:WD$AL$\$h#S,1tD$hH]&W.tkhN$W-h:#W-\D$Ph\#WK D$q;W6ef\6ujh{N&l$!U l$H4'1tUP QF4'r܉1hD$ Pj <$Wh#^D$ D$t$ <$}trÉD$h&"U> t:h1"U, t/h6"U t$UWh$#O^ F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhD#]D$ D$\6FʼnD$uf5,\6l$u D$l$l$hs$W+h%W+h#W+h#W+h#W+ h#Wv+hݽ"W`+Th#WJ+h#W4+h#W+UhT"W+kh#W*h#W*h#W*h#W*<w ~W|$Wh-# \ T1<$\6jD$<$rt$Wh#[ D$f,\6@<$Whk#[W6f\6jUh0\6jUh@\6 <$t$ht$0V/\ J21jD$ Pj< D$P\6뜉1jD$ Pj D$T\6q1jD$ Pj uuD$`\6J1jD$ Pj uND$X\6#1jD$ Pj u'D$d\61jD$ Pj^ tt$W|$Wh#tZD$\\61hD$ Pj uD$fp\61hD$ Pj uD$fr\6a1hD$ Pj ^D$ft\611hD$ Pj .D$fv\61jD$ Pjc D$x\61jD$ Pj8 D$|\6; W6sr"jW|$Whh#W|$WhH#΍L$$ t$\6|$}6L$$ L$\6t$}6rh#Vxl$}}l/'1ۋ>t.W4%Lt t uPUWװ Á/'r D$3MDHu D$"91hD$ Pj t4$h#XD$ \$"r)Ut$h#W h#WD$1ۋD$\6ND$\6W\$4(t$|t%h#Vw L$1Ҁ<tʉT$D$< w'<$$@/'L$ L$\6<$tL$$L$ L$\6|$}6cL$$t D$|$}6L$\616FL$<$C fF|$}6L$! L$\6|$}6t8L$$ D$|$}6tL$\611A<$D$ h(\61D$ ȁ(^_[]4$h#VD$ WVPθWEV(\6\6f\6h(\6 f\6=X6u=X6u#$}h(\6hgdV 1h(\6hfdV y28t 28uv$=X6u(PhmdVn xX5"3h} F1=X6u$h(\6hgdV2 y #1G^_ù#h#9 뙃="3tt$ t$ t$  U11HVD$ t$=(\6thPh(\6 ^D$L$01"V1t,uVh#-t"uVhX#Vhm$Vh#Vh#8T^h}6hmd5"3& USWV8 $RPh h]6QӜ}6 X6v|Pt$hp#S lj D$T$1D$ XƉ 11 ‹l$T_6 }6]69]6hWD$P $;D$$r#=]6t =}t=}uЉD$$#=$X6tȋ $X6=WEVuT$tf9W6rD$Pftt= X6%4$t$Uh#R D$t=VEW=$X6$t=VEW4$t$UVh#JR= X6|4$t$UVh #&R=]6$D$PSt$Ut$Vh5#-G=X6u $h(X6S(3V 5X6SVI SGSt$VhVWq ]6D$ L$D$11t4$hI#8^_[]USWV T$ $11F1Ń= X6|Uh#Q QPWD$Pt$ә9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99= X6tUPh #PP Ɖ ^_[]Ã= X6tUh#= X6tUh#PċL$T$tPh(\611@PhU#\t"j QPI u=,8"t1HW61Yhe#j>Ph#t"j QPAI u+8"t1HW61Yh#jSWV։ϋ\$+ X6tItEu X61tGtB]6T_6}69w1]6 1tth(\6QA1@^_[Vh-#j*L$1=W6T$ PG1ɅɉWV}6~( WRPh]6Q }69u ^_h^#uQVh#jPQVh#jUSWVPӉ΋l$|$uj WVG Eu*"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h#V<t#ƍFh#P{m1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh# M1۹}6؃^_[]ËL$9/up`\6D$\$A/jPU u$D$ T\6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#ML}6!Wh#7L}61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#XoD$$Th#Sut]"\5'W PWS '> uۀ$U-$T14@6'D$XP+ tpC"uD$TPh#?$T$끹#@6'j" $eFMu SQЃ {Sh#D?h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$L$|$T$1ۉ\$D$l$N(V8T$ \$$l$ L$\$l$ t&ʃ D$$t4$\$ \$D$#D$:< Vh#W7 $TutoFh#ط/$PQh/#R~$ "Ph#Q? ~5$w$4'}6}6 hw#cVh#P~I$ $u ~ˍ|$@WVS 9t"b&J~PH k$5'1OJH w@$(5' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=}6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph# 1h#0~USWV|$t$t$h"Vy3 Gw46'hD"Ph"VS3 GPSh "V;3GPSh"V(3Vjjh\R&GXtVjj h%"GXtVjjh0"GXtVjjh5"Vj p=w(h>"V2 w,hP"V2 w0hc"V2 w8hx"V|2 w4h"Vk2 w"@D$Rt$UWQP -$71w8$Ћo,1lj1l$DRWt$>"P@PU,aUD$PShG"$S0$#a0QShU"$Sv0<.Ǡ!w4X7'hc"Phk"SH0  w$6'5h"_<t$uM55h$r#RPQhr""555WRPQh"S/7h$r#h"S/ "55RPQh"S/M8tDƔF1Ph"Ss/ F;Eu 1<1A71Au01<  $jj@PD$P`D$ Phm$'C9u<$u403H 03~(3H (3 h(3j c-1^_[]h#jfUSWV $ $ D$-@1}6}6}6}6}6}6$}6}6}6t$ h#USO c~!P$7' ~6˃PtdT]=l =?1AJ5l ='n~6뒹 .l =}6h$r#n ~6b ~6D$~6T$:@=}6ll =D$ Tnt uBxou D$ 1Ɉ ~6h'%V *t}6h$r#`ءl =$j:WC-}6tWutm}6S c$ \W~6t~6t ~639$ 1ɉL$tVh$PC tj/Upu Uh#"hy%h$ U#VÓDžuVDž7h$PӤ ƋohD#Wt(hh"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tU%lj?,$u1QhD$PQV諻 h~6hzd@P} tq$ PhedAWc WAs|$ WD8$9",8'uWr~6,$h ho 5~6P Ġ ^_[]hs#jZ$Phm$jvVh#j9h{"hz"ʍD$ Ph# D$ Ph#j>D$ Ph#롍D$ Ph#땍L$ Q4P8'h$USWV։ϋl$j蠩 V U CCCOK G^_[]5hh9'Ph7$h3$jvUSWVP׉΋tASW4$4(VS裩 Wh<-u(GD$tj=Vt>FD$ GDp#th'%D$P#u|$1F1B,$֋$$$,$D~6tP$r#t"P$h#L xF1Ë$4hx%0C9uj ?t2ƅ|$t t$} 4$r tA710h #F|$t t$H 4$= ^_[]ÍD$jPVK x!L$ȃtuuh_#֚묁tlP PUh:7#( 끉 ~6utD$P$"uW$P$u2#t#Pv vvh$h36ā$SWV։ϋY Wss ss҃ 6t~j RWss ssԅuA 6^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ衈聈 PQ40M40<8-<8D@ D@LHLHTP͇TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40340<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7yVw wfV FwwRVFww>VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu!SCuu SCu$u S$C EDȉCDu,u(݄S,C(E@ȉC@u4u0S4C0EHȉCHudh$VŋFNЄ6tbSQP Є6x 6~,=X6tffOfGG@ Չn,~$N()ǃ~$N(=69<$D$hP-6>N,ș)N,)n$F(teh$V$FNЄ6tbSQP Є6HT$<L=X6tAf=X6t4f.<$ ^_[]66F,)F$N($fOt@ 6븋D$L$t$ QPQPUSWV$$$ $$$(hZ$SV\1j _D$SVWUhPD؃r_|695x6rPSV Pt7=X6tf%"=@t4n#WQh,}%d WhY$T^_[]USWVP|$\$s s@=X6tf9uRP6t=6t=06tj:D$1PPPs sQs s6O63C 63K u "3&=X6tf%"=@t4n#Qhh$胣s s/)SUhv$ 6u =06t:yj h$6th $-=6uh$u=46X6t7t;f56D$P6jhb$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=X6tf=X6tGf"@t4n#Ph$/SVz.=6t)1=46L L h $,h$$p$l tRQf@ 66 1VW "3L$@D$DD$1 t$|$ 46pt95X6tʋ 465X6T$Htt tɉL$LL$QPh$=6uh$515"3PPPj66  5"3RPjjt:6=6h$:+D$L$ 6656=6 tYjj=46HX6tt,fI=X6tftfI=X6tfIfHVW516696t-j : 66 djjQP 66 AQP=X6tf%=@56568,$t$R=|6x6 t# Fjj WS~9ݹÉrFND$P9|$P$d닔$hjj RS~ )ˀ0^N9wh $訞h'$Ntf56615"3WWWj66 CRP5"3jj_h$h2$161P^_[]Ë$d#6 6$tҍt$PtV$lSUQP4$SUfH1G@u5656hB#SUu.$l#$pthB#5656SUq5656H=46X6fA=X6fh$6hS$h2#'jj5656D$DD$L t$\$ VS@@PD$PQVSf@5656tfA=X6tfA$l$p!fHG5656qf@5656SU5SUh{$ t$p$ph$; =6j DUSWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ؄6@4 1WjPQWWRS 9=X6f"3 6ff"3=X6twf"3 6ff#3=X6tjf"3"3f#3=,6t"3ȃ=X6t]D$ Yf"3 6f"3f"3 6f#3f"3"3f#3=,6t"37D$ G UV=46l$$tApQt=X6tRP nA(=X6t1ҋ ؄6I4-Є6teQRP Є6xtt$V/11jWpv =6=X6tf=6f"3؄6;x4})}jh"3W4 =6E ؄6A49rE =X6t<$fGj \$l$u6_=X6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=X6tfUVfXW|$$Wf@t$$W=46HX6tt,fA=X6tftfA=X6tfAfH ^_[]UUSWV$$1Q |6x69;$$߃9։$PU$T$L1 B(BE $BjZr1B$J$=46pt$ =X6t ɋ=46X6L$xtt tɋ=465X61L$|1ɅDT t$t RPj56UVRPU tE{[|$t}SWVjljUVSW)SW.jlj_{[ |$t]SWjljUVSWӶ)SWilj?UVSW詶)Ӌ$xX#UVSW脶)Ӌ$xX D$4PS $$W$VWVhPWV 461ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =X6t SWi ؄6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =46<$\$T$|$(t$,DpLtL|Dx=X6RShTtDp؄6D$0X0vvgRPgVFvvg RSgVFt|tx|$8gD$T$Rl$$D(D,=X6tFB\pTt؄6B0FN FNDxD$L|׉L$L$؉D(MU =X6t]RQ"g ؄6I0VPgU EMhɡ؄6@0 ȃ=X6t3ȃ=X6EhD,t($؄6@0MU EhEhD,=46L$ tL$D$D$=؄6,$\$ 1QOP\$  t19}#8@#pLp0l$$ Є6ɋD$taVt$P= Є6x4ƍ$56pS% ؄6@0fPt$t$ Є6x56Sp 6=X6tf؋6f"3؄6B09}+^jh"3S@x 6؄6B0N9rF =46tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL Є6taPt$t$$ Є6x=46t$,|$(DxL|DpLt1҉TxT|FN=؄6<$09X6QPd)RPrdVF^vv[d )RPJdL$(D,D(D,EM =X6\$QPd ؄6I0)RPcU EEhhȋ5؄6N0 )ȃ=X6t^ȋ5؄6T)FN^FV )S\$L$4$*5؄6V0)EM Ehh )ЋL$Ev8QS 61Ą^_[]Éjh"3pv $Ph$k=6th/$h$߻F & ؄6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lF46pt =X6tɡ46=X6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=X6tf)9F=X6\$tAf)=X6t4f=X6t'fL$=X6fVT$Rt)f~T$JR>>fD>=,6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=6=H6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=6t Vt$t$Ut$h$1Ƀȃ^_[]1A=6t1=H6<$\$ HfUSWV $8$4}tE1ɉM4M019 46‹DT 9 X6tRP]M$U(E$f M$E$U( u ^_[]%=uLI؄6(9‰|ǃ=6t<|u=46tFNFh1 t46tD$hVP. |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =X6t RP\ ؄6I0VQRPzh։D$D$ ЉT$t ؄6=46Q8k=46L$$tL$D$ =X6t QP5\ ؄6#8t@DQL!!IT u‹$8U t#DT tE=X6t!RP[D t(=X6t1҉EU}@U=}@|$6EM QPQPh$3WWh;$聇h_$'uQ{u u ؄6y0ƃ=46X6t:tMPWZ?UUlCD$T$NQt PWZ~V ~V h3$L6Ԅ6@ 뛋5؄6F8E -46T$$tT$D$ =X6t RPMZv0 I)؉$ʉT$t*DT tZ=X6t RPZ$8D t6=X6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W6E$8I QPQPh$3UUh;$薅h_$<$<t7؄6Ht)$|$-46Cq qƃ=46t0FV=X6|$$tJRPX)RPX4FV =X6|$$t&RPX)RPX)FV )FV h3$vL6Ԅ6@ USWV|$ \$t|69x6a6 6 ‹-؄6t9ˉrux9ˉ\$؉jL$QWPcց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סԄ6t`v0WUL Ԅ6؄6pxjV|$(WS)Љ 66=46jVPSģ Ԅ6A^_[]WSh $Ԅ6@ USWV$׉ν_ y@tnVՃ2v vv $<D$$8D$؄6p0vv_ $G ؄6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPa19rÃ=\6$t$ \$ti=46t,ۉ~A1_t4UT\$F9uۉ~1O ɋW @9uG W5H6萲t$ D$x, ؄6;Xt|$#=46t JًL B tmt$v vh$hW WVt=46t$$B1ɉL 6t$ $$Bt$ B C؄6;Xt`R5H6踱T$\$1ۃ=46t%JًT tN=X6t#RP/TBt/=X6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb6L$AI QPQPh$7W]Wh;$h_$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=46t+FV=X6tGRPS+D$RPS1FV =X6t*RPR+D$RPR+D$ډFV +D$ډFV h3$ L6Ԅ6@ 1@$5USWV\$41F~3|$0l$,|!l6 h69|)S9у} ȃ^_[]Éދ؄6K89}=6tOI.A!1‰9)=6l$,|$0t!t$4PWUhm$r؄6PVWU荰Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=6!$l$|$ T|$0tN# $ND$T$RPWUh$V ؄6<$\Ttq!qIVPt$ Sh$$@l$19=6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$؄6t$Sh$x1Al$,|$0USWVD$,\$( 66փσ56=611 J 6966 66696@D$ 6=؄6\$jD$ PL$QT$R[ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =ă6ȃ6tЃ68̃6T$tԃ6‹D$ȉ66؃6WUS5؃65D6贬=T6l$$-6+l$(=46|$`5؃61VV=X6tf%=tjvdv`MVdF`vlvhMVlFht4MTCut4mMTCuG9a=6t< ؄6(1؃6SS=X6tf%=u1=(6u(x$CS =X6t RPL9Ƹs& ɉ @u ɉ @uG9wt$t$t$5؃65H6襬؃61Ƀ=46 6^_[]PSh+$awUSWVl$|$؄6jVUW 1ƒ 6666=6-6=6-669؃68#{H1ۃ=46(=Ѓ6-ԃ61ă6̃6ډȃ6t@ă6 -̃6=ȃ6Wha ؃6t^_[]UWhN$Tvhs$Jv؃6t P,p ؃6USWV l$ =461ɅDT =X6t RPJ ؄6Y0މD$ʃQSRVw wÉD$4t,P_ 1ơ6$6QPt$0t$04$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 6; 6u3P56h =6t-66d 66Q64 ^_[]h$\tSWV|$t$66QPWVtH 1P1 t^_[WVh$ tV6tR 6~%646m ;56s6Pm 56m 166^SWV\$t$s sǃuG=X6tfL$%"=@t4n#RQh۳%t s s=6tfhR$66{@t1H1PPQQsHsDs su SW=46t6hh 6W -h$葠u7=6{놹 6s sԄ6H 6^_[WV|$t$ WVh$ C|695x60WVh$=6t7=46pt=X6tPZ t 0hZ$'=46pt=X6tPh9]&.=X6tfPh$ =6tqPh"1Ƀ=46DT =X6t RP:FRPh$ =46tF(F=X6tjP|tPh$^_SWVD$H8=X6t3P PP0p4u'11C9}QBRQp<ވ P0p4^_[USWV|$_8+t]CwL$Q A$T$ȉAh66Ԅ6@ =,6tD$ L$Aڍe^_[]USWVP-65؄6jt$pt$pI\TtN!NN WPh6k؄656U豀 T6X6ttut5؄6U56C }U tU tShx$|i1t$1FL L$hN D$dFQPǡ46pt =X6tɡ46=X6$L$Httuˡ46=X6\$LdtXu D$DVWg=46thh 6W{ 6Ԅ6X t$ht$h蠨|$Dt!1H1PPQQt$\t$\t$(t$(菬 66<$؄6jt$pt$p蟈Ł}U uu\ ,E ؄6LD9h P5\69N 565\6=X6t\6PP5\6`6h6M6P^_[]USWV\$0T$,t$(؄6HPډ t.=X6tf=X6461ɉ$D\$ۉT$u t P:؄6<$R01L$41́@T$؄61+J0#L$,#l$091۸ T$9и|0<$L$(DpTt|$RP9l$ l$9}16L$11ۋL$F)߉ӉŃw9}߃F<$T$tYL$(|$uSRPq9GD(|$u1҉ 1 ؄6q0RPa $D$(DT|$u1҉  ؄6q0RP) $Fjt$SU迗Ӄ=46D$|$ t6 $iSPWt$藗T|=X6t6WR8׉& $iSPWt$aT=X6t1L$ tYSl$ Ut$QT$D$$`؄6p0Wt$c $N1D$4 $؄6p01^_[]t$ t$h$(cUSWV@M461TD =X6tPR7D$,T$(D$(T$,5؄6F0D$EtH@t)PQ7D$T$@htȉD$5؄6D$L$|$D$|$D$NP\$,D$(É1 t1ҹ 9|kލL$0á؄6@0 T$D$=46D$0T$T$4=X6t RP6MDpTt\$9Ѓ}11@D$|$ ]D$1\$|$G)T$L$֋T$|$w9É}Ӊ\$|$D$ G|$|$u=46T$t'L$=X6t!RP6D$DT=X6t1 t>=46RMT$=X6HRP59L$0ơ؄6@0 T$D$=46D$0T$T$4=X6t$$t RPQ5Mt$t$$=X6tȋMD(؄6@0T$,‹t$(΃=46X6t+tMVR4uVFt$t$ 47KVR4MQ AD$:MQqD$T$AQ!EL$DT=X6t1ҋ ؄6q0RP耐 ƋL$ jWSQӃ=46D$ t7~SPt$t$$NjT=X6t RP4|$)~SPt$t$$輒=X6tȋ|$1҉\$$ t/f ؄6q0RPݏ xËD$L$ L$0|á؄6@0 T$ʋL$ȃ=46L$0T$D$t!D$4=X6t)PQJ3D$ T$8=X6t@ɉL$ D$ #Wyh$#Wcq6N6?6bU%j 5l =f6Pht$6=l =h$Wh$Wۑc$j W66Ph$866~m(/$j5l ="3=mPh$$A 6 6/6$H6l =D$  6 666666D$ L$uD$t/= 6t= 6D$th$ D$13)hD$=6t 6jjthm jk=6thm jSh. jD |$D$ D$4CD$=6u PZPADžu6h&$%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$(L$9|ȉD$6h6$t2WR K;D$=Ћ6D$te^_[] Ph$j5耛PhQ $h3@ jƬUSWVP׉΋\$t$US2 M9t 9u^_[]WVhP$j5USWV Ӊ56QW=6t=6t hg$X1SW[u=6hq$XP6=6u<؄6Ph${XCWt h$eXh$XXV=6t>=6t h$X=06t h$Xh $X/=6u h@ $WX=6u h^ $W3=6u h $W6=6u h $W<= 6t=6u h $WT ؄6|$Y8֋T$  SP56565656h $Wd,$kdы؄6@DWSQP`D$T$iщډWSUR%jj RP胷RPt$t$t$t$t$VD$Ph $趲$=6 ؄6+x6 |66 66 6 tQPh6 $Y =6-؄6KC)s, 6-6Ջs4HS8\$ ډD$$+h6$T$l6 $ $ډ Љ 66tRQhJ $衱 =6t8h_ $英56tvvh $n 6j 耰=6t8h $J56tvvh $- 6j ?156565695@6tmj- ؄6405\6h QV ; 56Vʍ=X6t\6PPҞ5\6z`6=L6t 6j ؄6y,t+61TtRL 6 ؄6F;q,r6PL 6=P6t =L6th $SЋ61=@6=6u h $S=L6t h $SGRtgD$Ph %Fu1D$t)L$ jQPh %hNs%Ct-=6u h8 $S3  ^_[]1USWV6D$45؄6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B p6l$9؉|5؄6|$0G;~,$LHN4H~KT$މ)1@ p69׋T$9|5؄61҉t$L1F, 66669S,SދD$4HxL$HD$81ۋjV ؄6ׁ\Tډ\$tQ!QЃQ SPh6E؄656|$D$Xt1NPSWUyʼnFظ|߃\$ <$w4F46<$t LX FuWFsT$ 66$@=X6tfL$fAf|$l$$j / hX 66T$ =6t| $=X6t RP RPh $l=6gq$ʋT=X6t RPWURPVht $]($DX=X6tPh $86h $Eh $frT$ '|$@@u' T$t$SUt$A 6t$D$, F=46=(6$@=X6tffu$@=X6tfft}SU{$@=X6t?f=X6t/ȃ=X6 $ApfAAt$f=X6t $ApfAA $AtfA1ɉ 46 06 ,6 (6l$T\$X46pt4$9 X6t ʡ46 X6$tt4$tʡ46 X61ɉ$dtX$t $D$LPt$衹=46=86t=6u,$$@\=X6tȅSUh $C h$,p~SUؾ19 X6t1ɉH\H`HdHhHl$f!B=86,$(E\=X6tȅƄ$E\=X6tȋ ؄6I0H111҉,$L$ D$t ߋ ؄6Y8Om\=X6t͋ ؄6#8߉@DYL!!ÊIT u,$\$lD`Td t<=X6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9؄6H4 D$|$׉D$|$=46t݋AQ=X6t-RPs!Eh=X6tȋt$|$1҉11 ˉl$$WVRPSUh-$uA=6th$h$m|$t;SU蕼ƃ=46D$|t1$=X6t RPFV6=X6tȉFhܽ$|$jj$$$$SU z $A`Id=X6tEQP@ $plph'1$D=X6tWUPVhN $  $AhQl D\$C5؄6;^,T$$L$ $6 6׃ƃ= 65$6 ؄69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H2 ƋD$9\$(s+l$ Uh $>j#SWUt$@h> $h $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w w,6 (6ʃǃ(6=,6|$ |:w whk $= =6h $qjG $D$|$tjVU¾ p6<)1CVUh$D$,p p*46 06ʃǃ06=46 j S% hp 6tH6 69tDy1Y1 t 9u,66$|$ ,66Q1I1 ы|$ t6$G0W4L$Aڃ]D$ p ph $J< =6t)hy$1C+6h $;h $h1Ct ؃ ^_[]6jpjNfUSWVP$T$1B@B0 686؄6x,11=6t>Q:؄6x,$kd1PWSQh$h3B6؄61ۃVU聶tzljl$ t$46pt=X6tʡ46 X61ɉT$HtttȉD$LVUz8tD$PWbu(C؄6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$86ŅtTM1ًU1 u3VSh$w w86HPUMpX86 69tmu1 6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $X:'h$F9h'$eh$ejj聴=46X6f@=X6fh$8h)$eeU1hPVPVҜ1Bh$8h'$'et21VWhVWVW莜1 tah$+76h $du<tf@=X6tf @f=,6tjjxfh: j5656n>T$1B@B: -66  $6$Wt>E6+56=6kdPWVQh9$h316uF$h\$vv 躑 6A1ڍF$h$cvv 6ǃ=46F$ X6&jPf 1 6I F NQPQPhSt=06F$ 6t%QjPSh#$hp$>6#6QjPSh#$hp$36=6th $=61F$6 I1)щN$uh$b-vv *ǃ=46F$ X6$Wt jPW 1҉GW1҉GW }hjD$\P:u =46X6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=46$tD$\=X6tL$Lu$D$PD$PD$XPy6;,$/6$W=`6v`656;4$]|$T{$AhjWs -46=X6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=46$|$TtD$\=X6tD$L$|$TtD$\D$PD$PW٧;4$=6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhB#ss oOCK =6th$ss QPCKhB#QPss fN 6;<$=664~^1ۋ/uu q]]8u9rۋ=6/CK tS  StQP HKX9rjj轄`^_[]6j&ejÃPh$/L$D$@, +A,USWV $0 n8$=46ui=(6t`E=X6tȅtNE=X6t$;x6|6s&E=X6tjPo@E$F0N4 utEh$%Pd)$0 F=X6tȍL$A=,6AAhh$%Q ,6 X6tD$D$L$L$D$h$v v薉 E=X6tfM9v%}EPh$.;$h$4[4/E=X6f)=X6f=X6fEtf=X6t΋$0 AI 1 h$QP辈 h$Z$0 F=X6tȉE$$PpZEL$fAWQU: $)fEPUV =X6tfD$fXWPU $0 G0W4w wmfH$X6$0 =,6t>}t8h$v v贇 h$Yu EB6F0N411G9 v vGD$@=X6tȍL$A=,6AAhhB#Q X6 ,6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=X6t2f)=X6t%ffD$=X6ffX6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=X6tfPjUJk D$fEutEhB#P`l$L$Aq $0 JR ωtljhd$RQUW݅l$EMك9v%}EPh$*$hq$qWD$$0 T$ 3F0V4=6h$BڃD$=X6t΋D$p@ =,6X}$0 ~hL$v vڄ Eh$VJ6Bq$$0 1GPVtXD$T$ F0V4=6h$tڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUY $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh$ U4$F0V4=X6tȋ |69x6s5h$juv v݂h$T4$=,6E=X6tȃu}uE=X6tȃtb}u\FN U=X6tʋ4$h$jRQPX=X6t}Eh$T1 X6EtjPgC$0 A4y0$$0 t=6 $=06JR u=X6tPjVRQ菁h$cSƋE=X6tjP1Ƀ=X6t fX61ہ@€@t f X6fG64$Crv $0 A4y0AI U=X6tʋ4$h$jRQP褀h$xR6zE=X6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=X6l$\$tȋM=X6t1퍜$UQUPhScSh+$$"Ph!$ %9-6th~$誯l$\$ h$zQƃl$\$$0 A4y0| AI KC=,6taEO9tU$0 AI U=X6thS$jRQP%GEh$Pu $ 6fO4$E  ^_[]ËM PShb$"ȃ=X6tUSWVT 66,=6t>)"=6kdPWVQh$h36}ww cO W $T$ WGO ƀÄ:1=6t4=P6t+=06t"uGO 1F9ƺw1 tbQPc8uS=6xJ1v6KNj@ $GD$wOG tQPb8u E;-6|E;-6=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D46pt =X6t ɡ46-X6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t 661JQPFafp69)T^_[]fUSWVT1ۍT$1BL ؄6x,@=6t;؄6p,kd1PVSQh $h3t6؄6 6<\$11ۃVU衛VUm`$t$l$ 46pt<=X6tϋ 46X61҉|$Ltt<8tϋ 46X61҉|$PdtX 8Džtɋ$L$HQ$p:'xtCVU誓tV=6VUh1$^1=46L L tOjh$s6tuQ1y1 t6 u_VUYdtl=6tHVUh[$@{7jh$$PxyQ 6P jhb$D$P C6L$;JWD$ P`646tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$0 PVh$>0 PVh$.W 1Ĥ^_[]áD6u"$T$TQRjPVDt|$\= 6=61Ae]Džt<$؄6\Tu nt1؄6!=6H6hh$jV H66 H6Vh5$V1=6=6=6$L$ PQj5D6SCuSh$d$$8ffs1$8j h$V誸 VSh$ BVh#-u h$*l؄6 h P5\6b 565\62=X6t\6PP"C5\6,`61=6t؄6Ph$T؄6tZT6u6t2=H6u!=6$t$Ph$41OB 6uh$؄68< l6h6B,x6|6J0T$RtI,T$T$ ,$ȋl$L$ ݋,$߉Nu݉|$,$ 466u@,$\$D$=6h$?,$\$`L$(l$85\6F4$*T$ l$\T$11|1ۉ‰CwD$FD$ FD$nV8<8D$ 6|$T$D$DSh$h<$"e؄61XǀPh P5\6 565\6S/95X6t\6PP\@5\6f`6 466 ؄6=6th]$ Sh$h$"؄6PP.=؄61@L1XP\hhP4 h6W76h 5؄65\6u 565\6-.95X6t\6PP6?5\6@`6؄6 Ph$uh$!ud؄6  h P5\6 565\6-=X6t\6PP>5\6`6؄6h$h$ ud؄6ǀh P5\6G 565\6,=X6t\6PP>5\6`6؄6@ ؄6HHщ8<=6th$w=6uh$u_h 5؄65\6] 565\6&=X6t\6PP75\6'`66؄6D@RL҉111C QPh($[ ؄6HLщ@D=6th$v=6uh$h 5؄65\6v 565\6.%=X6t\6PP665\6@`66*HHPLщ8<҉@D1ۉ,6 466؄61Ƀ,=6hM$1L$ ؄6L9| 9PhH$؄6=6th$xu=6uh$Ih 5؄65\6 565\6#=X6t\6PP45\6`66@hm$L$>(6؄6ǀ,04ǀ(<HHPLщ8<҉@Dh P5\6E 565\6"=X6t\6PP45\6`66 466G?؄6L-=6th$:h$7$6؄6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5\6 565\6!=X6t\6PP25\6`66=6t}=6uth 5؄65\6z 565\62!=X6t\6PP:2؄6ph5\6562 hd65H6=؄6VhILVjP+' G011D$)9|ËLG8 $HLOd t1SRPV5D66t0|$u)h$h $s1AL$=T6tLSVV36 ؄6A8$HLId t1SRPV5H6U=X6t SVV5 =؄6G0ŋ $A9l6 h6ʃƃVhp6VjP% jw,6y9 |6x669؃s6É66C 6UPpƣ6US_6 Vh6F؄6 $06=6 61Ƹ1ҽhWV5Ȅ65D6|56=665Ȅ6=LBALtl=6Hh-$Xh$11IPPQQPV7Ȅ6f@5Ȅ6+6 Ȅ6fĀ6FȃtvFjPhL$ =6th$n=6uh$nt1FȄ6f@5Ȅ65 Ȅ6fĀ6Ff=rmh$=6th$n=6uh$t0fFȄ6f@5Ȅ6,5 Ȅ6fĀ6Fffuzh$=6th$m=6uh$tt=11IPPQQPV6Ȅ6f@5Ȅ64 Ȅ6fĀ61Ff9D> <: $4/1@ Whj#/h(3ԅ3H ԅ3~Ѕ3H Ѕ30hЅ3? t ԅ3I ԅ3~Ѕ3PЅ3hЅ3 ԅ3 t ܅3 t^mNt"YAyt n+j m- yWh5 $+.P61^_USWV 1Є6Ԅ6؄6$X0Shwl661N56566hh8-Ȅ6̄65656Ą66 6611ƃj$\ShÅ…t|txt$FD$61_G6yG 1HG GG9l$td$X0j$Sh_ÅEtu56rPVQƦ D>/|)Ot$L$6܍62܍6$!D$h8J܍6$ D$tB?JL$h)PRQXSWVD$t$ |695x6r==6 ؄6jSPV<)޹#394v t^_[PVh!$CWV|$ wu$;'1XD$@uPw w Phm$*=6th"$Ih!$t ^_Ph!$趽6USWV$\TM@$ 5uh`̦h`VP =6t h"$ I=T61ۃL뀃=X6t\,L$UPQ DPPz$\, X6L$L$UPQ |$u $PP@1LDffLD@9u=X6t8PP\X6L$UQPn t"PP\L$UQPH  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h"$(USWV\$t$=6!ߋ,t9Xt6@u|$t&j^t1ɉH HHXh1^_[]h)"$VD$ L$56#p9tыR9u @^USWVt$|$VW/؄6!t7^Fu+11 33 1u{ 6tqt$0|$,\$(l$$T$6t9PtjRQ 6(Xxp L$ 6t9HtjQ56 6(Xxp ^_[]WV ؄61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$='$1Aȋ$sY9Ut;'q1Ƌy 1 t $B8HB8tQPQQ>C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h($'h'$h ($h h&$Ph'$O4$V0Vh'$hp'$h hf'$hU'$hWVt$ F,t@6th($F,P1~,>d9~8uv0^_h'$h'$h h&$D$x,u@Pt PÊ黊h&$h&$h h&$WV΋I01t*N8~2IN8tPQP PpN0G;~4vɃ~8u^_h'$h'$h, h&${h'$h'$h2 USWVEH1Bx,T$1h{yM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS艉e^_[]h&$h'$hF h&$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h1($hr($hK h&$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h&$h'$h` h-'$h'$ha h&$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h&$hC'$hq h-'$hC'$hs h&$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h1($h($h~ h&$rfUSWV\$$|$ l$t$6t5H6SWUh($USWV5H6 1^_[]USWV\$$|$ l$t$6t5D6SWUh($4USWV5D61^_[]V= 6th)$Œ2j56HtahQ)$腌h $+tS6xL~61 6 s"@Pt4hq)$ 66F;pL|^56vj6t'x,tP6P6á6t x,tt$t$t$t$P1WVt$|$ VW=46dtX=X6ts,؄6`uau33 u1@1^_WV 6t1 6 ؄61!`u/aʀs2hlpx1Ph)$ԊPh)$h $gJh)$蹊؄6 ǀdƀah P5\6q 565\6=X6t\6PP5\6Ѱ`6؄6!1111QWRPjh6hh)$h $艶lh)$ۉ؄6 ǀdh P5\60p 565\6=X6t\6PP5\6`6 ؄6dPs+aʀu Ph)$Ph**$h $蟵h*$؄6ǀdƀah P5\6Io 565\6=X6t\6PP 5\6`6^_jUSWV1L$ AL$HAL$@AL$<L$ M'L$A M'AM'AM']u }h*$SVdl ka~(bt@it YltAsttuJD$PW.5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWX&uh='jBƉe^_[]Ãu953ujhM'D$PF u1PPD$PjXi953t$Dt$Djt$0t$0SV*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQJeRPt$8t$@t$8t$@W3u2h+$R1PPt$8t$@t$8t$@}Wv3%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Ph&r#hVbD$@w ww7VPhe+$S  1h*$+h@+$W fUSWV1L$(AL$$t$@L$ D$ }] h+$WS6h aLuKVbtit'cD$ Pud"D$(Pu D$$Pu!udt AuZD$ 93u~]#D1غ$Phzd@ tN|$$tOh='jt$ {t$@{1Oe^_[]h='j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$'jc " Àuh-$Up1O^_[]Åt&$jv % VUكtt$ <u&$jw  WU~tJ 1u$jq 轺 VUJbh-$Lh-$Bh-$8SWVL$t%T$1H1<213$>'F9u1^_[USWVT$D$\$1f'C9uы$$$19FًnTnP1$1ۃFHVLWT$RD$PQ)|$ t)t$1K1 713$>'F9uӋt$$;^X |6$$ ȸ.$t.$Q$Ph.$UF1C$11ɋ$ )SVPjSRU$ 1K1 $)jWQjt$vLvH$ 1Ʌ\ S $FVP1$^TjhM'S4 l$k,S(C K$)̓$$|BShm$hD$PRUt$s$s D$ Ph.$$C K$jSjUt$QP$ l$EhVPE$9.1C]2UWh3.$S$$1Kt$t$hW.$Pftt$t$h{.$UGP9lSWVPt$|$\$$Զ0PS  ^_[PD$tu-Ph"[D$ L$ $QP] j \XUSWV\$,|$(hjdkƋl$8L$4D$0D$^_[]Vt$jVutOjV` tAjVKjV:tt@ h1$ h41$hY1$V 1^USWVPD$H qTqPl$ 1Ҹt, $] 1H1,;13$>'G9uЋl$ $|$AXAA t#1J1113$>'F9uҋ|$Q1u:t$WtUWu1$s1$PW1N^_[]ËD$uP h1$P1ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vh#h3D$4C9uP荛h I$S=1$D$ t$r# 1$$r#$L$Ru0QSh1$h3~D$<r31F4$t0t$h$r#Sh1$h3KD$@ F9u1H^_[]ËD$j$,(诙USWV|$(jWujWth1$W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h&2$s,$ʃЃ,$9Չ|ˉ$|$(WDxt hA2$'HP ,$9|ډȃ u h_2$$jjjW>$\$SWjPjt$ t$jjWs X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWGl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP#GE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W  t $p q z H @AQ@A$Q @QHALhy2$S\h2$h2$USWVP\$|$tus$" $&"$jhUtQ1@PVSjPt$8t$8W E1u>4$h5$W V[Sh4$W4$h4$W 1H^_[]UWV} uOʃl =|RQPh2$VUJPRKx& $T$W1ٹ|$5l =h2$ 5l =h"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhM'Vw! 1OujV5l =AuW?,VQ>~Ih 3$Qp1$VQ7 t1Ph3$Q= 1O^_SWVP|$1N?u;j S5l =6 8u1u5l =h"t$ ^_[WV|$1N?t5l =eH1t^_h4$t$USWV 1N1;B} e^_[]É׉ $D$ j P5l = у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5l =bIxL$T$$$jST$ RL$Q, tXS?$$ىډWT$$jD$ PST$R薀 t)t$h5$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSmljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$P/D$Ps,jhM't$$ tjVt$$ jQV$Ѓ $V I iTh j$U$  V tZs0wh73$V1t^_[]1;BB ,FjhM'P 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W*tB jUp Ӄ  W' tD$p0hG3$W 1^_[]ËD$L$stitau1t$QT$ t$ QP1PhQ3$Q^ 1HUSWVt$|$ t)l$\$$jWUS耽 tWUSh3$1hz3$Ve*l$(\$$jWUSM tWUSh3$V91H^_[]Ã|jWUS;11USWV\$1s3h'%5l = t^1WB'MtuWh3$t$ 1NB'B' Ch'%j= Džu^_[]WV|$ B'B'Wh4$軷u^_USWV t$@\$$t}WhjPG @uvÁЅ3t Wn$j t$d\$P|$Xuv$to9-3ugPhVSrh4$SQt$hG8$t$X: 4$`NЅ3tWڈt$h,$S hB'j#4$!N1H<^_[]ËD$8j$Pt$ fUSWVD$,tA|$0D$,D$^V nL$ȉ9ljt$4|4|$0u1D$,uh]8$P^_[]É$|$\$8t$0t$<|$49}91D$,ut$t$V>1(Rh=$VWh=$Wh=$V2 1H^_[]USWV Ӊt$$t$$RQ1Ot, D$&"$"! D$"$&"8$s p ՉT$R Eh @EMKM$E OEHMLEu UED$0Vt+t$t$hD>$V 1%Sh=$V 4$h'>$V 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0#h>$SU7 tPVW_ u9-3ujh0VWhHJ'jR4^_[]ËD$ M'H M'H M'H M'fUSWVX1L$ AL$A\$HCL$ u} D$h>$VWy bt(t?qt0PSD$PD$,PuulD$PuD$9=3uHD$|$|YutJL$T$xupt 81ϋX1 t$@uh\J'j-Ɖe^_[]Ét$ t$Lt$Lt$t$0t$0}W~!1NtƉT$4D$\$ D$ D$D$$$WktCD$@PWzjhM'D$LPH tXj$t$t$ DkD$0T$,WL$T$4t9_t0uh>$uvShZ4$Wb \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh!?$P%1D$Bh!?$ D$_$ӃD$DL$H(X,EP2t$@E X,L$H(u-4$t$w7t$HhB?$u1fUSWVPM(,|$8O] D$1hm?$uS+ sujsWVVuutqD$931t$ h/$ V* hC$荴WD$A$D$tD$A$1ot$w7] Vօw w V03H 03;@3h(3j H(3H (3 \$03H 03;@3h(3j (3H (3 GtPhC$0 h #!03H 03;@3h(3j 訊(3H (3 03H 03;@3h(3j l(3H (3 Ow7w  03H 03~(3H (3 h(3j hF D$Sh_C$;$1۹vC$v6SJ $|$6$v vS, \$'Whm$PS$Wh&r#PVVS\uhh{N&S VSh|C$蝃 GPh&r#hVVh%B$xG8$jmVj$P莬VhxB$RhB$EG0O4 t#$QPhRrP\$ RhC$yUSWVӋ$$$$J'hB$" Ft hB$赂hC$訂F ~1ɋӉ13$ 6@uh C$hB$hB$Yl8|$Vh&r#hWaWuQh;C$$Ę> t hB$ hA-$ 1A AAt$Qh&r#hVVhB$hB$hB$蟁Ĕh-C$芁|$uhusuqVh7C$ohU-$buuulh#C$#C$t$r#PRhq%Ĝ;8jmWj$V6Vh&r#hWWhB$Đ^_[]USWV΋\$$|$ ʉl$͍L$jj h$r#UPjQ舳 yD$SWVhC$|$tUh$jj  ^_[]USWVDt$`l$\\$XT$1 M'A M'AM'AM'B0,D$` h9D$VU k)Hw]r$uStJPShu7HsutPD$PS uhK'jD^_[]1Hu߅tjhM'D$P t9-3uPhHD$PSJ벃luh5]&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhwD$SW a~bt)iuRt7D$PV"uUt$D$PVAtD$PVcuhK'je^_[]Ãluh5]&1u΋D$ |$|HV t;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H 6H 6@6 6h616F6F6F6F^Vt$|$uD$ h606FD6F@6F<6F8^fUSWV$$$#h1"WV` ou-l =953m 1O$QhIH$D$P $ƋFHt$ $M'm ^ hSh&PD$ xþ1${Cm WhXD$P- Ph="V CPh|H$V CPhH$V uCPhH$V ZCPhH]&Vg ?CPhH$VL $CPhH$V1  CPhH$V CPhH$V C PhH$V C PhH$V CPhH$V <$u脗 $lVt$" WGU $ɿt$ D$tQhUH$P D$PhA-$t$ rp~ Qk wh I$P fG8Ph&r#h\$SjShI$V 4GPZPh*$V- Vh_H$肖 $j D$$$Fo~ 1Cj OƉShXD$Vo )Wh&r#hD$PD$PhH]&V  Wh&r#hD$PeD$PhI$V wwhPr%V  wwh9$V w$w h@ #V l(jm$Pj$W$t$PhI$VB ,Vt$m C$$L$ AA H94$hUI$t$ M t$hgH$t$0 t$ v8t$(w t$B h#UIh"UsPVj(3tkSG`h N'jVק hH$$1ORt$貧 1O4$褧 6h(3VV 1*Uh,$$i V t$` ^_[]ÅtVF h3H$hI$h hoH$hKI$hh$I$hI$hhH$fPfUSWV]} #D$D$ hpI$SW iu5l =tFumD$ D$9=3uUj]$,(ZEǃD$T$ЃD$,jSt%D$t6htI$h N'jYjSi D$ tjSQtD$t h<$w@h#VGI$tQw "hIH$Pj )j$PN h_H$Vj h I$D$ Pj jhP.O D$0Ph*$t$ D$0$L$ 11t$ L$ D$PhI$t$ bD$\Pt$ tpt$hI$S 1O1P V貤 0hI$hI$SڙV茤 hI$S辙t$m ֋D$+D$ L$,D$D$@L$$L$L$^L$(D$, t )|1h8L$^Wh %^$;|$tv vSj ]6D$1P胛@ ^_[]hK$hK$ h^$hT)&j USWV $ShLO'U ǾlP'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT$3qL1ATAPAXkiA\GL$A`i AdWL$Ah!i AlgL$Ap"jQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph#Vc |$V V (C 1Љً(L$I$1 sD$PD$D$ t2t$ ^ {uWv5u{u C $< VUD$PO T$ʅҍ$t(» t)1M։9$uSh"hXG\$t@GS1RRhVQPthh$r#Vz VhK$Xl$ yT_31w) 4PjQn; VSD$P D$PhM$W$\$Gt@GS1RRhVQP_thh$r#V VhM$zWjwhM$h\$ SShL$PW\$tw wjLj PV?D$1P5^_[]hM$hK$h^$jR USWVD$X$\$l$@EM}M UMUMT$ U M$U(M,T$0U0M4}8E<@E@MD1҉UHULUPUTEXi@E\ N$E`iEdN$Eh!iEl%N$UpQRP9 1USVP^_[]ËL$1B L$SWV։ωhjSi9 jwS G PKSHK@ CjDt%Sh'iP3 t#t$Đ^_[h1N$h+M$h?N$j fUSWV l$4UttQ"DGU@Ë|$\$uohN$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSPu  0t,hN$ MHtU4uL9rRQPG  t$|$t%u@uhV tI981tSul|$tDEM9rQWP  u@u`V u@yu@u`V teEptUt$8ЃtEu8uXV t, ^_[]hON$h+M$AhON$hK$5hON$hhN$)u\u\hN$udShwN$j wlhm$j fUSWVt$SK 1tvt$L t[S tCPV Vt$O tPUW#P uW薈 S 1S WK ^_[]USWVu]PhoN$S t$f1j?1Nt}ǍD$ Ph$S td\$ t\hjD$P4 jS\$Sa ShiW t$E L$Uf jQhoN$PN je^_[]PPh$t$ u1$YVPt$ t$t$V tPh$VP u1$^USWVt$t$lL t Nj\$ PYg 9v6? 61N*Ƌl$WYg VPU  )SjU2 ^_[]USWVt$t$K t?Nj\$ Pf 9s9Ƌl$Wf VPU  )SjU2 H6 ;6?1N^_[]UPh'&u t$61H]USWV@uPhN$V ] h5O$VK tPAf |$ P\$$ShiV\@ |$ jSd Ph5O$u M Vy ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP.d t!Ph5O$SL V 1He^_[]hs%h2O$hhN$R.WV|$$h5O$WJ t;Pe u1V1e jPV VhiWQ? t^_h?O$h/O$jVhN$-haO$jt V6h$3V V Ď6hwzV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhO$hV>tVhO$bLV#FߋD$t$j7QPhO$hV`>tVhO$LVt#F߁^UVuPhV$V t3$L$ AQhiV= u hV$'1e^]hs%hV$hhaQ$S,UVuPh W$V t3$L$ AQhiVe= u h$W$1e^]hs%hW$hhaQ$+UWV}W#ƉPh$W tZt4$P<tW@PVa tGPhV$u I t>V+1e^_]hs%h/W$hhaQ$A+hV$h/W$h>W$ h/W$hXW$j hV$t$F tPhV$t$I HhbD&hV$hhaQ$*WVPt$|$D$PVW tKD$tUh^N$WF tPh^N$VH H^_hbD&hV$hhaQ$n*hV$hhN$j h}N$j SWV$hR$SF t]P a GAsdWZt^WPhR$StNpxPhiS3; u?V1M01HĐ^_[hW$hW$hW$j h S$j4 USWV 1CCj7Shxi P9 uh&V$?,$Puh?V$#Ɖl$D$Shxi W u heV$j $L$9~D$~*1t j PGShm$"HG;|$|j .GVj+?USWVH8['D$@4['D$<0['D$85T6u#D$1D$11D$=X6D$(Pj%u hU$|$T$(L$,T$։L$ ȉƒ\$06eĉL$T$|$|$ɚ; t$D$\$=X6u11D$\$W|$|$ |$|$|$ |$ ʚ;||$t$ L$ӋD$D$t$\$\$Ë|$t$ D$$P~u h^$j t$ D$D$t$$1|$\$F =)3@O9t uGtMF L$u@T$(\$,T$ 3T$3L$ u L$9L$0 L$9L$ \$ \$} VЃuGt^VЃtTjD$ u WhS$j PY8D$L$AËD$L$AËD$L$AËD$L$AËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$ )3)31ËD$H@)3 )31SV\$ Sh)3uCЃ r"CrCr s'01H^[h)3H?r Q' ؈)31ыL$t 61ÍAЃ r)Aw AwÉ&1HUSWV1t$ D$hVP# )3x6t8u^ 6ǁ6666 6$6(6,6064686<6@6@wh)3R&uhU$0h)39&uhU$ht)3 &u hU$j $5)3tvh$3%61J6K6L6(3tt)3$h)3$Um ƃV B~>CNL6F v/FwD$Q'Q6Au"hP$H$Q'M6xu>Wu4D$P1VhVVj V5l = X69t$:*ƀ 6l `C Lvms)3(3u$&3O6P6rN6S6D$P1VhVVj V5l = T69t$taYJ6>K6OR6CatTl5$&3+wtz(39t)3 &3$ÿ%3؉$(33 P6$u =S6uB="6=K6=J6u|t =S6u =6uftu^S6uS$ttH)ŋ$L$ T$ RQL$QWPU%ud3 u&hq"h Q$,5l =hK%j芻 t$PD$P & u h$Q$D$t,DtVPyDžuhq"h1Q$JW WtS)uhq"h+M$Wuhq"hK$)3t H9t@hq"hMQ$$@ t%VWЃ$Wj1hQ$hq"h*haQ$USWV 2 uhW$h Q$j{ Ƹ)3jmP$r#$r#tX$jL)3PtX$USWhW$h3k<)3t VSm#X$u$r#WWWWWQWhX$h3%<$Vp j0V )31tT$q9t Iu^WVΉhjW D$PhW$V tZh-%V5 tQPP L$PyRPQ WhiV* u h W$2Ĕ^_hbD&hV$hhaQ$]WV hT$Q+5 t;PP  u1W>P j PW Whui V^* t ^_hU$hU$hihaQ$hV$j~ hR$f1ÃD$ 1ɉJJJ JJ BRhiP) t1hR$j% $1ɉJJRhiP) u 1Đh S$j Qh)3USWV΅t R1 2/ +/ 0($D$P~n!\$D$1t$$tsVsD$tVPVh$Wx trC=M6D$uCt\=N6uCuM=R6uCt>=Q6uLhj$V VhiWn( t!$uۋt$$4u=P6t ~ j A5h(3sѥWt& )3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh]S$h$VVUhS$Z5 jl$U$V# Vhit$ t$,$t!PhS$5VhS$p,$jt$Vκ Vh~it$l t$tPhT$4j 3ꍄ$P$$ j:QPhT$h$P葾$t'$UhT$B4U E}uj:$$hT$h$P6$t'$UhT$3U> E}u-)34$tVWUmuj|$W$V耹 $$ DŽ$@Vhit$V u$ hT$\31@Pl$U%jWl$0U 1@D$81D$l^_[]hFS$h&S$j2 h^$Fh#h+M$:h#hOS$.h#hT$"hT$hT$=J6Z$t%U$Pj USWV Ӊ΋|$4hT$Q4+ tPWF 1EUhvi Vv j UD PhT$S$- Ve H ^_[]VD$tL$r#t$jj QPRjV` V 4#uz$r#PVh~U$--у $r#t4#Qh=#PRh#hrU$- ^WVΉhjW  WhiV tD$Ĕ^_ÐSWV$h%V) u6h[$V) u$hAZ$V) uh[$V) tD`6 \6=d6!lj=`6hjSR {Sh7iV t Đ^_[hLZ$j Vt$VPhm$,tVhtPhYZ$f,t$V詥t%L$ PQhy%B, V艥'%uߋD$=rPhbZ$,^USWV$WW1ɃtQÉ1 jVU菱 Uh8i(S0 D$ sjP?QƉD$$Uh8i(S :t$NPhZ$@+hu%t$D$;D$t(h$+hu%t$ ej)*j *\$#|$h\$*1A\'9xu H uh{N&*t$(hjV  Vhi$ St$<\$8h\$O*Z$I['Qt8u 9A uVh \$* VhZ$41#X4h$r#hy%) j (jmtz D$ ~[11ۋ!9uIuU褡PhZ$)hZ$)hZ$4j (D$ 1AC9|M rVļ^_[]PWhK$$hoZ$h+M$h"hZ$ hoZ$h|Z$je Vjmuh6hVV2^hZ$j, h3jjHh$\$YUVuU OPhj[$V t!#`6 $ `61e^]hs%hg[$hh[$ USWV(ӉQtoht[$U$ t`6H1 Rh8i(U u 68uIjht[$S t)D$`6t(^_[]hK$Vh[$j h[$h~[$hZ$j SWVt$T$;h%V$ t\Ƌ`6P:? V> PWűt+Ɖ߁PWt2 É`611H^_[h{%h[$hh[$h[$WV֋|$ QVWPh[$j WVPt$T$th[$VX# tkPy> V>> PWt>ƉPV5`6蜡 ǣ\6V1u `6$h#Z1H^_h{%h[$hh[$WVPt$T$hAZ$V" tbP= V= PW\tIƉPV5`6 ǣd6VI1u! `6$h# 1H^_USWVt$T$1h[$V" thƋ-`6P0= V< PW軯t6ƉPWst>V ݉-`611H^_[]h{%h[$h2h[$h(/$fSWV|$ t 1H>t$|$\$jE PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V: tE$$PwCt/$F ~G F17  *  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPk Ɖ׃с11E9r 8"t$8t 1H^_[];sC| C 9s} m "WV. t/t$ L$Ps(,tD$$F ^C F1#  USWVuD$ tV} ]CtP7H tEC tP72 u/D$ Ph'&7 u$D$1$ 1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vt|$,$h'%W%D$x&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$kID$4D$4D$ PD$8Pt$ t$ WÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxrx1X \$TfD$t7|$0j WP[ t9t1ۉD$=r+"11HD$$PV|$1OL$L$D$L$T$PQRhm\$V6 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSPo sD$ t P4$W4 W(<4$uM S]s {te|$t^t$Vt$t_@PW4 W踺tNVsE0 ߉VunU ۉt3EF ^C F1Vt$h\$hu\$h\$h>W$ h\$hXW$j! WVt$tVr1H^_V t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'c<$t@1@>M.1-t PUS 1GG GG1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUs6t>Vs&t)u4 '1H^_[]Ís s(CtP7_ uCtP7I t1@뿋C$1$l]'4v6 !6 P?;  v6 tMtk $t$ 4$UQ$t^hc$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhb$j虄 t1Hx^_[]hc$hc$j? WV0t$<|$jWh-_$V萴t8Wf t7HfJBRhiV t!10^_hc$hb$Whc$j˃ hE_$j SWV6h+3VS6h+3W@VgW^6hTV36hWĔ6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!hd$9$HQPۍ\$4|$fGWhiU t$d$f|$*u'd$=K6t PfD$(WhiU t$0d$f|$*u:d$=K6t P|$fG WhiU t2D$*=) PhEd$_=K6t hMd$GfD$(IWhiU> t2D$*=) PhSd$=K6t h\d$1Shi8U |$Dhcd$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQhc$ uVhkd$,11t j,:DLxPtT hc$v<u h"$j $PhiU tDhod$$t$h{d$ hRV#yj PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR Phd$$=tPhd$j $=tPhd$^_[]Phc$j~ h3jhhd$/ÃD$1ɉJJ JJ fBRhiPm t1hE_$j~ 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hb$jS~ USWV,$@$PhiV tr$A jjj". xgljj2 xi$-hSWK xB$/uE$0uf$Ciu.he_$y1H h_$yh_$yWL 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h$`$h%h `$h`$ha$hO_$hU`$QL$4Qh_$O(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q ̔6t ̔6E͔6tIAtcAtCAtPA tSA@tBAyAAT$h̔6UWt$PVt$D$VPRRh)`$,l$ }"E!Ê<)\<$^'=K6`Cs|$[VPWl$PhT`$h`$p#<*<0<2=K6<$Z`$<ta`$sQhm$#D#1L;$r#ya$QRPhC<#G'%9u<]K%C=Ph`$hm$=K6S<$CPh`$KPh`$pK s k t?L$D$F`$PWhy%6 N%܋L$D$(Mu} L$D$D$F`$PtPtPua$`$ a$"QPhy% N%D$ŋL$D$(ȉ</=K6%<C<$_'a$=K6CPhi`$=K6CKSRQPhv`$h`$C~@sFNuQPh`$ IRQPh`$Muj>l$ L=K6?CPh`$u(sh`$hm$Z=K6<$CPh`$8KPh`$"Ck tAt$D$x`$\PVhy% O%܋D$t$)E}twt$D$p`$ttua$`$ a$"QPhy%r N%D$<t$)ƃl$ rPh`$4j>J<$€a$$^'a$rQ=PuJC<u;h`$hm$=K6yCKQPha$ ]=K6Pȹ`$6<"< b$a$ a$a$a$a$a$a$a$a$a$a$a$h`$hm$=K6<$CPh@a$1D3 $r#txa$T3 ׃l3 URWPQb'hNa$uj>l$ <b$b$CPCHÃ)gj JEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]hy_$h_$js WVD$(1www ww7fWfGfGwWhiQ6 uh_$o1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ ;l$D$tD...P^_[]Wh$Q 1<$tɍGrD$X1.Ph#Sdt E;,$sGwUSWV։ϋ\$Qhm$5W)Ǎ 9~)j<-t+~'K1.Ph#9t OE܄u j-j>^_[]ø wxc'ø"øSwc'ø"VPt$ D$Phb$Vˎ tD$P^hs%hb$hh%b$VPt$ D$Ph1d$V~ tD$P^hs%hb$hh%b$WVt$(|$WhiV tgD$Phb$V t7D$D$WhiV 1uhb$l1H^_hs%hb$hh%b$hb$jp fUSWV8d y hWe$lh{%yU y hoe$ljhe$詆 t\ rL$jQP D$tPhg$0ljhe$Q  D-31 VPh  VPUSWQRPh`$1EVRQUh BVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj0< |$www wwVWj VWj V= S= W= D$ @ )T$VVQRWP1I9u q8tމ56 D-3tщ1@8^_[]hg$ojj jjL hhg$_ u8mg$jVk twg$jh$hg$Vhq"h%S j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjP ut$Vhf$< 1t$HFFF FF1G>\$SVjA l$ UVW2 nƅZD-31OjUj t:9uB$=hf$jVc;  8uh D-39tttn1VSj VD$$Pj D-3vh(f$@jjj 1VSjO VU6hWf$1=D-3u$=|$ u'1VSj VWj  `^_[]Ét҃t̓ u1Ht$8F FFV8 Phf$u1e$WV te$D$8x xx8WPV8 q"{jhe$h#葦 %SWi Whf$j +VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á6H 6t$Vt$VPhe$ij^*V5D-3VPD$$Ht5t$ I?rZ$ !P$Ѕuσ^PD$L$ $QPj覠 wXWV1N=6tED$@ L$1҉RRQWjP\t4$ hf$^_VQ): jhc'8 jV7 tP`t^Vh,g$>jVh>g$)jPD$L$ $QPjğ 蕟XPD$L$ $QPj襟 vj(XÐUSWV$$D$D$D$,t1H$11D$hg$WSp f~/P w`1A$c'5l = D$u[FtR=5l =D$,D$낃gl =8#u(@j L$ QP1e $D$8Ll =P~l@$)l =8#u)@j L$ QPd D$D$8l =L$QP˽ j D$ P5l =d D$D$8c1Fj D$ P5l =ed $D$85l =hg$83<=6u-6~q561ۋtVPǿuJVhm$FtPhi$FtPhi$ij -6C 9|?,u)É\$(k <D$jx D$Px Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u o8tz`Xt$76u 6-6CPVt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jv |$tt$ VUWx  UW&5 68C|$$8D$@PWFtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUWx #|$$tS9u$UW|4 RWS6 $D$utSPW6 uWhjh$_1ļ^_[]Ë 3DQuf u h k$W{@$N|dže^_[]hn"jWB t$h1$跧Phn$h3w jWVPt$jWV ? 9u9t x^_Vt$h"jA Vt$VCFt@^h#V^Vt$V?Kt@^h(%V|^WVPt$jWV> 9t9u x^_Vh"j= $T$D$0PW D$0t 8D$ D$(JD$0PW D$0t 8D$ vD$$c5p&$T$$MA QD$5l =D$o5l =D$1@D$Q5l =tD$ 1@D$353)h4u= }WtD$0PWy|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5l =hr$hn" 5l =hr$j / Whs$PWhss$Wh!t$ PWhs$j. Whr$?PhTt$h3 j腥SWV$t$$$$\$VPWS$H$HTj S7Vhq"B D$@t$hr$t$t$hs$׭ t$ t$ hs$­ t$j8t0h9s$裭jt$h)s$莭 t$2t0hWs$ojt$ hGs$Z t$ hes$I1$^_[Vhr$j- WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRhs$ uUD$ L$$L$D$l$К&\$ D$L$ |$D$ fD$l$|$l$D$T$]hs$j, WVPt$jWV) 9u9t x^_Vt$h"ji, Vt$V0t@^h#V^Vt$V5t@^h(%V|^WVPt$jWV)) 9t9u x^_Vh"j+ WVt$|$ VW t$?/tWhc"LVh|">^_WhN"j+ fWV1t$|$ ɉ @4u"ȉXȉX\ȉ\ȉU"5"" PQ40!40<8!<8D@!D@LH!LHTPa!TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40 40<8 <8D@ D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7 Vw wV FwwVFwwVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(qS,C(E@ȉC@u4u0US4C0EHȉCHu#Wtyh$#W^y<$t=l =W*@,l =1{$PPhPPV6Yjj5l =% D$,9l =1f{$PPhPj 6 =<6=l =jh$6h$.3WPn l =1{$PPhPjT6l =1{$PPhPho6rl =(6a1@D$(Sl =1)2%PPhPj%6(l =1|$PPjcPPh/3=l =h(%Wwh#Ww 46H6=8686=<6=l =yW"@l =1|$PPhPj?X6Bl =1{u$PPhPjp/31Gh3Wj>hu$-Q=D6<$=l =h2%WvuL6G=l =1#PPjPPd/31@D$$l =1"PPjPPj86ml =1z$PPhPh<P6P9l =1u$PPhPj\6 =l ==,6j:W OAj/W O.?y06l =빑w$l$0UU݋\$UW|$Pv d6`6s3DH,W5D$h*$WthY&Wt6W 46N1 |$PPhPj l/3,@6 3DHWD$<$6hv$3=d/3_=46tVhbv$z5l =hu$j5l =hUu$Zh6v$Phn"j* Whu$9Wh}$.D$ =86u1=<6@86$1󫍄$B$6Al$$+D$ -<6t1$ 1D$$$MljL$$ PWU[?t$hv$P6l$Ul$RQPm $׉ȉ `6=d61| h}w$$t/$$T$9‰sQt$t$WPhw$tFtA P6WPUk u5d65`6t$hw$|$(F=$PU耛 uRt$hx$  A#$=`hh6hv$1=H6 $VhNu Vhx$al$VjD$Py `6-P6-d6݃=86~VUWt$h.x$ߕ|>9|Pt$t$ )̓ }4$2\$l$ 66ɋ|$  6=06 d65`6σ|,@σ|1ҿ9  P69|щ 6|$ D=H6Ejjhh6d .hh6hw$6=06t606t&hQhx$ 066t=|hPhx$ = 6u1=61@ 6=X6u 6X6=h/3,=6t#jh=y$hy$h y$荞6=T6u=d/36T6t$t$ t$4Ut$$Vt$t 9t V t U =<69$PtEJtƃht$Fj GPhZy$jd$ P蝑& jn jd jZ h %M) l6$P6`6ApQt$6@jxQP$Pht$ ' gy0襉VhZy$jd$ P$\ $|$8jU$PӖ $PS:ku/jZ$P$dP\j u$<mfsjWV˾ 9uD$8%PHP$Phay$hwx$|$D$D$4jP $u/hh6h'w$$PhSk$jX h_#j  /dev3h6 l6/ D$ m6tD$ h6<$~~l$4 $jWh#"Oi u ƃrl$Wl$$UiMGWUi:l$ ʼn\$4Ë$H$|$(6\$L$ u D(6$dT$dž,<tx(=06dž dž,dž(Ɔ l/3p/3u(jhW~$=D6-5t6u"jh~~$蔊=D6,5t6 6N06F4Qt$Qh~$[=D6w,5t6F4Ht$Ph~$0=D6S,5t6F4 P69}"QPh$ =D6+,5t6F0=)hPh4$щ =D6+5t6F0=|)hPh_$衉 =D6+5t6F0N49}QPh$u =D6+6t6;6|QUUUU)ʹ3333!!сis{09\~\{0\\5 6sXș9}%CX=86~Qh$t6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h$և=D6**t6{4$=P611F9tA uPh1$j $Kd=d65`6 u։<8=d/3[ WVh$, =D6)t6<$C4$8=P6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQP\Njs8ƒPVRWf)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVhR$=D6'\6tm t6yxH1҉$q1ҋ8$$)$<$$1C$I8$ X6=t6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$WY1C1 t׉Ë$$QPV$$V9s($$$VYÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ\$9wȃr$9‹$֋$r‰$$$$$B1WRQPVË$Ë$ʃQPRS )ÍC4$$W$$P$Q{@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQbUj$P$$j@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh}$B~ =D6 t6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d/3$_|HL!ʉG41SSjhjPS%6N t6I4QSP_ t6H 6 6 6P44Q56щ 6`@#HL 9| Hh h/3H< 6HX T6H\ 6PTXH fǀ$ؠ%=t6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d/35O _(HLJ$46$$$t!LJ^F=86$$߬$$ڌ$t&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$$x t6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$ր$~x=t6O0 9| IУ66=<6u\Tu))У61VVjhjPV6u696656jPe[ =H6Gd6 `61ظ|(RQh$w =D6d6 `6565P6~ ș)dہ|4t'GuȹC=06tL1$PP$$5,6V1=P6VhZN P61u;1$VhjVu  =65t6h`VW1 =@6tWV5t6x\6hhPY 1@$=86hj$肤=86|o5t6N,I\Tt~!NȃN׊Nd1 t1WPhC$RRAt$639u1H$Whht@P? PPftu!ѡ86t $ Q$=H6u$|&t6H,$$DŽ$%$ t6I,$1$ DŽ$1h(3-t6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ h$=D6Y t6j5x6V 5x6FU $F +$^t6$~J`^p=d/3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=06uFh$ NlK`ڍOȃ$ډFd;v&h$+=D6t65x6F $11ہ~U uv`щSAt6$~!ـ1@ x6Il t65x6F=d/3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5x6N uҋt6B8H!tk)D4t6B8)Nj5x6$9sE)ȉـ1B~U uv`5x6F$CHu͋t6B8$؋N9ȉ$J`~U uv`щSt6$~!ـ1@ x6Il t65x6F=d/3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45x6;Vs2р1@~U uv`5x6F$Bɋt6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$6H 6V$P V PV~x; 6up=@6t6s4PP t66@6Kd156s466 t6q4jPtO t65x6{0 9 6PVQ^& =@6t65t6P5x6g t6y06$ryxtG$\%TuCl$AP$ t6Ou$ց\TtQ!QЃyId t156563 5t6\TG~8^xN`1?9'6+$~0lj$Ɖ$)ى$=6$я%Gl669wߋ$9w$t6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=86} $H$$$~A=H62$=|j.)h扄$$r#tu% t6ׁ\TtQ!QЃYId t1RP$Vh($yh$$;$$|W=869t6H,t =H6 $$ DŽ$j +gDŽ$Ct6;X,/$~ j f=H6 $hjP9K d/3 <6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A`]$h$ld/3fDŽ$13tt/3$_ lj$DŽ$t6H4$ $ H5t6D@VL!! $`Nd8\fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t/3@ lj$DŽ$ t6H4$ $l$h  5t6D@~L!! $߉$Nd t1$Sv4$j2t6@0p9w Au1H$$DŽ$1$$tZTǡ46t6@05@6V$SQP$h$l @6ɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=@6CX$tFDŽ$PQX18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$PF t6\T$$i$$ $$$$DŽ$H0$$_$ t6@$D$@L!! $`kX$h$l$  t6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h t6@$D$ @L!! $$KW$$$h$lt6Hd t1$S6j$$V t6$ȔȐG$11F$t =<6$$=t640=d/30w4w+_16$`SWP $PjS]C =@6t$W\=L6t6ǀ\8 t6=6x\hhPB P6QP5WV=@6t6 t6q4PP׸ 5t6HLNd t156v4t56956vG=@6tt6p4VVx 566@6=t6Od1Vw45656t6@4P56e^_[]ÿWjVA 1=P6VW\hB#8^BhO$薌j&LUj%EUj(>Ul6j -Uj&Uj'UjUh1$LhI$BjTjTjTjTjTjTjTjTjTjTj TUSWV=H6ua΋\$=<6tP6l6St$P 4׋ P6UPSt$$56萰 9u^_[]OD0tPWVh $\j$TUSWV"=H6΅ 6ut6H4H 6 6 =P6;`6d6t6;}FWh t'1I!;HtG#P;Pt;H uV9R_1ڍ_56P=P6Wh De^_[]USWV΋L$l$=<6t=H6teUjQ?p׋ P6SPUt$$5|6 9t?B0PWVh$E[j"kRP6l6UPQe ^_[]SI`wD$$t'1C:Qha$h3] .  [SWV1ۃ=06։ SjQ> =d/3@fF F)f ^_[USWV Ӊϋ5t6F Nd t15x6G=@6tx65t6PP跳 x6yU +y/\$|$y1U =t61=U L$D$uq`|$ G`Ӊ $u щw*l$$t'р4l$skPh$h3[ =t6x6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}AhS$ h$h-$11҉ ^_[]ÉՁ|$U u L$I` L$w$t'ʉـ1@BPh$h3Z 8ʍ 6ʍ   1$5t6$~3%)1@ x6Il 5t6x6K=6Od$sC=d/3CNdЋT$ t1҉t$VQPRl-{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRH[L$|$ щT$ՉD$ȋL$D$VW|$RPZыt$ʋL$Vt$QRPf,$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45t6;F8|$}X1Bσ) x6yU uI`1@5t6;F8|$|=@6tx6VPP 5t6F Nd t15x6USWV$΋=t6G Od t15x6=@6tx65t6PP胮 x6xU t)hS$=D6(x6xU ‹l$(H $t@\$=@6tx65t6PP =t6G Od t15x6wt66HC, $9r%UQh$S =D6Vt6 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$56Wt6\Tud6jpxt$0t$ $<=@6WV1L(ɉL(@ u1LXɉLX@ul$6jpxt$0t$ x$,;=@6trUV胪1tttplTtDpC u1FCu) Aw% $D l$hVU7  w% $D9Pl$t6T$56p0^_[]jHj HWV։σ=d/3ȃ@PQR  =@6t'ȉGffF=d/3u GffF^_fUSWV$8tW ƅuWhu"j $$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h)=%t$L 1 Sh"U CPh8"U C Ph"U CPh"U CPh"Uq CK,C,Qh/"UY C0PhD"UG $@D$t Pφ 1-Uhzd@$<W t1 VhedAW hjU2 D$ P$4WD$, 9L$L$9u0$S11:58tx$0h" b$11҉ $ƅ*ŰPDj PU ^_[]$0h"ju USWV81ۍD$4ShPSu1NtAljSPSWuWJ uMU D$t$$$Q1e^_[]fWVt$|$ VW) t$?/tWhc"0XVh|""X^_WhN"j fUSWV|$$\$(SWt$(t$(})jj`SW}~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPCE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV0 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj$u Vhx$ 6̛6%ț6ʼn߃=6~VWUt$h.x$B|>9|Pt$t$ )σ}4$- 6-6uU-6uY5̛6=ț66@19lj| 19ǃ| 6u 6͋5̛6=ț66ˉjURPC=ě6l$ 6uA@19lj$ $t$u hЛ6haw$jPVWv|$wext23$2fs3$ WhG"hЛ6hu'VhЛ6h6w$} 19ǃ} hwx$ ě6t$VUt$  U膐 t 9t Vt j8USWVӉ $(|$j W\$ SG Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ <'8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"j蛿 WV4%3Ph؃$VA 1GVWjh"Vhu'WX6USWVu} D$8jPg=П65ԟ656%UUUU)3333!!щ%i6B6993333T$u tv|$΍Q665ܥ6 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=̛6ț6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1ě6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣě65ܟ6؟633t$ƺQ=6D$6D$ 66D$661 656D$86 66S666N5 6$64686[<6~1f(6 f*6,6 33f06\$H$SWԇ 93rWh@6 56|$t"VgYjVhP6> 1`6أ666$6D$46 ܟ6+ 6 1҃r1I156~σRVPWڽ5ܥ6H19w+56|$OL$)9r΅u 46f565656V6YVjP GD$AD$ 11L$\$66tn<6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@46t 6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ $6|$11t$66=6~i 6 i{56Q5̛65ț6PRuh˅$R8 6 656PQWh$+86@ܥ6 61QQjhjPQ6I 5 6jPb =6uk̛6 ț61! V56 1N1Ƀ *ز&Fu  1@D$$=6|>hO$e=6|(L$ 6 61PQhC$PP5D$$639u1H|$LWhht@P PPftu!ыt$6tL$QT$=6uL$L$D$ 1D$L$ 11T$h(3v=$6t$tX<6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f526616 56D$ hh؟6Pt 5ܥ66P56Vt$R =6=6 6156ǡ 6)؉1t$ P =ܥ6Wjh6 6H9|$u_ܟ656 6)ʍZ9s1Gр6B9r)6VhPx t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P 6 ܥ6L$)QhP u16@ u6L$ D 61Ҿ6Vt$# 5ܥ6jVG =6tb1=6t 133/Yx6F;56r6L$ D 61h65ܥ6 G;=6r=6t$|\tX=$6te<6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=6|$T$T$|ʉj.1t$몸$r#|$|$tu% 6 6jQt$,Ph($\2T$;D$_=6* 6t=6u&D$ D$D$j -11hB#1~ j 1=6d=$6146$hjV) fF쀁'fFD$8FFF fF5ܥ6 ׉؉t$ ֍$fBt <6$,F܉VDF81 L$ F4D$4z 61CL$ =ܥ6W߼D$(\WʼD$S56tPjt$0 6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ <6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V 61CL$ \$6 6=ܥ6t$,9sD$()QjP t$}L$ D$41ҋt$(VW'VX$Yj=$6t86t 637363@1=ܥ6à r t$hhjV fFAb$fFܥ6ÉFD$8FFF 6fFfFV ܥ6AFmlj\$r*D$p1ۋ ܥ61zC9uߊ 61h65ܥ65ܥ6f583|$D$1ۉt$ 83x1ɉt$)r6RQP Wh836V 836D$ f6 61Vt$ \9\$t5ܥ683D$ CiL$T 1VhVD$pPM 95$6t86t334353fD$TA"fD$V33ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h65ܥ6iL$Tj f261ۃ=6 56<hh؟6Ww 5ܥ66P56VY 56 6156ơ 6)؉1WP5 656e^_[]hT$h,$ $h$PL+h1$PhT$h$Vh$Rh($PRhS$hVh$hVh$RVhԄ$Wh$VPhI$h.$vjVWt$hM$ghy$`h$YhO$Rh$KRQh?$Bz$1Ԇ$'hT$hc$"hT$h$hT$h$ hT$h$jy USWV6=$6tr<6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ46t 6 6Ѓ^_[]SWV=6u0׉΋ 6\$QPSt$ 5ԟ6| 9u^_[WVh)$h $j© USWV=6΁ 7u=61 ܥ6 7611;ț6-̛6ǡ669v@1Sh@x'8!;HtH#P;Pt8(7t.D$jPjh57 u h$+(7t.D$jPjh57 u hՋ$(7t.D$jPjh57_ u h$轔(7t.D$jPjh57( u hՋ$膔 7 t+f88l78ħ88ħ8t'ƀ8'(8ƀ8ħ8((7) ȧ8ԧ7)Ph8Q, D$jPjj57s y h$Kȧ8 ħ8@L$H 7@fP\$1ҀڈP@ D7P T7P ; jhD7j j57 he$31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh`$P Hơ7 79}1Ҋ\<ܧ7B9|1@9u 7h$~"17ܧ7Ph#G9uj s*D$<jPj j57 y h${t'D$jPj j57x y h$P!7t'jhD7j j57H y h@$ 5l7 57Phx7h$jh93hh57 y"93 93=h$jh93hh57 hj15̧85Ч85ԧ85ا8585858ܧ8XD$<8@ppp pVPj Wj<9587~h8j CF;587|/USWV։ϋ\$l$1EE EEfEUR<t tM!7u6jjUE u##VEt)xu:H Mt0t$VSС ^_[]5p =- PVh$Wh$j脓 PhД$h3 je =8u-=48t$h%t$ 89$7~$7j1jhܧ8jc` th $j. USWVXէ7 8ffڧ7838 83 8 ԧ78fا7f֧71ܧ7Ѓuȉf ֧71t$<jVjP57& 4jhx7jjhԧ757_ y 7t hΓ$VD$<jVjj57 h8jB ԧ78fا7 7 r&sK87878ܧ7+ 8ɸMb-8ʉ ܧ77 7yf֧7|$qD11ԧ7C9ut 7‰f֧7ȧ8T$1A xVWhx7h$L h$h3p 81B 88@ 88(88,88088 8 uCء8888 8 88 88 ؉+88D$HT$Ll$H8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88&wh07 88 8888ʚ; 886eĉ811ۋ88D$T$ ؋88D$8D$8D$58L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v 8858=8|$(t$(|$D$ fD$ l$ \$,l$|$,=8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8=8 7t 1A 7y77 79}(ܱ8i-@=B'ܧ7@9uܱ8e^_[]h$h$j4 USWVh8jI `7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$D 8;$7D$D8 8 t]+ 88$$߬$8+8D$\D$\5&&s=8uZ 7tQ8 8 t5+ 88L$xD$|l$x8+8D$XD$X5&wD$DD$D 807 &w١8 8 t>+ (8,8$$߬$8+08D$`D$`5&D$Dw\$87$fDŽ$jḩ8jW D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$P|X SD$lD$lPD$,Pj575757W <h8j6 7D$8<BC97)؉D$D$8 T$hy'\$A98I؉L$A 8Iff9u88888888 8u88888848 7 1D$18 8l1A hȌ$Ąh3A 7<1A t$, PVh$ ΍T$(jt$>PhВ$D$  7t$؉T$΍T$(jt$F$y'hg$΍T$(jt$Jh$:΍T$(jt$bF$y'h($΍T$(jt$$Fft$NfQPh$ ΍T$(jt$؉t$hՑ$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPhV$΍T$(jt$ ؉t$hz$΍T$(jt$؉t$h$΍T$(jt$d؉t$h$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h$)΍T$(jt$-؉t$h$h$Ph:$L$lL$AQ D$iPh$ph9$ hG$hl$SNhİ8h$9t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ $L$dT$C;T8u#PhX8QD$XfL$$ D$LT8PQhX8 T$Ҹ $u1G$T$P:L$r |$ rI03H 03~(3H (3 h(3j (  }T$A{^N2D$ˀ) h$uPt$,L L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh$h$9 |$ sS03H 03~(3H (3 h(3j Y  }KF߉Ήs(T$h$_L$T$؅t%03H 03~(3H (3 1I h(3j h(3ء48;$7*؅tء 7!^L$AQ T$Q=8 8 t+)|$L$p|$tl$p8)ЉD$PD$P5&888893v93 8v 8\$CfK%8f!t8 48T$ .KfKf8D$ ȧ8@1ۺ9T$t$,l L$IfɋT$8RD$4\$T$T$$T$ $L$Jȧ8@)t2(uK 8 7t1 8h$ 8  7 PVhg$ Ph$h$h$h$AfPhޏ$h$h$h/$hH$hb$hx$h$h$h$whɐ$mh$c 8h<$1BD$D$pf93@)f~\ 7tSωL$!ȹT$V!RPt$ h$T$ D$, 7t1RT$D$fxf593 7ruTt$,9 L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B7C9D$= 7 ؉T$57|$7ܧ7)RQP_ GD$9L$~D$8:ܧ7uG9u߅uQt$,g L$IfɋT$8RD$4\$T$T$$T$ $L$E57)ܧ7t$>RQPh$7;7}0u h$Ph\$Cы\$1B\$D$\$D$T$jhь$j| 1Ah4"WV888~b<8@8 03Q03; @3h(3j.88 (3Q(3.H 88by`)<8@8 03Q03; @3h(3j88 (3Q(3H 88|tN=<8t403H 03~(3H (3 h(3j 1<8@8h(3ch3V8H88L88P8p8^_jj1A1=48P3USWV׉E\$1AM 7]E uWVh-$t hK$ShQ$ 7t5@D$ &\$D$$Y$e 7fyuh3je^_[]UVh1AtD$x7$g$ 8D$$$48D$$$8tD$$$ 8t9+ 48} $Ď$!L$LD$L p&D$Ht$H\$$$$  48 7 8L$DD$D=8@|-8& 93 8\$,D$(\$ D$\$D$\$D$$$ 78 8 t5+ 88L$XD$\l$X8+8D$@D$@5&,8 (8 t7+ 88L$PD$Tl$P08+8D$L> QPh$l 7tkD>L> QPh$F|>uGD> 7ufPhL$x"L> ffPQh7$T ^_[WV!7u8jjV& t'86 PWh]$hhİ8"6 Phm$hhİ8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hu$!$t$t$ t$SPhe$a UPh$G t$t$t$ h$.t$ Ph$t$ PhZ$r0G9s'GPh#| KG9r߃$^_[]fUSWV|ƀ8-uFh3#Vu 8h3#V1u 8T$,11CD$D$h$Rt$0Yz Hw؉$z'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 31;L$(uj}1L$ 1ɉT$Љ $PL$Au $AP[}D$t2ڋL$ PWM Wf uމ$DuY|$uj u h$j p jj> u $8j/ uV< j/ j jC> t)qtOQX/ j j> um"$8t1Aj jh3#跥 ukWh$jh8$t$U? _$QJk0WW= h$t$r#VPShy%Wn SWhە$j?AVw&=8u$r#BVPh$h3jfD$tPh@$ hT|'PhT$h3jJUSWVPu } hT|'WVv cR~5StET 8͍Hw4$@z' 8벃L88둃ftTdL 8t8e 8V8G$888) 3x(8= 8tjjhhx&Sg =8uh$h$h%; 1C@8FLCSS H3 VT$W$z' \$@1ɍP$\{'X81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12`8#@8L$L$# 1AD$ PD$@PD$ D$<+48R D$ Pj$<8;3<8;3<8;3 H8L8׋t$#D$ Pj88d$zT$ ED$ L$TL$@JL$C<8";3-L$#d$d$d$L$׋t$h8:8@.8"p8x8 8\$ 8H8L8 t P8t H81SSP L$Y\=8j$)/jD$D$ D$$r#D$$r#08L$9a|$u q48 88ta|$  ‰4 D$=@8T$tD$1@D$ `1ۉD$0PhxSh8~ atgcuL$8 88P8@P88088в8P8 8 Ȳ8tJt$(~A|t108t|$ ObT08 8tPt$ tH@WVh 8Po 8=$8t=8u$08tMD$tH@Vt$ Wn =$8t=8uL$͝$08tDD$(tIAVPWn =$8t=8uL$(۝${08tDD$,tIAVPW`n =$8t=8uL$,$.08tDD$4tIAVPWn =$8t=8uL$4$08 tDD$0tIAVPWm =$8t=8uL$0$8)f=8=$8tP=8uG=08t403H 03~(3H (3 h(3j 81=8IWh85,8/ u+ 87tt)7|$t+u-h$/9|$Ph$![$|$u$ PPhk$+83u=<8t"1ۃ8=<81ۀ?D$#t$ }t$$}t$(|t$,|t$0|t$4|t$8|e^_[]jhT)&j` ShC#h$ h$h0$j,` WV93t#|$ 93WPtFu93F^_USWV,׉1l$u5<8V5,80 D$ VPUh<8WSS|$G"ww Gw\$VVSVjWD$t2P7k1PPSVjWl$=$8t'hM$f =<8tt$ hV$1|$94D$=$8tCхL$% D$@<8t Ky9=8Cx$CD$CPS5,8g+ uz87t 9D$=8u{=$8t i5 8jt$ P$P$tH@$5 8P|P$PhIi% 9VzEt7tuh$[$u$ PPhk$1G,^_[]Ph$h$ h"h4$jt] USWV0=$8AuF8,r!4`|'h"Ph$aPh$Ph$F<5${'vvvh$uF|$(QPh}'RWs(3PWLhI$7F(|'QPSPWs(3PWKhR$F QPSPWRs(3PWKV xdvvh $ V!Q~'t|'~ $~'tF\$(RPQhSrh(3S*KV e^_[]FPh)$FFfh$F h$r#Ph$ F|$(QPh}'hW^rh(3WJVƘFPh)$FHfw6${'h;$chH$PhD$PhD$o6h8$'hE$ h`$hY"KhR$71H9vhq$-NT$(PQR誔 FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPht$D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$Xh$PSVh?$Kh(3>^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV辂+D$  PZ1PPWSjV膂|$dt$ \$hH$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9;3tE;3P{y$L$t h$hї$QQh]%PPh$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh7$( 03H 03~(3H (3 h(3j T$h9t$\i hH$; L^_[]h$ jh~$j M D$t'T$tt h$hї$QQh]%PPh$\ ËD$t%u˞$%tu$Ph՞$$Ş$Ph՚#USWV|$<\$8D$4t$0~u/jUzg u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR~"lPhm$\PWhk#K ^_[]USWV|$4t$0=X8uMX8hhY8BWt Y8'j.hY8}t@hPhY8.Y t"^tCt0Wv`rhhf%h`8X ^_[]1w)ȉPjQ SVU fEu jUe WUu&Vh`8Sh$hh`8`8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh`8Sh$hh`8H`8[SWV$L$4D$1G't$"tZ@:t9rD$Ph$[,^_[SWV|$t^D$uFD$jjP t1Nj0j.V{t@hY8P,u7ut$ө f%hVh`8'W `8^_[VD$L$ 1Ҁ0QRRhh`8VP\ thh%h`8{ `8^Au yuyt$Qtu ȃP; Q3 APh@$hh`8`8SWVD$`8Q4&$R[84&$R\8ƄR]8.r|I1AFL$ t$=T8u d8tL$|=d8t@T81C=`8u WUjqN yVhm$81ۉ؁|^_[]j趲SWVΉQhSm; t!1G=`8u%5l8Sj N yVhm$71^_[USWV 1t$ >WWVWhd' u;D$ D$ PFWWVD$Phd' tt$MWĨ ^_[]hu%t$  tԉ1|$l$Vh$PVS$RHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$Qt!ʼnD$t$Wh|dt$螃 ul$$WhedAP胃 f$a$>ukSt$h#"h%h$WGƄ$tl85$ $t?$QPW` $Kà9Éu|$$P 1hu%jt Å~A1ۉh"PujVh#"hy%h$WqƄ$|$tl8\$ $tf$QPW臸 C;\$ mUT|$l$|$$PUSWV n ujcD$$D$<$sh/$V)thk%V3hU7 Ƅ$hk%sߐut s hk%V:tt s h2$Vt P B l8D$ h<$VtHáp8th$PT(j,SitZ S B,PD$PUGxD$!=`ÉUhm$83 SADž?tG<$tSWUhW$h%h$V!V tEUhg$&ZhF$?Uhx$h۳%h$Pϴ15p8tD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S覨\$ =x8uD$$D$ P$P\ 8\$t$Ph$)&x8PU uUhm$&1@$~#Qh$-1@$\$$$Ĕ ^_[]$Phm$j) Ph$h3軫 jAUSWV L$|8$T$t-8*jh|82 8š|8$T$1i E$48t!u6$t$P袁T$ uF$t$P膁T$ tEM<ǃ h+w$$1 ^_[]ËD$ t 0|8$4$݋D$ t 0|8$$ؾ8Phh8' uh8hm$j2( fVD$t.})zhq9h2$58H i9T3u%۵%'PQhy%58i#u58hM$i9^ËD$ H^WVθ۵%'PVDt)uVh$58裩 i9SGt8tPwhp$z wh{$huj whq95 Gq9q9^_WVD$ t;5q9D$=X8 8u X8';pt8@uVhT$jv& @u=Xr9thXr9Php$ŀ Ph{$赀u5q9=X8^_Ã|$t $臲i9Ã|$t ۵%fi9Ã|$t $rEi9Ã|$uh4r9h$58 i9Ã|$uhr9h$58 i9Ã|$uhq9hԥ$58轧 貱i9SWV$$DŽ$HH$pƋ$ ƒtS!=i9$t$$atσ=i9 =i9 PSj $;rtr1Auu($$h$PQ te$P$$h$PQ t8$(1;BQPVWGVE@Li9^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hhi9trʄt<$1ۊi9t8tCu 9si9B+$=FFu4$D$|$ 1 i9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ m9<$؉D$m9$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$58h $<$?uhVWm- x^_[]USWV0$Du%$H$Dh $PQx y1E-z9hu,jLUh8訲 t$H4$=8I1VV$P Í|$0;=48=z9$H5i95i95i9s =i9$t$9ƒ=D8RPSQWy=z9uE=8t<D8D8$Hctz9D8 z9VV$P Å 4$jz9i90^_[]Ã$D|Ã=48t=@8;1 T$󫋄$HRjh4 |$D$=48ʉǃ=z9$H[L$05i95i9j =i9$t$9Ã=D8VPRQw=z9u9=8t05D8D8$H1tz95D8G=48-=z9$H$HL$05i95i9j ƃ=i9$t$$H9=D8PVRQv=z9u_=8tV=D8D8$H1tz9=D8$$H4h,$辥D$P E;$Dnj9=8t#8@=u1Hjh2#P jh8 WV=z9t@=8t75D8=H)9D8H)915D8=H)9u z9^_USWV1@=D8S=H)9Fϻ&$ͅtUSh4$58藜58Rt$PhVhЅ3xd3L$DH?u$h8t$t$i9WVD$ tul1=i9i9~"uhkt$~h~"WDt(hRV#WzDt1Wx8i9~"n1Hki9RV#Phn$58J =i9t5x8h$58( 58h$5i9t \8i9^_vhM$58 mh$hX8t$t$i9h$h8t$t$i9h$h\8t$t$i9=\8t i9hʧ$hD8t$t$ai9WVD$ t+}&}.1=`8`8RV#1Ht$u8vh~"VBt\hRV#VBu$`8RV#Wv"<8v8hVWU =8`8`8=8t?~"?t5 858>O#t5<8RPh$QG`8#58jj6hۧ$)B`81i9^_h5$h@8t$t$ i9h>$hT8t$t$i9WVD$ tZ}UuZt$~h~"WAtOhRV#WrAtBWy7vhZ$58s h1H_1=81@18 81ҾRV#t~" щ 8PVht$581=8i9^_ËD$uD$L$h$PQ tvD$phʨ$gu<=i9u0=X8t58h$ D$phɨ$vgu+|r9v9z9Li9VD$ L$i9t u]H 8HQFtsP" t8=r98t5hr9h$P׎ i9(^VhѨ$Pjj$h$?V(^ËD$tIDuD$L$h$PQo t$D$ph $Wfu|r9>i9SWVD$-uD$L$h$PQ  1G=z9hu,jWh8< t D$1VVt$d ǀ?tx=z9tyD$thWh $eu |r9=z9uB=8t9=D8D8D$btz9=D8 z9VVt$ DžaSjz9i9^_[ËD$uD$L$h($PQ tmD$_D$L$h2$PQ tI|$BD$ph:$}du8D$phB$ddu|r9ÃtFi9USWVt$ |$.E1ۈ$58jj,hJ$;% u v1.”i9^_[]i9USWV D$ #D$$L$ h$PQw L$ ȃ#D$$L$ h$PQM D$ L$$|<$Dh#t$`t3$8|t+4$;$H$$ 3D$$h$0S`D$1E-z9hu,j諰Uh8 t D$$\t$=z91D$ H9=48"t}%$9t$t$$T$$VVP4t$Qz9u?=8t6D8D8D$$" z9tA z9D8E_t$jʯz9$9t4$"诒i9 ^_[]SWV$tKjjutK~Sw 9uWjL1uh$91Hi9^_[þV Fujjh~# %tj/VJ t@hQW~ =8t858V 8HQP~ Q Pj 蝊|j5\i9h'Q#WV聃  jWVs Vh$%i9j{SWVPD$D$t&D$t$h$PV ri9^_[ËD$ph$^u|$h$ tD$x|$Wh$^WS[PjWgg uP|$h$ t D$x |$Wh$K^W[PjWg 1ۃuM|$ Àu*D$p Vh$ ^VZPjVf 4858h$ D$i9=z9t =v9uJ=v9t#hv9hL$58y i958jj%h&$W6ËD$i9;=r9u=r9t#hr9hb$58 i958jj$h$5ËD$uD$L$hw$PQ輺 teD$ph$\u<=i9u0=X8t58h$ D$ph$c\u|r9Ji9ËD$uD$L$hw$PQ teD$ph$[u<=i9u0=X8t58h$ D$ph$[u|r9蠍i9ËD$t8uD$L$h$PQu tD$L$QPh$r# Pi9USWVh$V $|F$$h1Gh4Vi 9}hhu%VR G9$uVhm$Zu j\T|r9^_[]ËD$t8uD$L$h$PQ耸 tD$L$QPh$ [i9ËD$thuD$L$h(/$PQ0 tHD$:D$L$h$PQ t$|$D$pph$Y Ãtۋi9VD$t$5X8X8u h0$Y%螋i9D$ ph;$Y5X8^VD$Hrdi9>5X8X8uhI$:YD$ phS$$Y5X8^VD$t$5X8X8u h`$X%i9D$ phe$X5X8^Ã|$u|$t諊i9Ã=48t 1PP)ju=48t 1PP jt|$u|$tRi9Ã=48thm$5X髽V1VVcVtVPD$ D$t}uD$p*i9h$W!t+h%W!t h$W!u: 1Cvtu&6h$58|p sz1Hi9^_[t8u88P58hٮ$586p1VD$ L$i9ʃuCuD<D0hв$P(t$Dhڲ$$t$` $t|$@t$t$@ЃD$;h8t|$tt$%D$L$d9.$`-.$i.$t].|$Htt$HD$H|$Ptt$PD$P$t$DŽ$$t$}DŽ$D$Te^_[]ËD$lt8uu L$DUuD=h8t;P象D$HL$H+h8tD$Ej/t$L$ t@Pt$Dh$t$HeD$t$Uh8L$D|$D$81ti9pi9li9hi9$$9l8t1$Pt$Au$\$` ti9pi9|$py|i9f$h32#t$LND$|$t$$QP""u5$8$<$$$\$` li9hi9pi9 ti9t+t$蚸j5ti95pi9P'Y=X8tPt$Hh$58` ti9pi9 tQPh$58k`58h2#x 1O$=8K81O$*|$pu+ D$TQh'$h<8ht$hW =r9|$Lu:|$LD$puuh?$t$Hh,$:uh5$}D$L|i9$|$LD$L8|$dD$t$hV$}8P蚞$$W3$<h&%VK`1A$<$ǀ?tvj:W! t=@j $QP` ~޻t?$9u3;$u*WV39$<r$)PWR t/h&%V_Džm1Ft$Hhm$1$t P$$u |$p$$pi9 ti9t$Lt Vh$t$dt|$dj%W t Wh,$1$GGG fGb$P$xPW# $u2$t'8t"$tJ?t1h %W3tVhl$Oe$-(2WDŽ$t$D_$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB 8JBB D$(PRW$81 t ]@0RtD$(Z$$P^-j j WhSvv t%h"PS j "PW =X8t+D$(xt!~$t$WSP58[v jvk Åx`=X8u~PvvSx)$P$P$Ph$r#ykS 1KW$PhĶ$ Nȉޅɍ$P / PW$4h$bh1N=H8tJ$t$uP$$t$uPݙ$88~Rz9Wh$0tNu1h@h$hD8 t805D)9ދ$tPDŽ$$t4W.PjW: $tPDŽ$$t4Wf.PjWz: $tPkDŽ$D$(t P- |$D$$h5j4$8<tQhH$$FD$$\t$ j8tV=X8tWh$58X t$$tI=X8D$tPt$hh$h$58{X1@t$ht$hhԳ$f |$dwh4$V耮 #hF$VihT$V[8tph {#V? ȅupi9 ti958h$ 5ti95pi9hh$V5ti95pi9h}$58W1F&1t$lh"$V迭 $` #=8t"D$$$t$QP脭|$hѷ$ tPh޷$W` h$h$h$WFD$$0$|$Pt1$t$t#tD=X8$tPh$58V FWh9$$8Wլ $$0t-=X8tPh$58pV FSh3$W蔬 t=X8t58h $` h#t$ ct$1V|\$D$Lt$P5B3^Ɖ$$ىD$ 8H 8 h$" \$D$ D$8L$4D$ D$0D$D$,T$1@t$|$$L$<$$D$,$D$0$D$4$D$8$t$Pt WCt V6ߋ$$$$$$$t,%"t$ht$hht$V $$ˋ$$Hh8;D$]|$@hvjt$hjt$8~ ;8t; 8tQG8¸9| 8Q訍81t8p85x8$t$jsDŽ$jkމ|$`$t$5858 $J1jD$,P58B \$(;8W18"NF؊ u@;ut tH@D$(h#P"-$$u 1É.1ˉ$$8$4=|8t/j$P|8։щ ы8u81ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj58軣$L$T$Pp8t8$)$$8T$@R1Ot1$VSW $u*/#tu'VSWΔ t߉$ȉ)u$$P9=i9=\8$T$Lt8$9=p8}#Ή58($Pq8HQP;H~-Q#x8Ρt89=p8}Pj#|LЋ$$L$T $|$`t)։>ډ׋$$|$8‹$4$8$ |8ˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$ş$|$`tCt$5858 h#58)M|$`=$@$Dt$h,#6lh#t$D$8|}jj &n$D$@h"Po D$@|$@DŽ$8ti9 pi9 m!ڃt9}M#$H5li9hi9$$!;$$=X8t58jj h$fD$TmD$@(3=i9=\8t8 p8ƒx89}%8HQP ;HQ#8HQP<Q 8tB$ڋ$!t hi95li91ϋ$H1 D$h}%P h"t$ED$@|$@tDŽ$` t$D$@Ph$h$Vh$O)"8)PShɴ$Ӿ h۴$%Pt$Hh$jkh$h"$Lbhp$LL$D$ D$8t$4D$ D$0D$D$,T$1@މPj Gt$KthB$9xj#ct$@$=` $#$1V$W$$$$$$t$@Ѓt$@Wt$ u.58$PsP越PhO$VC t8=p8| jjli9x& pi9 p8ti9t8; hi9e1t8p841\$  pi9 ti9PL$T$ T$8t$4\$0r\$ X81tt$h$58B L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$xJD$L$ L$8t$4\$0ËD$D$,T$1@t$nPj#/E7tt$hι$58A T$d|$`D$TD$L$ L$8t$4\$0ËD$D$,T$1@hK$ID$L$ L$8t$4\$0h$ID$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hl$$H$D$8$D$4$D$0t$,$$1@މjh$HD$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$$$ω$$$h$hz$hhH$!USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q t}D$V~ƉD$j@Pvt%L$L$48@P~ƉD$j:VB@P~D$ t$D$0|$h$jPW4 D$4t 8D$t{8tvD$ t8tj;P\ thL$PhT$Wjh\$WTVWh$F Vh$uF1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh %V @L$ǃuC=@8taD$t$uI$t>th$V31Ʌ $t}th$U1ɉL$<=8=48t 1PPü=8K |$DhPW |$L$D$L$D$ tD$ D$$=H8H8L$QP q=H848t=ut$8t$8t$ Rs t D$,t>D$Pj3D$T$"tQPh$kD "D$Pj虓<$l$,|$u'j/V tG1|$t>tFhhR&l$LU l$t$1l$ -|r9D$Pj貫9-|r9*x1l$,1Kd}Z<$t3$DSVW Sh %W SUW <$hh%t$LV t$l$D$ D$<4uT5D8D8=l8$t$hP|$LW |$D$Pj5D8h8uj/UE t@ʼnD$ D$$=l8tAD$Pj?>uP=i9uDh3jhh$O)1D$PjF8i91ۃcÍL$%L$0d؁D^_[]1Ehd$BPh$hߺ$j\ USWV օ\$ |$$jh$Q l$t=jh$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CSPyS\$$UP { uG<$W$xC Uxj@V|$$tZ{ u 8w@PwƋ_j:Spt@PwG_Ot[uUnj]U1$tYÊ@t<:uL)SUV谿 V-,$}:1j:VtEt$t$Vhʵ$1ۋ\$ t3tHj PU9 }t $9ut=s fCt$t$Uh$?CC tWt_uk48KUVh$_? t$t$Vh$G?\$ n1HJ388(u$r#UNvC{u{ !%t %P,vC1 ^_[]h$j? WV։2vvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdju\=8t<Ph$jdV1~ 8Iu1IPVQ jh8 G Vd08j \=8t|$ tD$ t$ЃD$t$1t$Vt8=p8$Pj#!h($h$h7h$SWV |$$D$h{$W!t D${$=i9$t$D$q9ƅu=r9=r9 4F95q9t jVuhl$4j$=4895q9t jVth8h$t$ jh|83/ jh8/ hjDx8h{$W  8|t1@v58h3$| M58hi$d j*#i9!hjD$ ti9pi9 tQPh$ \$$SWh۳% j:Z j"D$ ti9pi9 tQPh$ Vt$h۳% x81WWN"W4$j58h@8tU K=D8thD8hZ$58. 58耞jh@hD8hЅ3'tEt W=D)9k80t&ƅu'$$58PT /{$~ t$=48tH)9j 6W"s 88805D)9V =L)9t'~t!8HQP;H~Q~ N Pjhj h:j ^_Ã=8t8HQP~Q fPj fV5<8u<FA\t"uAt""tFAQt FAAtF5Ti9 P)9;$Ti9 P)91tu Xi9Xi9\i9^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4'RSt$Dh$QP li9hi9ȃt8p8D$u݄$|9s0;T$ D$r$|$\$|?؍<)h$؍<)h$QPK N+pi9 ti9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRV1j $^Ã0D$4L$8T$ 1ɉJJJ JJQRP耼 x$1H0Vg0jV0^USWVh=X8u=\8u }t$XjV;h+9~= 9N+ 9y@BD$HT$Ll$HL$$D$$5&t8 p8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$r#t4#|$d5|i9PRQh$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$r#r4#+|$QRh$Pt$ $ų i)s<$*<$Hrr޸t1@D$))kd΍ $9HQP~ Q PnʍHr̃t"1$9HQP~ Q P%\t"u5$9HQP~ QP(9Gdu(91G $9HQP~ Q P蘢[~#\uE$9HQP~%Q'H wr? t:,u3PNt%(9Gdzhk$ 1N(9=(9if%'h(9P趢tu :v2USWVՉh(9Q|tDj.V{1ۅt6UP|u&)Wh(9VY u1ۀ(91C^_[]SWVD$=48t5r9h$58~ nD$t$h$PV` uA `848t<8t$~Vt. 89PQ i9^_[Pv耘t=`8t"=X8t58h$58 1G=48 Sh۵%hq9TV =q9=q9Sh$hr95V =0r9Shr&h4r9V =Tr9Sh;"hq9V = r9Sh<&hXr9U xr9=H81PPv h$jG WVPhD8賞ơ8?snt$h$P ƆD8 E8?)PRQhЅ35 x?t$|$ D)91; 8 ^_Ph$6 ^h$t$h$58G =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=8tDt Wbh$.$t Vbh,$PD$D$ L$PQRSm:4$uu|$l$ 88tQSh$PWSh$PF D$WjPUhЅ3tU58sƉ$t=`8t`V跜S謜<WFWt$P}S Whj$V.T WSV#T $t Pa4$Vh$蒟uD$uqh$' t66hs2#t$h$58Ki9kt$VD$VPjV D$Ph$Ƌ|$W赛PjWɧ u{D$ u?h$& tt$VD$ VmPjV聧 D$ 8Ph$膞Ƌ|$ W7PjWK 1ۃD$  ˀuPh$Bu_4$z91F=8uR48,=88z9Sh$qOuh$ 1$tP_$|$t.WgPjW{ D$tPo_D$|$ t&W1PjWE D$ t P9_d^_[]h@h$hD8P 805D)9Whhr9臡 ur9v9z9V5X8=8u X8h$远t>h$h9O r1ɀ9.)h9Ph$58tjh$h9R tfjhi$h9xR tN=8r9tr9j h$$h9$ uh58h/$1 S=8r9tr9q9j h$hq9oO thq9h2$58 1Hr9r9r9r9r9r98hx$k1Ƀu 1Ar9u ǀr9u r985X8^Vt$t3DH@tNFuh$VstQjh$VQ tDh$Vst9h%Vst.h'$Vsu'r9r9r9 r9r9^á9t P1948r9r9=8u 8d888z9t P \z9=8t8808j=8t#8@=u1Hjh2#PE jh8f WVO0jk=48tp9t1@=u1HjP[ 59ݕ9d8x#jP/ 5d8! d848|$ j=48tD9t1@=u1HjP 59V9481i9P8u Q0^_Wh}$j/> D$tPHt h$j > h$j1> USWVt$ \$l$|$WSU tU| u;HDO 1 t$ t$fO gK9uX ԅ3I ԅ3~Ѕ3PЅ3hЅ3莕 ԅ3 tuÅt$g t^_[]Vt$VHt^VhU$j6= hhr9 tr9USWV=z9@8t`=48tW$tw9Phh9 j h9n9tJ91P699tNjwt99t$h58VJ |0/thh %VJ hh$VJ V5$$P  X8L$X8i9$-\81i9\8$ t1=8PGt*"1SSQPVh$Z}%u8i9d$$r t9$ t1=8PPD$X8$i9-\8h32#V諽9V9t2/$759v9Vh $6 h/$ 1^_[]USWV,=@8t8l$@11 SjhU tUh,$ ",^_[]<$tދD$0S ,^_[]WVP5X8=8u X8|$=r9tft$hx$uqj h9l@j WP,  =3LO@1 58jj(hO$lru=i9u=r9u r91HtJ=8uA58h9x( 8HQP~ Q Pj ?1H‰5X8^_USWV45X8=8u X8\$L=i9=r9!t$Hh$֒+j h9jt|$j.h9jth9P94$uY9519 91f u>h9h$58P f920h9h$58/ 9t$1 UҎVh$UO D$(VAz!у $ X858jj(h$ju=i9u=r9u r9tj=8ua58h9~& 8HQP~ Q 0Pj E# 8tUh$58 4$|$5X8=i91Hƒ4^_[]t$h)$j2h9`t9hC$jV6 USWV\$l$jWQihY#WAiUhq$S~N Džu&Uh$SiN DžuUh$STN Vjh^_[]SWVz95X8=8u X8=i9h #v9u_j h9gtL8tGx"uAHt.1Ҁ"ux"u"@v9ZHt@r1Ӎv95X8=i9^_[SWV$h$V&C Vm@ h$%Pݍ1Fta\$SW t?|$/uH$VPVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhx&PV ƅu 4$Ղ 1$^USWVHuI\$ $Cj j ShWuu [r t "hVW9 j VS9 8]t/M I9Nt vuvvSf jjSO ƃPjS5 \$fD$=8~%|$@jWI=8O$Cuu S$ VjP 1D$ PWhpq" D$ PWhb$h$&讑81\$@jPPhSvvq thh"S8 r8Sh$&-D$ PWh$H8$\$=8~N1PD$P@<T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,8t踐8#tj}ud袐8AuZku<FD$ t:D$L$ PQhhuGn t\$ ۋEu Y ED$ PWhԳ$c% 1He^_[]` t$a__ SWV|$GHO~H0^_[Ë\$1NWu4G `f@uď8t 躏8#ug GHO~막뭅t蕏USWV|$\$GHO~H^_[]1M;G~ uWS迭u4G `f@u<58t +8#ug GHO~렉륋t$t WV|$h 3$Wɀt.hx&W跀t!t$?tt$ h1$#1F1^_ th|$j' Vt$ Vt$ S t^Vh$j' USWVHE ML$8t$QPV DUt$F|$x| u2HDeO,1t$t$G(EK9u61Cl$WSSUt|$ ut,$G( t^_[]USWVhr"PSyt+hr"VAythr"V/yu̔9Ȕ9u }hX$VW( Hσ s УB3߃c u1̔9σdt ltntHȔ9뵈Д9Ȕ9맃t Vu'39u=Ȕ9q1z4$9-u yt$$PQ1ۅtw<$uaȔ9tXV8uNWkvƃP*VWPY 3.gz$PS ߉ޅu4$h$\1$tE=@Vh$t$$=Ȕ915ؔ9=Ȕ9jV DžD$PWa$$P Vh+$D$V=Ȕ9$=̔90Ɂ==11BWjV* $=̔9$uXh'$Vhy%PW9r DŽ$.gz=̔9uhh W |<$D$D$P_D$ T$Wh =̔9D$ #D$H=`t= ujVR xLVVh$;Vh`"*$Vh`"Vh$t$ u hz$V舽D$ !=t D$D$pD$5ؔ9hVW:* WAs|<ǍWh'$ttI=̔9uCД9u:Vh9$$Wh*$-hЅ3rjD$P|$W t $VhW$1PPPWd=̔9$uL=Д9uLhh W ƒu 1@P D$ 1@PZ T$1=Д9uW4$T$WjVh$$P t$t S7N| $T$ V1PPPD$T$4$ t he$D$ tP t hz$L$#L$̔9tKfjjW tT$PQL$n]tDWh$b4$u WVh$Wh`"KWh$*$l$pT$ 3T$ϋD$1 u V軺4$ $Qt$Pt$h$s4$ $Wr|h"$1B1PW 5Ԕ9h'h#h3o jV3h'h#VO w~PhF$V; jUSWV΍D$PQ\x#L$D$xt$hI"1L$h $tS&$ǀ=Д9u$hh$jى\$9r<$SWV6 t*t)u1ۋD$)؃tǃwh$ hp$@<$D$1Bhh$PW|$ WW3e^_[]h"+PD$L$ $QPW=Ԕ9u Ԕ9XPD$L$ $QP,jBUSWV׉ˀ=ܔ9u hz$d t$ܔ9jjjS`!ƒt7jPS% tuh$Tl$h$11PUVWh$腖؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph$jV萔L0L0D0.Vh$h(3p Wh#•^_[]PD$L$ $QP藢 =Ԕ9u Ԕ9XUSWVpT$hL$lhx!}ha!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$L'1@ɽ9jD$0P~Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $ȃ'Cىt KDP@uD$ 3|$1 ,,C t ^DH@ujGt-Ê 3DA@CCu 1OD$" 83L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E89ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êt3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =<31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhP 911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P> $(4$hUt$P> L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[5jj $( PS_ j8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V E =9 hh V EKCDH@uٺ%$yG=9 GKoCDH@uٺ/$KfCDH@uٺ<$ GQC t _DH@u%ƋD$pWW@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,9t!9}uEpVlX*mj 9xt$p@ 9>GWVt$F1Ejhh9f Å1|$څ,5<9589h$|$t5<9589h$9 911<9t6 uGp5<9589hZ$و W߅uFu|9t@Py99P`9(^_[]R5<9589h$j 5<9589h$5<9589h $VQR5<9589h$$P5<9589h$$P5<9589h$jjUj- 5<9589hI$lV5<9589hh$UP5<9589h&$>5<9589h$(5<9589h$Q5<9589h7$5<9589h~$5<9589he$jj 5<9589hX$5<9589h$5<9589h$5<9589h $n5<9589h$X5<9589hC$B5<9589hW$,$P5<9589hm$Shm$95<9589h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u|9_NSFJ1<9tJ9ouwvSTt?G $pSH|$698^_[]Ë$@S5<9589h<$j SWV׉HЃ s%j SV~ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC99s9؃^_[]Ë589=<9SP PWVh$j USWVP׉΋$1m~ w]$' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x B3B3>u)jH1҉P5B3 B35ojnH@B38 B3>u j59h(3Iu 9Pihy"j DXPPhM$h3ujiUSWV\$|$t$ 91EtB5 9WV} 49495 9I14989Ht8h32#pt 9 49I <9KphU#jh9/prf09",9 ...<9949@9 9 =89u98#uxnu 9  9W1 t,E-9@J}949R)ʉ1ɉ499‹\$k891m1 89Q89u>#u~nu 9t 91B C1ɾ8f 89@91ɋ\$u89\$t1A ^_[]ÉSQhm$jU USWV|L9uN P919u:=9uL9Ѕ3Ѕ3<9$T9(3X9y"H91NHQPPGL9=Ѕ3PSF=\9tC\9S茐S5<9} th\95<9 o\9=\9tMT9t=(3tPEVT95<9h\9萿 \9X9=H9tH9P9 P9@P9<9=9QPrf|$98t0W5<9\9Vf W59V =<W5<9$V4 W5<9$U Vd *U PWVhA$Wh\97l9h\9T9޻t=(3t PrDh"h\9`pT9rH9tt$t$Pf T9H9tȋL$!QP` X9\9=9u89<9T9(3X9y"h32#PoL95<9hm$ 9L9$@1Q5L9P薋 5L9hD9h@9N ƅttb@9|0 uNt$@ $@ $QV5@9P891@|^_[]5<9hm$j 5<9hp#h)$h$5<9h $j h$h$ =\9uh$ h\9轌jbh$벡L9@ u:HQP~ QPCt5L9PN 1=9t 9t SWVP9X1t^h32#3mt&Nj@HOW CuWA[뾋HWPʼn WA1F^_[Vt$Vgt^Vh$j Vt$ D$tVP)uVh$j V^WV|$t$ WVt^_WVh$jS SWVP\$|$\9t P]D$jPSW PL\9VPSW \9^_[USWV89jh`991FD$h999JBtOz T$R uW|$+;A `9d99ыR L$y th|$ 89)щ;HT$7D$t{T$A `9d9+9. 89;H@ `9d9|$to9u1ۉ891;A891;AT$t1~T$ 9=91ۉ__ WjWSQPZE|$t4JT$B8 89;H`9T$9591~>~ VjVWQPD1FT$19=91ۉ__ WjWSQPDT$t tCsBtt$u 89;Hr9xt$t891BtȉÅQJA7$'=h95d9$=`9FPj W  @) d9QPW! 9Ҿ5=9 9R҉Y = 589h(v"5T9h u 1Pjh2#`9S1P5959)1Pjh2#9S1P5d95`9S%1Pjh2#`9S1PS =h9 T$`9=d9GPj S ƅ l9D$4)أd9l9 5x9|99a9j5959h`9j5d95`9h9 4 5T9r  T$`9d9D$<=T9(3=B311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5B3r5T9jjh}%5T9j$p 5T9j p 1-RL$ tKQD$ ;B3r5T9jjh}%15T9WjSt$ tsQ5tejPh' tQF;B3r5T9jjh}%41')B$Ph>$5T9e Z;B3r5T9jjh}%1t$ D$13PhJ$5T9d F9ut$ t$L$)4B3F9r5T9jjh}%z5T9j$o 5T9j o T9@ @9  ֡9 h9u55T95d9j5`9=l9t5T9j n n jh`9Y h95 =h9( 5T95d9j5`9=l9t5T9j An 볋5x9|999+`9T$JQ9T$ut Q;P d9T$I9D=h9yBu%hh r F 5d95`9PU ;d9 jh2#r5  _ T$=9ujjh$r#h9 h9D$0d9D$,`9D$(l9p9t9`99l9L$(t$, 959L$0 9999=h9_ d9QZ=<39`9 @ `9 d99r 9֍|9@PQ95x9 F@+6vFt PΣ uF6^_ËFp vhm$j USWV ՉL$99щT$Љ$ 39E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B į99r7 į9P59999$90D$SPt$V~ it}ŋ4$L$]\4$L$t&uE\į99r+į9P59ƣ9959F1C4$99\$D$ į99ȋ$r+ į9Q59;999 ^_[]USWV`}$111D$hP$u W^ uu5l =>ut0Gtgl =;ul =$8u 3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h'%SYU t+8ttDGhW$j~ 1E L$3 th$% u3hm$jn tD$PW uh~$ۃ|$ tt$耡 uh$뼅tt$ uh$렋Cu/h~# %tjh$VV( VeSPN QVh$ -6Ph$h3R jsGUVQt@t $e^]Vh$j1 WVP։571ɉQPW V?t$8t 71H^_68"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPv oF vvRF^USWVP1k<jP3~4jP3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<jP3jP3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph3jjCh$TjCV1=9SCZt*ujjj: V\V装5<e95<r9j5<@9jP9t#1ɺXP3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$]tE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? 3DAh3jT W@$ԇ'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLW~=m$ 5<ӣ5<1QQPSE3t$V5<C5<f1U)19}1ۋ$p$)ŊEt9}1< ˊEE5<6hq$1VV5<菇UVj5<}Vj5< 5<^5<p5= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3jQ bxu+=9 9σqt$VdV$Vx5<Ih3jQ ,$,$fUuE 9|)BfUh3jP ,$T$4xut EfEuGza|1x(| E9}ED ufMh3jaP !}Eu)uE t uP贼u f;}]D; jtTD; tt$4UЃF4; ~ttt$4WZuzE tuPu vE uZuvE9,Et)uE t uP跻u EtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃuvEE tPvE ^_[]_St$59t$t$h$h3CZ4S$@ t$St$t$ t$UPh$'S $A It$U59t$SQPhz$h3bC$j7USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$p@tS;tNt$Cj S)؃ QSVWD$pt G}uo $ $l$Atl$|$qKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufthR$VSwʀ|$Gu1PPw|$ GL$G)VQw w腺 ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQ  =9ۉ9t @tFj-9E3\Jك@to@uwt uDZ@t< ty< =9u =9tI59wtj 59 =9uj 599999?=9u"59wtj 59j 59199999 9f)91ۈD$u9C59vt$L$4 59v9Ƌt$|259vVUUU9}j 59|$uCj 59KVW59] E߃ @ Ȣ99=9uW59ut7j 59n%5959(Y999959K ^_[]t$Phm$VPt$D$ L$ $PVP1A4$^h$r#t$t$t$t$USWVP|$ \$$l$(t$59D99D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j59f1ɉV,$E|$@t[D$@8tRD$u:hKZ%59Wt$@59vWh#59cWWt$Dt$` h9x%59=W4$R59sD$ 59s59t‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59*W59|sth%US59sW/)PS59 59P59bÃ~0L$ZD$  &- L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ貝 KOuLuH|$@tAt$t$D|$W蓡 Wh3jr D$z19Dzf tN;L$$} 3DXuh3j+  $9A)RPQ $8GED$t+)j Pt$59L$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P莠 4$踮0^_[]h$r#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59p59o$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PKtC@j P5uL$$)݃} 9WUQS59裈ƅ|$ VƅtV5<4$59/PW359MPWI1PPW> WeD$E|$ GWUPS59Pŋ=9VPW=9V MPWFI5999#WUt$ ShZ%59辮1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV4$tWV褈V{CWUP`CWWC^_[]h$r#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$r#t$t$t$t$USWVP|$ \$$l$(t$5999D$,$VAUPA14$SWt$(^_[]h$r#t$VPt$D$ L$ $PVP1ɉ4$ ^V59j59-k^fUSWV $$$  :15:50:9j%5:W(:WVPi 'Ft(=` :tvvP vh` :&B>vuɸp:H ::::h%踤 D$|$ h{Z%SUu e~o~1pKrtCGDL :붃fg5l =h32#V PhWD \$h#W6 D jPh# t \$Sh|$W u4 [%'WPWVn t }u몋}tE$th#S5 <=u͍4@h#P5 Fh^%V 04$VWL H :h:h:hZ%5l =k bS$$$ Fml =D$/J1Wh^%lu#D$=uD$h|$d}:h^%k t61W" t@ < uFrWc 1Wc jh 3$h.$e AR5<gǃ5<h1FVVPWc}T :$ t5:5:W5T :hVVjVjhj5<)薅hh9kD$D$@VljD$ VD$1Åj2P迓L$t|$ o u*t$ $%n ut$ \%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVhJ# ![ :j:j"P :$u誸t`= :t jǡ jjGȜ/91 ^_[]Ét$ hT1GQWP Ph#h3e  VAW =h3jj,hNZ%;j Źh3VjhZ%V V1Fh3VhEh]%V UWVV܂ hK#o P覜 6|[/=9t>V萙PhW^%W 59599=X :t>VHPhi^%WH 5X :蚾5X :X :=9uh3jjh^%e^_]Ã=\ :tá:tt$P ja jZ hK#` tP蓛 t h %肛 Zjh.w hjUSWVB L$Qe  P} Ń j h]%Ug ~ uF t$|$ W: WfD/UW` Wjŋ>7P&tn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P譎4$蟎UV S{ ŅS] ^_[]ËD$L$I41@fUSWV1t$ :j%Vt$t$ t$t$4$jjVP;= :P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15 :,~t:VPX~Bjhyt:jPWyjhx=L :V/Vbu%t:ǀ$jhxup ~t:Phm$jX jtOt:)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5 :jV#jr4PVf8 t:$*tKuKt!Pуtt:$Pt:L$$Q3 tXD$t$VSVx)VOu^%u^%t*VB^_[À)ujhbsu Vt5<z1WW5<# 5<e5<zSj X9;xhj_jZjC]jVkJ^%^%!}E'USWVο$WQS Wh^%S诌 WSU Wh%U蓌 S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQVP Sh^%V SVW4 Sh%W Wit VW^_[WV1t$t$t$ t$t$4$5 :jxVtkjo4PV[5xGt:*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04< Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWu 59t@WPhW^%V 59I59K9sh}%h_%- 9t*W蚋Ph_%V 59.5T :0AtPhQW#hy%j[1e^_]Ph&_%h3@ j UWVV#t =X :t>V1Phi^%V݄ 5X :R5X :T5X :wh"h_%: X :t81h_%W莄V虊Ph_%Wv 5X :$!0FPh_%hy%j[1e^_]V1hhPhPjjPj jjhe3hи4xjP訪V輹^h3jjh^%9tPjjh^%ީjd SWVD$x1|$9tX :Ps1; P]PVh:7#Wc^_[USWV$$$L$$QPhV $h32#V ! $D$Wj1K4$n 1G9r6|$  WUŋ$(\5F4$ ÃugD$ PV-WuH|$dh32#V $t:|$G=9tVhb_%hK_%P1 1KS1D5$$t 4$% 4$fu9tVhb_%hj_%P 1ۉ؁Ĉ^_[]U袐$$$1KT USWVu ED$l|$(PVW!  ED$8D$1ۉΊ<'t  j Fj'V3u Vljt$ t$PSW D$ t$ )VPh"L$Ql! h_%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W tWT É@/ WS É|$PD$Su} ND$+D$D$ .t Vt$W tS:} Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ h_%P 뒋D$L$T$;t RPSRK |$\$$hu%Sl G|$\$1\$L$< t$0Vhht@W fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=<jP|$ W 5<m:5<j5<_5<r*m<D$D$(D$$1WSYD$ L$VWSPQd61N|$p$ \ :h\ :hptt$$ֹ =e3\$he3hbtt$(诹 us=e3ujjh 2&j!= he3hf@t$${ =e3t0e3he3hbtt$(R $`%\$e39t P薨X :t Pq£:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5\ :L$@EL$D$D$9}@D$hP+%ApI{g|$u9Mx{;5<tVHjP%|$ۋ|$t h2#Z+hPD+ gԅ3H ԅ3~Ѕ3#hЅ39Nj|$tfjr* *;5<t V|$ t E%u15<M5< j5<OXwft$(胆twPquW_D$td$8u-e^_[]D$t$ h_%jj Vh}_%P 1S 9 1FV9 SjhuD$ |$O 4$ ))ht$Ps FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfF >Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p 9 )) hPh 9[r 14`'jVh 9P t1GuD$(Vh g%j@$SZ 1PPD$0PD$XPSD t|$Lub4d'h 9hy%h-jSj"D$L1QD$PPQQS,D Shg%s1= 9su=!9lu3 "9DH$D$$Ph % u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV j!W|$0W iW&]hhg%QChx9PPji=x9 hx9PPhh}%hh% Phg%j+o hh%Wohg%Wohh%Wohh%Wnhx9hh%Wn =x9t!hx9hh%Wn $9h)h%Wnh9h%WnhGh%WnWhc%jtnh 9hJh%h DŽ$h{9VVj~j hb%VC {9defa1ȋ 9ult1 j hh%h{9C {9manu1ȋ ~9ual1 {91 {9none1 9 tlf={9 tb={9t`h{9h 9hh%jtCh 9hh%Sj~$$'|{9 9hhh%HOh"Ifh 9hh%hh%hL [ 8 9h`%D$ Pj3 ~ht$ h$9Em t$n{j h$9ztha%D$ Pj ~ht$ h:l t${j h:*t=:t 9ha%D$ Pj ~ht$ h#9l t$z=#9u:h&b%D$ Pj@ ~ht$ h#9Rl t${zj h#9臐t=#9t 9hh"9iu="9t 9D$1@$" hw9S$Wk V"9PPjxV#9PPjw SWdt% 9|$$|$ t |$uj!9PPjye|$t j?9PPjz^h!90$ =]9u=b%=r!ƒb%t๾b%=ujQh]9j j]9PPj{h$9PPj} 9u4D$D$Pj|$uh:PPj|=:^$^$t:={9b%t{9=!9t!9|$ti=?9^$^$t?9=]9^$t]9=$9t$9SVWQRh 9Ph"9h#9h"h,$L=]9^$^$t]9=$9t$9WVQRh 9Ph"9h#9h"h(jjjf xP* z9b%Phm$hb ha}<h 9h_h%hSn S"jrjQ$H1WWV$PhQf%`; t( ;$P$Tshcf%jPbt^DŽ$ 1WWV$Phf%; ? ;$0$4&hf%jPh`uq5: 1H t$t$6v1t$t$vhb%j<$t$js91@$F=:h"hc%J hc%jft$(VU VlPhKc%h.c%Wtf=#9th#9hhc%WXf =:th:hsc%Wt<:1ɀ= :/ :QPh%hhX :^ 1^ËL$1BhT:WVt$=9u jG7Wj 螄u1@l:`5:o1ɀ= :/ :%QPVWh: =1ɀ= :/ :QPVWhL : 1^_Vt$V dЉh :$^WV D$Ph,:W u:$nfsu-Vh,:h:] Vh :hL :] tWj 蔃1F?t[h 9hR:hd%jPu>0:d%h,:VWh: h :VWhL : 1 ^_SWV=9hU 9u(h%Q\u9hw9hd%U=:t hc%˵=x9t hh%赵|$h 9hd%hW h"WƅVWPhd%j[h$V[={9th{9hd%Vy[ hc%jj[ 9uGWPhd%jK[={9tDh{9h]9h!9hd%V%[= 9tCh[e%Th 9hge%h]9h!9he%VZhc%jZh}%he%XPh!e%jZ h%SWZhg%WZSWZ=#9th#9hg%WcZ h!9hg%WPZ =#9tPhw9hZ$W/Z h"9h#WZ W覣hc%jZh;e%Zuh$9hHe%nS=x9th~e%XSh 9he%FSt V?j%^_[USWV։ϸjPPW tCËl$hjWg ojh 9W$Z WVSY S> 1H^_[]USWV$΋$PhV%訤u tW$r#V ^l$PSU :<$u :PVUWhtg%hC1Ʌȁ^_[]ÿpg%fT$L$t$q"u/Átut$Ãt6u8h6h/u uh%!w'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhh' ~t{4$6V1ۅtjSSWPjhh'}tEhu%VV' t&|$\$PS׃thu%j0' uVXf VKf1ۉ؃^_[USWVOi%`'\$|$jSPY9 ƅt Eu$wS7W wh}%7wX G^_[]WVL'|$u\'t%|$ jWQ8 t u1^_ËL$e34USWV1td։σSFPSW9 t u6P1PhPPj D$PU1 D$t΀8uɃ<$uð1^_[]ËL$e3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E[i%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQX $V1VPD 95 :D$40$X@h7(P@tt$45<6BhЅ3Z 5<$9r :ɉt$ =1MD$Ni8D$$11t=i8,4:tǍXUSN݉|$|$l$$(:t:ƀyH1ۉLPTXVUQS t:" .hQPS VUh :S ,t:L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQPt:$()1HD,048Ƃ(1 :<5(:6W:|$c[ (:P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً :ɋD$L$ӾV W$r#QSPSl$GUA t:$H@ VW$r#RPQSD$BP 9t% t:QUHDRhi%P =t:$0@ơt:$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.- :L$QP5t: u<5t:h_R$Pdž$l$t:()8 (: :VM(:VjP: L$ D$@D$9 :yuƇy$u4P4 44S*$똋D$t:$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$ >D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4 >El$L$),$|4xfDŽ4DŽ4 >T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ >D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ >D4B1hPPPPjPPjjR$Pjz4$1K|$$8hm$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2f3}L t:f31@멃= :yu : :s19dL$w BsÁt1USWVD$$t:*t1G.$ )$Phi%hV Ns%jt(hfMVhi%h% j$ i %W踢t:$Ph%hVx WVh.j%蜥 ]h %Vjj\Q1PP3Ahjl1qf$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$|'hj%D$P j%D$j%X3|$0tPhj%hW Whj%D$P> Ns%D$(j%zhj%D$P j%D$j%i3|$0tPh7j%hW@ D3t#Ph>j%j\$S# S\$W D3t#PhEj%j\$S S\$W L3{"t 3$2%tWRhLj%D$ PG D3@(j%tej%D$Ns%D3|$0tL3tQhrj%hWk Whxj%D$P t%D$j%Q|3j%tj%PD$P k%D$ k%!hj%D$P j%D$j%D3 $t!t$PQh۳%h7t)$j4$UtQtUd3U$ := :t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh^o%UP EtjPN t4$T؁ ^_[]Ê$ hNs%W$D$jVc ù D$jQQPSA S  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uhxo%SSVUho%SC$ Pu1Vt$hlo%P4$S$ l$Sh&r#U8 h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQ}^_[9rwًz89y8rw19HUSWV t:1G*ZƄ$hk%进h"h<$菞Phk%jVC 59t t:QPh3k%VQ 5hjk%SCt:)\$J$WPZx$L$@PQD $d$ PV, D$@Phk%SB D$0PV`Y"D$0L$8L$D$h"Pw\$D$H$194$h"WՍFuށǐW$W胿 SQ;t$$ *h^9tPjjhNk%g1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$r#$k%\$t7ȉL$7 T$wXj%D$ Ns%D$$'$r#$uht$$PA k%Pt$hk%t=uD7L7qQPh4l%ub$$#d%D#t $D$ t% $T$h %RT$ D$L$ 1@D$hYl%RT$j%D$L$ h %R蒋uD7#t$$D7$r#@tl%$r#yl%$r#tl%T$($r#tl%T$ |$$$r#tl%L$,$r#tl%$r#tl% $r#tl%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h`l%t$D?@غRPh l%t$>ClE;F{Pp\$CPWH SMt$0|$4hh褕L$0QjP7. P8WMtVhk%t$y> SvM=` :u#D$@` :@@hPihl%\$ S0>hl%S">hl%S>=` :th` :hm%S= $ 1|$@VVPWhQo%7 ;w$r#r#t#Qh6m%S= hcm%ٕhim%̕hom%迕=` :t hxm%評hm%蜕1hc%WL=SֆWhe^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ 'hm%Um1 Ueuhj%hm%UF1 U>FjVD1Ktljt$#"hm%:G$GNs%G w#"Ghm%9G ${$Ns%C(s4C8'hm%9C<{@Ns%CDsP$sT'Shm%U{0 UstlShm%U_0 #"UP9F$F^ FShm%U+0 F'U9F $F$^(F48ihj%hm%U/ Utlj%Whm%U/ #"U8F$F~ ^Whm%U/ F'U8F $F$~(^48+4$iƷm۶|$9U91Khk%賙tzh<$臙tiD$h<$Pj記 XWl$UVt$t$]I6NIOu4$=It:Phm$h 1PP}#t:)t5Ph%hU 鋔$ 1$ 91APuDFl9Ɖr:t:Phm$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhHn%hL$yҋ81u/Akl|Tnn%w{n%Ph\"h%Vu ^_[]Vt$D$QPbLt(D$t%t!hnhPQWRD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5:.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh&h_&jjAPjQQhe3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h7(PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwU~t\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ 64D$$@$;E tL$ A;L$tI1۸hSShW4ShjU>~`^_[]USWVϋ@PD$ P-hFPt$V辬 x1|$T$RtPQL = :1PWt$$t$$wD$T$1PWt$,t$,w t$t$RPqho%|$dWE# D$,tjPpW?0 t$ Wt$ .0 |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:7#S@^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhn%h:1^_[USWVu Oi%P'jVP uh8j}wL jVw- e3Oe3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhn%hSb Z8^8PG@$QP"B'$HffsWBD$Bjhn%1ۃt$D$hn%hn%WG Vhn%SG Shn%Wћ SH$Ph}Dt$VW9W}V6ۻ$Phn%$ < 1ۄ$h o%$ho%PL$LQhH]&PE t$,04t$jj h$r#RPjV |$LWDs3r \DZ@uWQVt$h(o%ht$ N 1C}$.1ۿx9PSW~ t$L^^^F~ FFVhQt$ ? t |$dJSjV~ $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$r#RPjVn VSh]$ht$ }G8@É؍e^_[]x9=}t'fy"9 9NuEt FuXt1€1ɾ9( Ӏu A'w'9 ' Àu A&r  uȃsƄ\$,04t$jj h$r#RPjVP $PVSh6o%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$r#RPjS W$mPSVhBo%ht$ 8 -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hl%q9 Y|$h %u pDžtoh'6ptkDŽ$v/rDŽ$/dev,$$VuP:& D$/devf@/VuP& Q踃낋E\tu xt@@AED$5:$ttt$PуuNt:덬$WPUw% t$/devfF/t:WPVT% [Sm\as@a9aO$CQPU% {PWVt:$t(tt$Pуt Nj5t:,$1D$0$h@h7(P5tt$Gt:PUntTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS# $WD$pV" l$ Uh'%VZ ǰD$hh"WAmh#W+mtyhD#Wmtgh/$WmtUhk%WltCh"Wlt1'%D$to%tD$VPS" VWS" Uh'%jNY DžED$4$v PS} t"vhm$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$= :SWt$t$h$1PWt$t$h|$p%W#V% V+^_[WVt$D$D$PVW褼 t$L$QQPhsp%jӚ4$B+ ^_VhRp%j  SWVPVjB>u1@G:9s :%VPWSh: wsVPWShL : 1^_[USWV |$ faa@D$$1C$r#=0:thr%j0:VrPWhy%h:vD$PUAD$h~ :59hIu%j訙x0:rW!:u :QWh :Vt$D$PWhgu%SR$'D$D$ =mdt2Vh,:h:1 Vh :hL : 1$hVS1o t$t$t$D$ 9jVV葏 ~;Ƹ PV;!D$i jQPf e9]D$|$haWw'o ~#u4h9h` : 21jio` :ލ$9Hf@ >tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Ph` :_ u`~*=0:t!hr%jU10:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hu%hu%h'ht%jUSWV|1ۀ=` :t}h` :hu%jŕ ue0:au%%:h,:VWSU' h :VWShL : VU#N@1 É؃|^_[]ËD$L$I1@Ã=0:thr%j(0:Vt$ D$t PmVj=m5T :n^USWVPWj<1F?tih :h4:hp%j讔uL0: 9au%p%h,:VWSUh: h :VWSUhL : 1^_[]SWVPVj`<>u1@; 9p%h,:VWSh:褆 h :VWShL :菆 1^_[ù1@t 9It1ùtA9t 1ùD$9Au|9ËD$|9SWVhflhy1$hWVj 㹔g3WSChWWh@Wj659WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW|9tI1r rr2d0u&1q1ur1ۃ0݃er @뜃|$tB eBBe^_[]USWV|$D$L$BJ 0uQ=91۾{N&-9B0t#1urF|9tu99u'Cϸ99t0|99t90 59|$Q-jVPh5p%W3%^_[]WV|$t$ Nt tuhp%Ckp%p%2t %jjPWV^_USWV|$=:t h :j;WWG:u :l$}QWVhg%hU虃 1PP d ơ:t3Ѓ<PUuu#D$=ueߋ$$$t:P{jۉt{uhp%jz$t]PUhp%h[Z$t:hhSjP2 jP W V jUhq%h Vi Ve tP$t:Uhm$hi jj7ah5T :*1@|^_[]Ã=:t=:tUhAq%ju C|91$t:Vt$hd+%VY\tV:t L :X :^t$-:u :USWVt$,VBZD$j$t$Vo5to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44YL$|$)L$OGj$W5DžuD$@PPDžj$t$04|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$Vu< 1D$44U豌 D$44Y$D$D$ j$S:4Ņm<$t$ >tV\$Sd VX$|$);\$u ^_[]hu%hu%h ht%aSV5g31/t.T$ g39u9t |9t q/u^[V1ɍt$QQPVhGq% y1t1^USWV|$(1$PPWVhGq%l $D$(1PPWVhGq%3 Z$LF1d$Pj%J4$>$'h}d%$Ueh~.hhu%ehhUdW55T :GD$hjU5T :ZR 'PPqhVjU5T :)VVt PVW WD$ P9St$5T :Q 5T :.5T :Sjhw% j D$ PU UWh$%c D$(SSWVhGq% $j葾 h$%fMuQ1AtCjV u4Vh#v%"1ɉtjV uVhv%j) D$(SSWVhGq% u$~h[q%jTȁĐ^_[]1USWVhhau%>X :tPjjhvq%311::::::g3/u D$8g3ڃ9t|9u@:Q/uD$/u.::19haj g31@|$>Z|9M :L$ :L$j5<5<L5<=0:thr%j聈0:::6P5:hq%jaa:Wj b0D$ttRN1ҋ0t1t /u oBrg|9uƃ|9:1|9uAuVD$u,D$ :D$:1@|9:^/ :F::QR5:5:5:Phq%h` jj\/_5T :]19tvhq%hu>h,_t$FVj.~thq%j軆hr%j謆h:r%j蝆1G99thVr%jfh %_L$QPu{hor%_$QPnuYD$3$L$3$ t?htr%hr%Mft!hr%jޅhr%hr%a迪1=0:thr%j訅0:]$1L$VVPQhGq%L }t|$ th[q%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h}%h+s%{at@Ƌ|$]1Phs%S9 4$WV VOhc%S^_[USWV-i3ta1Fi3t&U7Jd1tUhm$h] 111Fo u1tjh1@1^_[]Vhns%]t$hPVD hh9V! x(9ƀ9hs%Qcn j/PX*@}s%:^SWVhs%&]9hPV VN9K5:X99PVhy%hWu jWh%4#2 hQV[j< 1hhs%WWhQjHj j j jVWW$94ƣlj3WP*lj3V9WZ jj[t$59hs%WV u hns% \$WPS S踗SVj jjZ1@^_[UWVj WWd/ W |$ hPW6 j W{(tZ: 9tV("RWQPh%hhe^_]1PPj<3 USWV=$9uj5o3 ǣ$95(9uo3P>ƣ(9^V= 9~GtO 99W0 WEL;9t1(9h-Y $9A j 9$9$Vy y))L$H 9Jx .@ SPt$ D$Ph9= 9-o39|uP5$9 $9QjPiW P5(9 (9 QjP0W -o3D$%=@t=ut-$9D i1$9D8 jt$h %t$c = 9-$999P2  (9D G= 9V V $$$9B 9fJhkjQP/Ą^_[]VPt$D$ L$ $tt$VPAy X :t 4$VP+y ^PD$L$ T$$RQP XUSWV$01D$$h+s%WL$Phm$Q_ hs%WL$Phm$Q7 ht%WPhm$Q 4$NP=hH$t$ t D$ t$h"PED$\$t$ hS| tt1h#S 4$0PHP$4VxI u <.=tShm$t$t t$ hSC| ut$ Gt$G4$t$ t3h0Ut$FVj$~t$t$Gt$t$*1Ʌ2jQ#D$t P D$t P Whm$h3CU jj$T5T :i1N^_[]t$ Ft$ FV)11N4$t$t$ t$ 4$ VD$FVjw#F^SWVPD$$h}%h)t%Wt@Ƌ|$4T1Ph:t%S 4$WV6 VEhc%S]^_[hZt%h+s%St%)1ۅtHq"t]q" 1ۅÉ[USWVh# Ph D$1Ʌ$l$h#U%r ti\$WPS} 9s?hh %S& =w%hVS =wjS t@h#Uq u4$R 1jV^ 1Ʌȁ^_[]4$$ 1AVt$VD1|TsrLc1f ^Vt$hd+%VsFtV,:t :T :^WVt$ D$wǃr9t\q/tSPQj4 V5< 4V5T :3V5<茦V5T :}5<O5T :A5<5T :^_WVt$ Vc$ u.>vS0"PVWht%h3n t%^_WVt$ 0PprPGt$>FFVj F^_SWV=g3/t/t$g3GtPVDt /u?É^_[USWVj$t$ %1ۅtKƉ|$\$FUShSSj WVM $Vtu;D$ rj$Vƅu1؃^_[]VPT$ D$t$4$GVP ^USWVӉϋl$jUtMƅtPt$Vr% S3OVUP tP׃S.V%^_[]VPT$ D$t$4$VPv ^À=9ua9gq":5u%:?u%:E$: I$:&q":SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP" $LL $UT4L$ L8L$T$T@Lƽ$$hVWU~= uD5<w |5L Ku1PPD$P苳 )ƍD$Phd@VW. |$D$|PhedAV/. Vf$1 GaD$P$,hu%t$V( 1PPV軲 $C]su PUhh 9t$胷t.!9CD001 %91 u= 9tZF9|4$%ja$,hV%$0uv EPPVn jOhH9D$4P} D${O1ɳ$$uƒrL+1Ht$,D04$荲t$$,hV%u EVPh]$P EtE @E w-G$9@  V,؁^_[]1D$L$I@P|9wʀu9Au|9 |91USWV$$1$hWVE E jShWWh@Wh59Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur|9A1ËD$1ɋ0t1ur|9A1USWV ։D$ $E1$  D$$ ,$D$0v% $EJv%ufv%D$$?v%Yv%uv%F\$$:k \$\$$&HD$\$$)|$= :=4:=:$ <$D$D$v%<$q|$4$D$ :D$% |$D$ :D$4:D$v%=9u$ByD$1Ƀ o3\$pj3C|$D$$$%$D\$$({|$!<$D$:D$pj3{=o3$r#|$l$ D$D$v%$kljl$4$i K=9u $fxD$|$D$$.$%$C\$$'|$u1=R:= 9=:$ <$D$D$v%<$t|$4$D$ :D$%. |$D$ 9D$R:D$v%$juLl$ t$<$D$Vy%i$ \$<$D$y%i$ l$4$h > ^_[]Á=mm3ftp]pg%=m3PFSWV|$ty9GO4VSy6tRVL t{S599Vh959h_%hS[ jSh%4#s fGlj3~"PptV}V]1^_[ËD$ 9Ɓ9 ,9fH 09fH1SWVt$99V~)S4:Q F,9F09F1^_[ËD$L$01Z5fSWV1ۉShPS$ tD$$P% t VgC8VS C81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3V聪y 3B81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë= :1SWt$ t$L$ T$/D$T$SWt$ t$/D$ ׋P :t$ t$(2w%L$\PSWt$t$,t$RPPQW $ :1WSt$t$@/D$T$WSVt$)/É֋=P :t$Ht$H迍$PWVSt$t$w%PPPQMW $VD$`Pjhq1@USWV u C(D$|$8hjW; wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ'|$D$u$T'B P'BL'BH'QP׾X'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿȍ'HQQQQRPRPjD$ tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ R)L$ tEH/uj#EH@EH`L1^_[]/EHjSP> EHHLSWV t$ vDhK&WSbN 1WSSPPjjh= SAFDNHA`1 ^_[ËL$Ahh1USWVL$Ay#;(9~(9h.0L9P#;(9~(9jG 0<9P";(9~(9jH/@9P";(9~(9jI/D9P";(9~(9jJ/H9P";(9~(9hr/P9PZ";(9~(9hJ/T9P2";(9~(9h"/X9P "-(99~(9ŋx$t;11ۋ@(48.P!-(99~(9C ;X$rɃ-(9\$h|$lCD u9kwi$'N4F8hv~4l{89F FN$Nj5 :QP T gvrvvww*nw5f|5D9Uh5x%sFH@Htht&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPwYGX FPv3t~C $i)ىQRPW 1D7D77qfD7 D7 4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A nOu\$ 89fA |$tAqfAA 1AA tAfAALJ A )AufAA) 91jEVVhyhhrjJVjVQPh94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch %PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]hnw%hYw%hlhw%b!USWVt$ kFllPvuNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ / 1/D/D/D/ n{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWVt:t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$'t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0GP :GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Whw%Q [ t$$|t%L$ PSƋ|$ Whw%QZ t$St-$L$ PRVƋ|$Whw%QZ t$ "L$ PƋ|$Whw%QZ t$PSVW :D$D$] ٹ}$L$ |D$ L$L$<1jPWSRPhC$j$Pi* t">tt$ Vhw%D$DPY D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$Pz |$YtZVr MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV. )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ :}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP  $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋ :1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VStD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hC$jVm% C `L$rL$DPhw%uL$DPhw%jQ0% D$D---D$D$sP :CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhw%P0T SVhw%PT VjWaSX :D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hC$j$P# t"?tt$ Whw%D$LPPS D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD $uR1jPPPhqhPj jjj%VjMF4x!t$PW0Va1@^_[]hx%hw%hhw%xWVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ ('N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; H'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jSG t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=9t@u.1}hGju tEx z%rtz%tz%M u@=Uu,>t'D$ L$t:;\M`|ˀuK(Ѓt tu tPjbjW WƍD$(PV$1 $$QPV|V $VW9$ul$`=u]tP$PSf $5fǃU'VWWhm$hz% uQe^_[]SWV0\$@1҉1 F FFF =9tjP4D$VjRRS0<^_[USWVt:(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hz%jkt1e^]USWV8=9EM 0~klP1 ËE E8؃lklQSP7 ߾Ԏ't:$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSz F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h%h%heh[%nUSWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSWP L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$ :u s :D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$l'd$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQP{ T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$( :u 2q :D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$|'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQy |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut %1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVw >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDs l$(Ph%Uj h"U [Ɖ$Uh%jYu D$Ph)%VFu wXw\w`hM%V/uPwdhd%VuwThu%Vu f1ۍ{aE4'WuWuWh%Vt E< t<uEMPWQWh%Vt$<I}%9|2#PVwtC9z1hc%WTtV޽ D$PD$Pt$\$4Sh%h%WS1(^_[]h%hi%hBh%hi%h1h%hi%h hʀ%hi%hh%hi%hh[%USWVhj{{1O1ۍD$ShPS$4}}9+ōF,PhedAUQ l$$4$0$($<$8у|1҉$$dp F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Qr D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$3$$h́%jP r=t31>t9>u 9>t0uk9uV.V&OVU31@19$,|;ЃVt$2؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'u_m FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h%h݁%jg6h%h݁%jh(h%h݁%jihʀ%h݁%jj h%h݁%jkh[%D$T$ L$DrRQP-o ËD$Djt$ P USWVl$j/U 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=9ui"sv<9 : :tx(9w4Ju1AQPuã : :H :k4+$1 4+VhK&jRg 1D+ <+ hsVPh:%jW: 1D+'<+(D+($D+,t+0^_[]V΃=9un9) 1t(@"u :t :9t 4Hu1^USWV|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃= :u ^ :~V19|(1@@89|~@w1A^_[USWVP= :|$(L$111='"\$uӀt0t u@tӋ;\'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0\' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh'hT9F T9k9D11KjdƃwDh'DtGCuޅtH= :PGd :t)1ɀ<t d'AuVt^_[1V :t( :1t ҡ : :F9r :PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hy%jQQWRjjh%(,1^_[]USWVhu}WWPHD$T$t:L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhvt:@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $r#1ۺL$#PWVSh0RQ t$kPW$r#PShPV t:VL$'Qt$t$t$ t$PPh`g$h%$Ǻt:$0Ͷ$t:$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCxffC C CfCC= :rC fC*C,G1ۍD$(huSSSSSSSjjWPh貓48P胓@,wt$VWrW膔FuQ1K589mt Pmt$A589mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h %h%hyh%2USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$r#PWVSjh\1U5 :|$ ww,$x%t$R5P :RPSQVs U5 :w$w l$45P :RPSPUB G\$skhSjPD P迹Vc9j!h?%V V訞h裫Y%L$5P :PRUQ hv$5P :PY%PUS hKPSD$Ph`%hh<9c 1҃9Q9A \߉$4PWhA$j$W hWh<9{U Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,9$EBL$ ;QU<9Vhr%WU Vh9WT h%$&İ^_[]USWVX] E81h$r#PPPPhw%PP= 9_ vSL$QSWPL t@D$ tWD$8uN L9uhƩ L9D$9H*h$r#VhA$Epd+D$8u RPt QPVW҃ :1VSt$t$"D$$VSt$t$ L$8QRPt$ t$hw%Ep/dD$V9p1h$YQVu WPTtY$UtOwGD$VP›)vVQj P˧ W@ )Q$YQPxR H LCF;puD$VPhm$Epzc e^_[]USWVLt$`T$d\$1*kvs0C41GPjhtq3  9u vEL$QVUPL 1hPPh% h hj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 589c_|$.89L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾ'D$ǃ@ܑ'SPHD$ $t:L1OًP|T$|$`1 |$0jP4D$DD$ :|$ 9ϋ$|$1HPPVt$t$WRQjD$@ hƄ%VPWhZ%jڽh@%ShPW? hA%VՖ1BP$hք%V趖Ph%jy hՄ%hPW? hք%Vtƻ$q3Wh%hU贯 1tVUhZ%juŃ|$tjh+'$Ą ^_[]USWV ։Q 1Ht L$ L$$Wo; $f} r= jh%U贈 u&USh%D$Pl uhg#, W; Ņu>L$4t&t u$Ut$ t$ h%jt$_LWb $ ^_[]USWVՉfD$/D$jh$%>D$5謔t&裔8t虔SPh%hU VSU= 991j/U~t t5ÍD$9tK9vH8/t@PE CߍD$ PWD$%= h$PW FƄ$/u&踓$QPhy%hU /h$PU< hh$%U< e=@uWD x*|$VW$Pf< 9r>J??0|$Wc Wj"01Ĉ^_[]hU t}/u }$$tcD$UWƁ`|$tVh %Ug< 9=VWUO< 9%|$W x(W7P>1F1S60jh*#j SWVύD$ PQ1xVD$)tOjWKx@ljj PW W  u $=rɁ uƉĜ^_[USWV h讐ljPhW@ju \$hjS蓏 jh%D$ƍD$ PhW@Vsu t$1hUSF ,$'tWP̄u-P9D$C :E,$ !u1L$PPPPhtjPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@'VhW1|t FT91@^ËD$ P9fH T9tPPQQQh%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺|$L$~D$<P t3$r#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$r#t$DRQPhl%jV D$ T$Bj5 :QPv~$r#t%t$DQRPhl%jV踦 D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5P :t$hy%jt$hVD$XP1WWjjj0賕, :|$4D$0t:L$QW<W,D$DPV[~ljӍD$DPV苀|$߉څu D$$H؋Pٸ"D$<hp%t$J|$,] {t+[1h %St Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hy%jt$hVD$XP1PPjjj0?,j D$DPV<  D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5 :PQe'|$ RPhC$jW菢 ;P :CVDSjP jPPhW9 2 V8@(^_[WVt$ 5<T5< ~$uFjP59F$1O~(1hW9QQh&h%hRjFj WjPv$hX9{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$= C{$t%K0 u G fG lJu'fG G5Gl2G G, 4G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVh%jPQܟ 'u tEj,j+荅L$jPPQc/ h2#7j*fL$QjPT6 h%$j-?t$R5P :Ph]$jFVZ j.h'PVhs%hhX92 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5 :RQgvL$RPh$jQ蹞 G<(\(|(Pu#]j#]L$>PSWh$x%j&Q%j5 :SWvL$t$>QRPhl%j&VU $F|(,u)|$hgPh%j(W" <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh]$j(V轝 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%vJ>t 4$@;|$|$upd^_[]1؍L$>PWh%j&Q$  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V褜 4$h^VjP lj|$D(dph-PVh%j(WQ *USWVt:$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvát:H1WjHDWWQZơt:$1$ t:@u <@TX uDHXT= :tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$r#WRPPQ1ҍD$*W Q$r#QRhQPD$$W Q$r#Q1Qh0QPa&)ߋt:0D$pL$$QL$.QL$QPt$SPW/ t:0uNjpfL$$QL$.QL$QPWSSj'B0 h%$0+|$pG$DŽ$$T$0<$tT$@BfBBU6ffJ B c6BfJBq6B fJ*B,6= :r~(uB0fB:B<6@1L$0huWWWWWWWjjPQh\4t8P[@,w$PSMS\$X(؃u t:TXK$'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h %PpT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5t:R t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh %D$ Pgt5hp%t$ zgu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0 :)ދ :\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(r L$)։t$ t$A5: 1Fh4%h#%h]h%8dL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S  tt<1^_[USWVGD$5:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1 :9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX >AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}9k<4LE1UЍe^_[]USWV1 :T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=:t*=p-:11M<t9\@u 9DDMHEr=:tOL-:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=:,:J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@p-:D WVu)y8u.q$t"y8uqxu Hu^h #hp%hm h%0KD$x8u@h #hp%hm h% KV (:; t:tD:t99t‹9u€:2t :^WV΋$tRtt tdjhX"W> tvjhE$W> jh &W> Wh%h"r Wh%hr tsH@#Wh%hq u`tQ0|@yu):9tЋ9u:0u1H|$5:,1C1҉T TTCD {k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D {$k%h.[l1,:D$ $ 88Ƅ$48ntyPhT%Ut$%VXM PV$ P ,:$d8ntyPh[%Ut$%VM PV$ Pj ,:$08h"t32#Phy%Ut$%VL PV$ P# ,:$t8ntyPhb%Ut$%VL PV$ P 5,:$,8U%t4Uhh%ht$%V3L hV$ P 5,:$,88U$t4UhG|%ht$%VK hV$ P> 5,: $X8l$~4Phi%hUK hU$ P L$ 5,:\8~~Phu%ht$%VYK hV$ P L$ 5,:`8~8Ph|%ht$%VK hV$ Pm L$ 5,:h8~8Ph%ht$%VJ hV$ P' L$ 5,:l8$~pPh%ht$%VJ hVU L$ 5,:p8~1Ph%ht$%VAJ hVU L$ 5,:7 878h%ht$)VJ hVUb ,:t$PUh%h;WD$,:ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=:@D$1HD$$D$1i8-:$P5:\$ "$x 1ۋWSPQL $($0}U$WT W+!|8/tW!fDŽ/-: $< R P$PW! t $L|$$t0|$t)$P t$ 9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4=-:,$V%  PVh%hD$)PEG 5-:.$r#t22#PSqS >tiD$Pt>Sh%hfT$\$ -:$DL$4L$0-:0|]t$VPh%WS -:( ( PQVh%WSt$\$ CCa5-:.> >,>(>$> D$)Pt>Sh%hTS$$(t$,t$(r 9t P 91`9tWWhB%CYWh%h3qI 9t8Wh%PYI 91NtjhX%P=I ^_[]1N =:tt$h%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ t:V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$u$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx90^_[]h #hp%hm h%%USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tI xL$<1$^_[]USWV4T$H1z$X11D:tL\$St:PQL t2L$ D$; $…u $;Չډ $ڃ,ut B$Hrt)u.$CM$։$B(r,JֺE$h0-:^~x14^_[]ËD$1A1҉PPP PP@ HH $hLRP USWV l$8fD$-59u61ۿ'P9މuڃ59J\$<|$4$'h4 SPVhAy%Woh5aǸsu8j5 : L$RPhC$jQI7 59h6oh71PPWVhAy%U4du31PL$Phm$jQ6 59h8t)u D$ h&r#jP{6 59h9t)u D$$h&r#jP:6 59h:zt)u D$(h&r#jP5 59h;<t)u D$,h&r#jP5 59h<pL$QPVhAy%Wq ^_[]USWV$@1K $ $ؖ'_ 1hSSVVjjh=p$  /t$l$ WSU Uhd%WS5 S |/D1l1_t:, 1>WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&r#US3 1USSVVjjt$" S3| xL$1^_[]WV|$ 1uOG P t/1; }OX"h,:x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h^2t$hPV $$$'D$@{tUhu%V USVu 8Ouڋ$xhLuhMSPh%V}C(~Ph&r#hV1 }hNHC,~Ph&r#hV1 }hO#C0~Ph%hVi1 }hP#VPh%W)^_[]USWV$r3u*11IhuPPPPjj PQQjhq3P4r3Nw'$R($'WP\1N1jWWVVjjhQ lS, T0D$4h&r#QPr0 1PD$PPVVjjU D$Px x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP` Qkd)Qh%V豲 ^_USWV$h^|$hPW; $$$,'{hV VPh%{hWvvPhlj%W[hXp1~,t[hYS1~0W[hZ6ǃ4Vuh^V0FT~Ph^#hW*. sh[[h^1~`{h\vXPhӉ%WF\~Ph%hW- sh]mFd~Ph&r#hW- sh_HFh~Ph&r#hW|- sh`#Fl~Ph^#hWW- shaWPh%V/[hb1~pPPWh%S^_[]USWV$@1N R$fT$`' 1jWWVVjjhc|Gl=Olt:,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&r#QP+ 1PD$PPVVjjU D$POt x1pGp1^_[]1wwVt$F~|F Pt1@1FF^SWVT$1ۉZBr 1Bl@Zp講Qkd)Qh݉%VH ^_[Vk<44EB,0u|$|E11NT$huQQQQjj PVVURh1q49t\ljPWHW\x=9}9kk<EA8u¸|E11NT$huQQQQjj PVVURhJH49t=lj$\$SPW.x9}ku L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h%h%hh9%lSWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$ȗ'@21^_[Ã!t*Wp1@<QKWPV& rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ Z%D$ PN D$F,N0~8V4t( uD$D$PSWRQt$(hF%j$uÍD$PWRQShn%j |$Mu'%vE4tL$Ph%Qn D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=:$Whp%jP 1t t^_[]Ë 9! ÍD$XWh%Pj1~jDjjtD$$2#Vt$\nVjnD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h#W ƀ8tt1tCuVL$ D$ j jVs É$qj jVs t#D$Zj jVs D$T$C\$ \$D$|$u\$uthhu%S* hVS \$E61ۉSt$,j SVs É$ tbD$ ʉ $tQD$ D$tGjhB$t$}Vr tOjhB$Vr tdjhB$Vr te|$ush2#jlD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j hS'l$}Ur hj蠤$tJ@j`PQT$ T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;h%h%hh9%] D$phƐ%j iSWV=959t^s3ߥt#$t$j(PVs 4$蝣_u9hsj|$0VPh]$jxW WVV &t Ĩ^_h1&h~%hh9%o USWVσ=9u h 1t0?t+9t!-9E WP tt/|$thh'%S9 !hvS$ u4$$$$$St$hݏ%j ^_[]SWVD$Qt$Rh%Pj h2#t$]$jh@'P uWh2#j]$tAt$h#W7 8tjt$2h2#j]$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh%S h%S h"%S h(%S h0%S h6%S h=%S \$h#S2 ǀ?t(+$'WPO uE F@j`WV -j(WX tj)PG t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVUG |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&r#WU WUUjU@ H>wѻPD$x0h&r#SU SUUjiUL@ H=wˉt:DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tq.9Vt$ 9u W. 919vFt=N-:wu1w-:hZ:^ËD$Hs-s '.h #hǑ%hh%5 Vt$ =9u-(t;u2L$ rȃs'$tuPP:1 hZ:m:^WVP|$t$=9uI-j PVk =v1t-h;t -:t4Ƅ-:^_Ë $9u։^_-=F:t|F:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWhX. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jhT-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$Ph|H,1\$}UM;t;Gs} Sh%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh%h$P $L1QhPjV變x`WhydP艼 D$VlB|$t;jWS) \$;MU}h%h%h h%g 1e^_[]RSQ Shi%RQ# ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSҴ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H-:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SUZ @$\Cǃ1:k0hWVi D$4WhPW$XnpD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(+tÉ|$UFd#D$0jPUQt$(+1 Ⱦu#\$,hPt$ 藒 Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P` P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P#tn{ C K$;}sL$4QjSPL t_D$HtW-:)1ɉAw Puu2S"j@jP0 fdžUS#p1ۉ؁4^_[]h\%h=%hh%3 USWV4D$L D$PhjiƋl$X\$T|$H̞'W-^ F|11Kn^؃N$F Fdž?džjh>US @džPWtwt%D$ D$D$D$F114^_[]h\%h%hh% USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPW2R D$vP6R 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[hl%hP%hxh% USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7!15q:5q:5q:D$D$ D$1D$h%WUtq1.SPt$ L y` 19u2q:q:)u= 8t1FVhd%1FVShr%V-6t$DD$D$L$D$ L$ D$|$tvD$ P=ƋT$ уƉǃtωÁtt؉D$ u 蓜 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj ~ UQL$ɋD$tP V踚 P@ h$r#PVh%h3g j V jV jR @ VPv^Ð= r3u b r3q:@=u1HP 1; r3USWV}uCjhq:F q:q:q:q:q:q:q: q: q:q:|$(jWOF 5q:5q:q:q:?X+=q:q:@1;q:)ω|$$\$ q:95q:T$s;D$0q:D$(L$, q:q:q:D$q:D$$D$ =q:EtQ1$w ww7wwVWVF 7www ww$PWj2 M$q1~~~ ~~$PVj 1@F ~~~~WVWcF =q:B5fDŽ$ q:t$Phm$hQ 1Fq: q:ƒ\$\$xT$T$|l$xК&ݜ$݄$ p&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Why$QPI q:9|ӡq:tPL$ڈ L$)΅~DQ4))h$r#Sh<'Rh$QP̯ Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4$'QPh$SWS L$(+ q:T$,q:NjD$0+q:x@B‰L$hT$ll$h\$@q: q:1F؃D$@5&|$vqL$`\$dl$`К&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4$'RSt$Dh$QPխ  q:q:ȃ||=q:q:݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h$QPA ƃ}u 4)h2#QP ơq:@=u1H$VQPt e^_[]+q: q:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h%TV 8tL 8#u$SjVb tGtV $1E48FB$)Ex t$7@[h%h$%,Ҏ h%h%軎 7h%h%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh!"jPEuhĜ%h0%{RÉhPKt4Vh<"jPMEuhĜ%h0%-R1H^_[USWVp $$$!19L$PVW1Hl$UK} ƃU= VD$PWa tb$UtM$dt谛 $dPUp t$jW\ tu)$-j4'WU 1Hp^_[]Ë$j-UP3 D$L$PjD$L$PjSVt$ t P닆t>PD9džW1ۃ1ۋt9PlDdž- t^[V肋 V 1ue 19^SWVlT$|$$VPC1Nt/ǍD$P;{ PSW- t W;l^_[USWVӉjh0jQ ǃt{jjjV L$ F[I#t$r#V=1H^_[SWV$uSh%hD%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8  89h%h%LNF G8~ ~u3FVh%jv S?uh%h0%3Lt6hWv  t%uhЖ%LPWVu  s V^_[WVp׉$ftPh`%hD%K jL$PQWX jjP PjW tnjjW t\PjW tHD$|PWV t2Ph%jp >u6h`%h0%J"h`%JW h`%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW3jWx35^_WVPt$4%@5@u^t8tW%VO$%8Vh+j?#45@u`V,2<jP,I u h%G,dž,sh%|Gj?3 t1t3u5O$0͔$ a$1Ph%F ͔$ a$1PWh%F^_WVt$ h#pG8r4@84^_8t8t uh%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh&%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP( SUhM%F SUh;%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Po w_ǍCWt$PR ;)QjP{ h%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQh%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYh%Q肣~PtVAt(t NLt }#tv%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph\%;G$C$G>C>>-ك**PWQJ WtHAt[ƃx t Ph%%p;<%KFNtTHNUhE%;$w 1Ow 1OOWt#QWtJV<1V\$ GtIO9tA t1Uhr%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Phٞ%6:11BU%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhS t$h%h%9$1Ph%91F\$ MbihS$( EuVh%?9ut 87t t 8 uF띃tVh%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=q;uFGGtIO9tA t3@UUD" ;WQjj.>jV(t0<t$VtSB< t<=VS= h%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/r 7 Vh%h:7#!7T$1|$`F(f9t(~ tωӍV QPRh%6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$ShD%6 <PUt$WPSha%5T$ V>t*4$QVD H^_[]WVt$4rDD$ tN8tCt;D$ jP,$ u!h~%h%5 j-^_Ã~+ajjj衶 ̓kh%h%h%5 1m9h%h%h%4 <6Rh%5@h%h%h%4 111dh%hə%h%w4 @+X1BWDPU h%h%h%14 11G1=q:q:6u P9W+q:zhؙ%hЙ%h%3 t0S vPh%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VQ` tE9u݋D$ 9t9 u~<$h%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h4%W^ .hE%W^ !hU%W^ D$$D$he%Wd^ |$t$<t$\ ǃt1Fl$<4d\ GF9uW$t$<l$U/\ WUD$P  E t=1FߋD$@D$P[ Wt$U EE F9t$%E0V[ @PVU,Mj/ljŅu <$1EWhn%/W 3|$D$D$D$ D$l$@Wh'h%UV)jM,4tN6urD$̓o%kt?nu1@D$뵃Nt4Uu@룃pt.xu D$D$넃|1@D$ pe\3$rbD$8@#L$؃ 94$D$t$4t$j%W|$47@D$D$4tۉt$t$@D$ D${ t^$D$9}*s |$ D$@tVv[ t|$/@Gu݋$;D$ut$Sj谑 D$t$[uD$L$jPD$@p  D$4ttq$@D$ t$ރ{ tV$D$;D$}*k |$ D$@tUZ t|$>@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]wh |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWY tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xh%WW h4%WW \$,hVSa j ǃ0%$r31O$$0@4jV9u11@PP$u1Ajj uD$l$(D$ D$D$$d%t%Uh'P$V?u$duiM)4tQ6uD$ 럍Hv H w?$d'l =$\w$@'D$ә%D$[D$ PxGD$%D$2 $d 1@D$D$D$$h5l => $hD$%D$D$̙%1@D$x ˀD$D$FD$93t$bS{($h($$p$l3)$艄$\$,Su1VVVS6$U$PjSA\$h$%薩 D$93$4$|$0W ?31VV4Wo6&$$Pjl$|$t\UHrBPt$hG%# t$\$ SgR_ 8$U\ $`$d$`$d3T$ QR$4 $$`hq"h"%l$,<$茄D$ t<t,<ulhU%ȥ D@Ug uDh7%袥 LHUL hD%耥 TPUCs D$1D"^ Vh""4$hq"h1%"D$1Cl$,$bu Uuhq"hʝ%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PM $ }$nUqq$VU# U+A$;$r3t P%$dP@1uh۝% !$dt3$Xt'L$jQPw uhq"h%#!$j"$hh(3. $$d ؁^_[]Ë$r,u'3Qj$4 $u*$`1PQQw $$c@u h~%$VUI h%$`5 $d$`$dUh|`jj$=t'Uh`j$($}hq"h%hq"h%D$L$Phc%U$"h#(Z 8thq"hΛ%3$`Z L$aWZ 8 S$`$d$dl$,hh%i u! Z 8th%hq"h% hh%1 u!Y 8th%hq"h%^ URtUhq"h"%Uh]%1k$`r;$d@ щ$`$dUtePhq"h%KD$ Pjh0j, hS2#yUPh7% U$`$d҃ ց uK$`$dr>1r3$L$ QPUM W$`$dҜ%r 3$$r#$r#tܜ% t%VQRh0&賎U{\$,1D$WhPiu h%Sh&]j$$nuhq"h0%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u1%%$4PF$$9|t$t׃z Ru$dh\%P_S[$bhv%JhF*&yD$ L$$$XP蟾Uh4\j$d$ uhq"h0% $dh%|$dD$ L$$$XQ Uh4\j$d$W uhq"h0%7S$D$xhq"h%`_hߛ%hq"h%9hq"ht%*hq"h %hq"h% $O+ Ph%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h%PJD$,PB't#%@tD$,Ph+Qj$dWD$0P"0$01~ tVh5jj$$vSQ WVjhwt=D$|$ffN(ffOfuj4 ȉG_1_F*N>QPS  F>)^_[USWV$lt pvhR%PWj t=wM$lDGJ 8thR%hm$h$u)h%hR%hhf% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U9 =wfD @PUhhR%W=udh%h%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF Ph%n tt {>u[[ht hӤ%? ~>t$fF(ffCCN*V>RQP F>4)mC Ph% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#G 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]hX%h4%hGhf%h4%hHh%@ D$tFL$tt 9Jt +G  G 1HBH@M1@hX%h%hh%i@ USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;vRF 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$hX%hإ%h h%hإ%hh%hإ%hh%> L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]hX%h%h|h%= D$t L$HH@LhX%h%hh%Z= D$t@LhX%h%hh%4= 11WVD$ t!L$T$t$|$x0p4P8H<1^_hX%hĥ%hh%< USWV(l$<\$߾'1|$ |$|$<$E4t.1FM0 I?rC E4  G9rՉt$@Pj1 1Nt91D$ D$D$D$9E4t$1E0jS4A t G;}4r1(^_[]hX%h5%hYh% < q:tD$ q:Qq:q:WVjPj1tMƃPj0 t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PѩNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =q:t'q:H q:q:N8tv 1+hX%h%hh%7 USWV ύ\$Sj, CƋG|$1ɉىT$ 9ڍT$RT$sӉىD$ T$t$+rt$y" tD$ʚ; 11D$T$z T$tUʚ;+T$T$ _)ús1҉W_w +T$stK_t$ w W ?u G D$T$BD$L$Je^_[]fPL$T$ D$$PXUSWV ։ϋ$ =,v3t:l$ }; ESVhU+T tp L$PQ5,v3迢W(v3s>|x| @t,'\$$3SVU\ Uj b (v3 s SVW  ^_[]PL$T$ D$$PXUSWV։J< $VhUcS SV PUh:7#W< ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,v3ËD$,v3r SWVhS$  1OtFƃ ||t : +D$HP0v3Phm$Q] 0v3^_[á(v3ËD$(v3@P )v3 SVt$  hjh(r3h3(v3 s1fà 8 jSP  t: V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhj t!jhj 1ۃۉ^[ Vt$t'PWdžtP9dž^靄D$t$t$t$ SWV$hjW4 C jPW Whi 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv 7 7 7 V1H11Ʌtu $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0 VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV1 Fjŋ$@VD $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP& tًv\$~;1$D$0Ptl& tF9u19D$$"$8ЃD$P1~11TjT$4R4螼 t GP9|PX~11\jT$4R4c t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh<%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PV CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0# R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWhh%e$_w ɺ@r <t5<(<$L$ 1@ut$hh%$1@fG(FG>O*VTPRQ. $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVW^ w_ jVSJ r-/ 1N^_[]j:Sr t/@1UQhQQj QP G8mt. (G8GjSP O t 3DPu:pKCu1l$PVhVVj USP G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjSG* F jPS WSh~i1 tD$Đ^_[USWVPƒ!D r: r: r:r:h%Fr: r: $<  O+VQP! 9v1 LJ\$ I;<j,jU@t ǃD hs%Vj,j&Ht ǃL hs%'j,jPt ǃT hs%t$$Wh'VM D$9rhs%h%[H$|$ 7D$PWD$t$h#D$P~E ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0hs%h:7# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h#D$PxC ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h[$U= h%U' hK#U $D1)h%U 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPdc t6ʼndt$+ `Dd<t A`Nhs%<$Dt&u"t$ $<$ 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U'v tu;uHUh%'D$uuUh#t$$t$$P't$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPUB t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(3|$$t)`#L$# $ 1CƋl$ \$18%s%Sh'Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\WQ Ê@tC< t< u CCu1j h\%W j hh%W jhu%W jh%W jh%W} jh%We jh%WM jh%W5 jhǫ%W Pjhѫ%W 8j h%W ?L$P1T$XPfL$T$t$XVY(1Kj/V uD$|$PjP5 L$r L$rL$T$t$XV'1Kj/VN uD$|$P jP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$r3t PB11j|$\W6!ƉD$V茼yjW t>tht$Xh&% |$X t$1VWhWWWWt$t L$PA 9>t$XhE% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/P tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$tǕ L$P9>t$Xha% L$P ЉT$jt$\# h%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$t ,9h%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t L$P9>:t$Xh% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP h  L$j ZP< t< lGG|$Xt$P$ft$Xմ $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|t 8Ut$Xh(%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h{%@D$X  y@Uha%D$P |$X D$P D$P D$P |$Xn$6t$Pvih%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xh%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]Vh%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t肌 L$P9>t$Xh%|$Xtut$1VWjWWWWt$tA L$P9>t$Xhɮ%D|$Xt7t$1VWjWWWWt$t L$P9>At$Xh%Qh% %P C t$Xh%W à \$S螮ƅ|$PPh %SV!  jvVj/t$\ AL$1|$P# KD$ɋl$t t OGuh"% N|$XoE1j:WJ l$t2At$1VUhUUUUQr 9.Mh1% j=W  ED$(@1 t H@Wh%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVh%>nT$P   xUh%=D$(h%J h%Ɔ <hA% D$Pǀh% 1K$dVhO%D1DDD DD.u h % 1D$(1h $Wjh%W1xhb%WhXD$Wphh"WZPh%WDJh%W.hG#Wzh%Wh=#Whʵ%W h%W> t$ h%W h%V h%Vs h%V] h%VGY h="V1Z h%VT h۵%VE h%V6 hԵ%V' h%V h%V h۬%V h%V h%Vk h#VU Vh%  t KC  t KCWhQ%Ɔ  xt$P1$ƀhuh%XttC< t< Cuhk%0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%Wu t-h%Wc th\%WQ t h%W/ t@Ch7&V th%V D$P@ tsFH t t@@1 t H@ttC< t< Cuh%Ƈhhk%wsF< < F1$SUjjN tUh%1C CC"$f8l$1USjxSjSSW訁 $D9]$ƃWh%ttC< t< Cuh%Ɔ L$P1S=flF D$PVE@ ; 7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h;# 1F؄t  H@hJ%1K؃<^_[]ù@D$PǀǍ0PVjJ wh%F -{]< < Ch%G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWS5} L$P9>sSh֫%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/S tIGC1L$P4 1D$PVSj2H u7tb\$1SVhVVVVW{ L$P93tQUh%tGSh%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uhޭ%j?suh%ItF1tC< t< CuhG$Wt)WC Åu"=1rWh%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP{ t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8UJ ljD$FWUPv >)QjP= 1FFL$TT$`r|$\s72USWV׉ˋt$$V >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P( T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$PҊ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vJ 71M^_[]USWVՉϋRߗ j=Pj ,$|$D$ V 1ۉ\$t?t9D$ 1j=S( )9uWVS D$\EuVި4$N t5ƍEjPt$ V 4DL$h%Uh%h&% |$$t#4$ܖ tzSRD$hv% D$tHTMPR h%h%hhv%] Vt$t#1PPVz t@Tt$ V0 ^Vt$t$Ƙ^h=%hܯ%hdhv% SWV1SSQ t&WV(W蔠SSV Džu^_[WV|$ t^ǘ1PPWͪ tPWݧhƅthjV( ^_h%y1h=%h%huhv%6 D$t L$tHTh%h%hh%h%hhv% Vt$t61tpT^h%h%hhv% WVt$D$ L$zVP)9tV 1^_ËD$HTt1Pt$ h %h%hhv%C USWV\$tF+1PPUV t.jVUD 9^TuVUSV_u^_[]SWV D$4toHTty9|$0uPLjPWt<Ƌ\$8PWShI%j Wr VNV ^_[h%h'%h h %h'%hh1%h'%hhv%4 USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËETް%t Etuu# 8Vt h}%跨ňjjU豣 jWU蛣 Gt ;D$TG9t ;D$TWU苠WVaurGTL$tIѺ!! tDݱ%WWj03u!T 8tJ 8t h%ާW߅11SSVˢ tLWV۟WU9t! hf%舧WSSV聢 Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVȚDžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:&t%SGtr7tCtt-SjJ1h 8t h%Wj1u2A 8t(h%ե&t%ScSj0u 8thα%菥1ɅtWV誝W^_[]ËCT@$u Cx;Gx%Wh%h%h;hv% D$t%@<t <u ø\ /1h>%h0%j;h% D$t%@<t <u ø /1h>%hI%jQh%z D$tBHttu#xðÃxux uxux /1h>%hT%j}h% D$t>Ht4t uxjh0'PK[ ] /1h>%hf%hh% D$tEHt;tu&xÃxu x uxux /1h>%ht%hh%U USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^z Wo1=u!GB9r1ɍ|$0+G /1NjB1ɉÀthAu_1ۀ=r:uD1FFFF FFGFr:SVrVW_uPr:މ^_[]Åt 1u19[:Rt1h>%h%hh% h%h%h'USWVP|$G<t<$ $ l$W)Ã|WhVT ۋ|$t(ٸF\$$)؃|PjV 1=r:u+r:W9u!r: /1N^_[]h%h%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQW ^_[h%h%hh%h%hh%f USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ. ^_[CPh@$WVc 1t߉h&hϲ%h{hڲ%hϲ%h|h%I D$tL$tf Hh>%h%hh\(&h%hh% VD$t&L$ t/fqPp QPI H^h>%h %hh\(&h %hh% fV[$D'Ph% u^USWVD$t$V\1Ij0Vu1|$/ooo WV5't-1C 'I?r   DE9u֋-'t/11C 'I?r _   DF9uWt$V4 1ɉt$\T$\RVQ2PVt  81I $ȃD^_[]WVP|$D$L$ $QPW6 tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP% tbL$1tHh%hd%hM8| /IG?uWG9rD$^_[]ht%hd%hh %< USWVl$t$|$t1ۅu>t7NLv%t_& }#tÉS1ۃ1Ct:tV>tXtSh%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t 1NA~0jh%W uW W G9rh(3肧 ^_[USWV |$ 7u ;l$$Ujhdz%U \$C UPWh̳%NS$t^DžtnjSW  8th:%h[#荙9h%~1HzSlt$h:%h:7#R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWh\%hE% =mQ[PWh\%hj%辘KUSWVӊB D$ L$$t WP *QPwNjD$$7@uMh#茄 %tQh%W w Ph>%We |$ t$hE%W@ {D$ D$hO%$U t$h%U U |(6h%U 1>h%Qz h }#$U] 5hv%UG h?%U1  h_&U h<%U h%U 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C PhT%W I4p'ha%W +7$@D$o|$L$ uMD$@tBL$qPSh%W"A%D$ E|$tSh%W <$tBt88t/SQt"D$pHpDSh%WAM|$ tSW3D$ t7t1Phm$W D$ 0uWQ W踫ǀ|$ WD$(P D$  #t%Phm%W; vKL%tg${N&tRh~%W AsHh%W 'CPPh%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPhô%W3 tr7@OǀD$(h'P胆t0ts~ t!V^t&PD$,P9uvh#%Oh#%B1OĨ^_[]D$D$D$hδ%W t1PPt$0V tc1PPV 9thu%hm$W oET Phm$Wf QjUt$0V蝌 Ņu1UVWU h%$V蓾 hO%V} h%Vg h }#VQ h_&V; hv%$ tzh?%$ %tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSu% #( # #D$  # #t%Uhߴ%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPh%W ?Q@th%W|$"D$<uMD$@tBL$q PSh%W0;%D$ S|$"$<D$@LL$qPPSh%Wtl{USWVl$t2E1Ft/׉˃PWh4%S tEu11N^_[]USWV\$l$|$ttUPWp 1tk<.tghO#Ww tUhв$We tCj hu%W葺 t/tj.W蹔 tUW4n 1t^_[]D=|Vt$ 'Bء03H 03;@3h(3j g (3H (3 Fut$03H 03;@3h(3j $ (3H (3 Fsh%K Fshڬ%5 FshWD$ F sh" F%%%%% %@uwxn%rh<"r]ɵ%rR% rGӵ%r<ڵ%r1%r&fF#r%r%Q< F sh%& F sh% Fth$ Fs h% 03H 03~(3H (3 h(3j b h(3襘 ^ù%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vitg$$QPVh>%h%h%US 1N@t+9w');@MQP'At9w :)߉h>%h%h%USD ^_[]USWVD$<Pi t$ $h#VI ]NjD$@HD$?1jh@%W蝶 ujh<%W膶 u|$D$4Njt$0tNF tA.t;\$SP D$P1U1HPUUUUSF 9l$u9t[,OuD$,Njt$(\$Sv 轶 t-D$P1U1HPUUUUSpF 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#V Dž4$~y14$oy" 1H^_[]4$Ny USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQŕ t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ V "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DH \\$ $2f\\ $$&$T$$&$O$sZ/t uPD tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1貿 T$$t4<$t s%|$$u1Fy 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl莾 1 ^_[]ÿt 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Ve 18 1H(D$ %%t?%L$QSPWV Ą^_[]USWVt$HD$DD$L$ tk$,C r7 rp   V1$UWhP\u%Vj 1ɃIUWVM$/S$SWhm$VyUWV# D t$$UWPhS S[9 $tVj L$C @yj.$Pt$j d$Phm$V E$8u*$@$UjS C@G jPSZ fC $4CCD V$4PԆ UShip誕 C O*W>RQP蝆 UShips  1N^_[]WVPRQ ~u~uF $`19؁Ĭ^_[]h\%{oUSWV(ˋl$uG*SVP7 tuD 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$Ǜ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS蚗 |$jjI`Ƌ$(@h@h:%~ljFuJ1ۍl$ShC%j U] h@UOFuCޚ 8tǍ\$($PhqB@W } f<$f|$ jUSA ShlBW| txD$PhpBW| tZ$$VЃuBD$PhfB@v{| t(D$FP>F u+ hN%^Ft P-V)O1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ l FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP{ ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P菈PVhw%S1I/ދ$0$4Wj$@U t|$r $,84$GP P$0Vh%WwSYGPVh%WR$0$4|$WjU $,t|$w1Ћ $ Q蕇PVh%$4$4#]ScPVhĸ%$4轴T$ }ltE$u?ClhPhhWWVhٸ%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhN&Vt$$@$@$L0 >}k|$`$0PDL$L$QWhN&Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhN&St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VU\ t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$袈  蕈 V1(^_[]ËL$DtD$L$tPVQ[ D$ƅuJ SWVD$ L$tT$$w% .11t$|$X+9s "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`qF`^SWVjh0jM 1NǍ\$PSPhWdtrjSjjWdt]jSh@hWsdtBD$$1ɉ $L$ L$L$D$fD$DtD$jPWuZ t W^_[USWVt$+VjUAChu,$t#tVh)Pj@^  r%s@%PSh&%ZPSh%I 1Bh) ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVhǼ%I ^_ËD$$POL$1Bh)` SWVt$tgw]Vh)j @^ w$;~PSh߼%H GLhV ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%H _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQhӹ%G w$|w(<PSVhF%KGG0GHe% w${|PVhl%G G0GH%c1HG8G4 w$B|PVh%F 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( l&|$D$ fD$l$|$Hl$D$HG4N PQh%xF ?G0D$ D$$l$ l&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P'{w0PVhS%E w${w0PVhS%Et$6u$HujGtGht:?w%tP~%IO%GHPuXj<c@O;Au<t t%?up%GH0ts]Sh)w4Q;Sh0w8P;Sh`1w0Py;C w8w4Ph%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVhȺ%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh=%;w SWVt$^ Sh%'BG0+G8PSh4%A VhVj81G?6u %EHPV Vh%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h94VD$tF9tAtIdtI;u D$ th%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$rPSh%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRPBI T$(  D$tz tA<t]<tYD$PPjdD$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph˾%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KF Ã\$L$\$T$|$ ‰ʹ ыT$ L$\$)9t$(D$ C+AQVPE L$t$(Ã\$T$\$ D$0hL$|$0ʋ6D$@@ZD$L$)ȃfPL$ы\$tD$0t,ˋD$L$)ȃf2AL$كt,ˋD$L$)ȃnf3ȉAL$D$L$)ȃDf7t$(1D$ ˋ\$$X\$,\$8u1L$,1C\$4t$\$8\ˉt$(r\$$[L$,1C\$4L$\$8LPL$4\$$u4|$u L$,:t!L$\$ 9L$uC\$ \$,B,;A*ыT$ D$x\$ShP# t|$ tsjPhL$\$|$ P_ PL$|$)9 OGPSQB ߃<øHT$|$)9QGD$ $ GfGGPS0ǃT$L$D$ L$DD$8D$D$D@1T$ D$,D$ЉT$ | T$D8 B9rKruڋT$$T$4u+L$$1BT$@t$T$4Tʋt$(r6L$$1BT$@L$T$4LPL$@u|$u$L$$:uT$ D$,@,;D$8F)9D$T$ 2BL$$D$DD$8NjT$ L$AЈAL$AWu"D$)Ѓf9ffz׋\$  T$tQAY uK˃L$)9 GM AQSP@ L$D$T$\$ |$fG G|$L$\$T$|$ |$0t>D$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP? ǃL$D$؋L$؋T$B)Á+),PjRh ,L$1OAhT|$ 1|$CD$PjsǃSt$ PJ? G D$G D$ GGDCff_f_1ۉT$SfGEh蝱 fGG@D$ffGSf f_ t$WhD$ p\W F PhA%/'k ΃]w'6uhX&V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h<%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h葪 ƍG 4$D$,$5&D$\$$(%u(Wh]JVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GH%GP_iVjhStSE0, pLJ  twAQ \ BjWhfjP[h_%h0%7'sY EX>@P, UB( A J*R>RQP5  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%% PjO1wLw w wL$u]rruG XixiF SPh%F% D$h$PS6ΪNRh_%%@u3EpCP t: @ NH M plYho%(%u Vhk%%h%v$ޅ3=u1HL$h$QP[ t=w:F h%Ph%$ w` 1Ƀ8tmF SPh:7#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP3 h%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$WPVh,%! M1C1G G\$"O0)G4)G8uL$YME Ph˗% A}w s$DUPVh% WuWVt$ Vh]Jjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(PhL%>W0Edh%WWNttxV1ɄutZE tS@;FuK_ PTPSh% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EHe%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr Y N@H@USWV׉΋D$$E t @9u ;M$^ P 1NcD$T$ PUSWV$$($$$$_\ftPh%hD% ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h:7# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%hD%  t `jW0 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P^MPVh%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s%n1ɋl$ T$Et*u4%& Vh_%"̿%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% WQ} /6uh%VEiP6ΛVh9(uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$C4$teSPh["Vt$Wh%t$( ["ۋD$t$0$ % P_C4$L$ t/PUVt$Wh%QSPh["t$Wh%t$$7 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWPi +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$+BPVh"% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph% v B1F FFL^L$hfWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Phۺ%  %GHPVq^_[WVt$ F PhF%g OhGL^_D$ȅtȰ (1SWV\$C rF 1H4t${GPhVB ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h'D$(PEdx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVP VVP ƍF8Pbuz3WMhVP SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,PZ toVD$(Pc~xF| uF|FXMdQPfVt$|s9tV;UVqT1PPD$,P ƅuC$t$xh'D$P1PPV ƍC D$~dV`Sn8U`?1PP$g 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&8 G8 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u1L$( Ʌt ѹ )QPh_%jW+O ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr6 t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU_ I6 8th%h%t$@s"j@{Dž@7Gt D>1ɨ1QSV; PQFRC F CFKN\$l$ o ! Fo ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF 0 oUSWVD$1tW8tQ\$l$G@tjUP艬 u8u@$Vu4jjt @H h%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjw t:NhVRPh_%j.Q: @jPW t&@`F`Nd#hW%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h=%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ hd%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀjPj781Fuh%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPh% u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh\'U薚 Shd'U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$hj.PSjp 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh%3 4$ f4$~ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUF tKd(1tD$ @`C`|$u%CdtC KhQt$(Phv%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$džܔuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h%% GdD$ D$1xG O4SQPt t $tsOdtYG Ȳ%t-%OhQRPh<%hWj[u! 81t 8t hN%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh^% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$% D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQj螽D$ t;t$(hs% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0QjT |$,wVh%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh<%h%e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh%h RQh]% \Rh%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP{ L$  uhj/ËD$CNC KFCF CCj.L$vQP腦 Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj9 $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$hP%|$$HL$Xpx jP$PL D$<t$h%|$rst$hg%$p΁Vt$ h %t$$C$x|$D$ƀt$h|%B1|$t +D$(t$( 4XPjQp Vt$D$`P~ \$Zt$h%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$h%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰hO%t$D$u%D$6j D$@`L@O|$ut$hP%몋sLߋD$,9CPut$,t$Vp VGPD$$t$,XGLtbt$,Vt$P wPD$(À|$$.&D$$h%ø|$$3WQ%t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h8%U|$u/j |$u$jt$ut$h@%$t$et$4t$t$hZ%|$$tL$11BL$jSD$(D$$UWV}u WYh8 ƍG 4$D$,$5&D$\$$$%ԶWhIVjíe^_]WVt$ VhnWۭVhIWĭVhW譭^_SWV|$G Ph\%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP tF F^_[hz% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%袴L$jQV u h%$BHJAWhjj*G Ph%+WhW iSh%|Yjt7UhjPs@h%h0%O)h%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%! t#@uUhp%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%j봋4$VUh%. WjDu! 81t 8t h%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj@ t'OQPh_%j.V h%ر)h#3  WhPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWh uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF Ph%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh %hD% jSWQ tD$ SVk h %詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh%b PUn!D$C,9r|$t"w 7h%, PW8!,Nu^_[]WVt$ tqwgVh>j胥1GGG G XGft/^_# Vhg%h:7#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj]< \$wWh%%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWVd t0 D$ PShS%+ ^_[]hE%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PShs%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%$ WSh%藫 F PSh%ت t){4t#D$} t*tu Vh% Vh%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]Ef%fx'9t Qf9Au<< <\$H $|'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%oD D$ PD$p Vh%% D$ PD$p Vh?% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh%wD$`$T$B"pF L$ QPhe%P 1Br&$F  $QL$$QPh %<$tD$x%$l$ |$$ PD$$PVh%蓥D$wi 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPǾt $jSjj)W諾t WI^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPVL t?jWj$j)Vt"$jWh@hVͽu%h%螤V2H h%艤1N ^_SWV\$|$1tD$'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph+%ߢWhW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ WhJ%P E]1@EEE,E ]$z t(Vhj jWhl%h:7#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh%h0%Ġ$1ۋ6<$tD$D$$t;F SPh%Ο D$$hPS6V%Ch%6Jh%蘟ޅ3=u1HL$$hQP}B Ã37@$:VL$QRP% \$\$TSjQjWp D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Phy%~T$E|$wD藏S GDtL$$SQP蓭 _Hbh%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph%h:7#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh %\ot/Vhj jۓ1Wh+%h:7#b vF Ph%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7&E%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 ti%tPV"ELPu4 u<Udž6ttFtu7@t'P>dž ^_[]à Vho%h:7#ٚL$1jSWV|$WhjdtxWhS>WhS'WhSWhSws^_[SWVt${Du ?~ Wh%P 1@1ɉKCCS(C|S KtHd sHdit x4t^_[Wh%h:7#k ^_[ønL$x4tBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhjP迋uhN%h0%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh^%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hgWt$$t$$t$PD$\0 t0L$ D$ PQhgVt$$t$$t$PD$\0 D$ L$)1HF t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$ȶ'J   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Phx%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPhǼ% D$P4 uOt$ pffBfBpɋ<$tXQlRd ڃ p7t$ffBfB<$tD$WVPR" ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPj |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$|$Wj PRуt!f|$w/ VhZ%V1Hkfǃ<~ hʼn\$ fft>D$ǃL$tJHP dtKWUP薒 D=l$_D$ fǀ< 1fw ̷')h%葃R|$Qho%j W4 D$l$ f9<t1}~ QWh%PEt$sf<z fu.Wh%z(Ex(Et(Ep (El6tj!zD$0^_[]USWV΃|$$w Vh5%躂1H׋ 1ۉt$$S1ItU辽 $]h]d]`\$,Džu\$Sjƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ VhP%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蒀k(UPh%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%4},WVh!%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$nt ^D Vh;%h:7#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VtP6jVjj`v-wx9Dths%Vu Vh|%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Q|1s%8WjjVuD$$Pj7<$w$8'8uJ%=ǃ8q%8u+%8u%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h&%} ؋?ut$u {`<$uhs`t$ hH%{} 1CdC`<$tWVPjQqCdt/u{hT$uWhPjqChtWhmPjlqC|Pk|$s|6Gd rHO uuG OhQPh %Vz #tG OhQPh%z G$Gd rWt+QW)1ɉO$O GWQQ qf  r WwW"AhO%Wp;u<$G s`Phz%t$weC`tEu_Kdɋ<$t$u[KhG QPh4%t$wR)\Kh<$G Ph%t$w t$$Kd<$t$W shQPRh%t$$lwj7D$uEG \$VPh%x sHsDhV7:uVhȺ%y~|t7OdШ u( uG@jPwU Odt Od t^?8|$WN7/4rtujoe^_[]Ë<$G Ph#%w5Ch]Ph%t$1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%u:fD$D$D$PjUVD$0T$4)̓w! t$h %ufjPD$DP D$LȉD$LD$PȋL$LD$P9v)蕰 t$Pt$Pt$h*%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%]s̮ t$hq%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF PhO%rt}u^_[]8V6)^_[]SWV΋y Whh%q 1CCCC CC$?t`^_[Wh%h:7#q ^_[Vt$F Ph%q1B^L$`Vt$?N QhN%Po 1B^jL$WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vh/jg1CC C XCC~ ;u Wh%p Wh%ot_^_[Wh%h:7#o ^_[ËL$_Vt$Vh_jifF Ph%o1B^hVt$?N Qh~%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hD%n tjS0 tD$ WSV h%vn`^_[]ËL$aVt$?N Qh>%P?l Vhjd1^L$&L$@ 8v3 l =9T$:@=cRED$j P5l == l =D$0؀:؋L$9j 18D$8j P5l = D$F 98} Tءl =8B؋D$8Z,#8r< 8r<l =X*|$W5l =Fhr<} 8yel =D$#8r< 7 9r<#8r< D$#8r< 8r<D$j P5l =H< l =K9BT$:5@r<I1L$xA AAL$hAAA :hDr<QP5l ==Dr<wwhHr<y Gdr<W} @ 9r<@\PT 8r<1Wh(3pM=Tv3=Pv3} <l =D$ 9r< Ck :r<_ 8r<l =t 3xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQh`$P|HH=w$)11ҊHr:B9u9~8r<u7h$ڼ ~1Hr:Ph#迼 C9uj л \$$} # :r<  :r< 8r<@ 8r<%:r<D$P5l =l =8L$9v\$$END$$ؚ&9|$D$ fD$ l$ |$Pl$D$PL$T Tv3Pv3L$LD$Hl$H &|$ T$ fT$l$\$4l$ T$4< uh%,< 8r<@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f D q 1Ah%TQhJ%Z5l =hp%H5l =hˊ$6P讏Ph%" 1Ah%Q85l =h%5l =ha%hhI%1FVnPh|%V81uS á8r<t=h%P1|$L$8jQj*j)5r<yu h%8r<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5r< yy h%Q9r<t+DŽ$j$Pj&j)5r<xuK1ۃ|$$8v3D$,tD$t3S?r<uh)%h%ƣ r:$r:|$$tF1FFFFF  F)F.N, r:$r:9rF t$ƃ|$t.t$L$Aut$hF%+8v3D$,|$,tF)F/8v3F 9r<@;DŽ$jjj> y ha%Ir<r<Pr<r<Tr<r<Xr<r<\r<fJr<'ur<`r<|$tjt$ j.j)V.w=8v3ujhHr<Vm yPh%UPh8v3Pj)VvuY=8v3tjh8v3j j)Vvth%$PhHr<VC yh%hl%h%VD$ %i- jVj%j)5r<uy h[%C- 8r<H H r8r r:=r<u"t$@jV? ȣ@r:FȣDr:r:D$t ur<r<USWVH ӉΡ@r<D$pu @r<hr<j;pr<&\$%P K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( 3D$0LA J$sw%PQn F9uEPhI%V h% h%h$%9 |$ FPhW%" 6Phx% |$ "h(%h% h$h$ZL$$ 'j.$Pt$ jyF$Q4'hO%Thj%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"P}o $@D$@|$ Ph$r#hy% t$ 9|$oh%hw%̗ D$$$T$ $@WjWh$x~&P胗 Ft hE%p 03H 03~(3H (3 h(3j )L$|$$t1 q΃j.PL$Qjuj.h"$P% $Phx%賖 |$u"tVho%虖  hc%芖 03H 03~(3H (3 h(3j  t$GNjL$+{h%ihb$ 9r<t$Nh$ Ntu%x~&Pݕ 1L$1΄u j,ܔ D$H%x%%sVQ菕 D$9D$t$uKj,藔 h%j D$4L$:D$tHj,n D$4WPh %8 $D$4D$ uj,? h% 03H 03;@3h(3j)虚 n(3H (3)h%hb$ 8r<؋ 03Q03~ (3Q(3 h(3j ) 8r<z|$h ot$dc~)/F1#ty1h%n2td3h% ^ F N t$~WRQPh<% \$S 6ƅx*Vha%œ 'h%趓 N ho%蜓 D$@Ph%膓 ~`1St$6t:j.$WPjuj.h"W! WSh%7 Sh%' C9u\$,t$ |$d|$h19wƉ΅h(3K (Mr<T$p1Ʌu9Qމ V&jV w  VPlj貉 5xr<h%o 5r<h%\ 5r<h%I r<tPh %2 r<tI r<9~hĎ$ 0D$D$L$d$ p& \$$$ 03H 03~(3H (3 h(3j \ r<r<tzr<$$s<|-s<@v3r<$\$\$\$ \$$%) $h(3J h(3J USWV $$919gՉ $t$ $;8t$hh$%$, =&GШu+$ ؃?9?)9K9si 3LA J$sw%PQhV =hV$,8 =GC~ 9r9$$ul&hh$%$,V =wDG$8:$ t-؍L$VSthV$, 1 ^_[]USWVP։1|$4$u9|.HPh_%L %wS$'W )1@1sC9uÅu.PhK& t$߉E1 `^_[]USWV4)ȃ'h%裎 :։ϋ ˉ hm%ˉ $Wf_oUSRQt$PhP%; Gl$j.UPjuj.h"Ub Uhr% Gj.UPjuj.h"U/ _UC()|c؉<+<'ueh%0<9#<,uth%蘍 '<+ugh% <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5<t$PV;hD$$HL$L$ 1x1PPPWS jh@Pb 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$<D$PVP訒L$@D$D$ 1 G|$<$D$=Xv3$TD$j=hlR&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hlR&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPa SVUV |$|$t$ "+Hj=hlR&P Ņt$,]m 04$Q"m 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H e dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=0<u t11jNt4<1H<0<t PY1@h32#h%蓀 0<1USWV1=H<MT$ l$(L$DžD$50<hhI<苈  |$t$#j hI</ D$I<h#Vǀ4<tUPU uTWV覀8<WV藀t7j L$QP# x#L$9u<<;D$ D$uL$us 0<8 0<APQ~ PQT  0< tuQhhI<艇  |$uH<1^_[]@<L<L<1Ҋ+~,u"1t$L$t' t" t΅tAL$=h<uh< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=D<u#H<0<tPR 0<t 4<1^H<0<tPQ 0<VtJT$1Aj<ƃ=D<u#H<0<tPQ 0<t 4<1^t D<t D$D<1@1USWV D$,L$(l$$~ )$1H$`t D<1A\$9|ωL$ tgp9tX tt$ PR t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$H<0<tPxP 0<D$,L$$ ^_[]f11f11Ã=l<u /t(p<11hh<PjNtp<1<l<t P衆1@h32#h%{ l<1USWVT$1=<+\$0L$ D$D$|$(D$5l<t$8Sу l$,D$ D$D$t$j S* \$1 h#V|E|$tt$(P.Q u~#WV{EWV{t^j L$QPZ| xJL$9uAE;D$ D$<u/h#V{tj L$QP| x L$9t[ l<8 l<APQ~ PQO  l< tuQt$8S螂 E h#V{Eth#Vzwh#Vzah#VzEHh#VzE /h#VzE$j:t$ 4) 1@|$ u<1^_[]WV=l<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh<hp<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=<u+<l<tPL$L L$l<D$$tˉ01C؃^_[<l<tPjL l<PPhh<hp<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=<u+<l<tPL$K L$l<D$$tˉ01C؃^_[t <t D$<1@1fUSWV\$l$t$VK PVWf UK PUWR SK PSW> t$ VqK PVW& ^_[]WV t$uRt>DžtA=<t ^_Épxj Ph" ؀=<u1F1=<tZ 1맋5\v3GY $r#QQh%Pփ0W USWV1ۀ=<t ؁^_[]yZ D$ |$GSSPh<jW&u < < <r1HĢ<$r#1ۃt2u3hWh% D5<~ȍQ2w$'ɢ<PAu Ȣ<?$D$-\v3 X h?#L$Qh%PՃʢ<`v3@ˢ<dv3 Ģ<I9@hv3 Ģ<I9@<<<̢<Ȣ<yɢ<pʢ<g`v3 Ģ<A9~WH`v3Oˢ<Fdv3|t%ƍC!t2)É$)t*4<L$ 4<$)PD$p xPh<K =ʢ<=̢<WjD$hpj Ph"蹺 5\v3vP $r#QQh%5\v3]P $r#QQh %PփFN 111{PZDWhVM ESWV 1L$ |$ ru\95<s(>tGǀ=ʢ<u.;=<rN;= <rD< DžtVjW.M =<t^P 1ހ=<t& ^_[À=<u1Ffu]pxj Ph"E 뺋5\v3O $r#QQh@%PփL NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95<95 <H_ŋ <!9r؅ Т<9s9s_< 8!9t.M9wI9rE<8! dv3!9u!=ʢ<=̢<<Rf ʼn9rPVU!  8!!ōD$p <PVL$D$PVt$8 <Pt$jUV蚶thŋ$L$Ai Qh<=ʢ<=̢<u=<M 1=<tM^_[]t$h<O=<1GDu3t몍D$0xhj Ph" 5\v3K $r#QQhm%PփI 9U7)SjZP)MPjS3I :9/ $)QjZP)PjSI tƉ111USWVˡ<!9ta)‹ Ģ<h t u9=,$)<l u=ʢ<OE$)ÍFu\wlw'xD$X <PWPW=ʢ<N V4<54<w(' ww'1É;GsG1B TGHO;Mu9}tAtDEWP35u%E9tt9sMxt MPQK}-E $ut=ʢ<tGV^_[]ÃWU VjZS&G vjZv G VjZSG V t$=<tt ^É01ɉHHj Ph"A ҋL$SWVȋ<!9t+)֋ Ģ<| u 9t%)D @A Qh<@D^_[USWV=ˢ<t^_[]þ$r#VVVh%\v3Vh2#h"h%\v3%=Ȣ<u}%-%=ʢ<uf&8#=ɢ<u&RQPh%\v38&=<u7%"=<u3#^%=<uM$:%=̢<u@$VRQP\v3\v3$ <|$gfff̉ҍ4މ劄1u#GO wһ$r#2#SUWh=%T$t$|$f4SUWhD%\v3\v3$ <Ggfff̉ҍ<߉劄9u#FN wh$r#h2#VhS%T$\v3$ Т<|$gfff̉ҍ4މ劄1u#GO wh$r#h2#Whb%T$\v3$ <|$gfff̉ҍ4މ劄1u#GO wҸ$r#PPWhs%T$\v3$ `v3|$gfff̉ҍ4މ劄1u#GO wҾ$r#Vh $Wh%T$VVVh%\v3USWV΃=<tPt <3!1Pcǡ< <!)ȉ9r1Uc<9tEuótP-<!1PPjhjUP t(8<t<<=8<=<<-@<1ۉ^_[]V΃?<< ; @<v$1u<<Ɖ <<^USWVPܢ<آ<< 0trƃh'P`F,=<=آ<4$t|n011FEEh'P'ـEECآ<(9r:5\v3C $r#QQh%Pփ=Ȣ<<11ܢ<9s[ $,0EEh'Ps+آ<C<]ǡܢ<آ<(9r<9$sj,Ѓ0EEh'P0Т< آ<s ܢ<)ÉE;ǡܢ<آ<<(9r$^_[]@ L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡ<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9Ԣ<s$5<!։Ņ9<v6J Љ  ȉ  F1r{@p9Т<sBJ Љ  ȉ  Fܢ<آ< hv3u%1I#5<!֡آ< dv3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPUf tPUv$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=ʢ<t=̢<uVj1^_[]VhU;< USWV5<1!-4<t E4<1-<<E@;@<v@uW-<<E@<<tE3t,ÉE uUh<=ʢ<t"=̢<t!4<E-4<^_[]VhVjS|; USWVΊ Ģ<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S>~VSqSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ Ģ<^_[]1USWVȋ5<!) Ģ<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh$< Åk jS$<W SW4<4<;-<r ;- <1WWjhj\$SUb t\tV9tRSP uE< j@\$S0p -\v3"; h2#Sh%PՃ=Ȣ<1lj1<4$9v(< 1QQjPjVQ @wg1=<jYŋ5<!Ɖ)tPX<9tut݉<$/ <u1]4$D$x Ph$<tA<$$<C 9r09$v+jSV7 SVK4<4<uɉD^_[]7 V< <r!1F<u. <<F9r^USWVP $1N=<1!׉) Ģ<D$)ot +t=ɢ<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVJDGWVy;_s_u.G WP=ɢ<u.M,t <-},^_[]jPRy 5<^_[]USWV@׉9 <95 <jV; <u >9uPV; <FjWV *1ۡ4<t  4<8<<H@; @<v@j<<H@ << 3H <HPh$<@<9rWVG u= 9 j@S0 -\v37 h2#Sh%PՃ=Ȣ<9=<u]4<t  4<6<<H@; @<v@u,<<H@ <<t=<p xPh$<@^_[]9<u)< <4 flv3ølv3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á<3D$t$P\WVL$T$ ‹q~y ;q~ t 1~9 QPT ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4'W*' tF u1^_ËD$t w$'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ $r#$r#tƀ>t9x%4 0DPWVhw&h3cO ^_Ð1|$w L$t9tøv3f|$3H#t$r#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]= 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PS  `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ Ps. t F;'tm'D$'D$D'1FthPt$$V V" Ft$N tVD$PS$ |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-\1 01H^_[]Ë ' r ,$<'t u‰,$<'L'<$t9rPQt$[ 1t/<$t9v0 |fL$N%9 (v3fL$c%9 (vx3føÃD$L$L$ L$D$Vt$ t$Vh3O hŒ"V?t"F0 0kPh$h3K 3Vj ,VV ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t. 0 w. 1$^ÐWV|$ W4', tFu1 ^_D$ftL$QŴ'1USWV$п$$ u V  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#wF4$Y(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$D<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$d' j F H @(N]_?[\;^r~uFFD<D<C><% ^q{t|~F~F ;^r~uFD<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFD<F^9րրw t$rI{i9s <$=3]D_\,<$t~uF FD<D<Au~uF D<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF D<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF D<F"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF D<FЉL<$USWV t$ ^h.\u/;nr~uFFD<D<EMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFD<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFD<FωωD$$xt~uF D<.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF D<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF D<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFD<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=<3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uD<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ赳 F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA D<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FD<FUSWV\$1=<39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh <31҃9v1B <33Dh1҃9v)1BuG D<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFD<D<E<^_Ã~uFD<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFD<F1^_[]É؉D$% 't$t$U$ u U t/uՃt~uFG롋$USWV 1=<39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytSʹ'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRqD tF^~uF D<F1^_[USWVP1N׉$1+t{`tswsK$8'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=<3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ s ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$h'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4螦 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ N ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhP<TP<ø%Vt$1Ʌ1t э^fffVYT$ws^ÐUSWV[l$,D$(u1T$|$;D$ T$$750PW讦 E> PW薦 0PW~ F PWf tN PWR |$D$ tH0PW Y PW 0PW ia PWѥ ti PW轥 |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1h9r 胼$ t+$ $$ FhPW9X D$D$D$j1҉$ xfD$4D$d۰ /$$ AfAfI%QPRhW2t$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ V訛hPWV j:W>{ D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVPÎt Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,$L$ ɍ$ d1,$L$ Lz9s L$4.2qPh$P)$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R } RQPUh$P$$,$ 9sL$42qPh$P$j$,$o9sD$l6$,$/9s狄$ @2PQh$P$$,$9s狄$ @<h\,$9suF9snF9siF9x|$B$ y ,$9s%NM9D?<$ @<L$|Ic t$xjhQPRt$Ph$P$$,$9sL$tW2QPh$PT$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ ,$$ |$jj Rjjt$,$ 聈$,$$$49s獃 ,$$ g ,$QPh$P$$9s獃 ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP pRQt$Uh$PD$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$P蟽,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@q l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$P蜼XD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P膻`$,$$_9sjjjhRt$,$ K$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$Ft PQhW_1ɃD$D$ D$1 f fffUSWV`[(t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r=  l$8D$UPjO tCL$HD$ QPV t2VI t+jPj 1ɃىK'謡 (jD$LPV蝠 蕡 (l$8芡 0jUj v 0`^_[]fffffUSWV< [õD$yXXD$/Xty$/devjPt=ƍD$4PhFtHV[ V@ t|$4l$8$<D$ oD$ $<T$$6!PhQRV=D$ t@D$D$D$KD$'p8L$T$ t$F69t$D$0l$WzE?tD$pD$ jjRs tkD$tJt$PD$P  ut$D$P uPL ujjD$P k6蛟 8[ 耟 iŋ$\ $X $T $P :)tt$ P$` tVjQ$p 1tWhgtQ] < ^_[]ÐSV[JL$t$ t$ t$ PQft+9 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[üt> mB 9u8jjՋ t P1 1 4 0ǃ 'ǃƃ tʝ 01^_[ÐUSWV[$01 uut!j/Vh uS tƅu ƍ|$vVPQhW蚴=r) ?h@VsǍD$ jPW D$$WtLD, L$Pjhjjj QD$(P~y Ƌ<$t'Vu D$8 t菜 8 聜 L$^_[]ÐSWV[ö u3P6ƃ $tj/Vpg uA蒚 Ɖ獃vVPQhWD=rӛ ?t" VP蒍 tEFu7hh%@V  hVPyB ? jj t=jjj} !ƒt" PqJ 1u 0 0^_[ޚ 8#uVt׉迚 ƐS[>[ÐS[t$[ÐUSWV[u }J D$<$< t$u$$D$Pz/ut=k<T$JL$|D$x$L$x$PQm$$$Pt$llH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$託 D$@j PW- 苗 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $蓏 \$ 8u$$>$0։] D$|D$$D$$D$$$D$ t$t$|$|$$L$PQLb|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6=m jjdRP蛛WPGLjh'v6m W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[KL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[˞|$GtB#l$%t$Pn9t!G t7t9uӾ^_[]ÐUSWV[[tC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[xt$0t$, Ǎ3 VP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP7tG t@/t;L$uЃt'D$ t$jb…<$uNt$0t><$9tRM[ PUW >&t1<$W5 ^_[]fUSWV[;t$D$hEt'1PV6t%D=u1 uVPjmD$@ 8^_[]ÐUSWV[ø|$ D$hEt$1PWa6t%D5u ^_[]ËD$@ 40tMi D$jPt$V ŋD$18txi r"u## u/B"tt$ aC4$WPjуHWPj.SV[Ít$ v[v PVG^[ÐUSWV[HD$,8tD$,1퐐8@ujp HƋ|$(WW F$"jUF D$ D$,F>3 D$Pt$_1}nu1ɀ}ouL$D$j=Ut3 tǃ|$D$,t1PU!4tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8 t 4$V1^_[]ÍUPj0USWV[Õ$4$,g 0\jPU uj:UW2 jPUm tKt$}/3t$UhVh jVPUV P8 t$UD$P/$0VPW-  FD$ GL$ jjQPjR1tqVUW  Rd 0$0Xd 0kd 8uj/UBŃt$ $0UW  zd 0bQPWx  111Ud 0$0P$4I  11,$j$4V$4WjUpP>2PWNst$t8HPQ膇&c 0$0P$4  1,$D$PUc 0^_[]Í,$UPVWz1[c (1WP$8$8zVsfffffffS[{D$D$ $L$T$jjPQjRi/yD$[fffffS[D$D$ >$L$T$jjPQjR /yD$[ÐS[ûD$D$ ?$L$T$jjPQjR.yD$[ÐS[[$L$jjPQRqyD$[fffffYT$umÐS[ޒt$ZqSWV[ü|$Wt$t$O 9r1a ?WVPj^_[ÐSWV[l|$Wt$t$ 9r` ?WVPj^_[ÐSV[t$ i ƅu4Pj^[ÐSV[ݑt$t$ ƅu4Pj^[ÐSWV[Ü|$WƅtuGWPj ^_[ÐUSWV[[l$|$UW`ƅttuaUWPj^_[]ÐSWV[ |$Wt$AƅtuWPj ^_[ÐUSWV[ûl$|$UWt$ t/_ 0UWPj^_[]ÐSWV[l|$t$WzƅuWPj ^_[ÐSVP[,D$L$T$$RQP* ƃuPj^[ÐSV[ݏt$t$t$ ƃuPj^[USWVP[ÚPt$0t$0t$0t$0t$0jt$4: Ɖ׋,$t1] (t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[Pt$0t$0t$0t$0t$0jt$4= Ɖ׋,$t1z] (>t$,t$,t$,t$,t$,t$,Pj ^_[]fXL$"wÍ0ffffffUSWVDXhD$4t$dT$\l$lL$`1ۈ$<tyD$XD$T$D$hD$t$l$D$D$ D$$D$(D$,D$0|$  tt Z %ju %#jo%#jx|$L$t\$4t$hVWRt$h\$4t$hVWjjs~D$$<$|$ D$<D$81$ |$ <,L$4 GD$ =u <$f :<$F<$f ՉʀЀ r ʀ¿d ʀŸV _@F O?1 G<@& fu  $t$T$։t$<1 tl$<1 u<@TP* <$  |$ |$8\$6O? v 1ҸGD$ $ t1#T$#t$ |$0D$$D$,;D$s L$,D$$D$$ O3L$< =u!L$$;L$sD$=D$ L$$L$$HL$ D$$ D$$y|$ t^;D$sL$L$ D$$ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$8CD$,7|$$T$()9%D$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$D$$D$(D$,D$0T$|$)D$݋\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)oD$\$4VRT$$RQPh;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9sD$D$L$$݃L$$L$(D$,D$0T$t$)eL$\$4VRT$$RPQ^\$@L$$D$,T$()9D$$;D$8sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$PjjfkD$8 $~D$$|$ $݋\$4WRD$$Pjj,kD$8 $Ƌ\$4VRD$$Pjjk1Ʌ륋\$4WRD$$Pjjj~D$$$D$8D$ x@uNt$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjhD$$u|$0L$$tB;L$s5T$ >#\$4 Q L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[.jt$t$t$t$t$[fS[L$T$ Pt$t$t$[ÐUSWV[ø|$$t$|$0t$(aD$ j/Uj ,$t|yUPt$ WVt$8IuUN 8uFbt$ t$Pt$t$@t$oD$~ L$ u [PQt$ [ÐS[njt$ 0 [ÐS[njt$t$t [ÐSV[Ýn0t$t$V( tD$~ L$u  PQV ^[ÐSV[=nt$ t$t$VP( tD$~ L$u  PQV ^[ÐSV[m0t$t$V' tjt$Vh ^[ÐSV[Ímt$ t$t$V' tjt$V ^[ÐUSWV [8mt$4@|$gD$ L$jjjjQQPPt$(v$[ÐS[gD$ L$jjjjQQPPt$($[ÐS[ft$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[Õf$\$Xt$QP%$ % $$`t$PRӁ&$  $t$PR蔁&$  $$dt$PRP&$  $$l$htD$xPR |$x  T$xtD$PPRҀ |$P  T$P$t$ptD$(PR萀 |$(  T$(tPR\  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[5d$U$tvu $ 󥋬$$tvu $X tukt$ $ 󥋬$$tv!u $0 tut$ $ 󥋴$tvu $ 󥋬$$tvxu $ tuLt |$h |$h 󥋔$$E@mHt ։t |$$$$Xt t |$0$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XgD$D$L$$$\$`l$(D$@D$ D$ D$HT$8B$L$D$4Qx$h,1T$L$,؋ $LIfDL$9$D@4dL$$LD t;hPu$h,$D@D T$v$D@L$fH|$p1j $LII HLIA 9t$ u‹T$$D@ʍ f|$yS4OD0 0L0Rw|9 G, $@fD0f|0$vxt$(cx‹O,$L$@t$)֍ L~;|$ _L$ǃp <ǃt ^ǃx vǃ #ǃD :ǃX 'ǃ\ #ǃ` #ǃd #ǃ -ǃ| -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW+ 1 QTpQTtQTxT|=u^_[]ÐVYD1 T$tpqttqtxqt|1=u^ÐUSWVP[ÊD l$j+5GG(ujjeQP u0Pjj3hQPej> j< j^ jv j#H j:p j'` j#P j#@ j#00 j- p j- j_ j| jox jpH jr jy jz j{ j|( j}pP ǃ !ǃl +ǃ !ǃp ,ǃ !ǃt -ǃ !ǃx .ǃH %ǃ 0ǃ %ǃ@ `ǃ %ǃD aǃ ǃX fǃ ǃ\ gǃ %ǃ` hǃ0 &ǃd iǃX %ǃh jǃ %ǃl kǃ %ǃp lǃ %ǃt mǃ <%ǃx nǃp %ǃ qǃ #ǃ| oǃ #ǃ sǃ %ǃ tǃ $%ǃ uǃ8 4%ǃ vǃ` ,%ǃ wǃ %ǃ xǃx ǃ ~ǃH #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ ǃ {ǃ( `"ǃ |ǃP ǃ }2NthtBt'zx ϋtuQjPVp 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX;? l$+4+ع x( PPu^_[]fffffffX>L$fǀ ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[Î>t$0[ÐUSWV@[X>|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:\10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;{ 8u1E3t%\10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[:0t$t$V tt$Vj^[ÐSV[í:t$ t$t$V tt$V^[ÐUSWVL$[d:|$0D$(T$ 2D$ED$4D$D$ ftW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjj 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$l 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!QI jS[.3t$j[ffS[30t$ [ÐUSWV$[2|$u'2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(PtjjP ,GTPְtjjPՕ GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V P"D$$<$$u$Ps HuǐuU P詢D$$鐐<$$u$}P Huǐul$Ut$V V贲U諲$|$+D$H$\ H HT HX` Hl` 2t p2 t2 x2 |2 2oG[ÐX* tT$QX`1øSWV[l*1t$t&D~fx닎f8upσ>~"14;>|ҭVɭ^_[ÐUSWV[)fǃ h u$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$j T<TV$2@4tV} =wlj<$hVt$ VM VT 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍhPwjS[(0[ÐUSWV ['|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4\10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$薣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ\10vL$Eǀ3뤐SV[$0t$t$V t V^[ÐSV[Í$t$ t$t$V t Vr^[ÐSWVP[K$$t&T$t$2PWj $^_[ÐUSWVP[#1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[+#T$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[E"1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ø!D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW|ŃuRG @tG 8u=D$3t.\10IrD$ǀ3G @|$tmG  f Hȃ  fftVWq=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)\10oǀ3g 룸Pjj Q jSWV[|$WgƃuOG @tDm 8u:3t)\102oǀ3^_[ÐUSWV[{tt$339}3AP3yt' 333343;33PQRP聎 33t331^_[]ÐUSWV[ëtt$339}3AP3詚t' 333343;33PQRP豍 33t331^_[]ÐSP[$tT$ 2Pjj $[ÐX tT$QT1øUSWV[VTAx43fTFT$PLj F+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh贍to DHDHDHDH uǀD$ FF^_[]øPjjh,PjjQ踴 j>=Pj(ffffS[Î0[ÐUSWV[h|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ̜uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[ít$ t$t$V t V^[ffSWV([i0Wt$<2WV0^_[ÐSWV([)t$8Wt$@2WVd0^_[ÐSWV([0t$01[ÐS[13t)PtЁ3QP [ÐS[þ13t+PtЁ3QjP [ÐXo3u1Ês3ÐX?3u1Êu3ÐX3tD$s31ÐX3t L$u31ÐXL$31fffffffSWV [iD$ D$D$$ t$VWj9 XD$D$D$ $jWj8 jj3:jVj8,^_[ÐUSWV[13PtЁ3QP蜮 $ u( j3 ƃ$ D ~:Pjj $;, u, jPj 1D }t&jSEHjjQppG@|t0QjP Et"@:t@0Qj8g @0UjK @UjX5 p踢 jjjp赩ǀ3Qt43PjQ賡 ^_[]ÐUSWV[3$ uPj ( ƃ$ D uRlD$D$D$ D$D$D$, L$PQj ǃD @HtȍL$Qhht@P tBL$t9D$t0\9 t ǁ39tǀ3\(8$9hu9xt WUPgK 9hu9xt WUPJK Qt43PQ It3PjWܟ t6@$0d^_[]ÐS[$ uPj ( ƃ$ [ÐS[þ$ u( jm ƃ$ [ÐSV[Ê@HtȉQhht@PC t!$tL$t\, Hwtǀ3^[t$ЃS[D uOl$D$D$D$ D$D$, PQj5 ǃD [ÐS[{D ~:Pjj $;, u, jPj 1D [ÐS[3t[ËPtЁ3QP [S[Qt3PjQ8 [ÐS[~Qt43PQj [ÐS[>^[ffffffSV[|$ ta@|$t|u7x1t-0QjP 3p 1^[þfffffffUSWV[ËT$2tt6usRRt1u8]RuARt'20PjR pM ^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%20PjQ% p訛 ^[fUSWVP[:t$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,t3tt$ t$ P? [ø[ÐS[t3tt$Pc[ø[ÐS[þt3tt$ t$ P [ø[ÐS[~t3tt$P[ø[ÐS[>t&3tL$ t$Qt$P&[ø[ÐSV[0t\Ɔ43t)2Fpt9PVlPV(3tP3oV^[ÐS[nt3tL$jQP [ø[ÐX/1t T$~93|4 RDÐS[t3t PWV[ø[ÐS[îD$t3t PV[ø[ÐS[nt3tPUtJ^[ø[ÐUSWV[+0Ɔ43t)2FttrPVPV,a3tR3~>11;3}:tt3PpT^_[]ÐS[nT$t$t$ [ÐUSWV[893|$0t$,T$ $u0XMDH@utl$4D$ Ug 鐐t$ D$PL$ QD$ Px)t$8tL$9D$)<9u AT$)RUat( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[ø8D$ $4VjPjtSʼnt$UaƅtMD$ $t$UD$PVʅtT$t$$V Vq^_[]ÐUSWV[|$3t P 3~/11퐐440q0;3|4{q3ǃwwLJ3j0jvj4tW2Ht<@xX3~3 P<72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448wp0;3|4[p^_[]ÐUSWVXXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wa 1Ґ$t$V|$(WD$0Pt$$0ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V讳 $4D$)Džu |$ $tR1VT$ 蚊 4$)tWj Ve T$L$ (^_[]ÐUSWV`[X14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WY PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P讀D$T$3;4}D$PRjQD$PRjQhNj$D(PbD$$L$ ;47&ffffUSWV[[|$$D$hjjU t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[ë|$$2t$Ƌl$r:D$02D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$Uc 1^_[]ÐWVYMD$T$ t$w4  p@^_fffSWV[t$VO~~tyы9uv0gv,g9p9p 9pt PݡDgV;g1^_[v4*g9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PfffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[Þ|$ uT$[ø[ÐS[n|$uT$ L$[ø[ÐSWV[<|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVX~|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$ujt$ [ÐUSWV[|$tyG8 tsl$ 1tiWD$W$jwPW{ UW4$t$W{ 98uj y48uG^_[]ÐS[nt$02[ÐVX>tT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVXtL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐX_Ht t1ÐX/Ht t1ÐS[t$0[ÐUSWVZȿ|$(QL$,C@D$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prq` _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|qWHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqpk_ ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|4VtG9|델Kwl$9\$}!GPjVWp9uGt PW 1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[>0[ÐUSWV[|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ®L$1~t$ ~9J$u9r ^ÐUSWV[kD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [Èt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[-T$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[ T$L$ Aq D$t$jVPt$ ^[ÐUSWV[˧l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[ht$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Yؓ|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4px Ft fFV }![t  fN 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD9 t$$ $Pq|V\$U BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p; u D$Pz1r)1 $Ph WA\$ ƀw $PQR\$ D$@ L$P D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw $PV\$D$px1ŋG  $h QP \$ ƀ=r{,t$G $h WP F$h Wt$ Py \$ w $PQwE D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ uPQhrR?: $G= USWV [rD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [d_ D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$|Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$|PjQ0) @x H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$|Pjt$( ǃ D$ ; ;T$ 9<$ to j Pox) @lt|QjP%( F t3 j Piox) j |j m  ǃ 1;  $|l$*ǃ ;  @@ltWjPV' yA t`j t$nx )ȉ }u D$8o@@lU8 LQj `u ;  |"UjP& ; ~U   @@xuă tjWmx) j띍| ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$lx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$ kx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$Sjx) j f ; ~nUjP" ;  @@xu̓ t!jt$ix) j룉PS[~VD$ t# PQix) P1[fffX/VHy8~DyD~>Hlt htðuu냹tt u1ÐXU@ xÐUSWV [ØUAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21CdD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p  p0!0  0(9uD$t4$L!L  Lq1tt  ^_[]ÃttِUSWVP[PL$9 ft$9|$ 9l2uCUw$-4$t$skw|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXO2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYM|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yf>2~w-s qf ^_[]ÐUSWV[ ML$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZLLL$x?9J\~2D$t$|$ Irftf>vf1^_[S[Kǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[kKT$L$l2uI~w-ssw!ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXJh2ÐUSWVP[ZJt$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[,Hl2tu6@t!|$0QjP (!G@f@d^_[ÐXGf@dffSWV[ÜGD$ yOQW~ ;O~ t Q WPa4W^_[ÐSWV[,G|$D$OQW~ ;O~ t Q WP3W=^_[ÐSWV[FxWt$W^_[ÐSWV[ÌF|$Wt$XW^_[fffffffUSWVXKFtLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$b7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ +T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K Й~ ƃQWT$H ^_[]ÐSWV[ì4|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[.4  jt$t$t$P1[ÐSV[3  jVjt$PJ1^[fSWVP[ë3|$t t9t QD$PrL$QjPW^L$N|$kK)l$kK) $;$i)`PUt;y t0q$t~fuUvu1 q d^_[]ÐUSWV[1D$$L$t@1D$D$>D$POL$QjPW\L$kL|$kC)l$kC) +%;+%i? )PUt7q tAy$t+nuUwiu Ay^_[]USWV[ø0D$(L$1҄t@1D$D$8>D$D$P.L$QjPV[l$-?L|$ ) i)ʼn) i)kn%{n%lj*SiŠ)ǍPD$Pdt1D$H<tzp t:h$D$t}suPu D$uދ} مt3l$,t+Et$WP!uVEЃ^_[]ÐS[./t$ t$t$ [ÐUSWVH[.t$\lD$P4ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPUIYL$ȿNt$kK)kK) $3$i)`PU$D$$dED$j=U(tƉH$$D$<$|$WL$QjPWKXL$Ƚ-?Lt$) i)) i)Kn%sn%Ɖ*SiŠ)ƍPWD$5tcL$f <$|$WL$QjPWWL$ȽkLt$kC)kC) +%3+%i? )PWBtD$EE!D$DvY $$D$XPUPU1PU PUPdPU}t&PUitr*PUUte0PUAtX5PU-u^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$;L$uD$ 9D$ tf, UQ,$t'UW|$BUo4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQ_V $4D$ H^_[]1|$t4$转1USWV[(hWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG@M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$ 1Pʋ$H $$$H $<<$Rt$Wk /$//$H $>$D$^_[]ÐUSWV]Ř#2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[!1l$E<%uEpuEπ r?Nуstlu~;|$~,|$t#릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[=!L$ T$D$$Pj [ÐUSWVX!$1h ։ͅu4$( u'$h-( 5 @0t$E4}0u"$hE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$lσstlu7D$ ~ ~$BDŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,ϜE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $+ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $,$t"A$|t+H$D+$l1$uՋ$Q1ڃV$t.!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,2RE,}0M4T$$V$0PRQ1$E4$/1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V;9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,RrE,u0M4tڍqu4 $p1$P$P$=1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,.tRE,}0M4$V$0Pt$QE4E,M4},$-1^_[]ÐSP[mT$ D$$1Pj= [ÐS[>t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$ÐUSWV[è|$(t$ l$uP!ƅ>l$$uj hj`L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F4]9Pk1D$tGuP|$(x |$(tF|$(mV|$(Phht@U t$t$tL$t RB(JtRdPytjjPxw IA(dPPtjjPOw IA1t^_[]Í;PjzVSVP[\T$L$D$tRQPVƋ$t P.^[fUSWV[ t$|$t$jt0ʼnVU貕|$T$VŸPt$t~Pt$tkPt$t[!Pt$tK'Pt$t;.Pt$uA1 @VK^_[]ÐUSWV T$L$[íǃ, 5P,Ņt'}/u{L$$ t$  ?P/P茂PVuU\DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ nV`'u41V='GP$|$ $~:s1퐐Nt:t됐tÍMwUPWٰ D, L$$ t$ [tukP>tGUT$ PQhR~)T$ L$$ t$ $bt$ $:uw1퐐Ot:t됐tÍMwUPVٯ D, L$$ t$ [tu$ $ȁ ^_[]Í>, USWV[x l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP+jj!ԉG(hhPw|$ Gt\$h(jPX|$ "\$jh~|$ G9ouG)o\$UD$pz|$ Go\$UVP W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PF$ދ\$PԌ~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V蝟t.)9uUt$VP t6u0,1(V"9ſuUt$VO ^_[]fffUSWV [(D$48H L$@ 1퐐/t <,tEPHxUWPѦ .,v3l$4uW蟈EED$\$cD$D$|$j|WxtD$4@ T$L$ t017t<,t\$RT$D$PRwtDl$VWQ֥ Ut$Pĥ K1<$WZNjt$D$Pl$8uɁEW|$WV\ W8D$D$D$ Džt$\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0贀\$<u3D$u'\$Uu\$8C k$K($fC K(K(|$T$ t$4Pe>p1\$91\$-4$藅K\$PeeD$PhD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$d ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ QB ^_[]USWV[HD$t uy0|$ 1퐐/t <,tQL$赾$PFst2ƃ$UWPϡ 4$t$P軡 Q1^_[]ÐUSWV[Ë|$ t$FN,9vtU6}uCu;Urt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$vYPWJuLt}D$x@ȃǃtVot$ U)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$WuPt$D/W豼prWuPt$D1TL$4xT$$s$tntfuσ1} t WPV进 l$ E|$f>t WPV蝛 }t0EfEfF}WuVq f},t&E(fE,fF}(Wu V/ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[û|$ t$FN,9vtU6uu]uUUjtHnNT$l$f,Ninf|FFWRP7 ~F 1^_[]ÐSWV[ t$FNy9vtW62uuCu;W/jt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Èl$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|U艢D$tL$j|Ut L$Uh=r|UPt$P 10^_[]ËD$tP2L$ =r"D$t+PL$=r QUPt$T^jjP?rtt$ $@ 1D5t <,tFPGhD$4 VUPȖ D5$(L$tSD$HtJ11t <,tFPg Vt$Pn D5$h|$t+D$Ht"t$f $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[:|$0 $0 ftGt @1@WG(f4 hwUsX =wb,5 Ƅ4 |)ƋtVPU?X 9vD|ŃƋGtVPUX 9s D|ŃE$^_[]ÐSV[=t$ tavfvevev ev$ev,eVe190 uǃ0 ^[ÐX0 @ÐY0 @u0USWV[u$(E$$4D$$0j:W9{t/jQP t0V$0W  NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP^(P]Iǃa,RD$O0$$,PQhWJ t" ǃt轭|Oj j,(,q XPX XPuP^tj/Vt|$uF1$jPRQV0'F1T$X$jPRWUQVVPjESV[t$ j:Vwt/jQPm tt$V[1^[ÐVYT$փ1u t^1(^USWVH[Ht$dl$`L$\D$Dȃ= u(<$yL$VPj@QT$tLT 9 $ƅtID$\WU(R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\(1 "DŽ(DŽ Ī $;D$Du ЃH^_[]LUSWVT[|$pL$ll$hD$P= u( $t$ u L$WPj@Qt$t$ T$Ijj 'D$Wt$  $t$j 9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ `;D$Pu T^_[] KUSWVD[ØL$`T$dt$X}|$@uM u (t9ƀ RQt$dPj@W9 tRQt$dV M;L$@uD^_[]iJSWV[|$=uj u (tVw0}tL!(c TDŽ(DŽ W1^_[ÐUSWVP[8D$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=m 1T$ vPQj@R躾x. VPR脉 bl<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1ӥE;D$Lu^P^_[]Ët$d(  DŽ(DŽ x,$1,$u!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:# D$t$DRL$D# A @`? 7 19<$# D$D@ @`ƒ?7 91# D$D@ @`Ń?+7 9# D$D@ D$@|$`D$?7 ;|$  ՋL$#  <$‹D$Dp# D$L$ D1 <@4$T$<`Ń?|$_u+7 19QL$ T$D $L @`ʃ?|$_u7 19 l$ D$L(D$<_D$$D @`Ń?+7 19 ՋL$ T$D |$_$D @`ƒ?7 9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t  ;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?37 |$D/? 7 D/ ?7 D/D$7 /T$T$L$ t$ ?37 D/? 7 D/ ?7 D/D$7 D/D$L$ < 7 L/ ?7 L/ 7 D/D/ # <$<$";USWV[Õ$D$$4  ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# Hg3g4t2tkƷ< sԃ1@tt# tlj瀍 ;8 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ Ig|$| t!qtAD>1tBD>׹@# HgD,|t.tkŷ< s݃1@tt# tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# Ig|$| t!qtAD>1tBD>׸@# HgD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ; 1ttD~t# h  fABg w~4ABg w~4ABg w~4ABg w~4ABg w~4Ag wʼn41 @tt# tlj瀍 ; 1ttD~t1h$Qg$A# g$B# $u1 @tt# tlj瀍 ; 1ttD~t⍃h# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فphр3ʉрUɀʈǃ4$ ǃ0$ ǃ,$ ǃ($ ǃ$$ ǃ $ ǃ$ ǃ$ ΀$ D$$ D$x$ D$t$ D$p$ D$l$  ʋD$h$ ыD$d$ D$`$ D$\$  D$X$ D$T$ D$P$ D$L$  D$H$ D$D$ D$@$ ʋD$<$ D$8$ D$4$  D$0$ D$,$ D$($ ΋D$$$ D$ $ D$$  ω D$$ ɋD$$ ? ? ։? T$ځ¸ $T$ 1$ u$ E$ Qu$ ƃu %?? lj%?  $T$ @D$Xƃ4 $ ΃8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ J΃ 8 <  ˸ ˼ 8 < HG 4$l$T$ L$ Ń4Ƹ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[])USWV(]HD$<X%UUUUʁUUUՍ4P᪪Ÿ ż x 8 < x   x 8 < x   x 8 < x   UUUU 8 < $؃Ÿ ż x 8 < x   x 8 < x   x 8 < x   T$H 8 l$ < ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$8 D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x 8 < x   $x 8 < x   $x 8 < x = = $x 8 < x   ȃx 8 < x   x 8! ́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$Vu.1$xU6i$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-x PQR_h$DUt$@VK j jW= hjU- hj$P D$@hjP D$<;$`u`d^_[]D$RW返D$tyT$@PQhR]l$ $fffffSV[-D$ h`rƉP觽)Ɖ^[ÐUSWV[l$0 jD$PUh thUh`) $)D$j PUv $l$1}$K1D=t<$t h`tt$, gō L& 4$t$L$QWPjbV$8& L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃 t$ Wt$t$Pjbt$(V趍L& 8& 9&  :& jQPR ;P& ;& <&  =& jQP ;T& >& ?&  @& jQP ;X& A& B&  C& jQP ;\& D& E&  F& jQP ;`& G& H&  I& jQPS ;d& J& K&  8& jQP  Ƅ;h& jjt$ ^_[]fffffUSWVD[|$\w t2t$`tD$@jPVđ NjD$@9t8tmtD^_[]Ut8"u tr臲D$yD$ kD$D$[D$<D$8wD$X$2a$ WQjP90  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[l$hUAƉD$ D$PljD$V D$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$ t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[(t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Njt$t$t$@[ÐS[jt$t$t$[ÐS[jt$t$t$[ÐS[þjt$ [ÐS[Þjt$ h[ÐS[~jt$ H[ÐUSWV[Xt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[x~t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Ø}t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX|L$Q##wÍ %ÐUSWV [È||$(l$$t$ D$4!;D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[{D$ hPt$F [ÐS[þ{ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[-{D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[HOD$pML$LjPt$lv D$h|$df$D$V L$)L$D$PVWD$ |$$v=D$,t$.D$lp8L$ QjjV V1 |$)cƃPD$2PL$QH ? $ $$m=|$D$lp,t$ jjt$>V^ V |$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>V VV |$)Ƌ $PD$2PL$Ql rg $ $,p=D$D$lp0t$ jjt$>V V |$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7誹L$R)уtuÐWVt$  r!̐cw^_fffffSWV[ìHt$|$G@hjPT T{j@PWb g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[ÅF$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV' h$$VQhVU< hV1;$u Ą^_[]lUSWV [Dl$(16t$ %T$$NP NT  ()`N`L$$WRPc ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_nC$hRPN RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX${L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P| g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]̣ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[Ø1|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[/D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*|E E(}$uM$뉾1^_[]ÐUSWV[.D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*|E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ř-$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$1&4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$ &$FQ? T$‰ً$|$D$G<uD$ $X% $ru T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4(L$ |$ )t$)t$$t$,)wD$ L$?? n% T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍%FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N M&FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q賾 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj q%&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B -%Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅFGPGX FGTG\GG?$L$u aD?%FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  &FL$Q? &FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$&$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't&D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$c&~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=r%$FL$Q?P$D%$NL$Q?D$T$ ߋ t$%$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $xUSWV[ViE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8ϩ }43M(U,E4E09w)RVP螩 E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[Lt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU| F4n0)Pv8Ug 1tN0^_[]ÐUSWV[Kt$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[(L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R¢T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVX5D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$4L$@D$?? u)D$(c&L$(&É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+hT$D$tq01t ^_Átփ*tUSWV _(L$ y y$q9NQǃ8|$L|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ80D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPH )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw | o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw I{ o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw ex o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQw F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw pw o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQwL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw Vv o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw =u o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw dt o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw s o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq Nr $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq 8p $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv d^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv >] n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu Y } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu jW } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu V } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XtÐUSWV^XL$4t;T$8\$0Ӄs3I͉у1&Ӊi913tƒT$4zR13tƒT$4zR13tƒl$4M1ʉ3txT$  1ϋL$ 3tÃ1ؐ\=13t\=13t9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3t3t3.t3t $3Qt3t3t3t $3At3t3t3tD$ $3A t3t3t3t|$D$ $3At3t3tЉ3t|$|$ $L$l$11D$D$33t3t3t3t3W13t3t3t3t3G13t3t3tȋT$3t3W 1‰3t3t3t\$3t3_1ˋT$ )3t3t3tÉ3tϐÉ13tW13tW13tW13tW13tW13tW1Љ3tO13tRЃ^_[]ÐS[t$t$t$ [ÐUSWVXج$D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX$T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐUSWVPX$T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Nt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXÐUÐXoT$J r ,ù)ы,ÐS[.D$D$ Pv[ÐS[t$ '[ffXߣL$ T $ h, | 0 |8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_KT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P BL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX(D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$tPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YbL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +8)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +`)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[t$xƅt|$7V@G P ^_[ÐSV[́t$ )tt$Pf@F14P )P^[ÐUSWV[xt$ԯtLƋ|$$l$ $P @D$PWU&2 1uO(Vu O(^_[]ÐUSWV[|$GtE/D(U8]wUt#V譡=yarau D$0VS+O1^_[]ÐUSWV[k|$GtE/D(U\wU t#V-=tcidu D$0VӞN1^_[]ÐUSWV[L$A1t3)D(U6\NjD$pUt D$8BN0^_[]ÐUSWV[Ël$M1tMuD1V[uV't(WJ=yarauD$8M W1^_[]ÐUSWV[l$M1tMuD1Ve[uVt(Wڟ=tciduD$8eM W{1^_[]ÐSWV[é~Pt$ t$ ~/ t6D$t7<$D8WZt$W1tD$ 01LL^_[SWV[)~Pt$ t$ . tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"[LVqIL^_[ÐSWV[É}Pt$ t$ ^. tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"KVћK^_[ÐS[|L$T$ jt$t$ [ÐUSWV[ö|QƋl$$PK;D$PUWg- tgVND$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6J 4J8Vu 댅t D$ 01J^_[]ÐS[þ{L$T$ htcidt$t$ [ffSV[Í{t$t$u_Pj=tciduL$1=tcid^[ÐUSWV[;{t$t$#_P=loobul$VEloob^_[]ÐSVP[zD$Pt&Pt$t$` D$VbD$1^[ÐSVP[Ìzt$t$Vt$t$` D$VD$1^[ÐSV[=zt$t$t$!^VP8^[ÐSV[ zt$t$t$]VP9^[ÐSV[yt$t$t$]VPg9^[ÐSV[íyt$t$t$]VP9^[ÐSV[}yt$t$t$a]VP':^[ÐSV[Myt$t$t$1]VP7:^[ÐSV[yt$t$t$]VP:^[ÐSV[xt$t$t$\VP:^[ÐSV[ýxt$t$t$\VPW;^[ÐSV[Íxt$t$t$q\VP;^[ÐSV[]xt$t$t$A\VP;^[ÐSV[-xt$t$t$\VP<^[ÐSV[wt$t$t$[VPw<^[ÐSV[wt$t$t$[VP<^[ÐSV[Ýwt$t$t$[VP<^[ÐSV[mwt$t$t$Q[VP<^[ÐSV[=wt$t$t$![VP=^[ÐSV[ wt$t$t$ZVPg=^[ÐSV[vt$t$t$ZVP=^[ÐSV[ívt$t$t$ZVP=^[ÐSVP[|vD$QP0t&Pt$t$\ D$VD$1^[ÐSVP[vD$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[üuD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[\uD$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[tt$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[ÜtD$QP.t&Pt$t$Z D$VD$1^[ÐSVP[^_[]ÐVYnLT$1t 92t^ËBu0^ÐUSWV [(L|$ 19t$$9Gt{o F D$D$P0t[$W0ȅtЋT$ՋVtэQPRt$t$V1Owo tQX1 ^_[]ÐUSWVP[ZKl$9EuwD$tyEti} P $PptFUu0t$RQt$ P0M}u tQ1^_[]Í('F'PQh;RS[ÎJD$t9u L$ t9t1[QPjk[ÐS[NJL$t 9t1[ËD$ Iu0PQ [ÐS[IL$t 9t1[ËD$ Iu0PQE [ÐSV[íID$ t9u L$t9tf^[Ëp0ЅtItRP אS[NIL$t 9tf[ËD$ Iu0PQ [ÐUSWV [Hl$(|$$}(tD$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY\>D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY=D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY<=D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y<D$t9u@H@ty1ËT$ BÐSVPYl<D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY;D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY];D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY:D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX:T$t9uBJBuy1ËT$JÐSVY]:D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY9D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY|9D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY8D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX8T$t9uBJBuy1ËT$JÐS[N8D$t9u L$ t9t1[QP*Y[ÐVY8D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY7D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYn7D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY7D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [6u t1D$D$ D$~N~(DN+t 0tV-usD$WPv$ T$ D$1ɿ98"yxuD$j\D$WPv$ T$ D$D$9T$rFM8"utjPVl tu L$e^_[]ÐS[5' jPq( PQ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[3D$0( VPOV軷1^[ÐUSWV [ø3t$4NswD$8t)@tc@uکppQj WgjUVEZ tWVWWt UVI[1 ^_[]ÍN)5)(PQhR+WVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[î2lPQq' Pn[ÐS[n2' Pn[fD$w sÐS[2D$ ;D$uPt$t${| [1[ÐUSWV[1D$ t$tP{D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋$L$qD$ tL$9QWPz 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋ H vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í)))PQhRCUSWV ]/D$ \$$p1}<"$N<\u< $1ۃރSTl$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋ(Hptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ&* *)PQhRUSWV0[*$Du wj011<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} wP$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉pr*D$x*D$Ews 搐<<}jt$W9 tfjt$W& tS*jPW E $AEtLt@<-Eu<-u}>u$h\t u94$ƪ10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U:D$m$hō*D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$@$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[Î#jt$ [ÐUSWV[e#$j,$hjV9Y t5ōD$ PU$t $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjUYtjVU?^ |$t'jjjhjt$P跓|$t-$U~jWU] WU&lTVUlCS[."jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[ý j@ ƅtCpPV>jP^F,F0F4F8F<^[ÐUSWV[I t3PjJtjj@}DžuUOj@b1t=pPW8>GjPj]o,w0G4G8G<1^_[]ÐL$WUSWV[Øt$1p9nU(]N4 Džtbl$~4<$tC1퐐F,t1t$$ٓU. ^_[]Í.h.*PQhRS[îPt$ [ÐS[~jt$t$T; [ÐS[NPt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(&++*PQhjRQFGPLW11^_[]É.*+*PQhhR8-1+*PQhyR++*PQhRS[ L$A4tPQ4I,Dt*Pa,[Í++*PQhR++*PQhR~USWV,[H D$@xl$DuVJ}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,V~JPt$D54^_[]jj蹉tt$ LAt$DVL$*L$ql$$9.|$FWUP jfuDžt!PW> Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Utt^Ut$D$PZ U;1$D$jtt"WPt$ED$E E^_[]ÐZL$1t 9tËA ÐZL$1t 9tËAÐSV[ÝT$ t19 uL$t r ;t$v1^[ËR1ttVRQS ᐐUSWVP[:D$1t 9t ^_[]ËHh t( $tDU\st؉Ut$P ąt //.PQhRG//.PQhRZL$1t 9tËAÐS[^D$t9u L$ t9t1[QP: [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVq^I ֐USWV [t$(>t~(t  ^_[]ËFOjQvPgt҃~$tD$jPv @ ʼn$u 8"tD$N N$9u8"t=/n/.PQhR71jPj N,$URq7ǍFPD$PU tcD$;$uZfjPV tD|$u W肁1,$jpƅt-PVF~n WEt W3D$$0USWV[8y1D$4$G=w ԷՍ̸jAPV( r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[]D$0FuFt PV1^[ÐUSWV[l$(Ewd|$, .jD$PU! 8Gw t$OL$oD$̸Pt$,VD$L$?̸PVD$?̸PVqp?̸PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$̸Pl$,UD$0 ;̸PUZtsL$=tD$̸PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]ÍN)/.PQjtRSV[]L$t$ 9t8V 1;Q u.FtRqPB 1uyu"^[Í//.PQhR//.PQhRffffSV[ý PQ6|$ uX( L( V^[ÐSV[mt$ 1t9u V^[Y?D$t 9t1ÀxÐYD$t 9t1ÀxÐS[D$t9u L$ t9t1[QP[ÐSWV[Üt$~uo~(ti jPvvMtL( !jPvv*t1X( |$ PQF5V7^_[Í^0G0 0PQhRSV[L( VPƃT( X( VPƃ`( 1^[Ð1ÐS[ÎD$L$ yt0@QP`[ÐVZNL$1t91u T$ t92t^19^ffffSWV[ j@\hƅtEPWV4>jPb2F,F0F4F8F<^_[ÐUSWVP[Øt3Pjqtrj@gDžuU@xWj@g1tE,$PUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[|$1tvP9uloUp1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[Ú*։ $|$?uwG8]u<GcjjWr tC jPwwt,t1\jjPUt$t1U^_[]Í|3_30PQhRRS[pPt$ þ[ÐS[Þjt$t$t [ÐS[npPt$ [ÐUSWV[;t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%1Q10PQjmRϰQlGP]&Wyl1^_[]É.b1Q10PQjkR胰-1Q10PQj|RgS[>D$H4tH4[Í 210PQhR!USWV[D$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W@%$W/%pPt$0\ ^_[]jjjdtAD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðN)c54PQhRաSWV[ìt$~ t 1j Vt ;~ r^_[ÐSWV[l|$t$t0t*PVtuj Vm^_[1SWV[ t$F|$uLPVujVm1^_[ÍN)54PQh$RSWV[t$F|$uEPVtiu]jV}1^_[ÍN)54PQhER#USWV[t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]ÍN)54PQhdR賝USWVP[ÊD$1ɅQh Dt$7jH1Ƀ#hH$GGG wtHt$WՃj W=tjW$$<5PWtiu千~6PQWq tDj Wt5D$h VPW`tj WZ7XW X $ȃ^_[]ÐUSWV [$($$WtEP蘒x=ŋ$$t$t`?t[Wut.H|/t+1]/$,9/;9sfD$ .t$ VH rܡ?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$D tYjLPLUt$u t*l$ WU $t1$t$2$l$ 8t$H t U88V)Vܠ8$ ^_[]É,$9tG9t iy/t)rD$ UWPs D, ,$S[jt$t$ [ÐS[Îjt$ [ÐfffffD$ǀǀÐUSWV[;T$$L$ |$l$t$u2jlDtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1666PQjAR讘766PQjBR蒘USWV[kT$t]D$ |$L$tKutUtMtM L$$tEUSL1Ht t L t L |$$t L2 ^_[]ÍJ7:76PQjZR託ffffUSWV[xD$8t|$4D$0uTHL$HL$HL$H L$H L$H $x p PHdl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dVa4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Ht$@|$[fffffS[.t$t$jt$t$t$8>[fS[t$t$jt$t$t$(>[fYXZQ̀QQrS[t[fffffffS[Þt$t$t$t$N[ffffS[nt$t$t$R= [ffffffS[>1;D$[ÐS[1;D$I[S[88t jѐ1[ÐS[þ88t j衐1[ÐS[Î88t jq1[ÐS[^88t jA1[ÐS[.88t j1[ÐS[88t j1[ÐS[88t j豏1[ÐS[Þ88t j聏1[ÐS[n88t jQ1[ÐS[>88t j!1[ÐUSWVX d( ?) R4p( ѐ>t1 @u~1ɍp( >t 9u#;T$t$1 ^_[]Í4o:o:PQj>RwffffUSWV[$ÑL$(3qL$,*L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍyQPjmS[ެL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Ôt3T$8tOl$@to*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ &1$q0^_[]Ë$<-u FD$,Пt$0vE<+<-~؟L$ ԟXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő؟<0Пԟ؟ȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$؟+ԟ|$ /V؟tԟuԟП<-u ~П4$<:tkE$<4$P1L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$PJ $? t/ǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^W0ПD8t}:tjWP赈Wx:L$T$,ПL$ $_D$p70П:t%j=R00@)D$Cԟȉ $؟|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VSD$\(pD$D$ 1T$ $ $.T$tf\$QURAT uU4S $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:hRQP \$؟+ԟL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tRQP萅 1L$\|1uD1 <-t<+::BtD8tD$X8:t˺RP1?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP~1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80ПD8t}:t4$P $E<-t<+u:}:1<: :2=%=>PQj/RVffffSV[ít$ tjVO^[Í>>O>PQj/R@VfffffUSWV[[t$l$tyjjR 1trjtkNjD$oGG E|u|tsPjQRjWtKjPj ^[1^_[]J[8l$uE-[8$[(Wa|$7S[(릐USWVP[Jt$ l$ME 1҉s9r J9sAEOQ0N t`U)ƒQjRD$ V E $}E T$)9w΋MVRP- E E MU9r‰^_[]ÐUSWV[{T$L$t$ D$t0tUyy>>>PQhRKSpxA)9}8YTi t?>>>PQhRRx3rH HPp 9r@ 1^_[]>Y䐐S[~t$O1[fS[^Xt$ t$ P1^_[]Í/?>PQj4RzRŐSV[Ýt$ tjjjV0^[Í9?>PQjAR,RfffSWV[L|$t$t1hPWV0^_[Íz?D?PQj6RQfffSV[t$ tjjjjV t^[Í???PQj0RtQfffffffS[Ît$j t$t$[fffffUSWV[[t$|$tBjWG0~G0t ujW,2^_[]Í@?PQj/RP띐USWV[ۇt$|$ttft77t9fh L$f@Hx$p,L$ H(L$$HDL$(H V1^_[]ÐUSWV[Xj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$yt,ztڍyuft?$L$Ut: $fH f@xp$L$H,h(@D\zH -UWf 1^_[]ÐS[nL$ D$T$rRQ0P [ÐUSWV[+|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[΅D$t$t$t$0P [ÐSWV[ÜD$8pPg tWփ1^_[ffffffUSWV[[T$l$t\tE0~-},t xr }$t jr2Uʭ1Ƀ^_[]Í?@֍@PQj;RMuG@?@֍@PQjE%EDPQhR^C~uр~|$^[ÐSV[]zt$ t ~t/FE:EDPQhRB~uN .wu^[ÐSV[yt$ t41~t^[ÊV u.wL$~9|ԍEPEDPQhRWB먐SV[}yt$ t~t0^[ÍEeEDPQhR B~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[x|$t$t@1u6T$L$9w"QjVC FfFF^_[ÍD{EDPQh.R6A뜐SWV[\xt$t>~u/L$Fy |y|9IL |F1^_[ÍDEDPQhMR@랐USWV[wt$,|$(O $$PWV  N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍEEDPQhhR?EEDPQhiRW?SV[mvt$ t"~uDNu;V9r1-DEDPQhR>~t^[ÐSV[ut$ t31~u(NuV9rT$x 9v ^[ÍDEDPQhRh>fSV[Íut$ 9y ^[Í3FFEPQjTR>אUSWV[;ut$|$t.l$tGMϸwG)o >1^_[]ÍDGFEPQjbR=뱍ZFGFEPQjcR=또USWV Xt$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ>D$0 28t p׾$VPU 7+D$p)t5u+VQA$RjPO> 7D$)smH1 ^_[]Ë$EhF֍EPQhR;D$4$}FhF֍EPQhR;g$F΍hFEPQhR;D$a$xGL$dGՍEPQhR[;L$USWV[hrl$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQ< D$ }+$x)t6u,WQARjP\< l$}<$)s8O^_[]ÍEF֍EPQhR9F͍FEPQhR9렍xGL$dGՍEPQhR9L$;SWV[üpt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9EFEPQhR86FFEPQhR8)뒐SWV[Üot$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1EFEPQhWRg7FFEPQhXR=7VL$t"T$ tփuQ^ÐUSWVP[n|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP98 D$$L$(l$0O}^_[]Í GF$EPQhR5T$L$8D$4VU.GFՍEPQhR5\SWV[ül|$L$1uLwt?;t$w6)w*t$uQRjQ47 ^_[ÐSWV[wuHPQ@t4$$$WPVE)$$PhQR$K$@l$$hp V HhPVQ I2D$$p C$p 0m$p>wPV?tbōD$ PV豞x\#D$=uXUL$ QPVxED$$t $;Au=D$H0=OH1CHHH- U[WBt$Vl$E;$ļ^_[]$$$$U똍gH[HGPQhR:ƍ?H[HGPQhRqMH[HGPQhRYUSWV[RD$,L$0T$4t$(/l$$D$ D$f$t$RQPjV;L$u^_[] USWV[uR$D$$D$hP$S$k$$UhhWCD$ D$$GƄ4$$$UhhW~Cj Wt$X8D$1$0U t u뜐44 w$h|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&P $@|$L$ t$֋$^D$PjL$Q$&P讽D$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP+JtD$Hɋ$@tD$$L$Q$jP蕼؅$U$1$$׋$$Pu\~$P$W1u7Yu,N$P$'t/t u $Uhh$$W1?11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύI IGPQhRMH IGPQhRgn?H IGPQhR@VUSWV[XLD$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]kUSWV4Չ[KD$$0qƃ- - Ƅ$/jjjhWUV1Ʌ |$$/jjjhPUVxt1D$(D$$D$ D$D$FD$D$D$ $L$ PQRl$U 4$|$.vt:D$.jjjhWvvuW$3P u,$@$/u- JPRQjt14$D$;$0u4ȁ4^_[]ÍgHJGPQhRh莺USWV0։[I$DE$,8aƄ$+$+jjjhPVW1D$$D$ D$D$D$D$D$ D$GD$ D$$L$PQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/PH u$l$1PE;$,ue0^_[]ÍgHJGPQhR@$TJJGPQhRx貸fUSWV[(H|$,D$(/D$wl$GQjP G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#,K΍"KJPQj`RaD$,H$$t$,F $)ʃr#TK"KJPQj}RF$)N)!r s.^_[]ÍhH"KJPQjCRzK"K׍JPQhR몐USWV [èEt$ ~Nƃ1 V҉$t`L$FшT$?r?鍋1 $j@UPQQ\$+1 ~t0|$>L$:$u 1 uL$>͍ >T$1ҍ1 -9si$:HU;L$s>t 9sE.9r9s34$Hh9s맋 $1 9s$1 ^_[]fffffUSWV[KDt$|$lUl8PPWVEUL^_[]fSWV[Ct$ W!PPV W^_[ffffUSWV[èCt$tLD$F$V~nF1 PUWRt$t$QjVV)$^_[]ÍKKPQj3R 듐USWV[C|$,L$T$ |$l$捃KUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]Í܆KKPQjBR5 [USWVH[HBl$`D$ D$D|$\SrE$MUu}mLUWVRQt$PjD$JP'$$>w)LPQ6,jjjjPpƍ0+VdjjjjWoƅQUVL$\ QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$$H$0WD$ ;$L]>w)LPQ>(Ÿ4$jjjjUlƍD$$1+ VdjjjjUkƅbt$$V$L |$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$rD$$LD$ AD$AD$AD$AD$AW$L?/D$(PJRLL$QL$ Qt$($TPt$hh@Vp 1lj,$t$\hVWo Ņ~UVD$ P? e0WpU0,$xj$uj!ƅth$\L$QPG1\2F 2LFuF E;$lu5p^_[]1㍃LLlLPQjNRwUSWVl[8$D$h$U=$$U= uj!ƅtXD$XUPF1LX2F 2LFuF ;D$hu2l^_[]1ꍃLLlLPQjhRJ聨S[7t$ t$ [ÐS[7t$ t$ v[ÐSV[ý7L1 jPVM D$ jVPjY^[fD$ȉty!fUSWV[H7t$0l$,D$tjuj)|ƅtRUP1 2F 2LFuF(;D$u6^_[]1ꍃL(MLPQjFRourUSWV[u6$ $$P'h@V9l1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$?k ƅ~.V$P$P |) u84$l8|$$uj)nƅ~$$QP12F 2LFuF(4$Wk|$;$u^_[]1S[n4jjjjt$t$[ÐUSWVt[84$D$p$U$$U= uj)AƅtXD$\UPk1L\2F 2LFuF(;D$pu5t^_[]1ꍃL1MLPQhR+GΣfffffffUSWV\[83|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍMM;MPQhRMM;MPQhR$xffffUSWV[t$0l$,D$tjuj)ƅtRUP1 2F 2LFuF(;D$u6^_[]1ꍃL*NMPQjFRur讏USWV[$ $$Ph@VT1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ y|=P$Pt$S ƅ~.V$P$P` |) u84$Tq8|$$uj)ƅ~$$QP12F 2LFuF(4$W T|$;$u^_[]1討蓍S[jjjjt$t$[ÐUSWVt[$D$p$U$$U uj)ƅtXD$\UP1L\2F 2LFuF(;D$pu5t^_[]1ꍃL5NMPQhRGnfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Út$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP8 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPܼ ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [è|$$D$OGD$ $?17l$ )ȃ81D$D$ $jjUPjWD$D$$jjUPjWМD$D$$jjUWjP藜u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR 1u ^_[]ÃtOw OsҍH4otNANPQjjPUzu u @t tQUuNjPU0u t 1^_[]ÍuEjPV u DžtjPVt 1uú!?E1u<-ut<+uXMDHt$}D$j PWa L$9e9$YQH}+t؍ ߃/Љ(!ffffVZL$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[yt$(WjV xqN|$,t?r$d$D?r'- d$!L$jWV ^_[fffffffSWVP[t$tB5 PQhRx>L$ $5 )QVWRCy5 PQhRX5 = t@= ^_[fffUSWV[t$D$D$I@t NQw |ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í7O.ONPQjbRUSWVX[D$lD$ 8D$DD$@D$Ǩ̽t\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ÍKODONPQhtRHSWV[i|$t$t5$D$ WVjjjP[1Ƀىȃ^_[Í4oOeOPQj:RѷffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tP)rkt4)PsD$(8rl$ ugPt$艧ŋ$t$b0sD$8tP(W6p4$&#t$#Һ01UPt$"ŋD$G6"oD$ G > > D$8tP(G^_[]ÍOOPQhR耴OOPQhRVT$(#*3qÑ=jUPQRV_j蕸USWV׉L$[22jeVj+Vt-1T|$WjPj%eyFu<$|$1jrVat?R $UW`ft1j]u%%07\!wQ! 01^_[]ÐUSWV׉[G> tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[èt$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$#ŋ$t$]谷0D$8tP9%Wl4$t$q01UPt$ŋD$G6oD$ G > > D$8tP$G^_[]ÍOOPQhROOPQhRt$,|$(T$0VWU jHUSWV[t$8$8tP#> t9ut>mt9uu+$8tP#h1VϥEu> $8tPy#|$jWu u ƃu 趵8tUjtt$^_[]ÍOOOPQhR覯fffffffUSWVH[øD$`|$\t$$UVPWStUVt$aǃu.8uj5E~;$} VPaǍD$9tLVjA$jD$P:ct&UPt$hW(S{D$$oH^_[]ÉƍEP9PPPQj>R葮fffUSWV4[èD$\l$HSt$XoL$`u0tDunuRt덻`tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0L$ V蒢 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$Ń|$jt$ RUܠ|$tUjt$ RPŠ|$t>jt$ RP讠l$t%jt$ RP蕠tjt$ RP耠T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQ跟щ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPaƉр|$ul$эP4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0w0L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$wL$,T$$ QP4$Qt$(V0WRUt$h$[4$|$2jjdQUыT$,t$$rP4$Rt$(QPVt$dVt$d> 9wijt$ QR贝щ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRNщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\ijt$ QRD$ ы4$T$\B;SPPQj8RD$lPSPPQj9RƧmfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í|QύPPPQhR譥>USWV։[$$F t%G HO =r$,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ~ D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í|QQPPQhRܢ[PQPPQhR貢4P QPPQhR苢USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVHuD$t @ t$?D$ h |$t$($kPVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPH)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtP0Vt$FPVF^_[]ÍPPPPQhR՚USWVYT$tht$1BtBظkw+|tրztЃːt *u1^_[]ÐUSWV։[d]F,F tvʟFUP[Ol$~D$uNtQjPD$ L$$t$ F1퐐f$t=tsAuE @u1$P-0$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YPQQPPQhERM lt$10đD$/ Njt$$E @D$uPPUu w8t E u;$6Ĥ^_[]ÉNjt$몍1QrQPPQhRTAQrQPPQhR*||QrQPPQhR$cxQrQPPQhRՊOPrQPPQhR變7PQQPPQhER臊L$ PQPPQh/R\L$1USWV[fT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍4o΍PPQhRQ΍PPQhRՇT$8Q΍PPQhR裇T$8ffUSWV[õ$$c$$tu1D$$tŋD$3l$ 1!h@P4D$(D$$D$ iL$L$\QP+itYD$|$D$0t$\ d$<0fD$PPjup] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tP{PWu uhZ0D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P` (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$RjPv? u|$1D$Wt$7Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$RjPD$p)?jPD$p D$ |$t$ztG$`L$tZRjPq@ jPD$p /1ҋ$tRjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8 < Y1D$ D$l$t)ЅD$D$\PjuV |$讅8|$ $%|$tSjPu^ |$t&oD$u|$R8|$ $tt$Dtu V范$t$jl$ UN 1$u U>:;$uEČ^_[]Ë|$|$[|RQQPQj_R~y&S[jhjt$t$t$[ÐSWV[̵> t- > jhjVPt$$t8> 0jFc > > tP(> u^_[ffUSWV[K|$> jjj耠 > l$> tUQ> S > t]1i > 9> wHt Q8 > W(> t$UWP > u 1T$ Ɖ^_[]Í_RSRRPQj u> jP[0xƃ> 1> t > 1W2^_[ÐUSWV[۳ W> u> jP/x5ƃ> > UPr";D$wUt$ť1 0W^_[]ÐS[Nt$:.ƃ> [fffffffUSWV8[u }D$D$L$$jjPQjRMtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍRRoRPQjERz*RRoRPQjFRzffffUSWV [RPq10t\ƀ8tUT$D$j PVW tŋT$t|zt)RVP蕣1ɿ0kP&wA5@ʹ&u0@9~ $RjP,$SVPT$t$$D$ t %S.> RUPjQ葖L$ t>.> ^_[]ffSV[mD> u*ǃd> >wH!PV謚D> ttH> VP1^[ÐSV[ǃd> D> tP9>wH!PV+D> uVPj1^[ÐUSWV [Å$ǃH> ǃL> ǃP> ǃT> ǃX> ǃ\> ǃ`> h> D> hhUD$ 1Ʌ$t$L$ $t$ X> L$l$<ǃH> D> hhU耠D$ d> t$P@/j\WVO t8t剃H> 8#tj\WVwO t8t뉃L> j\WVWO t8t뉃P> j\WV7O 68t牃T> ǃ\> ǃ`> j\WVN tD8tPU\> j\WVN t8tP%`> hT> |$$W# |$3 j\PD$ P}N ǀ8tWku͍tUWmthUW|mtTPUWhmt@;UWTmt,UW@mt'UW,mQX> E5xxMf l$<$j\WVM 8t牃H> 8#j\t$VdM t8t艃L> j\t$VDM tOǀ8t扻X> 'PWcl"T> ;PWEltbce`T> D$H!{Sd> PQ諝 X> l$tэ'QPkuP> <$j\WVwL t8<$tP\> j\WVGL X8<$tP`> t$t$1ɋ;$u ȁ ^_[]7SWV[ìt$ǃd> D> t P蛟&>wH!PWӔD> t*t+VH> ju䍃H> WP 1^_[Í4oeS2SPQhRrZSWV[ܩt$ǃd> D> t P˞&>wH!PWD> t*t+VL> iu䍃H> WP 1^_[Í4opS2SPQhRqZS[D> tPcgǃD> [ffS[ިL$T$ j@t$[ÐUSWV8[æt$PT$$t$,ZT$LXD$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$W[t$ Pž[SWV[||$t$tWhVY ^_[Í?TNTPQj1RQ̐T$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[t[Ḯ̀rS[Ćt[ḭ̀rS[ät[̀ffff̀ffff/̀ffff^̀rS[Tt[̀rS[4t[Ḥ̀rS[t[<̀rS[t[̀rS[ԅt[ḇ̀rS[ôt[̀rS[Ôt[ḓ̀rS[tt[̀rS[Tt[`̀rS[4t[R̀rS[t[2̀rS[t[ḩ̀rS[Ԅt[P̀rS[ôt[ḷ̀rS[Ôt[Ḷ̀rS[tt[ḉ̀rS[Tt[̀rS[4t[Ḛ̀rS[t[̀rS[t[Ḩ̀rS[ԃt[1̀rS[ôt[Ḍ̀rS[Ôt[òrS[tt[ìrS[Tt[l̀rS[4t[t̀rS[t[s̀rS[t[r̀rS[Ԃt[p̀rS[ôt[j̀rS[Ôt[m̀rS[tt[̀rS[Tt[Z̀rS[4t[ ̀rS[t[!̀rS[t[S[ށt[ᐐ*̀r׋L$Q1fffffỲrJ!QS[Ît[fffffS[nLSV[MK tFL PjGtsL 4+L 4 L L R" ^[ËL HL jjjhjPj1tȉK uj$Pj jMS[ÎD$L );K t PN[à QP*[ÐS[NjP%PL uP>k[ffffS[hPt$t$t$ [ÐUSWV8[uD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$yXDP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P<Pt$t$= ZD$x$W<Pt$W @D$x$W<Pt$W )D$x $W\<Pt$W D$x$W1<Pt$W uD$x$W<Pt$Wf zD$x$W;Pt$W; `D$x$W;Pt$W <D$x $W;Pt$W D$x$$WZ;Pt$W D$x($W/;Pt$W D$x,$W;Pt$Wd 1D$D$$T$EHL$D$D$D$ P:Pt$t$ D$@D$ Po:Pt$t$  D$@D$ P>:Pt$t$  D$@ D$ P :Pt$t$j  D$@D$ P9Pt$t$9 D$@D$ P9Pt$t$ D$@D$Pz9Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ :|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ TD$ T|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$T|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V2D$Pt$V ID$ Vc2D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uPx=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$hQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$\ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|+VVUPQjIR&USWV[ë]l$L$t*t$1Ґtuщ )4@tRjP)( ^_[]fffffffUSWV[(]t$$|$(9jVPƿWLjVt$, t$(|D$l$,L$ t-|$,RUT$bT$t .l$(RRl$(T$tX$|$  tQ`T$ <$*^_[]ffffSV[}[D$L$ t(T$t L$ RPQ肰 Ttƅu D$ #jQ) )01^[ffffUSWV[[$$t|4r)uŦVVPQjDRv#jjU ;r) $$DŽ$DŽ$$jPJ$8jPDŽ$PDŽ$TDŽ$X$`V$`DŽ$hfDŽ$lf$n$pDŽ$t$|DŽ$$DŽ$DŽ$$$$V芅ƅxU1Ƀ ΋;$u ļ^_[]S[.Yht$t$Pt$[fffSP[XD$ L$T$$RQP+G[ÐSVP[XD$L$T$t$4$VRQP5E^[fffffffUSWV[ÈXD$,|$$l$0trjjWVWG0tW@9t Q G0ǀǀ GGG yw%\1|$,u"fG GGCGGƍD$ L$PQWM T$T$tD$(Չ 1tL;l$t1Ƀ|$, fO Gou GAu0o/$UtB1$ʀ;l$uG݉ojW^_[]þD$9tP'u$WVPQj?ReD$< WL$W$VPQhR3L$T$ WWVPQhRffffffUSWV[Vl$jU}(t4UEE u8jjjuU(!ЃtsE jUW$^uP}Tut5Et.+E EM0)׃9t E<)jUjUt^_[]fffffffUSWV[+Ul$jU$}(t8UUE uEFt PF tT~tE1t(0F t((F t( ~;~s F @ƋF PbF,t PRF4tP=F8t P-V$^_[]Í BVWWPQjKR?e_WVWWPQjMR?efffffffSWV[Rt$HW\L PVnW؎^_[ÐSV[ÍRHV趎\L P'mV螎^[ÐSWV[LRHWu\L dL PQmWT^_[fffffUSWV[Qt$l$VvZVt$z[1u<$Vt$R[DžtpU7t]wtуUPt u막t$~utQ^_[]É1ԍ4oWxWPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsXOXXPQhRv0UXOX֍XPQhRMUSWV [hGL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2dXXPQhR ^_[]Ël$ u렍΍dXXPQhR΍dXXPQhRS[îEt$t$jt$ [ÐS[~Ejt$jt$[ÐS[NEjt$t$t$[fffffUSWV[EL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(ƉDl$Utwn$Nj 0Q 1L utjh=dʼnL 0ƃL LtMjуL @1t*n$F,UQj P)|$z^_[]ËL )USWV[ëCL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(葶ƉDl$Utwn$Nj 0Q謸 1L utjhʼnL 0ƃL LtMjуL @1t*n$F,UQj P(|$z^_[]ËL )USWVP[:Bl$UNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj("ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[J@l$UNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(2ŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[[>t$|$ tЋL t61=tDtPǃL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃL D$ 1^_[]ÐUSWV[K=t$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtP|ǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[5<$tA$1uhjƅtcD$E/$tt$$9ux/Ĕ^_[]z?$9u/XH>8?USWV[{9t$tD$tdPV$xaa1ɐ΍,?UQ肷t&UP$y.w8"tV 1^_[]ffffUSWV[8t$V~L PL ƃL X tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PۻǃL ǃL 1v ^_[]ÐUSWV[û7|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í;]]PQhR]^]]PQhR6USWVP[ú6|$t$t#l$ t?tajUjW^_[]Í;^]PQhR1빍^^]PQhR u4o^]PQhRxUSWVP[5$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh[$p $L$1xjjjU|$ `^PQhl$XUjjjh@Ujh@6lj D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$4o,^]PQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP貰T$ )ʼnl$‰$L$\$(l$$|$ t t$ht$,D$l$ tEF4$ŵhD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$yr؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU]5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPn Wt$DU` t$$t$ t$0葳/L$0\$|$8T$L$ D$ɋ,$tt$T$LfT$Ћt$ 9v8)PU蘭|$u(U|$ |$L$1|$04$ֲ0rL P3KL P!L L$ <$14$m$lyD$0P,|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xWJt_WVPw UUx~1L$ ȉŋD$8L$D$8B\$W舱 |$ t$gdUU |$;$LP^_[]0WH^L$^Ս]PQhRL$,8^L$^Ս]PQhRꋴ$tL$,^L$|$^Ս]PQh Ru|$L$,4oL$|$^Ս]PQh R:$|$L$,Ń|$ \$t t$c4$4o,^]PQhR$|4o^]PQhR$|Y\$U誯|$ t\$t$b\$t$0胯X+L$ÐSWV[l+t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í;,^]PQhR}4o,^]PQhR{VSWV[Ü*|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[Í;7^]PQhRu^7^]PQhRpS[)L tPCǃL ǃL ƃL ƃL 1[ÐUSWV[Õ)$,E$$$(L uL ȋL u!>wQ0L L t%1L L PQ1t $D$uz1L VMVǃL L HL @M>wQPL u<X1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$VtfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$V}ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL DB^]PQhR}$<E^B^]PQhRL$<USWV _X%T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPUbtL$(U$Wަ ^_[]Í;L^֍]$PQhR|$^L^֍]$PQhR^|$|$(SL^֍]$PQhR&|$&;]֍]$PQhR$^]֍]PQhRUSWVY!T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdpt]ƃdNJD$$ƹdEt#<:tu)FdPWu`)nuE N$UWt1L$$8$U^j^]PQh`R0$W7^_[]Í;j^֋$]$PQh"RL$V^j^֋$]$PQh#RL$|$$&j^֋$]$PQh$RvL$;]֋$]$PQhR>$^]֍]PQhR USWV[+l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuP芽 F(N8D} '~wF^ FPB^ uWv$Q tƒN ~?:V|@uH)ƒVԋ^ =FF$BBQWP诼 uvv>Q K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 謊S[0t$t$ [ffUSWV [} F FEFUVzRu)ʃԉF:FJFx9u0RuO N ;Nue^_[]ÉfUSWV0[3D$(},PQ&XL t$M L$ML$f|$ L$T$|$QRj WP'BuOt$ rF|$j WP(c u0O L$FD$D$ PjL$Qº 79_t$} urP tgM9uWM % _QPR}Wu19r"y";L$(L |jjP@ PVJD$t$ L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V  uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPu 1ɋt$;D$(u ȍe^_[]VS[^jP;L h P>P [SV[ÍL hVt$t$t$%t1^[fffSV0[Jt$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[\t$|$jWQj VW) jWH^_[fffffffSWV[ t$|$t P >w!`PQE ~^_[ÐSV[ýt$ tPFtPqzFFFtPSzFF^[ÐUSWV[H|$(?u >w!`PQt$$oD$t Uyjjjj|$87P$Gʼnt$Pvt< t< tt$WXvt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P=J D$ L$ 8ukD$ $FD$,t$UumŃzAA jj t$I 28+8tq!0|$(tP߲$tPt .$ tEt@u% ba0`PQjJRvE@NT$RQjjjuЃ>T$u-bbaPQj[R/T$,$ t|$ tEtHHu0Nb5b׍0`PQhRض|$0EHHPVt$0t$0WRUуt z0$^_[]ÍaaaPQj}R聶S[ÞhPt$t$t$t$t$S[ÐUSWVP[Zl$t$D$ $ t t@8u'bb0`PQhR׵@8QUVwЃt 臻0$^_[]ÐUSWVP[l$t$h$ t t@8u'bb0`PQhRE@8QUVwЃt 0$^_[]ffffUSWV[;t$l$SPQW  t"t$ VW EWjjPU觉PQW t$NfffffffS[îjt$t$t$0 [fffffUSWV[xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[][USWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPvgD$tk|$jWWgD$,D$ tND$1ɅujW0gt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWx9!xt19)u|$T$(l$);$Pw|$$XD$0P辧ƃjP ftQ$1 T$|$$T@uX$L$0PVQWt5WD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ ‹D$$t $uCr.|$謴1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V{ DžL$~9t/;$WVQ2L$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j |$l$t$D$P6gt$ *gU!gVgl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$ft$ ft$f넍c-cbPQhR豪wc-cbPQhR蒪c-cbPQhRs9c-cՍbPQhR`Hc-cՍbPQhRתꋌ$hRgc-cՍbPQhR襪2c-cbPQhR̩c-cbPQhR譩RUSWV[xD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]QUSWV[l$ |$t$t V蚟1L$1jUWPV^_[]ÐUSWV[ël$$|$ t$t VJ1L$T$jUWPVp^_[]ÐS[^L$1jt$t$t$t$6[ÐS[.L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[èL$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]OUSWV[(D$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[]9OUSWV[ë|$t$t VN10L$1jUWPVp^_[]ÐUSWV[[|$ t$t V10L$T$jUWPV^_[]ÐUSWV[ |$t$t W訜101jUt$$PW^_[]ÐS[þ0L$1jPt$t$t$[ÐS[~0L$T$ jPt$ t$ t$ Q[ÐS[>0L$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WuuGكs^_[!t_t$t%<FF ^_[ÐUSWV[{|$ u ^_[]l$ t$W\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvP<$|$Dփ 6D$4)D$4@u \҉L$x MVrt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉr$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWqu#XDxuGws>4$$^_[]ËD$4  !rfUS [ÅE$D$D$D$PQwD$e[]fffffS[>t$ t$ [ÐUSWV[$$%= uRl$\4$*KƅtUSWV[X|$7mG(_NLfFLftfuwjfFH4NHʃf uojfFHf G(0jh@P F$NJf~HnHf@u!fu|nH@tN<3OV83W Ok6vjɚF NJGQqRQu𐐐pPO~D'FLfui9t̍%ddcPQhR轓FJt v$oGt!,$hP\OuG,$fEfVjfFHf4G(*0jh@P F$NJpPN~D*GN(~DFFJVVbPj(G(uwgHF,F(nTPUw< j/l$Uwt5;$u~Ut(U D$HQUt$; D$F,GFFF8N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGH茕G D$ D$4L$ $Љj0)t9D$"D$ <u AG OJ3D$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P8ōG UTD$t1 .YMPNQPT$ R5g u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRB4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$؎1AdcPQh1R܈D$u‹.蘎1F)EHftf },$FtpPCu|$t$u N)$xDuW@8/tOF(uI0jh@Ph tFFU$U <$u~yljF^_[]FUSWV[ t$tf8}t v$$>V }t!v$v$v$BVBWz^_[]ÍdddPQjBRFvfffffffS [[hPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[L$T$ hP[ÐUSWV ׉[ôT$4@xtb=t= T$4t=uD T$41PL$HL$DL$@L$ D$l$ L$RPQUWV2=u贋"كTw",# $T$сK1 $  ȉD$D$ ^_[]ÐS[ÞL$T$ t$[ffffff̀rS[dt[̀rS[Dt[ ̀rS[$t[SWV[ |$t$t-9t!t F9u1^_[Í edPQj*R|fffSWV[Ü|$t$tt1WV{^_[ÍUIeePQjBR'uύUIeePQjCR뮐SWV[|$t$tt1WVz{^_[ÍUIeePQjBR觃uύUIeePQjCR脃fffffffS[ÞL$T$ hPt$ [ÐUSWV(T$ [bL$<\$%t$@|$t;D$<|$"v+ƈ1t$ \$VPt\$u<+t<-t D$1 1ҊD$L$1t+ju軅0W諅01^_[Í4oQfePQjFR뙐SWV[ܶ|$h`W1t-t$)u=8Vu-81^_[ÐUSWV T$[oE$ j()ƅF F8$8t j)F$jPD$jPW xl$ t3unio3$$n tD$ u Y8a$nfsu F t$WV tK&88$8tv$v$G9v <9V3981E;$ u ^_[]%SWV|[$PW_1t?#D$=@u$jjWZ t1jG [|^_[ffffffUSWV[Øl$,E D$ƩtT$t |$4L$0L$u8uEV'E ?EED$t$1D$ D$1$1ɐw8l$|$Ut$"2l$)ʼn$ jjj|$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXD$|$tt$ht&L$ptCwm\$W}\$ֈgf1fPQjxRWw뵋\$gf1fPQjyR2w$vl$l1 D$͉L$4A\$P!gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$I1fPQh&R=uV\$tfI1fPQh'VufPQhrVt$xt$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPc \$R#1T^_[]Ë\$f1fPQhsRTh$\$f1fPQhsR"h$LUSWVTX8D$ L$pT$htwL\$ m ֋\$ ֈgf1fPQjxRg$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ tfI1fPQh'VefPQhrVt$xe$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Q 1T^_[]fffUSWVP[ |$88tqw$(G$t,GO4$6tV1‹n1 uV ;Wuj ƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$OjUTƅtF PVW. u$*jU!t@ PVW. 1J[8t u<[3[ $tD$ 81^_[]fff̀rS[dt[ḃ̀rS[Dt[SWV [)t$ |$t[D$D$4$Z0L$jjPWjQ '1usZ9 u bZ01 ^_[Í4ogfPQj񐐐9t uD$))t8t)Pt u+D$ PG^_[]ÍgxgPQj@RQD$(SgxgPQjARwQD$(7fffffSV[ÍL$D$T$ y9gRVQP)V6Q4P 1^[ÐS[.D$y%9gQ PQj@RU Q j@4R Q [fUSWV[ˇt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JU2hgPQj?RP눍U2hgPQj@ROq1^_[]fffffffK̀rS[t[USWV [؆t$ РD$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV](|$0||$4РD$P6t)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$ݾ^_[]Íhh?hPQhYR?K[USWV[Xt$D$.̉)ōР$PSt)1ҋPt14$ͽD$^_[]Íhh?hPQhR,JUSWVP[JРWstI010$9r$9r$i0mNA900W^_[]ÐS[ît$t$t$b [ÐS[~t$[ffSWV[\|$t5jWt ctVW(1^_[Í4ohhPQjARH몐USWV[l$t{jUt=ǾtUWUt1l$UPt$ L "19s#'NN8^_[]Í4ohhPQjVRHaffffSWV[,|$1t,m|PWzt |$t=t=tƉ^_[ÐSWV[~t$t-VW tPW V^_[Í=i0ihPQhRMG믐SWV[l~|$GPtƉx @VP1^_[ÐSV[~t$ t%VPMt L$9H 1^[Í=iLihPQhRF뷐USWV[ø}D$01t:>t41 |t$t$ t$ W7= uD$ <=u.|$$ HQ 9ttD$0HQ M9u;LQ s|9v9tfPǃHQ ǃLQ $jWP [K0TK8uyPD$0t$ )$jWP K0K8u4)  $PjQ+G $HQ L$LQ ^_[]ÐUSWV[|PQ tPQ 1t0DtPVtPQ Hى|$jjD$P tE t5jVt$ F:PQ tVt$V?ŋD$HQ 9tP$ǃHQ ǃLQ LQ UjPE ^_[]ÐUSWV[z81tR/tL,t4t$t$Ux: uD$|=uօt D$1^_[]ÐUSWVP[zz|$1|m|PWtfƀ<=t^tR)tI1 $ $lt+Vt$U9 u|5=uمxD$8.1^_[]ÐSV[yPvƅtHH0^[ÐSV[ÍyP6ƅtH0^[ÐSV[MyPƅtG0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[êxD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[HxD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[wD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[HwL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ÈtT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$^_[]ÍjkjPQjwR!C<kjPQjxR!$jjjPQjWRx!^jjPQjXRQ!SWV[lX|$t$tOtqWV t(t%uGPVNt WV=1 WV͕^_[ÍjkjPQhR u*kkjPQhR hUSWV[ëW|$t$tLtnWV詎t3oUV8t"}uG jQWPV褙1^_[]Íj5kjPQhRuCk5kjPQhRkSWV[V|$t$tqGG>t1^_[WV͍tGPV\tۍGPV諍tʍG PV蚍tWV艍묍jPkjPQhRmEPkjPQhRFUSWV[ Vt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    E]kjPQh$Rkk]kjPQh%RkkkjPQh RmGFGF^_[]ÍkkykjPQhR,S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[ÔSt[v̀rS[tSt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[R|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1+VkkPQj:R]kkkPQj;RVAUSWV4[Q$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFkl$0PQjU6Uh$\9ȋ$QU$`- FfN%QPR$`U$`N61Ʌ9$Fx$P$T)kPURQ6*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L%QPR$`$`W5l$ 9+(t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$0GlPQ|$W$`U4t;$Tg$P$T)D$D P|$Wt$L$QR3L$)D$D Pt$t$t$Ry3L$)D$D Pt$t$t$R@3L$)D$D Pt$t$t$R3L$r)D$hD Pt$t$t$R2L$9)D$/DPt$t$t$R2L$)D$DPt$t$t$W`219D$F$PED$1$10D$ D$GlD$׋D$ tD$ $ 1QPt$t$U1H)D$>Ń19t$un 1f$PL$$T)fv fD$ kVQURt$`1L$ ;$T$T$0L$RQPWt(8W $\9vpD$0Pe;fǍk$0PQhW0W $\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGkT$ PQhR,= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]ÍJ.lkPQhRRhH.lkPQhR($$bG.lkPQhR ;蛵fffffUSWV[E$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPPt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t蟳fffffff̀rS[Ct[USWVP[BPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf8^_[]ffffffSWV[LB|$t.jWAG=tjW4^_[ÍlNlPQj@R fffffXAL$rÐSWV[ìAt$u8nllPQhrRJ VOtF~tP6^_[ÐUSWV[5A$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W/tGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$"pplPQhcR_F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1*A<tY<uyYQuy uyuyt{wqhQ)t9uGIuw"t$ *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RZNjD$$fxxt$ T$@>P]fD$>P]fD$>P] f|$fD$f|$"D$<$$!|$hVWt$8RTYgD$D$$fxxVT$@HV$NjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8Wb"hj$P3 DŽ$DŽ$DŽ$DŽ$VWP$Pj%ګ΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WMAoPt$t$t$DQ$Pj%)T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FPZfD$FPzZfD$h$!Pt$ Vt$8WSVfNjD$$fx$!xVVAV=*h~L$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V跋L$tL$8$tYt$`~l$(u2D$4t$%Ut QyFPVt$`)L$8uBff#V01l$(E;$%b%^_[]QUǍ$o΍o׍lPQhR3o΍o׍lPQhR$%]n΍o׍lPQhRK./I΍o׍lPQhR$% nύnlPQhR$%~ύnlPQhR$%MTDvWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[6|$F$ jPŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P蒦 ^_[]Ín{olPQhR6@o{olPQhR |$hH{olPQhRUSWVT[1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$Q[tL$t$ t$e t tt,…tt$ P踃u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RtT$GtItu܍nlPQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1􍃵ooύlPUhh RanoύlPUhi R3~USWV T$[BL$8D$ l$4"t$@jV1]F1t 1Ƀt Du`1<$L$D$ Pl$ U,1oPU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ P 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UrGt!D$881<$;D$ ^_[]ýW?t‹GwtP&܍n͍olPQhR/I͍olPQhRn plPQhRnlPQhRmofffUSWV([u$H$<$$E UPM 1U4$Um$DUtڋ$D0WKt4$DptPW)tu뗐$@tP$Hp j$DWH1$@T$t.$@T$D$1L$D$=wu4$T$$L$%D$&hRWP։L$q 4&t$$DP跞 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$FT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$ FT$L$ ut$t$$LU4opcpPQhRkfSV[-t$ t,FF#EgFFܺF vT2^[ÍMppPQhR밐USWV[øt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ A L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVP^_[]ÍMqpPQhR qqpPQhReUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW ;D$uY ^_[]ÍMqpPQhR謹MqpPQhR肹%affSP[ÝPt$1Ƀ $ȃ[ÐUSWV$Yht$8D$D$ L$X1DKNl$\$1Ҁ0u.N uuW- ,$u W ,$01E;$u Ĝ^_[]XfffffSV[]t$ F tv0lF0v( lF(F,vkFFN gqjP FtF ">w|qPQ4tF F 1^[øSV[Ýt$ F tvFF F t6ѥF F ^[ÐSV[=t$ N u@v0jF0F t6f jjjj6YF0^[ÐUSWVP[D$@0%t$ $QPZgE< t< tPU$gǃUfF~ l$EuE jj ?cEF4$Wftx1퐐< t< ttYT$BH9u% JPr dtaL$AFF<4$WYft 1 1F^_[] 0U$010t$SV[=t$ F tvOFF F t6qF F vhFFv0hF0v(hF(F,^[ÐSV[Ýt$V(1|$  F ^[ÐUSWV[h|$ G uWG l$us1w0gG0G t7g jjjj7OG0tdUWuTG 뢨uG$G$G 1T$QRPwI 1uG$4$t$UW1^_[]ÐUSWV[X|$0l$,t$$F u.F(9~,sWPzatVt$$F(~,WUP n(r9t$(EffFtE9rMN M| t&j0t$$W01^_[]ÍQ)tӍ,E9rEUD$$HL$@JF)1"F$J Hƒ)9\$T$$BH9uBJL$ jPD$P17 D$蕰L$芰8$D$ L$FwT$D$$@ @jj t$ 6 $> $48D$T$ 1FfffffffUSWV0[H|$D|$jjWjjVA|Dt$bTjjWPjV |D$\$l$1D$D$ $19mzuB<tQ<uBt t z D$D$ D$ 4$ƃ4$ftf9zB |$r t>t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RXRWjP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$WM Pt$l$ U" t l$ /D$D$<F\$hPW |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~T$ \$WjR趧T$ |$L$F t[l$Et Nj,$U \$Wt$T$ R~ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$'~T$ L$E E$\$l$TU_/4$U_$L$$9sD$DQ_1ɉȃ0^_[]D$D捃qqqPQj]RaW\$谦SV[}t$ t VI_^[ÍqqPQh/RfffffUSWV|[(j$1tGljPWt)l$XD$\|+Wq W1|^_[]jjWjjUjKWxt҃|(D$ l$<$D$ƅuUW/$뚐USWV [H|$$(rl$ NBCD3EB 3M t蹨1 ^_[]Ë|$,j<^MƉ8D$0FMNUV } ~$E$F(L$w F,w F, F,$wF-T$$ T$$w F- F-nV U(V|$Ǎ<((1t)lj~$BF9r\9rXD$9rPl$$9wHҋ|$1Ѻtr1ҁD$sD$rlV\s@sщʉѺ u׋ $)jQWj+CF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPjkBF4~F:F:t1F;pS[~t$t$6![ÐD$@ ÐSWV[LT$|$9W v#wG,ʃt$<u0 Ћ0謥L  )r;GvqD$Ot$1^_[ÐUSWV[Øt$,~$ED$\$Pv(t$Q 9quJ艞$mD$!rD$4$ɹxt$2D$<$9L$HL$D$ l$6rD$$${$`$ttl$$;%`t %)l$ fr$D$D$jt$L D$0Vvt"l$ or$D$D$it$L D$0vt"l$ sr$D$D$it$L D$0ut"l$ wr$D$D$Pit$L D$0ut"l$ {r$D$D$it$L D$0Vut"l$ r$D$D$ht$L D$0ut"l$ r$D$D$ht$L D$0tt"l$ r$D$D$Pht$L D$0t$t"l$ r$D$D$ h`t輆|$4t|byL$DL$ D$rD$,$t4詶tƁ Ot yI u2D$4$D$5L$@L$ D$rl$$$> Ɓ Ot yI u2D$4$D$U5L$y6z.#z&8zyz3z^_[ÐSV[ͻt$ uYj(PVu youYkVQj(P芡RuY^[ÐUSWV4[h$D$0D$IuD$HL$j.QPjJ_zT$PQj.jR_y$tEL$PQVU D.0;D$0u 4^_[]S+USWV([Ⱥt$L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXش1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë${{֍zPQhRuːUSWV[Ó}PfD$|$D$ D$POlHHPP*{0ppp RQWjV-$r D$ƀe^_[]USWVP[ l$2PUމE2PUƉrPU讉PU薉rPU~rPUfPUNyjPUt# 1uRXMDHt?yj PU y8u$8 L$A.&L$0t9^_[]ÐUSWVP[zl$ PU9txF u6T}jPUW" 1u[XMDHtHxj PUҕ x8u $8 6D$t8^_[]fffffffSWV[Ü|$t$jWQGHO~;G~ t H WRYjW\S^_[ÐSWV[,T$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[٨|$(D$$u$PsgD$D$D$D$ jWPG0u ǀD$PW>DjWR^_[ffSWV[LaHt Jt @t A ?t/t5Gt E49s%}Y}jQjhRE4M01U0)E41u;D$ !u E PzPL$ Qjdj$+WZ9E4B?PWu0'> E49s%}Y}jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu0= E49s%}Y}jQjhRE4M01U0)E41u E E}PQjdj$+WY9E47>PWu0= E49s)\$}Y}jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$}Y}jQjhRE4M0QU0E4AD$|`/}$D\$u 1M QU Qqu It$|\$QRPVjdj$ +PX\$ 9E4<P$ +Pu0; E49s%}Y}jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-}Y}\$jQjhR\$E4M0QU0E4A|D$#M }4E0T$WP=;}E }4;E0 E4u)\$}Y}jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E E}PL$ Qjdj$+W/V9E4:PWu09 E49s%}Y}jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0K9 E49s%}Y}jQjhRE4M01U0)E41E E P+E Pt$ jdj$+W+U9E49PWu08 E49s)\$}Y}jQjhRE4M01U0)E41M AE  L$<%\$wL$ L$}L$Y}L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu07 E49s\$jt$jht$,D$(E4pE ;D$8}0L$}T$}T$ Y}L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-}Y}\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru cE E}PQjdj$+W`R9E47PWu05 E49s)\$}Y}jQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$C}VPjdj$+WQ9E4H6PWu0-5 E49s)\$}Y}jQjhRE4M01U0)E41|$\$E wL$ L$}L$Y}L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu0I4 E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E |PQjdj$+WO9E44PWu03 E49s)\$}Y}jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0!, E49s)\$}Y}jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-}Y}\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$}Y}jQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$,PQjdj$+PF9E4:+Ƌ\$P$ +Pu0* E49s)\$}Y}jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$}L$ Y}\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$UD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ }L$Y}L$$+р਀tsRPt$ jdjVD9E4g)PQu0J( E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$w||$X\$PVQj2jWC\$9E4(PWu0|' E49s%}Y}jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$}Y}jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$}Y}jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$}Y}jQjhRE4M0QU0E4AE MU \$VWu,P}$E E}PL$ Qjdj$+WA9E4&PWu0e% E49s%}Y}jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0$ E49s)\$}Y}jQjhRE4M01U0)E41E E ;D$%L$wT$T$ }T$Y}L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 $ E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-}Y}\$jQjhR\$E4M0QU0E4Au E PzPL$ Qjdj$+Wz?9E4-$PWu0# E49s%}Y}jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0" E49s%}Y}jQjhRE4M01U0)E41u rE E P]E E PHE t|PWVQjdj$ +PC>}$u E E PE E PE t|T$XPWVQj2jR=9E4"PWu0s! E49s%}Y}jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W=9E4!PWu0  E49s)\$}Y}jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0{ E49d\$}Y}jQjhRE46DD$E4D$W\$L$D$L$}L$Y}L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$g4\$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  L$D$L$}L$Y}L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.3\$9E4mPt$u0O E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$IB}4E0)E4u)\$}Y}jQjhRE4M0QU0E4AC}$n }$bE}PL$ Qjdj$+W[19E4PWu0 E49s%}Y}jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0w E49s%}Y}jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$}Y}jQjhRE4M01U0)E41M AE I T$(}4\$E0.E4u)\$}Y}jQjhRE4M0QU0E4A }g}4+E0-E4u)\$}Y}jQjhRE4M0QU0E4A}3}4E0 E4u)\$}Y}jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7|$+t$|$ +f@======2|$7|$+2z4|$7|$ +r|$7|$ +rz t$>|$ +rz4w|$7|$ +r|$7|$ +rz4|$7|$+Rt$|$+2|$7|$+2z4|$7|$ +r|$7|$ +Rt$|$ +DŽ$ +====2|$7|$+2z4|$7|$ +r|$7|$ +rz t$>|$ +Rt$V|$ +Ƅ$+=fDŽ$ +==2|$7|$+2z4|$7|$ +r|$7|$ +rz t$>|$ +rz4w|$7|$ +r|$7|$ +Rt$|$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$}L$Y}D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$*\$9E4(Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$|\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L$}L$Y}D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$ )9E4M Pt$u0/  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0  E495\$jt$ jht$(D$(E4|$ D$f E4w)\$}Y}jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u >E M4 U0B  ru0M4B\$QVP"  ƋM49s)\$}Y}jQjhRE4M0L$M0)D$E4z|$)D$L$}L$ Y}\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P肨PQjdj$+W%9E49 PWu0  E49s)\$}Y}jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj诈}0WC%ƋE49s,\$}Y}jQjhRE4}0}0)E4E \$u4u0PjF}0W$ƋE49s,\$}Y}jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$}Y}jQjhRE4M0QU0E4AD$|w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$}L$Y}D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$"9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0z E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$}Y}jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u 蕱E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$}Y}jQjhRE4M0L$M0)D$E4|$t)D$L$}L$ Y}\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$}Y}jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u E M4U0B  ru0M4B\$QVP\ {ƋM49s)\$}Y}jQjhRE4M0L$M0)D$E4|$)D$L$}L$ Y}\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$}Y}jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u 7E M4U0B  ru0M4B\$QVP ƋE49s)\$}Y}jQjhRE4M0M0)E4sf )E4w)\$}Y}jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$}L$ Y}\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$}Y}jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$+D$,;$p+u ȍe^_[]Ë\$?USWV [è\t$,|$(D$ .ʋ7l$Ut$Vt$40RQ4‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sG*D$D$Q@(D$ 9s$}Y}jQjhR)))x ^_[]1))lj$}}Y}PQhR#뽐USWV Չ $[ZT$8D$4 D$L$D$"u$}Y}jQjhR|$4QA$93<$779$x}D$D$}D$ Y}D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$}Y}jQjhRMQUA+<$-y'n'D$4L$D$ ^_[]ffffYXT$4D$#lpÐUSWV[kX|$ l$t$~Jt$~2UVax(ƃ|$tލF9wȉ9v&(+t$^_[]ÐUSWVP[W|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }%(^_[]E ffGftC,$RWGxǃ9w,$)xD$ hHGftf,$RWf 8 9Xσ95,$)5|$ oGwtc,$RW胡 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [XU|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.a# ^_[]Ð~34$U迟x(ŃtߍE;$wMȉ;,$v "(+l$xD$ h,h,L$H(ht$0Quu]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5"(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[R|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$. ^_[]Ð~34$U/x(ŃtߍE;$wMȉ;,$v k (+l$xD$$h,h,L$ H(ŋT$0PhRQuuU}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0](LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X(P\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōM~}PQhR|$ "~M~}PQhRX~M~}PQhZRwfffffffUSWV[ËJD$$L$1w|$ u 0E0~PUWVt$(t$(QR4 GXJL$ulÐXIL$w1USWVXID$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$>~~PQj>R;\$~~~PQj?R|USWVP[ÚGt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í~~PQjgR1fffffXFTs ÐS[~FTs ht$ P^ [ffffÐ1ÐX/Fu ffffffUSWVX[Fl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tP7D$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$V 7t$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$6D$lj|$)ƋT$ D$kD$pX txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[Bl$Uƃ;D$vc(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[EB$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]5ffSVP[ìAL$t$D$T$ $xRQVPQ'x9rRQPY ^[USWV[[A|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[@|$t$l$tt$$PW%t?^_[]VW t W LJWVUF ͐SWV[\@t$|$jW1Ƀ PVW ^_[ÐUSWV[@|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[Ü?t$t5|$r#u#jV#tjV$F1 ^_[S[>?D$tL$ ttu H1[ [ÐSWV[>t$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[\>t$tAjVq"t2|$jV"wsf~ 1 ^_[ffS[=L$T$ hP[ÐUSWVT$0L$@[è=uD$\VD$ P=ǃx\$D$t6r]=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$gt$,PV1D D$,\$XPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  w >L$s*D$@--tr0twPu@-7[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[ D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[]t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[ÞD$ L$t9u[Ípb$PQjpRyS[ND$ #L$t9u[Ípb$PQjpR$D$t&L$tu1u 1tÐS[þL$ D$Qss)ǀ[Ãuu ǀ[Ípb$PQjpRuS[ND$tL$ t 1[[ffUSWV[ j [1tQ@@jjPo f(_8tU(W蒝E(^_[]ÐSWVP[Ë|$tcOGQ9u0$jQPn 08t  G $GT$pw1^_[Í΀ƀPQjZRySWV[t$tRtC|$t3~t-0褜~r4苜;~rPxVo^_[ÐUSWVP[zt$t@F$t*.1tt$Vt 9<$u1^_[]Í΀ـPQhR뜐USWVP[T$J $Ћ*1|t$WBt94$u|$ l$tW}E$F;$} $)Qtu<|uprP $كU|vy uy P t&D$j.PWV!tl$t$y D$PSL$QRPD$PWU  $t!QPl$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(c$Qt$@Ff$w-j4D$0$D3V3AoPW|$t$8t$HQj%衐T$T$@t$$P6ct$t$6Pj%d$D$@9F f|$0u D$(8gt$|$u$L0VѰƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP轓T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PR]o l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0VJ=~ $!D$1$D$$1D$\$|$$Rt1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$Wt1T$ T$G j(_¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vlǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tBPWult1ɀ8 L$L$D$D$L$ t WPtT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍƃxPQhR跨]ƃxPQhR萨B3PUSWV։[ä_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUy$T$ E ulD$;tM E=t܉t$L$4QPBt$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPL$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR3WD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQVD$e ߋD$)D$U u E;D$UstjU|İ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QBVE0EEEe jUX|1뙋t$uyb)Eۍl6PQjGRϚtl6PQhR訚D$D$ D$Nl6PQhRqEtfffUSWV [Èt$@|$4uu>FD$FD$\$jt$8Ty1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$D$ 14$[>D$ ^_[]ÍaiPQ1܍j7PQhRq7PQhRǂJSWV[ܹ|$t$tt9h(#WV ^_[Íj7PQh?R_uǍ7PQh@R9룐USWV[Xl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Íj7PQhWR\L7PQhXR2%USWV[Hl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Íj7PQh{RLL7PQh|R"%SWV[<|$t$tt4WV^_[Íj+7PQhRu̍+7PQhR먐SWV[ü|$t$tt4WVJ^_[Íj67PQhRDu̍67PQhR먐SWV[<|$t$tt4WV^_[ÍjC7PQhR~u̍C7PQhR~먐SWV[ü|$t$tt4WVJ^_[ÍjS7PQhRD~u̍S7PQhR~ffffSV[=t$t$Vt$t$t$~>.u^[ÐS[t$t$t$t$t$J[ÐSV[ʹt$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[ît$ t$ [ÐS[ÎD$t$ P[ÐS[^t$[ÐS[>t$Z[ffY ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXx$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$:PQV ƍGэ}L$,|$ U(!Ћ$eW|$ƀހ:w7$|w;t$b\Gn߃^rxo;l$1\,, $*hwkdT$Ɖ*t$i $*hwi (Ћ4$hWm;|$Yȃ|$ U(!Ћ$:PQV xuD$ ƋL$$iQPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )${(^_[]Ë${ᐐS[jt$t$t$[ÐUSWV([ج|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ "q0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[NL$T$ hPt$ [ÐUSWVT$[ɉ$t$4|$ |$0t=D$0|$ "v-xi1T$VPqU\$u+t-t$0u#D$ D$t$0t@D$u20u- ^_[]fffSWV[L80 8tfwPVr $P L 1҉L$ #L L$ T$9s^4RtT$~t&1 9tFtP 䐐v FtP 덅t Q ǃL ǃP D H tY1H 9s=t7Z GtۋOtw wуG;tPV볅t V ǃH ǃD 轲$0EL tLyQj PP D$HL$L` \ t$t$Ĕ^_[]ÐS[îD$ L$01d[ÐSWV[||$t$wvFu 76>d^_[fff̀rS[4t[USWV[|$ T$D$l$$ht$L$T$(PVUWt$<9taT $+t$ QT"1^_[]ÐUSWVP[Êt$T8$l$ L$T$$t$,PUVt$8=9tS8+t$ S"1^_[]ÐUSWVtՉL$^$D$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$t u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$ l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j Vh$99u\$-k $@ D$ $@  D$ l$$hQkd)<4 kd(  $l$ \$T\$TD$\$t$D$qP$j Vf$99u$H*R )tȋL$ \$فt$DPQ$j VJf$9<#9uD$\$t$D$qP$j Ve$99u\$;D$\$t$D$1P$j Vqe$9cS9uB\$T$H+HA$I ȋL$ \$فt$DPQ$j Vd$99u$@t)$p$IЃȋL$ \$فt$DPQ$j VDd$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$KD$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$ D$DD$D$\$t$D$q P$j Vb$9zc9uRD$\$t$D$q P$j Vb$99u$@L$ \$فt$DPQ$j Va$99uD$\$t$D$qP$j VOa$9A39u"$H*R )tȋL$ \$فt$DPQ$j V`$99u$@L$ \$فt$DPQ$j VZ`$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$/t$.RPQjV^$9)9u$9 9$Htȋ\$2t$DPQ$j V^$99ur\$$L$$$Wt$ $ƒ8\$2t$D$qP$j V ^$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP !ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$)t$DRP$j VZ$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $)t$DRP$j V^Y $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $)|$DRP$j W9X $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$)t$DRP$j VW$9qc9uRHx1)t$DQP$j V"W$99u $L$ 1)t$DQP$j VV$99u $\$1ƍ)|$DVP$j WdV$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u75\$]\$$=L$ $<$\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TVT$$99u<$D$ ;D$pu t^_[]Ë\$USWV[(n( ʼnƅ~<01WUjP;8{<$D$l$ l$hT$$PD$PUt$(t$89t5< $+|$ %<"11P0^_[]ÐUSWV[XmX ʼnƅ~;01WUjPk8;$D$l$ D$ʼnT$$t$,|$WUPt$89ti; $+|$ Y;"11Pd^_[]fffXl88ÐS[nl88tP [ø[S[>l|$tP[ÐSV[ l|$ tV诩V覩1^[ÐUSWVP[kL$y~X$T$GsY11t5iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF :-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F :-00u҉u$ 11Ɂ<$)ȉ( ^_[]USWVP[fD$tQՀ:D$PytHǀ}:d$j"u1ɉP7Dž1N 9}m>dNhP Cǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw9u_1^_[]Ã1ҐdNzw_eNzwQfNzwCgNzw59u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[c88tWzƅ~L202jj!jPu W9^_[ÐSWV[lc88tW ƅ~102jj|!jPfu Wɠ^_[ÐSWV[bhRIƅt(T$jtVZ181^_[SWV[ìbt$818Vu(18^_[ÐS[~bt$jt$t$[ÐUSWV8[CbM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3X 11uP*-R[ H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uVz,T$iFH hFdNP(}m^1+dF JыV+D L\$jhY`QP ӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$`.1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[:_8}tlPQ+, $` u` 軝Dž<$}t+P艜ƅ,$~X-01K, ,$|$1jPUjWܪ/DžuP*^_[]hmP` ڜQWFUSWV[^88t P蹛ƅ~,01Rl$|$( u1jP UjWܪ[DžuPV^_[]ÐSWV[|]t$|$PQvX 1WP(t [ H(^_[ÐSV[]t$L$X t$Px(tt[ H(^[ÐUSWV[\t$8, 8t8PQ踛` u` QDžtA,PQ耛X 1UP't [ H(^_[]htP` 踚tW듐USWV[[t$|$l$PQX UP='tt[ H(^_[]ÐUSWV[Ë[t$l$8, 8t<PQt` u` ŅtQXl$PQ8X WP&tt[ H(^_[]h;tP` dtU냐USWV[ëZ88t(PIƅ~)0z|$1jPܪt j&PQFX ܢjP}ljՅuP趗^_[]ÐSV[Yt$D$ t"PQ˘X ܢjP^[ÐSV[}Yt$D$ tF t"PQ`X ܢjP^[ÐS[YD$t@ PN[ÐSWV[X|$t$tF PQۗX ܢWP^_[ÐUSWV,[ÅXD$$$(=ΉT$y |F &D$ D$l$jP$LP$LW=+|$t ֋|$ ωjD$P$LV +ʼnր|$t |$ |$G $@D$G~$(PjQz" G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU\)|$u|T$jD$P$L$L2)|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ $SWV,[ÙU|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ PQXX ܢjP|$x ,^_[ÐSWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[êT88t+PHƅ~#0( u1jP4$t$|$ܪt6BR lP~;yQi|1)΃<$uP詑^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[Q88tU菏Džta 8B( ujjt$|$ܪtVWP ljU9^_[]ÐUSWV[UQE$fBtz?:$uʀ/\$ ujzPWjPW t)YD$ ʀ/\$ uGH/t/1.tt:L0.uL0.u.|0/uD$V |0/uJ /u\$ m\$ hW-D$?= t$LD$\nfo/D$XoneiD$Tre/zD$P/shaD$L/usrL$`\$ PWQ D<`h@ WυeD$LhPWm ,D$,Ww$dNL$<lPD$8l$L$PD$$ÈL$+D$dT$e t$f L$gy΁ D$`T$a L$b щL$cyʁ ʉT$4D$hT$i L$j T$kt$y с щL$D$lƒt$m L$n T$o\$|$0yс щL$ D$pƒt$q \$r T$syӁ ӋL$D$tƒt$u |$v T$wyׁ ׋D$1T$4L$ vD$ y 1p h =] U I l$$\$]D$\$HË\$‹L$ [B,9D$,@D$0 D$tQD$xω\$ L$L)T$,hT$0RWQ8|$+D$$ @D$$t9 D$4t9 D$D$ BZz 1D$yt$$1\$x01tDt$$D$9|$ D$Ѓ\$u5K s CƁyK s K s K s y ȋ$\$K  Ƌ$\$Ƅ:>L T9}$\$9Ήы\$$Ƅ:>|$ l$~^ 9L$1>\$4$<t >~mv9} 91\$x1t$$t$B|$1 ʃ{ s {y  $dFK/iFSN 9hF9D$ut$J 1Q΃1rQ̓1$;8dNT;8eNT;8fNT;8gN9ul$t$|$<1퐐+/9ul$$t$11Ƅ fNfDŽ dND$@1L$8L$D139\$\$HL$Diy1 L$D9D$@7D$t$0l$ ƒt$$\$|$u/K k CyrŁjK C K C K k y Nj\$C ʼn\$3T3 ʉt3 L y ΁ ΋$D$L$09l$ |$999|$@l$t$:B1ƄjF9t"tyҋ$jF׉߅\$ p1ƄkF9Y|$4t/ҋ$kFЉ)D$ xW}t$D$,0W}HD$$0l$,|$L ~D$L| o$x_$\D,KL$M\$ 4$8$h $d1D$$|$ D$$d9 4|$~'1D$<\$ VPbt9u|$L$2)ȋ\$ PVx#L$1wՋ$< |$$ʁdNPVRω D$$ƄdN;D$9D$@$h X|;>:>u$XK߃D$$mH$`D$1\$;T$\$pt $ Y I|$8,~;uM}|1ۉp\$~<$L9t }}* $tDA>YY_$@l$U1Ƀ1ɋ$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF91t3 ́ 1ҋ,$u~}<ы\hFdF9uۋ$xt1D$l$E;$uD$^_[]Ë\$ dUSWV։[BtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$Ejat$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0Vm >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$P8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i$QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $Xq4D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9$l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[N-` PQ k` [ÐSV[-X jt`j^[ÐUSWVT$4X,D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[[ l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]͉PQjFRq‰PQjGRj|$$b<‰PQjHR@>ffffUSWV[[l$t$|$tU6^_[]Ína*PQhRʐUSWVP$[t$$` U[t,j&tPx $Hp D` D` 17"X`  xuxt)txu8u밾UZ^_[]Ã듍z*PQhRKUSWV[$` D$ P=Z@` D` D` $H` L$xb L$ǐ|$$tD$$9G t GtOD`  tGwЃ GЋD` 9tD` DžuZ@` u';|$r$;|$s<$$<$C<$1@` t$ .Y@` u#t7W譠u^_[]ÐSWV[ìt$$` WX"X`  xuxt&t xu8uj訏u $p@@ D` D` 1WNX^_[Íz*PQhRIfffffffUSWV[$$$$$tD$$DŽ$DŽ$ $$jPWW$@jPXDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^֊PQjPRhV_֊PQjQRAT $ ;$u ^_[]踊S[.ht$t$Pt$t$7[ÐSWVP[D$L$T$t$ 4$hVRWQP^_[ÐSWVP[ûD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[{t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[ÝD$ L$ $XQPRv[ÐSVP[lD$L$T$$XRQPV`D^[fffffUSWV[(T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQK֍PQj=R;׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]Í.PQhRL$8AffffffSP[D$ L$T$$RQP[ÐSVP[D$L$T$t$4$VRQPA^[fffffffUSWVP[Êt$|$PV1ht$t$ 7K x=|PLfF FfFfn vF$F,F(F $tjjjV|^_[]ÍNPQj>Rq)ffffSWV[Ì|$t%jW聼w jW}^_[Í̋PQj;RfSV[-D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍӋPQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$Pi\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $|xT$ L$D$n6 D$0 L$ I $|T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$|D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q2,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPnƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$PЃ\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $8BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$$PQhRUD$뀉׋$8G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$(B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$$PQhRBU|$뉐|$UD$xT$ Ӌ$(Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P;E|$8E|$8|1 uT t$ 9wS$w닔wl$Pmt t$T l$PU\ / U| 룋$L$19u $PK<^_[]þUSWVP[èD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [VD$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$qI$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[3EET$@t$DT$$dpU }jjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP0 )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[wl$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[cm|$hE t$p |$<$ MM$Ujjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ĺݜ$$$$$݄$D|$<ػx|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃ȺD$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃xL$T$vثxv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋̺|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU($t?$L$UE.$1xL$^_[]þTx0ffffSWV[t$|$ty8L$tu1 1 ^_[ÍPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[@M1ЃωT$(ЃM$U E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ĺݜ$$$$$݄$D|$@ػxD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كкT$8؃ȺD$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃xD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثxv#T$u؋T$xvq|$D$D$ ؋̺S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[lD$1r 1 9vW<t8Ɖ^_[ÐSWV[ D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[}D$ PHpR=^[USWV XHT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[~5SVH[UD$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj yL$(VPQj`-D$$D$ D$D$D$D$D$jPj-\ j[j[S[nYS[NfffffffUSWV[+t$|$tK1tt (h1^_[]ÐUSWV[`}uu \$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ8gt$(PV'T$4D$(XPV'uD$(D$D$(L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[}Y |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ÓXu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ëWt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXVǀb ǀb fǀb ǀb fǀb ǀb fǀb USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ÜUD$H~( 1u 9r1$PƉ^[fUSWV[;UL$8?tPS wc t{c ?u1>P9ƅD$t/Fn?tPFF ^_[]1?tPȐP$d )ʉʁ oΉPoUSWV[;Tt$tbF!r VO8}t3W=}Fc c tWc c ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[(Sl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P}T$,Bc c ti4$ō\8}th$P裍1}Fc c t14$}$c T$, c D$TG^_[]Ëc c 1␐T$1Ɂsrr@r"y(6s@sރx @tS[~Pj,tL$H@[ÐUSWV$[HPD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU;<8?t:V}?Ec Mc $t#VXD$c Mc $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[ÈJD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [GE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[D$t|1q1ŦzDPQjERx P$1D$jjWz ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[îCt$t$jt$0[fffffSWV[|C|$t@jWqGHO~ H0 WjWR^_[ÍAPQj=R 럐SV[Bt$ t%FHN~ H V^[ÍPQjIRy ffUSWV[ÛBt$atrt!w 11ҊNtgtGɍywD@ؐ+u˽뿁뷁 ՋL$) p1^_[]ÍĎPQj>Rw fffffffSWV[ÌA|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:EPQj8RW f  ^_[f̀rS[T@t[SV[=@t$ t;F0u ǀVNuFH^[ÍLPQj;RfffffffSWV[ü?|$A8uGG Ⱦ uuL  O @G0taW@9t Q*G0GG81t&WhG GGfG u WG t'DV|PVx|GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍPQjJRSV[=>t$ tF Ш u Vk1^[ÍȏPQj;RSWV[=t$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPֈ6@VRQWPL^_[ÐXO=L$AA A AAAÐfffffUSWV[=$u hj1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hV~p VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFϏj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCn(1V(1^_[]14dž$j$2tJpH\HH H \HH H8 8oUSWVՉ[T7jq^lj1&NL$jP($$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[54jQ@# t T81t>0耹rPtN_t u8~)1 9}8tQ ݋t PkVt81^_[]ÐSWV[4|$tOW螸^_[ÐSV[Ý4D$ p|$s t.jt$ 1dž,dž,^[S[.4L$tAt[[ÐSV[3D$ p|$todž,1t$t$^[ÐSV[Ý3D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[3l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uND׍ۏPQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wbRύ֍ۏPQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[/|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[x/|$(o(o(OG0!D$;G9} $wD$D$ P}$L$L$D$QPt$荠 $L$QjP t$豲$D$ GjwΫ $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$W艏 ^_[]ÐSV[=.t$ t$t$ #F,;F(~#F0^[ÐSWV[-4aAϏj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr{PQjbRrUSWV[ØD$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í{PQjbRPfffffUSWV[Û|$oEtjPu7 EjWu,EtPE EtPDžDžtPМDžDžU譜W褜VO^_[]ÐUSWV[Ø|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[ÍD$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[XL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T${PQjbRT$(L$?{PQjbRZT$D$L$ {PQjbR*D$L$_yffUSWV([8 D$i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W+ $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j?ՍwPQjXRgꋌ$!1Ƀ8cfffffffSV[]D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[D$tD$pD$lD$hD$dL$$T$dPjD$@FD$D$D$ D$ $$W3DŽ$DŽ$DŽ$DŽ$$$Vd$F$F$F$F$F $F$$N$$D$ L$$$D$($D$,$D$0$D$4$D$8$D$9tC;D$$uL(^_[]ÍPQh<R0j$jU0 볍P"VUSWV[%$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Pgj$jPd, [ÐS[P'[ÐS[P[ÐUSWV[ûl$j@ƃ#jv@1jb@j$jU+ WU6+^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XXD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$bԒuPQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$Xщt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$bԒuPQh|RƐ\$T$\${PQjbR蕐\$T$\$bԒuPQhRa\$T$\$bԒuPQhR-\$|ffffffUSWV[8|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc{PQjbRɍI{PQjbR虍w8{PQjbRn;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuE{t$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tT$ {PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPFE EE($}fu E(jQt$xsB t{t$t$jbP臈э{PQjbRdD$T$ {PQjbR8D$T$Ǎ֍{PQjbRUSWV[|$l$t$FtPBF FF($nf~ F(^_[]USWV[ƾt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7{PQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ{PQjbRR!fffffUSWV0[cu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍{PQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$${RQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$D$${D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^(L$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[þt$t$t$ [ÐS[Ît$ t$ F[ÐS[nL$T$ j[ÐSV[=t$ tAj@PVO FPhjPw F@FDFHFL^[ÐUSWVXլ$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[Ýt$ tAj@PV{D FPhjPHm F@FDFHFL^[ÐS[>t$t$t$ [ÐS[t$ t$ [ÐSWV[t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[MD$$&ydḰ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <(m 1D$D$ D$D$L$8T$jjPQjRI8tD$8(m D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$.FL$=L$UL$mL$hjjjPQRCD$L$8T$jjPQt$R6L$81 u/jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjRH6t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR5D$XL$~ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$Rh5tD$8he^_[]fffffS[ [ÐUSWV,[l$@D$D$ D$$D$(L$ D$QPj W1|$D1҃|$H1‰|$,m 24m NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ȑT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[ؐL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[ȏ|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[t[̀rS[t[S[Ύt$ t$ jt$$t$$t$$t$$t$$  [fffffS[Ît[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[؍$D$D$huLET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR:(ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$||$ W L$Ƅ$D$TtPWt.$Ƅ$8u$L$ThPQ $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWh h$PWR U|$|$Tt$h$PW |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0& $0$$tRt$t$w;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPW t$|$ t$$tPBA$$t Q"$($,uWP t$l$$t$|$t$P@E$$8$j`7t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[ÜtM΋uA~8t:~4~"`N4F8 I9rP/F8^_[ffffffS[.D$L$ AQ jQ0 [ÐSWV[|$t$t+jP6 tH  W6,^_[ff̀rS[tt[̀rS[Tt[USWV^5$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXH~D$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<nt$Pt$t$t$[ÐS[nt$ t$ T$[fSV[mD$;D$w.L$t$ 9w9w9w9wPQVB ^[5ffUSWV|[Øm$PU}1#D$=h(joƋ$$v1ɍDT TDTTDT D T$ u jWt$dt$dc* M;|^_[]ÐVD$L$T$ t$ $^ÐSWV[\lt$t~tT$y|$u 1M H@΃|8t<΃ DP@VP N@^_[øjPjj%Q6USWV[Ùk; s.Pjt9H>t̐Gtu1uOHO tww$Ѓ gq91pjPQw蓥1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[\jt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øjPjj%Q4SWV[ÜiD$L$Pt prxxp| pPxtz xyV*1^_[ÐUSWV[(i|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,pL$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[gt$ V PtHP tQ P V1^[ÐSWV[üft$>gthGt tww$Ѓ gpNjPQw%;u<tww$Ѓ 肜4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[leD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[dt$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[(d|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍǔPQjGR(T$4ҔǔPQjHR}(T$4USWV[Û_|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW̜LP=W貜1fu- O @1jW^_[]ÐUSWV[ë^t$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍޔPQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[]t$8uN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[ÍSPQjDT$B=sXDP%[Í&[ÐS[CT$B=sD$ DP%[Í[ÐS[ÞCT$B=sDP[Í[ÐS[^CT$B=sD$ DP[ÍC[ÐS[CT$B=sDP[ÍŘ[ÐS[BT$B=sD$ DP[Í͘[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[TAt[D$t8t9@€tuuuuH+D$ÐffSWV[@0t1jWQw t u1^_[ffffffS[Î@Pt$t[ËD$ĭ1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[ë9l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[8t$t8D$ t|$tT$t121Ҁ9 11^[Í܆/PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[7$0Љׅtϋ$tZRWPQ$$$4UhVH$yPVjk S[N7t$jt$t$PUSWV[%7$$$$L0ЉՅt$ tZ$RUPW$,$<QhVt$Lt;l$VPQhUJPUjj LtWD$ hjP' D$D$DŽ$DŽ$ yL$VPQjL$;$^_[]ǃLJPfL҃¿+w狔у̃ǃƒӥS[N5t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[4D$ D$D$$jVjti m uƃm tjljj0jVj3i jIjfffffffSV0[*4t$̀rS[t2t[S[^2|jPt$t$t$[ffSVP[,2D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[ä1t[PS[Í1[fffffffS[^188t3[Ë[ffff̀rS[$1t[S[1j1[ffSV[0m u#m V>u1m ^[Ðfffffff1ÐÐ1Ð1ÐXO0PÐ1ÐÐUSWV,[0l$D|$@o |ƃѢ =sdfo Fw%lo =uɋo 뿐o QUhWL$L$뀋o |$@l$Dt1o t& 9s8u+po ϧƃo 賧D$D$(D$$D$ D$D$D$o D$o D$ o fD$o D$D$Uj(P׃8^_[]ÍѢPQhR]fffffffUSWVX.$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$H8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$HD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$HD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$wQPetƄ$T$X $D$1PhhRL$$t$ T$DH@u u{F$$RT$D$u$DH@utD$(tDP@u Vu$,FPQW藓 D7t$fiiUSWV[$$$ $$@t-t $,$,PUQtRL$nWUPhQU=s>$4$4$4$4U$0R&U׶=r,j$ F;$u;^_[]Åt|.u|$aUPQhWf,hffffffUSWVX[Ø$L$p|$lGtG,t$x&9t$|8TPVt$|UQ$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$6AxnNj$L$|PQjE$L$xPL$QME$ǃ$fB$) $W 9$A A L$|PQD$L$xPQD$PjD$PQD$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWP?ƅxՍ7Pj C7Pt$C7PjC7PjC$ 1۸$IUSWV[;l$ |$t$D$@tP ) l$$FPj)5CF|PQCfFD$@ u1ftPf VPBVjBG fffG )^_[]ÐUSWVP[Jl$0t$$T$ |$D$@t PT$$։)͉ $9L$(B99t$4D$,WPBGPl$UBGUVP誔L$4 )΁r&¦uPQh=RCL$8QPA+l$ ^_[]fffffffS[>jt$ [ÐUSWV[$ $D$0$jU@Et U uEEEjeU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhmdtkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU?D$ djVU )PpƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w x1҅tމ8D$ Ϲրwr tt$$D$ >wPd tPǍ$WhhPXE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #5j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w A< vhQt$8 ƅ_BPt$NnD$ kc$< t< H$< w&A< vhQt$V襇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t@PV`< D$<@@@@ @@D$@D$8kj5Pj j$PD$PD$;t$ s E$EtJ*P\EDt%uHOPWu퍃PP!VPet#uV[ML$0 ;$u ^_[]VUSWV[t$xPdžft91 9s)tQdDŽͅtMtt|%X9ut&xt PWidžtPhdžf^_[]ÐUSV[Euo jP|^$D$F$FrWfF e^[]ÐUSWVx[ÃEL$ L$puo D$jP ^D$3D$fGt$VjWVd VW*GL$ ;L$pue^_[]zTUSWV[t$xPdž|$ft;19s)tQdDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$Atbt$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ j PV¡ ^jPV訡 &j PV莡 ?zj PVt kjPVZ  jPV@ jPV& j PV -zjPV jPVؠ jPV辠 jPV褠 j PV芠  4jPVm )jPVS $`FP#5d$/FP|Gt^GddGtAPt$'F P|GGtPQH7< < {$H׋$uʧt$0UP $[PY뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVS?r?D$PVt$y D$L$Ƅ|$PVNS?r?D$PVt$Ry D$L$Ƅ($H^_[]ÐUSWVx[È$$l3o h3o p;o t|P9h@tP|x$D$D$%D$ D$D$D$PjjjQt_ett.T$wPhi^[ÐSV[t$ t P>wPh+^[ÐSV[ítP^[ÐSV[}t$ tPҘ^[ÐXOL$hÐUSWVD[%$`$Xj7GD$}>wPhQ$UED$ P(MJD$(D$$D$D$D$D$D$|$#r-}$Xu|$#EL$H@ u uuPt$SV0|$ t0oE1tVPtEuv|$tT$D$D$L$ 9AD$$A D$(Wq)D$ QPt$z |$|$D$ @1tjD$#gRǃ)|$ KWQl$U;z L$l$$XD$ @TȃuD$D$+D$L$$L$;ED$ @ ;D$ |$ OP1Ry L$l,G )D$ L$D$D$l$$X|$#44$< 4$ٕu 4$|$MmxD$$AT$( $Q D$)" $iL$ ) ŋ$h19Rt0Ux $A,Q )׃9t$uы$@L$t$Wƃ)Vt$ U|x $(|$tM1D$D$ Pƃ)rWVt$U=x $@L$,9D$u$@L$t$Y@4$d$XF t$Ypv D^_[]Ëu t$YӍdPQj|RNr4odPQhR'\USWV[;t$|$.FA FA>wPhntDƐw ww7Vt5Hp U1J uV-'G V G ^_[]ÍdPQhR8@USWV [Xǃo ǃo ǃo p  p p p 1ɾ\{4rf0$ 1t tp )p F'ǃp  o ͅyy1o u\ǁw 9< tw 9o uPo o ~)o uǃo hPǃo p p )ǐM\{rƒƾ#$su*9 p p 뽍 r;p Mp p ;p dp j8p$p P Do1<$ )ǍͨPWQRjo?ǃo 0p p ǃ p ǃ$p ǃ,p p ǃ,p p Hp 8@ ,p ǃp ǃp ǃp ǃp wo 'с''o '='l'b!,p p )p p )艃p u[VwSOp GHp p Ho yy1o J or? ΁w.9u% ;p s)  ;p o ҉L$t'='r 'p D$$PUMn)p <p 4$ p |M= p L$o p L$ Wp OPp p P $,UPMp ,p P p L p  $o p Mp EHp p H<p D$$PUqL2)p 4p 4$ p D$>LT$ p L$o p Vp NPp p Pǃo o ~o po t'wu'r 'p $P@tBƉp ʼnp 4$ p XKt p o p P ^_[]1USWV[ù8p1ɀ8 )σ$p tdUVfty p U0Qtd$p t21퐐 p V4!tV;$p r߉(p (p p PQ&9uK(fͨPWQRji!VPWQRji^_[]ÍYJPQhR_fffUSWV[xDp t{NDDDDD DDhp .j2Dp tǃhp ǃHp ^[ÍUSWV[Kj02ƋD$F P~2FF蠍(Ff~FF,Dp t Hp 1ҋL$9uF(Dp thHp 9tF F$F藋(Dp Hp rdp RLp \p 0p Pp ^_[]19u뫐S[ÞQPRz jSWV[lt$8Dp t3Hp 9t^t,Pp Lp zdp Dp t7Hp 9u Hp ~t vM?VD?^[19uΐS[Nt$?[ÐWVX-L$ tsAQQBQQAA,Dp tDHp 49u4Hp 4~dp vLp \p 0p Pp ^_19uSWV[Ìt$trTDp Hp t/<t)Pp Lp zdp \p t$ lPQjS[ffffSV[t$ tjV\f jV^^[ÍPQj5R}ffffffUSWV[Õ$t&j$$P)$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjrNjh$t!A3APjhjj5t{Njh ʁʀ $4$jjjVOd!ƒu.Ё8u$$! P讁(p$t u|! D$$Pt$]-D$| $W?RPt$m @ &l+(ɀ GGNG G GGGjjuH tTP у1uP VPuJ $tMtH! u?jUu.B(W$t 4$e(1Ġ^_[]À!SV[=D$ pFtjP6I F!u^[ffffffUSWV[۰t$ D$hEtjPusI EwL$,8uL E(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUa !@uEIBj7uyH 1WUƅur}$O^_[]ffffffUSWV[kt$ D$hEtjPuH Et}^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPUG !@uEj7ufG yUSWV[Èl$(9s$QP,D$ L$t$;t$,w D$,D$1;t$t$yjt1tK[jutWVx $$t$jD$PVU8u&<$Q;t$,s!^_[]ÐUSWV[8L$,|$(19D$t$oity;D$touF$WV+)L$(žϋ$Eht ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$6L$uu D$,91^_[]À!USWV[t$(9s)QP*$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Qu $jD$PUV5u;l$,b1 !^_[]ÐUSWV [èL$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,4u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[۩t$D$xGtjP7tB Gt\u^D$tR;wUjPW, t=(@PUW 1PU7B ujG(uw^_[]ÃtRG$jPW tՋ(@PUW? 1PU7A uG$ 1랾뗐USWV[øD$$L$ l$DA4DtFPUL$(>A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍>2PQhRyoL$4T$0^L$YPQjbRIoL$T$0z>L$2PQhRoL$ffffffUSWV[+t$nEtjPu> EjVtE 1t u1@u)d1Ƀ Vt^_[]ÐUSWV([ht$@l$<}GtjP7> G ujU芌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$r ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP_ u !1(^_[]fffffUSWV[{|$ t$tGw#jP!džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP t2MQUQRP EG/1^_[]ffUSWV[H|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$׍YPQjbRi\$8=$roD$L$,td;l$tX14Eju7[7 t%MLH4jP7.9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [(|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$R5 $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Í߬լPQhRgT$믐USWVhXȞD$|$|G =tŋ\$jj$W/{$jj$W \$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$Wo ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WWO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhTR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhR|a끐USWV[ÖD$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V 1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$ PQhRzX\$T$ D$4@USWV[ÈT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJ] PQjyR'OT$>]t$֍ $PQhRN\$L$$t$|B,1o9wl$t$uL$H;qu LJ)L$*Vt$PT$9T$ t$|$)Hf,Jf6ŃsxflBL$fLB|$t(fr$t$t$@ŋP frl$M|Bt$sFD$D$$g$>] PQhRMT$W$>]֍ PQhRaMt$닸1(^_[]Íj]׍ $PQjbR$M\$D$XNL$]֍ $PQjeRL\$D$Hp>]t$֍ $PQjkRL\$L$$t$>]t$֍ $PQhRrL\$t$USWV[Èt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UtlƋD$cPULT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σsZʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]Í> PQhRJ$E vUSWV[ø|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ uhDnjt$Pt$0VjtRV tm9u.NWRV/ t ^_[]ÐSWV[|t$|$LQjPQWit2HfyuftfDHjWPV6i`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P- L$,1TMGDHjWPVg t&dž(@f8u$dž  ^_[]ÐUSWV[~zA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PV]f t׋@f8u$dž wSWV[Ì||$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[6|T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[zt$0l$$D$jPj |$ PQh}RYA>fL$ PQhR*AL$fffff̀rS[4xt[USWV[x|$0D$(pFtjP6 F!Gt 9u7L$ L$4D$ _|$,P(?99s$QPw7P G)RQB D$ QF(n$M1ҽtňʃ0(;wI( t`9! u $UV $9 $!u'D$D$@DWD$t=|$WP@ |$H9vjWPVtl!|$, $tt$L$E,$ύL$ WQPVD|$u( t u~$!jUWjV^_[]ÐUSWV0[hul$Lt$DD$,9EvHD$PUVQ D$$D$D$ D$D$$ED$(D$ D$$ D$ ,$T$Pl$H9¹)QUVg [|$xD$Ptu,$<1L$DD$H9,$vPT$RQT$ ,$uBj)N|$9s6WVt$t$ jRl$\Uƅ|$1f9l$s*yL$)ɋT$zQPRTL$ fAA)fAfDy$΋J L$ LDr2P D$D jV0 1|$;D$,uM0^_[]jRD$L0 ׍|$ύYPQjbR;|$ rfS[r1 uOƃ1 tt%9HuHP 1 E@[fffffffffffUSWVYkrT$r 1t\z:_L _ L _o ݃L 9stǃuƁL ^_[]ÐSV[qVwjV<$` VP̭^[fffSP[íqxb u;$ xb 0jjPQjRt<$ t ǃxb [ffffU %Ʊ}NNNNNNNNNNNNNNNNdINNNNNNNNNNNNNNNNmtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20260206173327Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260206173327Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple ofsector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260115%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist