08P5i'&<  '5iZP''`'%. %.5i'&P@@<@T 08P5i'&<  '5iZP''`'%. %.5i'&P@@<@TU 5i`'%.yA5i5i5iQ$f 5i5i5iRA5i5i5i^A5i5i5i_A5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5imKB%5i5i5iX`hpx$5i5i5i (08@HPXS$c5i5i5i`hpxP${5i5i5i[Q$5i5i5i (08@\JA5i5i5iC5i5i5iA5i5i5iA5i5i5im<5i5i5iHPX`hpx\$5i5i5i$5i5i5i$>5i5i5i$5i5i5i$s5i5i5i$5i5i5iA5i5i5im 5i5i5i$5i5i5i $5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5i$`a5i5i5i (08@HP$5i5i5i$5i5i5i$5i5i5i$5i5i5i$5i5i5i$5i5i5i$5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5iA5i5i5ia_C<{Wh`*m]0v7Cs8LGuf cXù'?ZT8LD#kqBKc6[:9b WtwB$@L(h| ] '~H%. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4?%4 (p"p"wwm$224 TTT,,m$22Ptd(QtdNetBSDPKwGPaXU SR ffffUSWVP[?.t$$ujPjjj j0F $u0& Q/tuIXuk;(s(9rD$t P#P#;s9rHP#$06v@ PUSWV [È>.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[] USWV[û<.; s' ~*u.UE9r^_[] SWV[l<.;s9r^_[f$SW&<.5u1ƃ5 tЃ tH$k_[SW;.4uYƃ4$t|$H<$kt$?t<$ktЃ_[WVD$0tP>tKj/V t@Ƹ!q"&PVt&uVhp"hp"h|v3&^_`SWVhp"hp"h|v3u& 1۸!q"&PCPrFh|v3j 6whw%h|v3/& uh|v3j 5jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5,~3 u$1^_[Vhs"Vhs"2 5(~3hs"j蜨wVhs"j\USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&tutD$D$$D$% D$t$@N D$l$h0~3h$$8D$ @l$0tD$Phg$j )D$  |$\$4t$,s$L$)L >QPhu" D$  L$s()@L$L bQPhu"L$ D$  s D t 4X&hu"yL$ D dtPh v"_D$(@9XU޿\$D$T$T$9tt$N9BD$4X&5(~3h*u" 1h^_[]t$|ht")*%WS$h>u"h[u"j襟UT5(~3hyu"j躟t$|hs"5(~3hnt"3$hu"jhc 5,~3p u15(~3h-v"jdSWVPD$Hw#t$>8&Wt ub<&$h"s"Wt N1AQhc5,~3 u 1^_[5(~3hBv"jϞUSWVP|$t$7<h>s"WVl fu $<(~3u o3)u (~3uhAs"0Is"t (~3hjQl ,~3u 5(~3hRs"Ih u3$(&SUt uUh{s"jh[s"j$NPVS& PV|v3PhVv"VE Vjjhv"&&hv"h|v3 uj5,~3lWVοVx&tuVhs"j|&^_VPΉj PQl x $9u^Vht"j˜WVοV&ftuVht"j蝜t&^_USWV\$$1~3 ~3x3 t3sVj=P}x<$hjjh@&Ul 3H F H 3VP3u3t;#=t%{ 3##=uthRw"%3tttzut!tcu3X 3^_[] 3zVhv"W Whw"4$hv"4$h"w"jhlw"hw"D$L$011PjPjt$h@z$܅~3~3x3t31PjPjt$hw"謅33hw"j葚1hjPPt$hx"x33 tj 1PjPPt$hx"D,2tZj{ 3u$1PjPjt$h)x" x3t3ËD$3h:x"j1hjPPt$hPx"΄33h\x"j賙3u$1PjPjt$hsx"蔄~3~3ËD$~3hx"jo1hjPPt$hx"V~3~31hjPPt$hx".~3~3fSWV3t/ p3l3 t5`3)փ>8F u`3~3d3 h3 ~3~3;~3 ~3r*jZ~3`3~3 ~3 h3d3^_[áh3 d3 t ~3~3hR&h$$jWhR&h$$jFhP&h$$j5hP&h$$j$USWVt$|$65$r#SjuSVW u=o3PM3u,3$33h&Ahx"j襗3h&1QQPf 3y 53\3 \3 =,2r|3uhNy"롡~3u#~3~3y"3h&13H3h& hQPce ~3yJ13H 3 hP5~3Q ~3 ~3y 5~3~3~33utS1V t3339x3r_ \3t= 3 ~3E ~3t# \3) t3I ~3" \3ujl~3 `3~33 3t ~3 ~3t 3h`u;5~3 ~3=3 ~35~3VP5~3W 31VhP3hjWhjH5~35~35~3~3h/ -,2e=33 3 t33339ss$`3 t3tQj QjP 35t35`353P$ xd5x3-t31‰1 l3 p3d3 h333d3 h33 3xPh$$諏+|3u63j5x35t353P  t53h$$g3 x3t3 p3l3d3 h33d3 h33C3s p3l3d3 h33d3 h33u@s)t83<3H `3PQQI l3`33~3 ~3j1h3d31p3l3hzy"jPh$$jWV3=t=X=zu 73~3 ~3t;~39щ5~3s))Rj5~3A ~3 ~3~3 ~3 u\5 3=3 tJ5~3j5~3 ~3 ~3~3 ~3~3ʉ~3)Ɖ=35 3 t jY=~3u3jPu X8u*35~3Pt^_ho#j莑hy"USWV~3|$,t~3~3(p‰D$l$|$,u 3 xT$ 33 t!3jQP5~3R !ƒ~t$VSh~3 $~ D$ `w18D$ Z 33 ʋ-L3H3t>5~35~3QP`@3D3 3$31 33T$<$t$ H3-L3l$13L$ (3,3D$11 ~3t,~3u#~35~3h y"T$~3L$ AD$)ʋ$tЃ|1@|p9@|53 3*~31 ~3T$1 uK 3$3I$T$ ~3~3)ѣ~3 ~35~3-~39(3,3$ t ~3)PQ5~3豓 ~31~3~3 ~3~3 t((3 35,35$3QPVR tjh%j^[$^_[]5~3h/y"5~3hx"5~3hx"j:5~3h$$jXUSWVt$(|$,\$$Uh~3jV[ C4WVs(P( 8jUj2[ 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hy"jV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h$$j"VPY9v VVPQ3 t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV~3 ~3t/jh2#jX ~3 ~3tjh2#jX 1t$PVFȺMb׋ X3-։+P3D$H T3iى tL$ 1FD$|$ 5,35(35$35 353535353hy"jdW|,WPWjW <383 t?ƒ ʺd%t#RQPhy"jd|$4W,WSPWjGW 4303 t?ƒ ʺd%t#RQPhy"jd|$4WWPWjV t$ D3@3 t?ƒ ʺd%t#RQPhz"jd|$4WWPWjV L3D$=H3jPt$ t$VSÉiL$it$V)QP_RPVSt$Whz"jdt$@V$V)PVjV e^_[]EVt$;VMMjfUSWV|353=t311C3W5\353P$ Mtg3u53h$$53W5\353P$ ݅~|3t )u=t3N{T,2rOH,2d53 t3=3 35x3jVP53W !ƒt^_[]hQz"j53h$$jWV~3uD5~3 ~3=3 ~35~3jVP5~3W !ƒuuJ~3 ~3ti1135~35~35~3P$ ~J;5~3~3r,f ~3H 3Phm5~3Q xw^_xof@ 3Phm5~3Q tD;5~3~3s5~35~3h~3 3~33 ~3 t5~3h$$j賆fUSWVX $p $l 7#h$r#jƼhkz"WS3 H-$&333@33333333u3i33S3G3;3333333=3-$<E=3u =M=3ui $$ =3u j 'Vh#t^_[]h~"h~"hAh)~"h~"hBh}"hL}"juSWVt$=3<\$Wj h$r#RQPS(SVhL@$i^_[fSWV|$13A$3GO ,31ʋ(31 t$(3 ,3jP503N  39}3W3 39|_SQ͎ 33 3u 3503WjPx!9u=(3,353>X 0ҭPh#h|v3 h~"'0詭Ph#h|v3 h~"N^_[0tPh#h|v3 hH&hN 3uá3u tjwGjFUSWVj蹂Ƌ|$11K< @u=$3t?jj503 503N(3,3$3503UjWA A)߉n(3 ,3N F53q033-(3F ,3^0#Ph#h|v34 hH&Mrh "]1H,3(30Ph#h|v3 h"'0踫Ph#h|v3 h~"LV訑1^_[]Vt$53q0F33^WVL$ 35439})=379}>3829~vRO9G9~-823~Z3΋Nu#82)Ou9~82RN982 43u 3uu82^_É1jDjDVT$3t=31363t@9uхt3uh%hK1^SWV13,3j?h"u."tWat|8/uWh4"Wh@"h83+ 83tLPY t$hg"Pd031ۅu@W`?583h$$kj"jkM"PJV@^_[V03tAPgxG0383t!P 583>831$3,3(3;583.0PVh&h|v3h"I^Vt$03t3P83t!P 583譎83V5jhă3hu3D} "x 3331<3@=ujuSVL$D$ T$t$<3<35<3<3~A2<3BI^[fV1@3D3L3H3P jPr]5]X3Fu^SWV5D395@3t$@3VjjhX3uut=\3X3X3jjPPLth"h$$[HP30`3@uH3=L3VrtVPc G~*h "5_3r0h"h$$G1N1Nyh/"h$$G5D3~@3H @3X31H^_[Ë @3u!T$7D3@31D3xD$Q@3X31HSVփuUP30`3@uX3jjPPKth"h$$GX3 \3 L3H3aˍX3)QhP3Pa _3P30`3@uX3jjPP$Kth"h$$FVjjhX3^[Vt$ @3uD3@31D3x 1H^USWVh"NƊtx<0uFD uh"h$$$EGuȿ|w WjP` 1T L ш @u`3hjV. P71Fth"h$$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$T& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP3 t uh@"XC^_[]eC$t38u@35 3Nj- 31;-3M1WtÃ=,3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-3|1MV315x35|35l35p35t3v5t3 3u 3uu ^j:jq;V5p395l3}t3I3P5t3肁tC5p3t3 3u 3urufL$l3r5l3 1^0誠Ph#h|v3 hH&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P l3|319t3@u 9u|3Sk3 t$$PPh,  $ 3| t %u3ڃuh2#Q誹Uuhq"Q荹jD$P 4Ë $h39}=d3]39|A‰T$R5d3NjD$h3=d3 3u32$@PSWl =3?5ƅt3VPP,+ 38uK=d3뜣|3Gh2#53nt:jPDžZ"x Q:? ^_[]Í|$;0Ph#h|v3 hH&> 3u3utj8t"j&7WV l35|319}'t3FىDuw9@u1=|3^_USWVD$L$9tVl3r=t3~=x39 t9|1Cx3Mu9|1Cx3=t3 9u^_[]fUSWVl$}!uEh32#PUT1h32#PjÅt*t$Sǀ}!u?S=0藜PUh&h|v3h"=eSzx(=3uWh(v"h|v3j 53+t$0f0+PUh&h|v3;h"=^_[]USWV |$$Wơ3$,3D$31-3-,39-3t\$=3t$ gDž~w11353Y6ts3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=3t!ɀ"9u ,3 uh|v3PP9¡,3Ƌ 3Ӏu1A9|$t $ 3 ,33t )) 3u 3ut j4 ^_[]j3USWV1|$=3t WrGHOHt uG `-39}3V39rFU53;z-33 3u 30u ,3F8Wʲ<1ۍF-39~N3 39wUQyt7-33 3u3uhtk30 F0Ph#h|v3 hH&9 33j2G @utL30 F380ePh#h|v3v hۀ"Y9-130=,3=3  )Ɖ^_[]js1USWV|$?!uGh"P t$WI,VPcÅt2l$t$ US NjD$8!u?Sz=ÿ0舗PWh&h|v3h"{8mSkx-=3uWh(v"h|v3[ t D$ )@ʼn3R0Pt$h&h|v3$h "8^_[]USWVPl$Uƃ=3t1ۅtf;l$ `1V$th~;-3u=,3t =3u8 GWPt$ F x4EEs @6;l$ |=3tt$$$^_[]USWV|$\$l$19t[=33t UPrUPFy&0Ph#h|v3 h#"61^_[]USWVP\$53FEx @u}|~PVq6tj39~l339SPugƉ33 3u.3_tO53;^_[]Ë53W53V舐 . ,1xщǃ|$uE3| /539$~Z39V53ucÉ533 3u3t 3W53UՏ ,$+HPS53D( |$tM1BDžhZ"4 0ѓPh#h|v3 hH&41 33539} 3|$N339͋|$|MVPst0533 3u 3umua(/ M0Ph#h|v3# hH&4 3t13uj-j/,SWV11u3H u37hu3u8u3@%fu39uu3H u3ÍF=ȃ39~Y39wW53r=ȃ33 3u 3t 30u ,3F 3C0轑Ph5"h|v3 h@"2%u31t 3033^_[蜹0aPh#h|v3r hH&U2 3u3u tj_+j*USWV\$ D$1tt$hR"yD$ l$1uHD5,v3J ,v3;3 3 33 3;t,uQ39;u3빋 3| 33t9t 31Ƀ USWVPl}33DJ@t t@3@DJ@t uHH 3~Ã=w$0&=3!h;"  !=3" 3A1Qptntl  Ӊ 3A˃=3FP”^ U 3@߈\$ ̀1ۈL$QuH 3H1KDB@,Aǡ3 3  Pj  53j$1  ˣ3@̃=3t=3y=36DB@jLǡ3@1Hptntl   ˣ3@̃=3DB@8!h'"=31Hptntl  ˣ3@̋ 31PptntlN  ӣ3@̡3HQPN"3@1Hptntl%  ˣ3@̍H 3 3 p1Pptntl   ӣ3@̡3PPv 3A1Qptntl  Љ 3Aˡ3PPH- 33=3=3 9=3 - 339 9w hl" 3PP 3A1Qptntl  Љ 3Aˡ3PPl@ 3A1Qptntl  Љ 3ADB@;h" 1ЍrЃ sO蚨j h3532C $3wk8"% 3 3:o t!gc ptrP  A 3< b=3Ho13PP9  3-3 =3=3 9=3 3-33@1Hptntl  ˣ3@̃=3F1Hptntl  ˣ3@̃=3h" 1@ 3 3AQP2 3<账j h353LA @2聦8"h"N@2 3x w =33t30h3&~ 3x A =3u;.53O1@ 3 3AQP@ 3jPP>3x  1q1ۃ=3Ƀ=3 ˃h% 3x  =3u-535 3 53g 3x ? =3uL-535 3: 3@;3?73-3x =3u , 3IQ T3x =3u, 3 39QPn3x QVP 3y F( 3y 1 3y P535 3g 3A1Qptnt lu  Љ 3Aω 3y  33=@29|PRQ 1=3u 33 ǡ3@1Hptntl  ˣ3@̉3z !3SPhA3x  1@+33uF%3x $<u<2=3t133x =̃3h̃3h#h|v3Z 3x }*x1Hptntlu  ˣ3@У3x '3G13 33@Hptnt lu  ˣ3У3x =33u=%|$Wt"535 3QP';333x ==3uJ)=33u53Q5;3)3hW"h"h"$3h%$31< *5 3y qt(3@P(3@P=3h]%+3x )53j 6'(Y$i*tEEp $A8GMi 3913)@أ3=3t W6U31 3u 3u u^_[]jjSWV=3uj貽L$ɸ!33Pjh"h"Hy|hK#DtkP|~=Yà P;tGWP觜|3/tf/VA~ed.hDhup53jh"Vj=3ujL$ɸ!3jh3USWVPl$5 3'Ƌ=3 3-39ʼn) u)E1u1$3E@3V}tzP蘹t_3PPj DžtO33H3u 3u[uE6M3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~3L$F$ <39} 83V3839|BVPiD5<383 3u 3! 3 u1C1E҃!%=3h3P{Ɖ$ <39V39V583C5<383 3" 37 09L$]939|WP7C=<383 3]9~[39V583B/5<383 3u 3yt v83 3 (E 3Q39\u=Q3I ( 83G (E,$s 3L$A 3 (3y @3)9~_39VPAI5<383 3u 3 @383| (3A(EA(3@39r 3L$A 37 33/ 3Q3 ( 3݀ (5D39}(3R3(39|KVP At]5D3(3 3u 3S583P[ (3@3D$1!PV0`Ph#h|v3, hH& 3 3u!u#^_[]h"qht"gj'jVj;5tL$Qq p PIH1赇0z_Ph#h|v3苢 hH&n1^V3t.L$19 P3uP3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h̃3ÝXWV 3 td< uh@"1 Q3I t;8t7P1ǡ3t?=3u6Ph3953h"R53j33tV353WP` 3t.h'h̃3QP<53C33/0]Ph#h|v3̠ hH&^_USWV=3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-39}=3M339|KUP=tYlj-33 3u3uyS53W_X 53=,3tsj jSWmeԄ0\Ph#h|v3誟 hH&1 3u*3u(tjh$h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u3 u3E#t3 uE1^_[]8uP3HЉʀπwRwj h353 1wI8"uh"1gu@3ErUSWV3H 3H%u,8Xu'33h"t18u=39 3L1}539~[39V53:#533 3u 3\t Y3 3Q3 u (\t u^38uT3H 3 31< u0=3u't 3| t %u3ى38339|NWP9t8=33 3u 3uuuw5303M1IE0 YPh#h|v3 hH&1 3u 3uu^_[]H3,j'jUSWVPL$3 3193}%3ȃ Eh"Kl$ 3PUVPt$$KǸ1$3PP 331S̪á3tP芬EPPjM Ņtl9u 3l$ u3ue$33+ 39}yF3@3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=,3tj jvS肮vލD$jPjSu~t1t$ED$$D$1E $A9T$ 439Ɖ $T$~c3t$ 9V5 36\53 3 3t$ T$u3=,3tjj RS藭T$= 3RSWSQ 4$D$D$ 3 $9~bt$ 3$9V5 3553 3 3t$ u3=,3tjj t$(S= 3t$SWP Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu|&D$)D$39~V3 39SQ43 3 3u3|$~#D$$ D$ ud$th"$=,3\$tjj SV賫 3SVPrO 3f |$%C<{0SPh#h|v3 hH& 3t e^_[]Ë 3u tjjUSWVPt$ =3T$-3E<\<&I,$D$h)39~Y39W5 3g3=3 3 3T$u3%$9C 31F9uEEπ;D$$,$L$l)39~Y39W5 32>=3 3 3T$u3ml9}C 31F9u,$y^=39} 3_39|W5 3(2=3 3 3tT$ 3T$M 0E+3;3539} 3J3 39|KVP1t)53 3 3u 3u^u`Iy0PPh#h|v3 hH& 3u 3uu؃^_[]jjfWV3 39|ld 3j Qh3- tJPLPPh#h|v3] hH&@5326133k3L$t$T$ =3@Q葤 33RDVu353@LF533^_SWV33r9 3@<u|L19tWWs59u33H23L2^_[USWV=H2=L2=3t 33$3D$j荣33 3ÍS4R4nr@44v\1L1 [ 3\1l1sRt6,lmL)1 3t)|?wt)LI1 3t~l)}L1 3,u44vL1Y 3l1}w4R4Ӆ HA9~R34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=3t׫H23$H2L23D$L21 3u) 3u&tj\h0"$^_[]jlUSWVL\$d3ڰh@"-+E"tNjt$`hP"SV fttu=$<߃u o3r|$L$ D$1@&ڃ"D$PdƋO9rPSt$ e tu;_Յuͅu t$hy"-|$dD$ Du$$1Fl$?uSt$ hU"jOL$j QP $;Fl$|1ƋD$8u&1zPUy!Uh$$j.D$ th"jNjC=m@!sHQPW xs{QPW x4$Uh"豋 =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@WL y?60Ph"ӍL$fqQhmW 3Uh:7#D$ukD$Ph"hm"׊ T$"h"T$"h",v3H ,v3~$v3H $v3 PhP"kh$v3j 蝐t$8t$8t$8t$8t$4h"Lt$Ht$Ht$Ht$Ht$8h"+t$h˄"t$ h" j/:pPh*"h|v3芌 jSWV֋|$t "?t$"VQP載 JB8,v3H ,v3;譎$v3H $v3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hQ"%thc"Pau 3hg"%thc"PZau hq"jhc"hg"H mPYu h"jb 0D$ u h"jt t$,)݉\$D$$D$11D$$h"SU c7~+Hr߃8tlH w&$Ș&$<$뼃4t6맃dtket/1@D$=$<umWt$'`Xh"5$<KD$71@D$$+L$ o3 o3T$uAo3$T$uȋ$D$,jj@R9l$L$ $tL$ $L$,1ۋD$P]CEu S)St$PʼnD$$e UL]l$$T$DtIL$ىL$$U$E L$)QPR 4$\EuED$ush"h%^u]hޅ"bh"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh$3t$ t$,QPRFt$ )yj{=$3y h"|$$tQt$(jVjhSNy h"jVjh5$3Ny h""mh"0^ǽt$(1CUVSwD$PMNUVSw5$39Nt$,M1L$XAAA @D$HPQS = 3u'l$hD$h 8jU&i ul$uDžy hS2#1O~fVS5$3M VSt$VM |$h5$3l$0fE<u1ju@hWj u\j8Nj18tƉjjU tD$68Zt j8tEVSt$ x )bi8#Thu%|$l$8fE= 3ul$0fE9EjD$LPj |$@f9fGfG$3G$jVU tQf|$<tٺtf|$4t?$3L$0u+fD$<= 3ufD$4 i8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h4"jt$(jxh#yghx"Ph9"h|v3jjwPD$L$jQ5$3w XUSWVA1K8uSt<։0hhU7{ ~WUV* ~)u1g1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSZƅu]jjtqƉx jPSN ǀ;t$8u 4$ ,3A9tL ,3^_SWV\t$lt8|$jYPW9 GY`&Ӄ(Ӄ,P6B60$4#8#WVd^_[USWV $8 $4 503VUPV0W5P&1WWPփ (JWWSփ _ƍ Wh PX& WjjW\& TV`&h <Ƹ jPPV(d& hVUP8 V"E=a==hD$\jPST& 1Nxr$ STǃW0t^SWPZ tg0$8 h"jQ<0h"j:< 1N ^_[]þh"j<۾Sh"j; ¾h/"V!=bt =buk $}u+Zt$WSVL$ y/ FYD$t8Sh]"#ShQ"WVP?/ 1QQt[0( Lt543tQP!0,tt|@PƉ4P8tg04@tt| r>1A8Љ4DAtt;L5rSh"j: 10hu"WV|$x$t,WDWHDWDW4Dx uW=jtw\wXtP=29}5PBt852WVh"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUi D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"?%|$PQt$t$RhB"j(C$t&8$\T$XT$H|$RQt$t$Vh"jq($L$l$8h "h"hh"IUSWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h"j'NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP=l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPhX& |$0hSj,6SYtND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh"j%^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh/" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ @3@3H3H3X35\3D$D$TH Qq T$T$ t$t$QShR"j  11KL$0t.wESPhމ"jV53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<938D$D$ tD$tD$43ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP "PD$tD$t$t$8WSP "PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhI"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L P3T3tt94 S.843T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Phw""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh" Qh"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPt;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhg"je1gD$4$DŽ$߬$D$D$D$@$߬$ l&a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh̎"b11ҋt$  t<=X3\3$T$p$1߬$$$߬$@3@3H3H3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPn31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh"W $PhD$(X& yN<:L$ L$tL$L$8]:u*t$ tD$PhU"j$ ,uh"j uh6"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW6NJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP詺4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhH"jT$$BRt RPRPVWjt$$Vh"t$$k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhX& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =(3yh"je11t$ t$$k,t$4D(D$L(L$(}tTt  t1L$(VWt$Q](d&[$t$ D$L$9Éʋ|$S=(3tQPjWhF"j.]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh X& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QX?D$XD$TPh]X& |$t$t$kL$,9 $ ?t$!0wPVh#"jD$,]|$t$t$t$L$$QWtXt$|9|$11k,D(t P';|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP2hNQ&j,u׋$e^_[]USWV3tWjjPck 39u 34t0jQNx!=(3h"jZt$3xi8tPPWhБ"QV`tPSh"WjK/t8Vh"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21̅3Iu顀2P3 2~ t1@3@9uUSWVD$921A9|G2SwƉ<$~ SjV 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5353$2^_[]V$3 3D$D$ p&T$ t$ 253t$T$L$D$\$ $_"5$^Vt$FtN H N tNHNfr v 2V) 3^VD$`sH) 3ą3 ȅ3HtP4BPQ@@1ҋЅ3v9tԅ33rh"jtp4F@Ѕ3^USWVD$T$#253tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv cF V>3 ȅ3 29|[5܅3tFNu 35ԅ3t5FNHNFy F4VPV3@31@j@P~U1@PoF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É ؅3=h "h"hh#"h"hh"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP ؅3H؅3N^,H 3ą3ȅ3H@Ѕ3P Ѕ3 3H3H4I3H89t;tprp3403t4F 3H^hD"h="h4h"~USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gh&sd&G4$O,52w0VPww D$0^_[]USWVPt$ffh&sd&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j肼8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv vz^_pUSWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3 53^ft$ t$ j$SWVt$frLN4F,=2~0WPvv 1h&t\fv4V1AN4F,=2~0WPvv 1d&1;NuN^_[hr"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS'$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h" USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP!3T$3D$M u1^_[]USWV(t$F(F}F F F$9D$4toh(j蹯ljPL$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݘ":V$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthaW1$2L$1 QWPUSVh(jÍD$(Pu S# P EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh(j1Ël$hu P: $P E1PU\$tE|$8t h"S,$SstU_ ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"pSt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"B$  $ V)19tQRh" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj"h$v3D$(u KHKpStURQPt$DljT$t h"=Qu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k 3VRhЕ"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$wL$tI9ȋt$ tPQ$$h"讋1t$虰\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttv|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` r:H4$QD$ $D$.uO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW~ƋD$0T$UWo~ƋD$0 u$$$UW4~ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RP}ERP}$GW #RP}ERP}$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` r:H4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` r:H4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWxNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP~xt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPwT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP@w|$FV D$t RP#w|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPv t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPu|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPt$ D$TBL$?ttXLT$BtJ J T$$T$ QPtL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPsي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVhqD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"OUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 袁A L$H SjQ8 ^_[]fUSWVL$T$ B3ulF1G&Uh֚#,$,v3H ,v3~$v3H $v3 h$v3j u q1^_[]V|v3PPh"VVjjhԞ"胧"@&PhB#h|v3&uj[USWV׉΋*h"U &tCt[PUjhh3s 53*3t233WVS53G^_[]Uh{s"j{x53h$$jxUSWV$:$D$VuP7 9$j uP 1ɉ\$QSuw Ƌ88"u11F9Ή$<$p1ɉQSu r] ËD$8ՉG8"u !t$$Vhyd53U tbVh"B^_[]jhș"7jh".uh""$h:"hT"$p hn"h"jv$053h:7#jvUSWV}E phoJ%V6Fh"V hh%V SD$(P53oZ#D$0= M$L$A1yyy D$Phwd53  D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhjhD$v1111O w+Ow?u$L$A1AAA D$Phwd53!  \$tmt$ NL$,D$(3D$FD$FD$ FD$$~D$(P^PWt$,t$t$t$hΚ" KuD$1D$|$Ynhxd 53zR531111VQRP53h@"Ehxd 532 3LQhq"ww ww53h"w_G|$9w  jPQ53շ!¡3tNSVPh"Wt$ 53A $9t\"Qj!h$v3ݦSVPh"nكT$;r ZƉ[|$?e^_[]jjs53h"lhI"h*"h"h|v3~ jQh"WV$u>$jvW膀 s'Wh{dЀ53荶 t^_jh˛"jIr653h:7#jerVPPhtd@53@ $t%t53h"$2"u"53Q3$$w"w"s$r#QPhP" 3$$ w"s$r#QPh|" 3$$w"s$r#QPh" 3$$w"s$r#QPhȜ"^ 3$$s$r#VPh">^53h"j7qWV$u^Vhzd@53 tH$D$PWVh6"$PwwwwVhD"^_%53h%"jpUSWV}D$Phd@53u tzD$Phd@53R u53hx"k3$|$\$ t$jVSWVRPSWt$h"e^_[]f53hg"joSWVP|$uX|$_hq#STƅth"S@u+1Qhwd53荳 t ^_[753h:7#juoUSWV|$0t$,1@<o3$1ۉ؉D$h"WVv qt\$te+$95o31|$7wWh|d53 D$ ;D$t-i9l$sUt$赈ƉD$l$묅hhPV_3L$ $r#t4#RQPh"W|$ t\ư1P`VvvvvQPh'"  G;|$ ru53h"$t1^_[]W53h"jm53hǝ"jmjP|$u1Phd@53螱 3tQhN"XD$ 0Qh:7#jxmSWVP|$t$^h#StDh32#St@h"SttT$da3 D$dD$ tTj/S/tF1;tٍT$d#3D$dD$,t>\$:t$1\$(XD&@&h(" u1\^_[]h"hY"zo3=3uj=3$333 3 3Yh1"5$<h "Ph"je3= 3u th"0"3 3t uh"t=2uh")ǃ|u D2j=03|$\G1PPL$lQPjW,t2t$dUtt"1PPD$lPVjWt52=03u4$P52Au#$=u03 3 3 $3 3=T3 ɡ2=03t&jQP2 2u[52h#jhhd3QP{2y" 8hd3h"2d3=03u'L$dQP152hE"h`3hrdAP 52h"Y_h`3hedA52 52h"hd3h2"_$$t(hQP52hO"$$ƒ 3>s1@![Vs ) ȣ3333? 3 333X33\35352=3=`3?w3 3=$3L[V$3? 3) 3>r$r$3 X3\3T3u 22]u1hQPT0 2u25T3h$$g]52 12j52|VpX3u Vh+"8 11h\3t1A1A1ۉL$@1h\33 3h3=3u#<33@3 3D3$3 t$\F|$LSSWSjVїt$LoT3n 1QQWPjV蟗y5T3JT352j/Vet@UUUU)ʹ3333!!сisL313t!tt3Z3cԋ"3 ,3031&3‰ 4383@31 <31AhQh(3+E i-(3=<3 / ,3ً03P+==w !r%1H$D$ ʀŸw1D$ $}ȹ"3yt3t  u<31I $L$9 (311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$3- 3=$303D$,3t T$$T$3=,3uu 2; <37=3l3_hW""ET381uh"9T3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRVPSt$@t$,t$4t$31K1Kޅ`1PPPPPP =28h;"138LFu=3uRh"%tajhݼ"1 "WjWWWP+h"t҉Z3u 3= 3u3u $31g= 3T3D$tD$|D$h"31N=t 蹵@ 1u"WhVVWP+9tigfff։f53<3L$ȃjPAmD$ u h"jkTh"Q1HL$ Ajh"61۾3D$^3tB?t=kWUh" b3L$ DD 3$ D$tD$D$ u3 <31(3|(.tq<(tk{PWh" 03,3(3t (BD$,T(2D$ TL 3$3L$ щtT$ <3T$D$,F9u߃|$~O1l$GVWhķ" T$ L D3$3L$ tT$FЉT$9uT$1۹շ"VWSSSP)T$ ‰ $DD$Rr3=ue3$@D$ $#D$u D$ @&1$L$19;ta $Ȣ3=3u3u$3u  3=3t8\3~ h"3~lhנ"]h"=3u1Ih3 ̼3t h "qh"t\3o3e$jmt1 3"3t 3t3$ D$ 3 u=<35(303,31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 3|$E9u KD 3D 3D$3DL /X3 \3WQD$lP2 DfLJUh"bI1N1N=03u fSWUh"=h3uUh"h3\$&0tUhR"gj(WPR x:?r3t T$ 1I\$fǃ$^_[]WV΃=P3ut9$1P3tI= 331ȉ1f ¸tP3PhP3h\3諁 f=3fZ3Utj@jh3f ^_USWVӉΉȃ н"t&"|$W!,$$j\WU2 D$EFI 3EPART3M u#E1M1 uu Wj*7 ;Et 11=(3t } tu$u SVRt$hR"Uh0"G ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-<3~x (3 D$ D$035,3D$8$t}t ։t$(t3D$D$($r#D$ \31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=3t-t(WPh"N L$ T$8St$,T$4$tD$XRQPW XL$ tC=u=D$8L$XRPQW l$0$$L$ *D$ D$Xl$0|$$L$ tW$= 3tduD$P $OD$hl$( >-L31ۉl$(-D$D$D 3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$03 ,35<3L3D$t$1\3P'(3 =03,3tDփ1WP 3u, 3uh"ش3uh"Mtgh#貴3=t$ 蹵@ Rh2"肴 h"sh%f=3uB139x @uuh"4PhG"$=3t3PPhc"^_[]á2=3uxPhE"53535`35\35X3hN"足5\35X35$35 353hw"苳5<3h"xPh"ihd"\\3 `3525353RQP5X3h"$ h" 3 $35\35X3RQP53h!"5L35H3hy"̲ USWVPˁˀ $3 3 31"33~t=u3t 9r u֋ <3~:(3”>u~t:t  Iu 3 щ $ $3t&=u3օ4$u 3G3tiP3ȨuhF"hV%賱P3tj 3=u3Ѕ$tNL3=3u"Ph{"0hF"Ph"t P3 =P3uQt9$$ty%tyy%1P3ti3х $t4$P5L3h"%=3u5L3hX"1t"13=u 33^_[]VPD$ L$ $QPtDh"wu3H u3~u3H u30hu3%Ɖ t9tDu3H u3~u3H u3hu3ƒ1Y^h;"j5USWV1=43˃y CS t 35311 uY1ɉNVt11@5C C"t&"Ph"0 h"n1He^_[]SWVP$2;2u+03u"QhmdPx y h#`011h\3<=P3u;5P3|- P31Puh"V=<3~e1(3111 ,303Pt,(38C;<3|h|"/Sh"/$2;2u+03u"QhmdPw y h#U/^_[USWVP։m1ɉQPU0 1O}t#Ë$8uD8"u r1^_[]USWVP։ϋl$=3T+(3 \3tú$r#t$76PSRh"T$7St$h̲"D$7UPS\$ Shݲ"׬7PUSh"迬77PUSh"虬7PUSh"聬7?PUSh'"f77PUSh8"@7PUShI"(7?PUSh[" '1PPPUt$(SRh"^_[]USWVˉ1u=(3h"T$$8$43|$͉)uh$r#Wh4"ݦ |$Z)uh$r#WhW"æ D$|$"3:!3 3 3l$M?>"3&3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$d"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h", $3 3D$HL$LVSQPyD$T$D$PVSUPyD$|$ D$@VSPWiyljӸ1=2ƉT$ L$@PVt$QR-yPSW|$LWVUl$lt$,t$,t$(t$@h"Z,hu3jdh3趲 |h#h3|3\$ $t < uC{ - l}3DAu<-j D$$Ph3> D$$\$ h6&Se4K|$(@D$Ph?"S7 $ϋT$ t։t=t$hxA&S7 t't$hB"S7 ct$ |$@D$1=2ы5H3jVWRwD$ՋD$D$D$D$D$$t$t$D$$  T$L3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhl"%3Vwƀ3t$VhF" 5H3D$,$t$P։ω,^_[]h;"j%USWV΃ twttuƹ"^T$(|$$+L3уD$ ;,3"L$ 03|.|$,T$0 83|$9=43|=3u|$4u 1^_[]Ë-<3~} ʉ$9tw(3|(tk ,3t( T( (t1+L39\$ \$$}2;T$}#=3u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉ3tt  $tt ^"3 ,311 03t$ -<3t$|$$|$}(3] ʀ|(tP ,3t( ;L$T$|L( (9Ή} =3{|$(t ;(3KC 03,3:"1$t=t ,3 03S"=3|$(5@35(3B1D3@3<3834303,3Ɔ3t$ |$(P39@3u85(3A1D3@3<3834303,3(31Ƀ|$(T$3\$1 5<3n (3|+D$Nu (3[\$j5L3,3)؋ (3P|$(t$ hhj:(3VfǀU@3L$ 03D$,3ƋD$$ȉ54383<311<3u(3=3h""u"}"=31|$(9 @3u85(3?1D3@3<3834303,3(3Ju UPQ$ <31|$(tD$,3D$03543=83^_[]h"jWV(3t^ tڋt֋|҉tΡ(34 <3 QPV4$ <3ƀ^_USWV T$L$<3@hPh(3  <3(3~C03,3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR# (3;UjP| fDŽ;UtZF , M ;M;MU;; ,3 L3T$)ʉUL$  L31 EE=$3 3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M<3 ^_[]h:"jhWV1=(3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5l}3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$``!1Kl$ 22uhUPzQ5X3P  ;2u[jVW52_!1Kt?D$H5X3#$SUPP 52V52o ;2tÉ؃ ^_[]h׿"j\USWV$0$,1@D$l$D$D$ $1h"WV# suM|j U5$< á$<8=L$90|8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-o3)1<$L$jhQP41hl3hedAP<^ =379l$| 7@f3UjDž\$ t|,v3H ,v3~$v3H $v3 h$v3j jhl3h$v3 ,v3H ,v3~$v3H $v3 h$v3j 诙<$ D$tt$r#t]"Ph="HD$f3l3Waf3gdWPV ] xnu)D$PhwdV\ h"h"V1^_[]Ph"25$<h"j4 h"h"Nj贉xPhj"h|v3 j蕉USWV\T$3< $SQ'D$9d$ՉjRPt$ V8\11 Sl$UV  9 1U\$tL$j@PQL 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4H&h"XT$l$ 31ɺ 31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 3ŅtMaQ4H&h"AT$ t tuf f1113|$ 33T$ 3 3f3l$E<$g\$ttXaQ4H&h7"賏 ;B Q4H&he"薏 <$\$t4H&h"v<$l$!F1D4 "V3 w,hP"V" w0hc"V w8hx"V w4h"V w"@D$Rt$UWQP荊$71w8$Ћo,1lj1l$DRWt$>"P@PUEaUD$PShG"$S&$#a0QShU"$S<.Ǡ!w4`&hc"Phk"S̍  w$ԡ&5h"_<t$uM55h$r#RPQhr""555WRPQh"SU7h$r#h"S@ "55RPQh"SM8tDƔF1Ph"S F;E=3L$y"m0DPWt$h"j, 3{<|$\$W4$*Wh"h"Sʸ4$u h"j F j/P 8t|4$4$`*j{USWV\$ l$|$t$1E3gq&33h"WVO h~n3itVn3Ѓa~.btCd 3봃otBs3띃NuS$<331=33mjSh&5$<tHPEuAo3)ރu4t$$V41ut$(t^_[]hn"j iPh"h|v3 jz$"=3uD$ D$@"3t $P=3u {%= 3u "=3u $@P0h"hG)&jWVPh32#Qυt1ƉPjPW Wt jP#VZP^_ÐWVt$|$ VW_dt$?/tWhc"蘒Vh|"芒^_WhN"jGfWVt$ |$7蓥WVUSWV $$l$WVSU$ $ hU3WhXq"uWVh4"jGD$@tF$j$hx&hVV$$$h="njxUSWV$$$$D$1 h)"SU $D$D$1G$D$ȃ 1$<&N|w5$<Ft|$`N|Z5$<Fx|$Cj$hh&5$<|P+5$<UFp<$h)"SU Vo3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hn"jWh$jGePha"h|v3 j@vWVPt$jWV 9u9t x^_Vt$h"j Vt$V t@^h#V^Vt$Vt@^h'%V|^WVPt$jWV- 9t9u x^_Vh"jWVt$|$ VW`t$?/tWhc"Vh|"貎^_WhN"jofL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h",1VWt$ t$QPX:1@PPVVu4u0uNËPh(h&P?8 }D@u hh& hh&S8 }D@PE,CEhPs%VfV\$thPs%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$x~D$x|$D$xt5Ph"X+%t9\$t h."?+\$xD$x\$D$D$ 9\$~\$~tSha"+\$9|1} t h"*hW5D3h"讋}4xME0;E4ru0h"*},u,D$D E4t h "`D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$">(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ W'\$tt$1F9tWh^"'D$ 1tt$ tЉ|$TB7D7R0'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"|v3Py |$)Wh"|v3Py D$ $L$t$}D@tCWH&1@9tWh}"E&L$G$D$$|$tD$|D$P$\$hT$,T$ T$UǺv%M$$D$$QRvVh$v3|$u+`t1ɉL Wc= 3uVt$W (t$ h%1e^_[]hR"hB"h1hq"hB"h h"h"hqh"h0"hh"6h"h"hh"6jjUSWV$ϋT$$l$ ȃt.H1 D$~t$t1@fFD$$utȉFh#u PUFVT$$t u uu *PUʼnnV PUʼnnVT$$`t,\u tȉFt SU>F V$D$$u tȉFt SU F(V,D$$u t͉n tSUʼnӉn0^4l$$tD1t@$tHu tω~#u$4$Walj|$t1@ltP p $tW| 33:H1эP3 3 $uFht Ȋ $1FVt RP=33$tL  t1 $u tω~htSWFljӉ~^|$~8 | 1@11u D(LtLpB9u T$$u FX1pt11H~N1ۃtOu D\l$$ptlH1HC^_[]h"hd"h"h"t2PD$L$ $QPh|v3LX XfWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fL$1r 11B@9rWVPt$D$$|v35D3h"WS 4$VWW Wj bjGfUSWVu D$Tj/6D3u@D3|Ph"j]1D$$D$ D$4D$8D$D$D$PD$Lh2"VS aH&$ذ&1HD$8ЍHw2$(&$<"WP1HPWh ,3떃bf$<0%WP1HPWh $3V$<"WWjWjl D$$3$<Hv$D$TPP1HPWW? L3$<\{$WWjcWW 2$<1"WPVu Wj<35$<6j $PV D$58$8D$!u Q$<j"WP1HPWWa83'$<H3$<y$WP1HPWj'H‰D$5$<hr"$<T"WP1HPWW03$<"WP1HPWh@D$8o$<_"WP1HPWW43E1@D$491@D$ - 3"$<q%WP1HPWW2D$PT$L$<@z$WP1HPWh(3Vh"h"&u=o3؃rKVh"hT"j/D$t t @@u|$$h"Ћ45P3j/V5umT3Vh#"h"hSJ$DPS貮u"5P3h#"hPx%hhT3[JP3T3 Ph"Ku = 3hjSҟ |$4tg$y\hh5P3訟 D$xD=L3~1hSPD$ F;5L3|1QQQP;D$ u D$y05P320s PVu h:7#E 1HD$j5P3Åy'5P3h20- PVu h:7# $DPSy'5P3,20 PVu h:7# $L%=ta= uDH3u DH3L$t$QRPS5P3膀ul5P3hd&5P3h)"NDŽ$$lfsD$tjV$$c $ $L$ Z$ $ u4hc"L$ u.$$lfst!$$PhPs%4hu"L$|$u$=2|$TtL31L3ɉ\$Hu0L3tL;$$ s5$$ %DŽ$$lfsL3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h" h"XL$8J#$L= j|$W$($(D$8T$ t$VN|$(O11VSh$Pt$X#xHWvD$(+D$L$,L$ ʃ|*5P3h"W1D$(+D$L$,L$QPVSD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$D$\D$8L$\ x&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xx>WhFD$(+D$L$,L$ ʃ{1QPWVkth:"j1F\$D1VPSh@"WFD$XWVPS%|$$u1Ʌ|$t1ɉAw1@|$Phn"FD$tt$5<35035,3t$\t$dt$<583543Q5$35(352PWt$L@ƃ|$4tV<USWVӉ $4-|$j W\$ SQ Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ W,8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"jUSWV|v31F/WVUhm"WVjh"WVj!h"WVjh" WVSh"WVj+h"WVj;h)"WVj$he"WVUh"WVjh"|WVjh"kh"WEWVj h"LWVSh'"<VC:fD$t1B9| 2I 21|3Iu顴2Py3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjV2& 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u53k53$2^_[]V$d3 h3D$D$ p&T$ t$ 25l3t$T$L$D$\$ $_"iA$^Vt$FtN H N tNHNfr v V `3^VD$`sH) p3t3 x3HtP4BPQ@@1ҋ3v9t33rh"jtp4F@3^USWVD$T$#253tC=`311-l39| n-l39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"C!USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>`3 x3 29|[53tFNu 353t5FNHNFy F4VPV`3@`31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H p3t3x3H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^hD"h="h4h"USWV}]uuu W@t d31@h31HCSuu WW KN0F,xNF4VPe^_[]vjv @  fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd8F'hjvp v ^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3Q 53^ft$ t$ 7jm0SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[hr"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR良׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS跮$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"mUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP豪3T$3D$M u1^_[]USWV(t$F|F|F Y}F F$9D$4toh(jIljPL$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݘ"a$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthѐW1$2L$1 QWPUSVh(j譹ÍD$(Pu S P EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh(jËl$hu P $P E1PU\$tE|$8t h"z_,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"_t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"*B$  $ V19tQRh"<* 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj")h$v3D$(u KHKpStURQPt$DljT$t h"\u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRhЕ" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$L$tI9ȋt$ tPQ$$h"^1t$)\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ s,[D$ p D$D$D$,$D$ E,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` r:H4$QD$ $D$.uO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UWĉljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPWERPG$GW #RP2ERP"$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` r:H4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` r:H4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW莄Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP胃T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPЂ|$FV D$t RP賂|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP; t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP螀|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV|D$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv a t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p 2A L$H SjQ ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP51 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jPwƉ t,UMFtf^81FFH1|$<΋t$  3uN 3NVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$袒tPQVhz" }L$ultDH!!lt1t=RA X jQ&t9Ftt1t ;T$h"h"jT4U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ 33uPt7 \$t$`tL//W}1}ottP  t1h SVP~ƻSWp 荈 ^ hjSZ V^_[]h"h"hh4"pUSWV l$4E}0I\$8u tȉFSt T$$DF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt-P/ڋLt$t$\$L$ T$D$D$$8L$4tI(D$L$$ "蚵\$8u;l$L$4A(I,WhT$L$$D$ 蓕 l$u L$4A(I,T$L$$D$ \ \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$P:l$4E 3 tr\$<u tȉFSt T$$BF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$ BF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWOƅuWhu"j?O$$<$4D$Phd@Ui tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$1 Sh"UYn CPh8"Uo C Ph"Uo CPh"Uo CPh"Uo CK,C,Qh/"Uo C0PhD"Uo $@D$t P1-Uhzd@$<W t1 VhedAWԑ hjU諫 D$ P$4w*D$, 9L$/kL$9u0$S11:8tx$0h"Hb$11҉ $ƅ*ŰPVj PUZ ^_[]$0h"jLUSWV81ۍD$4ShPSuc1NtAljSPSWuWuMU D$t$$$Q1e^_[]fUSWV $( $$ hojS h32#Ut.P|$"V(t!Uhm"JUhS"1OUh"l$D$QUPhڋ%WtPUh݋%W誊iD$$Ca2=ouV\$R&V{V$( ]hh0"WX ƃaT$,"V1u\$ىjW$( h5" VT$"V$$ h"V  ^_[]1ىj=ߊ< t< uGjh#W k2$( aj2WPW EKu$( 8~y$( 1\$ىj(Sh$PYI u$PUh" "j2PW^W E2$( ;(|V6\$8"V$( @VT$"Vg$$ hc"h";uD$ $PUhw"S uU蝚<Shh" $( aPWh"Uh>"$( x?$( Z1ىjPySh$PG uSUh"m j2PWU E2$( ;h||$jt\h"@PUW| $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W蝆L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR V聘q葨8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh#VG u<^Ft t u^F t tWPWV  tt$hU u1I1ɉ^_[]WV׉RhQl t6< ~< t<#t< t >t< u6AWhV8 űD$ 1GtPh$$^_Vk1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh32#SƍD$$VhP[ L$T$\$PQRSD$0PD$Ph"D$@P t$$$ىh"rC< t< t< uS+=$<rLjShD"Sh`"?Sh"_h"Mt$<L$D$D$L$ oPRtXljo 1tX L@uH~vCtTjhhn" V$^_[]V )UjSI D$ D$ CD$CD$C D$C$Cl$Uh&r#VV u D$CV蒔)1$<;obD$D$PSh" =USWV$0xjW{[ƅ~F$0h$1jUL[~4$hPM C9uЋ$4h32#SSǍ$ىhR"$0Sٓt| uƄ$ $0ph"QUqD$$0qh"QPOىD$PUePUSZ u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph֋%SOD$L$ T$ ыD$E L$ T$ D $A9L$D$uPdh"h"=<}Sh"h" Sh"h2"< $02t$t$h"$@t$Ph" |$W}~14_G;}|V_1^_[]USWVD$(}~;$ ~VE pSM $PjVWjS0WD$11D$D$D$D$$D$ D$h<"u VuWG H5$|&D$>j 5$<P?M Cr3밋$<$PCrj hq#V4I ىVvSn 1PcuE$ ~S4VH $Ph0 jSPt$VTuVht" ,Wh)"j:ÍD$LPSxu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV} E8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQgf $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPTe $Ph"Phr"tM"PSh" .1$P;$h"Shrt$VW"9;$PVh"ȯ|$$Vh"误h"jhr t$j-=3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQb $PhV"Phr"=~~;$1FȋL^&w &QPhX"  G`;$X|΋$\>9rh"$`>ߋN8L^&w&PVhX"覭 `Ouet$$P\$ ZSh"wh"$P\$;$PPhU"F VXhE"Sh*rt$  09rh"h"$\>$ThKk%ج Vh "$X~:$\1j hE$Vo "tQC`;$X|j 蔫~-h2"c$`>VS`Ouj c$X1~$1:t @`9u9u$\Phs"1@\D$,\$H|$PS$hjV赏 L$,9F Vh"VhrW h"F0Ph"胫F0Pv,v(v$h"fj |h&"O$Th";Ph"h"Fh?&%VgD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"ͪ$PtPhϝ%贪h"觪$Tt*Mbi)QRh"r j 舩$XqPSh"H ]hJ"6$X~n$1Wȃw,\"$T&L$7"!""L^& 8""PRhb"˩ F`;$X|ۋt$~G$`>G8tu #PL^&w &QWhb"u `Kut$h"VhrP>U"tj"P=t$1 E$`$d $jj h:`$QPjVyjh`$V< V$`t$Vh"˨$XMbi)QR$\VhD"蒨$|$|$|$|$|$|Vh"Z $\uM4#1wh"9L$!r "$PPVt$h"!11҉4hӀB9u$r#t4#QPt$h"輧=3~S$h1h #蝧1PQh"耧 C uߍ_ j 荦 rt$h"Vh&r@t$S>#;$PtF""tM"RPt$h"t$ USWV`p׉͋$tph"Sq,$tSÃr t1C1|L$PVQa Ou vu hu Z$1hoVWI owt1$0 j2t W: F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"WL9 Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhz%S ; tVjh"S: tBjhTR#S: t.jh"S: jhq#S: u$D$D$h"PhrWh"PhrW=3t?|$"t"PVh)" |$u$4ܵ&VhD"Σ ^_[$oWVƿ|v3Ph"W> Vh"W/ VhW"W  Vhx"W Vh"W Vh"W Vh"W Vh"Wե Vh"Wƥ Vh."W跥 VhO"W訥 Vht"W虥 Vh"W芥 Vh"W{ Vh"Wl Vh"W] Vh"WN Vh "W? VhA"W0 VhX"W! Vho"W Vh"W Vh"W jzVRhQ' t^Vh$$j(WVPΉ1WPhPPj PQ u^_Vh"Qj'USWV։ωl$PU\$hjS讅 E9C Sh"ShrW VhH"莡ssss ha"uss3h"`{""t"t$(Ph"9 t$4t$4t$4h" $t$Ht$Ht$Hh"D$8PhN"$t"Vha"Р$4ܵ&ht"負$h"螠Ę^_[]t$ t$ t$ j tt$h"jy&USWVӉύD$(jP71t$`FFF FFD$h$r#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP#D$HD$PD$P |&5p&|$D$ fD$ l$ \$Tl$+D$Ty1p&Ph$$j($PT$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$Й&ݜ$ܼ$D$pt$t$$߬$Й&ݜ$݄$T$xL$|l$xЙ&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$Pk DŽ$ <\$D9r<"ShrQ3h["Rh"UhrVuh}".t5|$d} r"<$c!r"P^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ 4t u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ s u$8`D$1@$C`Mu΃<$t $`^_[]t$h"j USWV$,h@"w8E"tŋ$0h"X8."t 3~?-|$h"VS(( M~%Hwv$& 33ǃDt*Mh=%5$<3u5$<MD 43nNRt 3j W5$< 3L$9&-$<23332j W5$< 2L$9]`33}3nP-tWpP-ujjQPh7"jlD$كL$l$ umt$=l$ 1  ut$)K3h"5$<h`"p5$<h"` $L$L$GȍQw[sV?PoP,-G A6P轍Gu$t L$-AGL$AL$$j=3u"hh"h"h"h"h"h"h"h|v3ƏP$WdPhA$We bU*yŃ=3u#3MIрK=3u }8$V+ƹV])uV+Wu!$VVY+DžD$u h%"Xul$Vh֚#h|v3躎 Vht|%h$ P蟊W(yl$`t$Xt$T1ҋ\$މT$̓=3u3MIрs6=3uA}t']h%SethB#SeuWH(Ņu{D$TƄ ML$XE|&hP$ Ph>"h|v3迍D$+hP$ S ىV1 D$@W'$WbPhE$Wc $'h|v3jjh">$W@bPh"W1c j)$W bPh"Wb =3tVh|v3jjh"$>3$WaPh"Wb 6WKTh|v3jjh"=33h|v3jjh$"=3ꍬ$U$P.aGV"a)1;$v7$5<P{3$P`$$1Ehh|v3jjh"=l$WK(_D$h!9jUP3L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%S\t jhh#S[ t ;/u f. Gf./WZSZ9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSWtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 3H $s-t$$tHfHxt P2)1^USWV=3th$v3jjh"1jj9#tvƃ=3th$v3jjh"`131GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=3tV$Ph"h$v3 ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph"h$v3} W_1l$$ttF9u t G9t$&Qt$h3h"h|v3q}<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"h|v3|EuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3Q3ǀ3|NAMǀ3EFNDt$h3h"h$v3,|1N1@=31ۈ33|NIL33WQǀ3FNDǀ3|INOWP3ǀ3|NAMǀ3EFNDVdPt$h3h""h$v3{C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$h/"h|v3z1t$h3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=3$ WbPt$h3h""h$v36zUt$$t$$|$$WƀH1@=3ىV_bPWh3hU" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3h""h$v3Ey؃^_[]S133|NIL3t!h3@Nǀ3APEǀ3|ONTt!h3Nǀ3FNDǀ3|INOt(h3Mǀ3|NAMǀ3EFNDƀ3t(h3Mǀ3|MODǀ3ECHGƀ3[SWV=3th$v3jjh")3=31VWftmxtg 3W sJX tCf{u7=3tSPh5"h$v3w S\S [빃;=33k53tc~ tWuLfthS"W Z=3tWRPh5"h$v3Vw Wy\W9 륋v$^_[SWV=3th$v3jj hk"(3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R3utDh$v3jj"h"(,th$v3jjh"'53t$G!jj#^ơ83;3<33,׋-3WV]Ɖ׋ <3839sAWV2ÅuWVh"p\ SPh"h|v3u c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"h|v3Eu:K39tPt$ ZU-383;3<33^_[]USWV=3th$v3jjhS"X&f03jY9T jj\ʼnT$3 3PQ\D$5<3583J\Ɖt$U9\ʼn$St$p\Él$9$\$<3 839ˉs6f03j8DTk D$;83<3rM\$ -39sI<39583s9-3tS 3E9u<3 839\$ <3 839ΉsZWVÅu h"YSCPh"h|v3Gs cWV[Ɖס<3 83911 uU9t$D$ rIWV<Åu h"|YSPKAc9-3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5<3583fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3th$v3jjhl"#FtVPXfvu݃=3th$v3jj h{"i#3=31ҹ$RL$QtMƋhtDEt9VP|$ We1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3th$v3jjh""3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"h|v3(p 1^_[]fUSWV`=3th$v3jjh"m!535353h."hh2k3 t= 4uFFF%)Fu9rV9=3tJh$v3jjh"F 3t(t$h$v3jjh"F 31V9vtRPh"h$v33j 3th$v3j y$ 9̓>t9߁^_[]á 3tPjt$t$Puù2WVIAfF=,3|C03)f8353jQh43u5,3F143PVQd =03F,3^_ù2Qh/" N8u"h"hr"53hS"h|v3hjr]WVjh2脺1t)h 0t 8@ W4^_V83 <3t7#43=@u%o>83 <3t43!=@t^USWV$$$ $jhWVd/,43tE1M1 tmjWVS$8jWVS$8t$Sht|%hVcV<$ (3U Rh5(3DžtGh%Pq>tSh"h|v3jg 5(3DžtGhB#P3>tSh)"h|v3,g 5(3[Nj5(31jPP6.+^^$DOGrhPD$PhR"h|v3f:hPt$V $(j7V@ (3u D5(3Nj5(3j1PP6-+^^X^_[]SWV׉1jPP1-+FF9tX\$)yWh"h|v3f %؉jQP6i-~tF hP6; F^_[USWV|$_ OtGhS7  GO9}vDty)9|n4 ȉG.uFh%PE<;-33rv=3tUh"h|v3e \GP1=3t:Ph"h|v3d %1=3th|v3jjho"H1^_[]USWVD$$PXD$x/@th%Q@k1ƀ81Mbi)43H1ًP1 t (3P RVB95(3At\G9uGSVP: t5(3Džu*h%D$Pxjtƀ8MbE^_[]USWVt$!M1 tFjhRW*,43t(E1M1 tm`ƋU R^_[]ËD$0谵 USWVX=3th$v3jj&h"p3 ߉^_[]USWV|$u h">WY-3u`Ɖˋ- 3UxDžuh"z>- 3)ً39w؉9vlj<3|$3WS&K^_[]USWV։ϋ\$ t;=33rVWh#= -33QPVW{s LK$\=3t%[$tC1K 1 uh#S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>Wk+333F$53^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$V+33^SWV|$t$Åuh"V,8;^ty^C Fs j/WGS*3 3W Ww*FV86P ,1ɅF fN^_[USWVd=3th$v3jjh"o=3td|$xh"Whh7 #Ph #h|v3I1Fh|v3Vjh#0V7>V2to=3uf=3ubf$HD$=3t PjE:?Phm52 y"W.0Ph#h|v3-I ^1Fh|v3Vj)h#V=USWV(΃=3|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$t=3tPWh= #h$v3<2 = 4 43hQV4 44^_[]t3 PUh= #k s-4hh4U 0Ph #h|v31 j(&USWVE3f03T3 P3D$?SDžu#Sjj0SDPO/F^_[WV|$ th #WWNƃ=3uhV~x=3tPVh #h|v3N^USWVl$|$\$u0=3uCWSmy5(0PSWh\#uuI=3uWS_nxB1F=3t\#t"SWPh#h$v36Uh#2$0vPSWh#h|v31^_[]PD$L$ $QPh|v3 =3uh"s"=tXht#)uj WV|$ =3u1VVhW走x!1F=3t8Wh#h$v3 #0PWh#h|v3^_Vt$~th/#V.FσfFVqƃ=3u Vkx=3t8Vho#h$v3T #Z0PVhG#h|v3/^WVt$ ;53|$3s(WV=t xt@u;53Ή^_WVt$|$ r4VWt xt@u1Ҹ9r^_Vt$144|NIL4Ft,h4ǀ4|REMǀ4OVEDƀ4F t,h4eǀ4|TMPǀ4NAMEƀ4Ft,h45ǀ4|EXTǀ4RACTƀ4Ft"h4ǀ4|NEWƀ4Ft$h4ǀ4|KEEfǀ4PF@t(h4ǀ4|EXIǀ4STEDƀ44^WVt$ V蜱1t%t 3P 9щrVhS#h|v3 1^_SWV|$|v3Whj#S S3HQP~ Q1 P t3HQP~ Q P t 3@ tntyg1@1^_[USWV|$$\$ T$l$t$>.u Ft#h#W1t9ho%Wt'\$j SWۋ $ 9uy6h#U$~h#Wt@ho%Wt.\$j SW膋 D$ 9uyvh#jD$PhU54 u ^_[2h"#jێSWV |$t$ >h#W9t9ho%W't'\$j SW $ 9uy6h#U$~h#Wt@ho%Wt.\$j SW莊 D$ 9uyvh#jD$PhU54 u ^_[:h.#jUSWVhќ$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"8 tjUh7#$ tG99ufD$u\$ tR$,4jVhd% EjVh=# 4jVhB# 5\$ D$7f@jh0uht$Vj P54D$^ރ9tD$j@hK#P ߉tD$P)DaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VD defDectsDuVjh#P V54545454h#Et2tR}jh#Vl ]H}j1h3#VG #}jIh#V" tt6Wh"Sh$$UփOut$g h#8^_[]1h#jxUSWV}\$j S54O D$t"NuD$Hj@PjSPhy#j$j$Vjj54rF=tPh#D$D$ D$$fD$t$j VE 0  9 1L$81qAQQ a A j QV54-D$t$ *jh#E p*  D$ @L$jhtjPjQ54h#h$v3葼D$t$H1D$`D$L'Ƅ$0VhQ`54 $j D$tPS跽 |$'y9D$(ȋL$;8&|"@D$Ph=#th$v3j GD$$<JD$ D$ L$jhtjPjQ54~e^_[]ÄtH<t<u'54h# 54h #h|v3 P54h#h|v3nhE#h#j軇E 0h#`USWV $ ~($ 1j4hT#? ?C9u1CCJt$LUPV3 CJjh'UVjS54~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P54545454hX# vL$D$$jh'hVjS54Ffȁw$VhU藻 VhU膻 ƅtL$D$jh'h$PjS54]$f1Ɂw$PUhWh#3Wh#vL$D$jh'h$PjS54$f1Ɂwh#O3t$ t$ 1؃;D$ D$4ƜF>|$Ń &h[&hPx% ~y)L$USWVP=445041,9|1C=445049}`s&H-&E9ƉMm|)t6jju uL$2L$9ȃ}  $Q -1F,MUۉu1;}E|u,E EmubWVl2#V[WjWjWjWjhhV; x`j"hy2#P9 h849 jPVj9 jh$VZ9 %4WLPWVA9 V;^_SWV։ϡD4H D4uhhH4rH4h2#h2#hSh"S5tZÉ 2#t$r#hH45@4Ph2#SuY|@h84K Ph3#SI yh2#Ph2#jI<|.i< $r#t4#QPh3#S t Sjj!hA3# Sjjhc3#N(4tSPjh%44hL4u;hxVjFyS=1W2yWV^_[WVP3#=4u% 4<u3#4u3#u"h%45@4Wh3#j'j*h4#T=4uh4#>=4u6hhh3#i8 xjh3#P6 V*94Wh4#jQV4h4#jv|V JjS)h 5# 4u 4ujj83#u3#3#u3#$=4u D$@3#D$= 4u 3#=$4u 3#=4u "=4u $=4u m$$ 4uH18hl2#WPV7 c8Vh3#j` L8Vh3#dj=4u hl2#RjjhL4<h=4#fUSWV#V& uC <=%:l2ShV>#$t$މ|$= 4t2=/ 4D$(2L$, T$l$hPRh,4QWVA\MD$(t$=4|$t'l}3@DJ@ut1ɊTAu=4umT$,$uWjSt$8^|$=4(4`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVhD!4h,4у *4T$,$VW1VSP54,4C$D&D$,$D$(D$=4t +1ۉ\$0\$&\$'ִD$4SPV5 ljӉT$tD$p!Ѓ詴8"蛴0`PVh&1<==41$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R[A1OD$D$1D$ D$j=QQD$ tOAL$ \$ h+#V蝥t=j,SAL$D$"h+#V\21۰D$t$h%V:h>#V$Nh\&Vgh4/$Vh;q&V.hdM$V̤c |$$i \$ Ct$ɍQw1$l&>a΀-% plj\$ Cut$BT$ҋ $)|$4/1ɉQD$PSo D$ D$ 938*8\$ L$ D$D$W|$h#S膣Dh&Sp;he&SZ7hG#SD3h#?#S.'h(?#SD$t$ |$@ 1ɉQD$PSL D$D$ 9؋t$8װ8|$蹰1ɉQD$PSY L$ 99։D$膰L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh,44t2h&B#v 1<==4 ڍt$81 D$ \$phjSh,4PVT$RKU$1BD$L4JD4`L$p$QRSRPVP4  4u1$P`$w &Qh,4hA#1  41<=4 j=V*z9=4 j=V zT$81 D$ t$ hjVh,4PRW(T\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP$$h,4h B#D$49t 8VhMB#S1JD$ $$Qh@#,=4D$t$=4$D$D$,D$\$(VlGC@D$p9Vh_B#0Pt$hA#|$oQhA#=4D$WSt$h?#VD$ 81ҸD$ |$\$ Cj"$PYÍD$pWVPSt$ $Pw\$ E $,4jt$tS7 $,4jWV# - 0σPh,4hA# B4  4$Ph,4h&D$ $u1@t$2|$ Qh?#(11G|$1\$ tpupthh#Q]D$ t$D$t1@L$ ɉ%t>#PQ^Q|$t 8t1j t$ h4$`St$hM?#FQt$h?#7.l2m2L$ L$ ف$K{8P|$W蒍D$ t@j QSV D$ ;$|$8tQtUL$4 T$hjRh,4QWt$O l2T$ gL$4D$ ,41ɍAD$4tT8`T$ Q$QRQPW~c4  4T$J`$w&Pt$heA#t$L$ $d$ r $3 $tu¸G#t(?#PQh@#|$D$u |$u |$TF1@]%t>#Pt$h>#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/A#@0Pt$hJA#|$L$lj% L$St$hk?#{D$$X&ӧ1ɉQD$PSs L$ 9t 9St$h?#,D$ D$ D$D$0L$0RPQt$,t$$P|tBD$tUtsD$ |$,4jVPM D$h|$t811FD$&|$,4VVP  D$'$D$8|$,4jVP D$p,4jVP UD$1=4D$44$Vt$h?# Ph>#=4he^_[]4$h@#ًt$D$t$$t$S5@9s Vt$h6@# S @D$t$|Х1ɉQD$PS& T$tD$pD$ 9t8u裥8 St$hx@#Qh@#{1ɉQD$PS ƋD$ 9t8t}St$h@#St$h/?#D$t$։D$L$8`OGL$0d$ rxL$D$nT$ӤL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl># j`j-{Ph,4h># h>#hxA#hA#h,4h6#SWVPD$t$|$L$ $QP6769w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS x1Ht$L$ltT$d;WuT$h;W(u Q,P ŃtD$ppPU v D$DGXHr Pv`oXd^_[]USWV$l248,4t 4/4Sh,4mtW,4މ)ˉESQ|$ Wu DW4VV+fǀ4/SUhmu,4Uh4},^_[]USWVhT$D$A7#&1Ch4ɑD$ CL$;rjt$V| ufD$jD$Pjh4V薠t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPWWt$h!7#|$$j@WVPVWt$h17#j?WVPt$=h2]Ph"W豻 4t5$4Ph=#5h2莻D$$PV5h2 (4^_V΅tOlHw;s14 4teF0 xPh,4h=#M Atʡ4 4t"0wPh,4h& u =4t^j]USWV=4ˋ} 4 4 t u tth$v3jVuk}ti=4|}t j նMO؃thD$VuPr t$UtuRh"P{5p2RhPx%7 bD$VuP1r tMD$PVh=# D$VuPq t+t$ t$ Vh=#Ҷ]D$ s*P? D$L$ r!QPhGB$ rD$rIPh&r#QPhÚ$xt$hL$s}u h=#`j we^_[]PhJ&USWVP=4u(ˋl$ D$$|$5 4 4 t u^_[]Åtth$v3jt$W j܅4| t j $^_[]uCuWt$h"蜵 K4$~DN1ۅtPh#zt#=4uPh>#[9t4C뿃u,h=#='t+ORh"##L 딅t~=4|t j }^_[]1ɉr $~1Ph# C9ur4$h9>#j tuQh"ܳb5p2QhPx%ó IWVD$0L$41|$VVRWQPmpt)L$$<$ug4 4tT$jjvB1A8= 4uQh"Ft$t$t$ t$t$h!;#%^_Qh;#j8USWV4 4=4|$(|$44 4t{\$,1PPQPSWot`,$tYUGtLƍD$(1QQPVSWbot&$;D$u,4jPwVWaVWD$8tPh,4h];# ;w1D$$&Ph;#Ph;#Ph;#Ph<#^_[]UWV EMT$ 1|$VVRWQPnt@u|$ D$L$ L$D$4 4tT$jj Z1AP 4t!u.=p2D$PnPWVh`/&QPh$= t$QPh&<#(e^_]Vh;#j6UWVEMT$ 1VVRWQPmt+M|$ 4 4tjjj1A` 4u5p2QhPx%萰 4$h t$t$ t Pdt$t$h3<#M e^_]Qh;#j6USWVD|$huI=4t@D$$1ɍT$QQPRh;<#oqD$pt$D$(1N\$$SDŋD$d\$ 1ҹt(t$ RRVQWPdlD$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2VhC<#j\$DS迬4 4tىjj(A= 4uSh"w$w wwwww ww7hJ<#迭,D$tM(9ʼnd4$1A1AUSD^_[]Vh;#jN3USWV$$|$$u1D$1ɉQQPRh;<#4$$t$V Btfŋ$L$ 11RRQUSPitO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=4tM<$1\$t$Whl2RhC<#jSL$$jjV G;<$|u 4 4tщjPV= 4uRh"<$~/1t h#ѫttVh<#軫F;4$|j ˪t$4QĄ^_[]Rh;#jd1USWV$=4t  $D$\$1ɉD$QQSP$Vgj\CWUFCt3j8Ct$S $UCu8W$h<#{ =4vjá11ۍL$l$ PSQU$VNgtct =49$$D$4 4tT1΋$PjU$h<#1Ʌ7_l$ 11΍L$AAQU D$L$PUh<#jdQN$WPUV to4 4t$jjPDH1L$AAQ\$S D$|$PSh<#jdWܧ$jPW Ā^_[]USWVP\$(|$$1PPUPSWe$P=1PPUVSWetu= 4u5p2t$hPx%表 $ $ r/1۸$r#WwwPh<#pC #;$rj x1A1AyVM^_[]Ph<#j3.UWV0EMT$1|$ VVRWQPdt0M|$4 4tT$ jj1Ay= 4uQh"衧1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$<#?e^_]Qh;#j-USWV@$ @=4t Z$ Vm2ƍ$ h jU輊 h%V  t}1ۍ|$1ERSWV蘰 L$99=z  h%jP ƅu$ 11L$RUPQ$8@$8@btIt =4$,@$@4 4t.1T$Ph X1Ʌ1ۅÍL$MPj}$@SPUB U$@KtW4 4t$ jh V0$ P}jPS SJ@^_[]贌8"tD$9t 8uVh&=#Vh=#j*h=#h$$j*USWV \$0|$,1PPUPSWa)4$91PPUVSWXa= 4ut$ h"]>rt51t ttt ttth[=# 9uЋkT ;$tl  1L$D$Sjh"գ {t+1:LtPh=#诣 G,;{r܃TD$@TL$9uj 觢VI1A ^_[]h,4hq=#+USWV }=4t D$ toh=#W|tc辊1ɉt$QVW  T$$9t8u蔊8,Wuh=# =4j11CL$ t$PSQVuu]_tWt =41=4u?=4u6L$1J1ыT$1 u#MUPj h=#1ɅRaMUPjV tK=4u-=4u$1H3$3|$ uMUjj h=#MUjjP e^_[]ÉSWVtl}3q~FDx@uAFX@ut9vl}30Dr@tH^_[USWVPω11s6tUVh<=#SUh#S t9VF4$Euuh$r#l,Ɖ$t^_[]hH=#hC=#j&hH=#hV=#USWV\։ύD$ jPj P萄 1u0D$F|fD$Y|Uh=#j D$ P$L$D$ L$/Ph#j D$ P[ $fL l}3/LA .sD$ L<u\$ SjPj S E9[|$ t D$ PVh=#ϟd^_[]WVth΋u\~8tU~4~`N4F8 I9rPE1F0F4F8FXHr PDFX^_fUSWV\$"4"4h(C#sP\su "4Rhq"Pxu "4jb"4Jmx &蹶'?c.5"4芓hq"P1xu D]4=D]43C#t]#l$PKrt Pu|Qߋ<-t<+u{uNh= &SwtGSM16kh8C#q"4t8u)h?C#q"4Pqt "4#hFC#}q"4Pqt "4OC#1="4tjh^C#~FP7֛j觛N="4u0j_`ujjB=#4t!=`]4u="4ujhuC# C1FVV7=\4uh#503>vu\~jhC#B jM5\4f:0BuK@"4"4!Ѓt4]4#4Bzu=h]4t0譚|h]4jS=]4u T#4=b4~jhC#u j j 6GWVt$ y5#45#4 #4ut[<|=^4t= #4t|2'V1Wu=WSBVpWV|$ Ws@jP9tWP8^_t$t$9tjhC#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9$#4<(#4U5k4M^=X#4u ,#4X#4U=v====,=XAf2 ,#4i\#4`#4d#4F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fĹ<D$\#4D$L$d$ `#4 d#4D$D$fD$ D$5k4Pj5k4U $#4,^_[]VPhht@ja t1hC#ktP$t$uչ%~h#4hC#rkt(Ph# h#4 h#42 h#4 h#4u.hD#!kt P#Tƅ~5l#4hC#jtP# l#4 l#4 l#4 l#4P^V[tP=/4t1H V^PL$$p#41Qw$& D#M(uMfp#4 xD#4D#+D#"D#D#D#!D#=YÉ$D#/ufp#4'D#ufp#4p#4WV׉vu1=/4u WV_^_SWVPh*D#iPi1Ʌ 2hr%ui;M&t/4Qh#4t/4=D#t/4Vy )+#/4@D#/4CD#/4L=&/4#/4FD#|/4q"y/4/4/4/4/4/4/4/4~ 4^4+4o%/4tƹ<湿#$r#$r#t /4d#gtlj=/4ID#O#4LD#>XD#t /4iD#!sD#t /4=d]4t8="4u/湄D#/43R&/4=/4u /41/4$r#u /4$r#⹦$/4t8u#4/4$r#@Q&q/4=/4tt8u#4/4$r#r#:/4t8u#4/4$湇D# /4t 8t1@ /4$r#104$r#D#c%VWWh04h04q#u&V504504h04h 04HR#N%V504504h04h04xA&N%V504504h 04h04#;tlj=$04#m(040&A#$r#$r#tơ/48t,<$1QQP PW<$Wi@$hD#,04<%=2$r#u$r#u$r#/48t2<$ h#4IQjPt PWj<$Wi@$4#S>004# tÉ404y#$r#tƹ"=/4u$r#t‰h$r#Ɖ5804>u ;4^_[É⹡$(04z8{lV t<0 1=/4u V{^USWV׋t$$\$l$;Et*+u(N%$r#t D$ L$M^_[]USWVր9tMτtC1H04 2U5h#4Wy H041H04U5h#4Vy ;H04|ut$#4^_[]Ë /4h#4USWVL $։ύl$ D$?hD#WP)?SWU J D h VUy $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$Axt$4h VWx L^_[]Ë /4h#4V=h]4t =#4=]4uF /4h#4/48t!/48t=/4u 0041B #4=]4u /4h#4b=]4t /4h#4H<04=T]4t!=h#4|1Fj 2F;5h#4|^Ë 4041B^ 0041B 4041B=<04ug=h]4t =#4uN=]4t /4h#4=]4u /4h#4=]4u /4h#4<04Ã="4"<04Ë ,041BY 804h#4Ht$j5/4{ 1B)=L]4tË $049th#4 =H]4jË /4h#4 /41BV=]4404t0041B5@04t-F=/4/4t/41BV^Ã=/4/4t/41B^_%@04t 041B>@04t 041B'@04t 041B@04t 041B@04WVD$ #=$2 lj Ƌ 04j" 04j 04j=]4ttV$ 04j5@04^_WV|$ 1Ʌ<+u OL$ GWRb-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%V0btrL$PQV t4uRL$xD# $x2P D#T$x D#$x D#w^1JD#^aD$# $2  @049uVD$ T$5$2! щ щ! ‰ 19^Ã=2thD#Ë (041BSWV@΃=2ttD04tVs`tx1Cj S*VGV^SP_GVh\%P  D04=D04!VhD#j@WzWZ@^_[ËD$H04WV92t#֍|$RQjW81B$52^_ÃwL&ÉfUSWVPt$ P!уtRPtt jhD#jhD#l$$\$|$Q t^tY9uE}!4u <Ճt(ˉ $19u tC ;$u~2KՃujh%E#t jhD#jh E#D ^_[]1ۅs IQRP踒fVt$t=2tjh9E#52^á2xy=L04uE P040@#4@u.L04jhNE#?t k4t2P25"4b*"4V1N=P04t9t/ P04,@wB$@(@1҉,@Ɖ^USWV=2P04@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`E#1@$qQ52 9D$}P04럃^_[]USWV-P041|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5k4(P04@9@S P041JЅt8=T04u/@u1u0@4@ '[WVP041t[@t @4v P044@0@{!уt RPF1G)t k4t^_USWVP04t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHP049t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë P04t$@(@ ,@1HUSWV5P041H(@$@9t#H1ًP1 u,@;Hs D^4%D$z9tG1؋O1 D$ ~9 $tG#G=]4t @t2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+]4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@2I!ƒ5P04@@2tOD2Q@u;G  )RQ@w u&P040@4@&OD1@l$1tʼn$yjhE#1="4u 2x~OUQP 5P04@@o<$t0@D$4@=T04tU=^4u#L$ Qh$$ ^4j2=T04t=]4u q=k45P049>tOOHOP045P04wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhE# ;41H^_[]USWVP04ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áP04@u1I4@0@Ë9t1JQQ 9u@o P044@0@1@@(@$@,@PPP@E!ƒtjhE#81PPjt$E!1WVP040@4@!΃t@@9} 0@4@^_SV\$t$ 5"4({P04h8@jP04@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjVD!ƒtP04 P04@P5"4vzP04@u@^[SV5P04@  ˀuH9tPQP Pdž @vv Hu5P04@uE u@5P04dž@tV31P04P5"4y^[áP04t@1fWV|$t$ t=X04ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV-,tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$r#j4hJ#lLh14h14h14h14\$ -uF :tjhJ#]jNbt'.t514bt0:wtptcu+14F&jSh14 14jSQ ,uF14141414141414141414141414141414hoJ#J1tPh?J#J1F$2VhJJ#Wh\04P(hSJ#dJVhaJ#Wh`04P ^_[h{J#>JPJj321B thJ#Jƅu&hJ#IƅuhJ#Iƅt]hH#V ru6hE#Vqu$hH#VquhH#Vqt1BE#w1 l}3TA ruƀd04ƀd04ƀd04@=u=X04D$d04SVt$ 14M1ۅuD14;1Cu12(u!=\]4u2 1ۅÉ^[D$d04ËL$=r!=X04tP5\04j hd145s'd04u d14e14ud14ESCd14Ãw@d04uQhkJ#VPt$ u 14ESCuw d04u;Vt V5`04B$14xPV@,@d04uPhkJ#V5\04j h14_r14^WVD$L$ =X04=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=X04t'~3P19wKS>~-19s2C,9r9v)CK$SU|BuF8AUjVao ɋl$u9tSv >Bt1|$jjSOF ~.EFE0uE^_[]V :4t";T2t1FVh14P/ :4p^USWV\$,=X04tV:4tgفuH:4J :4:419*Qh:4~-:45:41E4:4J:4:41E:4=:4u :4 :41҅; <2t҉օt1PS;H*$&= :4+"(:4Шu*%=tS :41:4]^_[]Ét$ :45 :4 2y9414)É 2n1|$ l9} SWh140? uԉn$r#t9414VWK\=94=145* 948u!e0 :4$:4tPr $:4%MD$P=-94E˨ -94E :4  :4? ǃ:4^_[] :4] v :4e :494=14v!x ux ;|94=14w% :494< t 948 t :4 :4  :494B594a :4948r  :494=14wx u 94=14\x tQ 94=14.uD$ L$PjQ课 $T$e^_]Ë :41; :4|14á :4t @@@ 11Q[1PPUSWV="4׉΋$$L$ D$1AyōD$PU #D$=xh32#U!bUW$ShUXo 0jhAK#Up ShU)o D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU(n S751PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV="4o=82u=h2u =W4P1TAP4@PjVP#SW4|8QZtQL8h"W_É4$pu1ND$PV x#D$ =uhV衴h4K#a0tPWƅdո(2Ex uָX2Fx uhAK#h#S^ T$Z}]VUhUK#S:S34$VW臲WVzĀ^_[]SWVhxK#/P/tt;^_[&h#V-51ۅt+hf%V5tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%qK#+iK#Qh#P] tWhK#v] Y=82t"hiK#h#vr] V(2=h2t%hqK#h#vG] VX2^_[^_[USWVPӋl$D$ $uSP82SS1tD$ t}t8^_[]StV믉h14jPN SPuSqWV948L$ Ƌ94 l#49}I9u94xtWD$94$94V948t,t$<$PD$948uڃ^_SWV 1494$ l#4+ :4|51ۉ|$8tZO\$l#4+:4$9|Ӏ8t-t$|$D$|$D$$8u$14)ȣ94594^V^_[V59414tR94)Ɗ 0@u 2594A=9414":4=14 1@^À=14t89494 2594:41@á948t AUSWVPQ/$1;t.߉WjU $)ډfu $;uƉ^_[]USWVhK#O+hK#@+VhK#P@ Åt^_[]jhK#Wz@ t VhK#Pe@ U uhK#*VhK#P:@ ÅuVhK#W%@ WV9G t'փtPhK#V^Y G?G uG^_Ð@:4i ËD$u5Ã<3PhK#USWVD-#4ÅE\$9uz$1ۀ|tisljDDs9u>rjjx D:4D:4$t,tV#hj:} =k4TeuYÃ=k4e4΃e@:4~o6/=X:4u #=:4 t t =^=X:4;:4Ct}.CЃ jS&ed~hh:4 T:4P:4=@:4t @:45=@:4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=@:4i@:4ih?%jjS\Fc`$<&="4 ]%t#-l25@:4=ES[jUY  xS@:4H݃t =]4-H:4>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5@:4 hL#9\#49(#49`#4=X:4SX:4C1Ƀ :4|:4ῃ5X:45X:4@:4/U]VsWWr!2@*="4%I:4@:47^4@:4h#jj|:4:4n="4 5T2@:4 }hK#@:4 _gh%y1PPv^41; P:4H:4 T:4HT:4P:4/="4 @:4%hL#1PP9\#49(#49`#4؉ك u. u.S莍i:45l2@:4%aih]%{jVy|:4:4 PZw H:4 *|:4уBЃ@*? !1҃ ƒ!D$Z=X:4,9\#4t 9(#4h 9`#4W jhM#j#t$(V0JOVrlp1BsRtM&="4=@:473H:4ЩuH:4Mj5<2ùe=k4Iv_*-t%+q1҃¹) |:4:4S\B D$t1< :4D$ D$ PD$PD$ P萪 X:4tjD$D$-<{|Q<`ʃ=:4tR D$HL$@븃@|:4|$ ^s 8eB@:4emhL#1PPL!ùe9\#4e9(#4e9`#4e e 1?PS1FP@/|:4Ph$r#5:45X:4虤 1;5P:4T:4|T:4P:4n蔰VVA 1;P:4T:4  T:4P:4|#4'M1PP5#4 =l]4 :4 t|7ػT 1;P:4T:4|T:4P:4蛻=]4P:4u' T:4|5d:45`:4PP:41QQm1;P:4T:4 T:4P:4|#4|C=]4u5d:45`:4P1PP5#4A T:4P:41҉3P5]41;P:4 T:4|T:4P:4]4聺觮5T:45P:4DT5]4J@:4NVhL#h1PP5 ùe9\#4e9(#4e9`#4e e /йSE*re|褹ʭl>4l:41l>4 \]4 p:4\]4 (^4 t:4(^4h^C#Cjjh+L#T:4݋5P:41ɸd9 jhOL#="4t>t5l:4l>4p:4\]4t:4(^4j)eD$t Pj{@eJr蘬 L$Qh$$1;P:4T:4|T:4P:4)O=]4P:4u' T:4|5d:45`:4zMP:4jjP1;P:4T:4|T:4P:4跷ݫjj蟷ūD$<3D$PhK#="4jhK#VR T:4P:4]4 T:4P:4]4P:41ɉ T:4|T:4P:41@Pe(ejhL#e1;P:4T:4|YP:4T:4 諶Ѫ=]4u5d:45`:4Ljj- T:4P:4ʃEݣ]4c T:4P:4]4x:4  x:41; P:4H:4 T:4|T:4P:4q j5<2?P:415x:4"5x:41;P:4 H:4T:4|T:4P:4 j5<2RCiP:41D5x:4=]4t5d:45`:4J1=W T:4iP:4me5"4V?P/V$P:41ɉ T:4|T:4P:41@PuGjhsL#P:41ɉ T:4|T:4P:41@Pk 2V_e!ֹe5]4RPyJ1A诳է T:4P:41҉AQPcMl>4Nnl>4@:4>X`hL#r1PP?ùe9\#4e9(#4e9`#4e e S賁+̲1PP5]4n豲צ1PP5]4jP#'P:4T:4ؽy蟦=]4t5d:45`:4Gjj5P:4d:0ؔP:4T:4艽*Pjj5P:49; eS贔D$D$Ph M#{豱ӡP:41ɉ T:4|T:4P:41@P"etbt3tFu j11A; P:4T:48L#|$r#L$Qh@L#11%P:41ɉ T:4|T:4P:41@P'"e11A; P:4T:48L#|$r#L$Qh`L#je5"4<h#Pz5"41=tjhL#o5l2@:4nvh]%1SVUh蠻Ag5"4rSPx]]4 l#4݉P:4 T:4l>49‰}P:45T:4)‰l>4;4e]4 l#4P:4 T:4l>4;4i1T:4P:415]4QPHFjhL#H3D$PhL#d ։u=h:4tP:4 T:4h:4e,5h:45P:4tI~V8JjhK#bUSWVP趮ܢGVD$1Ƀɉlj щ t>4p>4T04=k4uH9ljD$u21xUUjn6 9-k4u;=p>4t>4D$tT04 k42t8teue^_[]USWVPӉơH:4uH:41 r4$0utV4$#H:4H:41ESWPO áH:4 H:4 x:4tu1Fx` sKu j]j%u0SW5H:4 áH:4 H:4 x:4ujhM#t 4$4$^_[]WV=2u=h]4t =#4u袬׮t "4"4!ʃt]5#4QY;4u =2uP5T]4=T04T]4T04u _BLE5T]4=T041jPPB ^_SWV|:4߾Wh&t#@:4/ V+=:4u V@t hM#t u]%%P1;4PP^_[V蛫ơ@:4"~S.#V$^%="4:4VPujh?M#  tY>!t :4t P V!:4="4M:4.h3M#qF<+t< t "4t Qw V菛"4/7E="4V蜭h9M#Pt% ="4V^XP:4^(N5P:4jF5P:4jQP軯^5|:4V5:45X:4X:473H:4H:4PV"4h3M#h$r#r^SV H:4t s7@:4ZbH:4shEM#iH:4 shPM#QH:4 sh\M#9H:4thhM##H:4 shrM# H:4fyh}M#H:41Ct$‰sShM#jV{3VH:4CuϹ"t% sM#Q;4^[fD$=X04t@WV|$ Wjeƅ~WhVH ^_USWVt$0l$(|$$t U ,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD X04H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W! WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f :4 :4 :4 :4USWVi $AD$)< u?FP貛^tP 9~qN#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2hM#htjPV# jhM#hM#h9tjhM#hM#h&jhM#hM#h9tjhN#hN#h&^Vt$ t:j j tL$HΉp :4:4jhN#荞^Vt$ t:j j tL$HΉp :4:4jh4N#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]hYN# t8tMjQP[ ƅuhK#t98t4jhiN#P/ ǍEjPW We iUUUSWVP1F="4jt$P#19jV6 n1PPPSo!ƒJVWSI <$S[11 ?$:81xM'x+xG1O|E(|n|dȃ|$:4t:4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S1N^_[]4$e |t|uVP11xtɉSWVh:4t$b<ƅui\$h:4e5:4PSh:4I5:4P|:4t:4h:45:4p^_[ËT$ :4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=]4ÃB1ۃ=]4ÃCɍH9 h#4~Pj#|k;4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=]4ÃB61ۃ=]4ÃC%|$mu9h#4~HPj#j;4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW0V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ]t1=$^4ƃtEuG%t|QhO#hh.&AVh$$6 Eu ?=u Qh"P#$ u 覣!ƒtVHQhP#^Ã=$^4t$"4tPP&t5"4ËD$t5"4PF$1PUSWVu195"4O"4t_jP%="4tJtWg%W"="4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =]4uID$xAPrt4D$8\$PhN#FًT$WVt$j 1@t="4jWd$5"4t$V$t$5"4g$5"4$h"45"4##4t$ t$ ۨ8^4= ^4111k4D$4PD$,$jUuWPW8 Ujڃ,$C^_[]SVt$ h#V1Ct'h^C#VthN#V1ۅÉ^[WV$ VtVWVtWt^_USWV 1=]4]="4Pj\h"L#1Ƌ|$ 11@L|uM@-u)Fh#W)1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$P W致 "Su 1tXt^~u1O\$$D$jPWb uQD$P4D$(0#^jhP#4|1 ^_[]ÉOVD;t;VD1|$rɅuŋD$(N#1O;PrS貳 USWV="4t^_[]j荈hP#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jhP#U{PljD$UVPWES\$6,8jUHrS\$SVUP 4$ʲ S \W诲 ViC V|V$o#N@ |^WV|$=]4taPW}o1=]4#D$=WI*jP`qWPhP2LPWox#D$=@{WjPqWP1h@2VSn WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj5"4# QPTnt1GL$ T$3:43 :41@ u,L$3 :4$3:4 u!tL$\9|$X}e^_]ø'Q#Vt$V9vHx/uAΉ^fVn ;41ы5;41 u^ã;4 ;4=H]4t^6~^P~SWV1ۃ=T04t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=;4t;4USWV-^4~ON}=^4~Q111SWuljӉ:}qF;5^4|؃=^4' =^41=^4|=h#4111;5^4| V|ljՉ!<$=^4FD$1;^4ál#4D$ /4D$l>4D$$l#41/4l>4PPSUt$ ljՋD$ l#4D$/4D$l>49pt$j pF1Mh#4H91Z{1@^_[]Vh 2F;5^4uj{ t j2^USWV\$,=;4t;4&|$$t$ l$h#4t  $9~ |]4$x 9} H9$!tT=4^4t ]4tC8;41҃=T04TRQPWV脘WV Ɖ1ND$(D$<$=T]4t7h#4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=T]4tzmz1@D$/1@D$=|2uu=2t hTQ#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 "4t)!u =T]4u=\4u;4=\4t Xm;49l$"h#4HPj-|1Ot1E1=^4~1VV|{~ VVVD5 -T04t <$tw y|2j@ ^_[]USWV=;4t;441=;4u!x]4y=T]4t h#4'|$t$;D$||$$t D$9h#4~ =^4É!tF=4^4t ]4t08;4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=;4táx]4y=T]4t h#4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åth#4HPjytm=T04tPay1u11FUvUVRPVjv!уu k4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V h#4~&111RP!уtF h#49| 1 h#419^fVt$tsVGF95"4u#1=2tu1Ɂ2tщ "4AF=2tH ;4v 衧 v薧 ^鍧 ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá;4USWV\$S@Nj522tv W6Wצ |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@;4VEESËnUu9Ë\$sU) SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P? w0^_ËD$@0ÐUSWV$|$41ۉl$|$I|$tJ |Ɖk4uEx tu|$t${ʼnh]41FÃ=]4tt t uW{ʼnw t t uw uQ1{ʼnFR l>4IC)݃1l$|$#,$!tD{ʼn)݃11ۃ|$ t =]4t"{RPj F |$  jPV# \$St$V}y=]4t%$ЉWUt$ t$Pt$W=p]4t)|$ t"v t uk4t&1M$^_[]Ãt~$^_[][zUSWV։ $Q1۽t+L$ D$!ʽtjjQPVt$}ʼnt$|$0t$,HQtjjWVt$8t$8}Å u> <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=l>4jjPWV^_USWV,T$Dl$@ظBӃ=4^4t  ]4t08;4 @1)ʉ|ЉjSUQP虊كQP4v=p]4tK uu|| t u+| t uk4ttk4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tk4ǃ݃ tkwRPW v=]4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N l>4 CfN =l>4=]4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1h]4l$t$1E1!1M,^_[]Ã=]4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdQ#c^_[uƉסh#4HPLi11 u^_[8iWV!Ӌ h#4It*QRP4 h#4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhR#bKy1V[hVjRPUo=]4jusj'hD$ jhD$T$l$ !Ѓtd9}\h#4H94$SW!уRPvlj9Љ $Ah#4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$h#41VVjt$t$PY95]4^_[]1K16-;4-;4h#4H $)QUjSWP(1K[6=T]4tf"g15;4SW=gh#4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9,;4QU#>$4,$tt=t|<9,;4|wC^w \$D$ShU#jW$4,$*U#f9,;4u+9,;4}9,;4t9,;4hu_G t t1"~#ut|\tt t tL@?3~|$j=W谠9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuU#$r#6$4t$ t t_G칒U#$r#$40tUP?tuU#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVn$;4^_[]SWV׉Ή5(;45 ;4h}U#hS@=w )WVRQ#$;4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^0;40;41;4JtGtO GO 0;41;4l2 t0;4u0;4^_[]ÍZ w6$'tEGЃTZ$'btPeu>f0;4랄tGOm>2#놃>4#w>[&h>0&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]0;41;4d   >0;4 0;4 1;42;46;4RhU#jh0;4U#0;4_t>$r#vVhU#<=4P+t <=4ƒ"hV#蹻@=4Pt @=4V#jVLD=4jVLH=458;4h=4h=41=4PҎ $u>4^1|$á>4 >4SL=41=4P=4 D=4H=4 P=4P=4@P=4;L=4|1ۉ>4>4>4>4 >4$>4(>4,>40>44>48>4<>4@>41H >4>4h=4#h=4=4P $u>4[USWV\$0l$,1=]4uSUƉס]4 ^4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| @>4=]4tU t@>4=4Z=4T=4l=4]4 =49}Q=4ƁT=4 l=4ك=]4WV^! tt$j VRP)NV 1 ]4)~$=4r5=4ƂT=4 l=4Iu܅~+1ɊT 5=4~==4T=4l=4A9uס=4H =4ƀT=4 l=4=4>4^_[]Ë ]4t ]4=]4t1]4@V5L=4P=49}9 H=4<u"D=40Ph=4 H=4P=4F9|Ӌ5L=45P=4=4>4^SWVt$\$u$D$0j?oPŻ/=X04t&v!Ss1҅ SVqt1҃Pn1҅t$StP=4~- H=4Vt[uH=4 P=4LV3Zt P=4t> H=4VtV[t'i=X04tVs1҅ƒK1JFVY# /4#/4#5/4#/4‰^_[QY# /4#/4ʉ# /4#/4áP=4D>4>4H>4áD>4P=4H>4>4ËL$1wQ5<=4T1SVt$ 1ۃw)V5<=4.uV5@=41ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1V#9u!B1@uDA;1A+u%uVt1@^ÃwV5<=4;u߸ع#L$1uj jE1ɉHHo SWV=0>4 u|$t$\$t-1 |15T>45P>4tm1@Z ug0^4t \]4uU=(>4~+\>4 X>4\@`>4(>40>45P>4=T>410>4=X04 (>4%=ua`>4P`>4d>419Rhd>4bmhd>4md>45\>45X>4\>4 X>4H `>4(>4u"`>4d>4x,1WV=X04t `>41At^_[ÉШu-%=tS0l(>4=\>45X>4뢋\>4 X>4`>4(>4USWVӋl$,|$( >4=]4x>4uBu>%j jzC1҉PPx>48>4 >4 >4twQPl'UWS x>4xt<>4Ph=4蔅1x>4 >4u+(^4t\]4A\$l$͉=X041؋5P=4D=4 >4Rk5P=4UWS% 65x>4˂ x>4=4PV軄>4@=4VP诅V荄 >4AVUUUЍ@@>4>4 l>49}oh=4藅ơ>4 l>4Y$gQVlu&D=4P=4PjVPm$>4$#5D=4=49|P=4l$ EVjUek L$ )v %uh=4蚃5x>4芁 x>4 P=4; L=4 5D=4|tq=H=40jf jH=49u"_l$\$u4Шx$_l$\$u$5D=4 _ ‰$ u*,^4t =\]4uKuG ڃ^_[]X04m_uiud1UWj>4+=4 t28;491J$;<;4} qɉы4@;4)t _D=4\$ PjSi 1EL$D=4) P=4PjS`i ǡH=4 P=4tW4V)>4~Z$>4t\ [5x2)Й)֋$F UWh?% N1 >4E1- >4$_PdtUW ]X04t6=]4t-QdtQd UWl $UWS t1@1^_[]SWV=`>4~4։1d>4Pd VW u C;`>4|1`>4)^_[Ã=(>4~\>4 X>4(>41WV=(>4~\>4 X>4m(>4|$t$ =0>4uu 15T>45P>4itb=]4tY>4l#49>4|>4>4>4P=4Al#4 >4H9>4}]4 j ]4]4jf=^4>4tL@>4tBx >4 l#49}; j,>4P >4 l#49}@>4ы >4 l#49|L=/4tC/4„u0=]4t't4|$t- 1j1j 1j5P=4958;4 uD=40H=4^_V=]4uajm5<=4辉tMȺj9D#Fu=<>4u"Ⱥj>V#Fu^SWV։ˋ=P=4GP=49=8;4 uD=48H=44D$ >4; >4~~ >4P=4>4 >4^_[SWVL=4 P=49}1T$5H=4ׁtu Ӊ P=4@9|^_[ËD$L$ T=4l=4VD$ L$=,>4u=]4ttNI1҉ tK1G=49~l=4T=4+5L=4)΋ H=4 D=40 ~^,>4>4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8k4u/8;4H9| Qu@D=48GO1H^_[]cS D=49t D=4Mtۉ>?SUSWV-8;4\-jSr jSr DžtVtRU5D=4V H=4UPW U~y 5D=4py 5D=4=H=48;41t WMy 1Gt V=y ^_[]USWVL$D$ʃQPO1H…t$=8;4D=4D8OlV tnk4uc~D=4>-8;4u@D=4 (I=8;49rHŠIJD=49s=8;4)\8OVà uQL$ t D=4t=8;491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vw 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15l>41Kl>4|EtESSP tl>4@ԋ=P=49=8;4 4^_[]USWV=l#4l#4jD=h#4~AƉ!ӹt111CRVƋ >49;h#4} C!Љ̓uԉ=l#4)|^_[]SWVL$M1Nx@Nj\$S芨@ w+;t1PPSE t2SP1^_[V=]4t'ʁt1|21I9@uzu)u>uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Qx@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=]4u1@$5>4+5>4~1; l#4^USWV։L$|$0\$,Ѓt$>4!t6tC؃T$RjQPWSQ=^4=8>41ۀ=4>4tw4$4>4 >4ىȺVUUUЍ@)I=4~4,I=41E 8Vt$0j* G;}|Cu4$SG @>4tf t>4p>4!Ƴttt$,9} 5p>4=t>44>41ۃtQD=4 P=4T$ 1ۅ~&L$ PjQ\ P=4~H=4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E>4;l>4uX>4# >4uD$,>4= >4==4~01=4 8jG;==4|h=4t>4;>4~<$~>4 P=4 >4$>4~1 ;j_G9u>41;l>4uD$Ph=4tP=4 L=49~~51ɋD=44*1 H=4444A; L=4|١P=4) $ >4P=4 >4; l>4~(]4 j>4H>4;l>4؉^_[]WV|$t$ =]4u1WVP PV WVt1@1^_Ð>4H ȁDW4r1DW4W4>4W4dW4W4 W4 W4W4W4W4W4W4W4USWVL$0D$,l$$W4$W4W4t-9Br }$r1z3|$( HW4u$$rW4t :=W4W4W4<$:rBJ jl$(jWW4tC:W4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?W4t_ )ϋ,$]}W4tW4tV+BJ NF=W4uW-W4MEu$9ˉ|-W4],$ϋ=W4t sKӋ$JHJ^_[]USWV1=]4tD|$(T$$!t3|0W4W4=W4t'9PH }=W4u11CŋE1ЋM 1 u ]u,W4W4W4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}k4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[k4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStW4 11؉^_[]Ã=W4xÃ=]4u ;41]4Ph>V#4VW4xNH W4d|@W4* W45W49|jhVV#z5W4^USWV|$ l$1ɃW4W4tKC9⻌W4W41 W41 5W4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9k4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$Rk4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=h#4~%GW8É!Ѓu O;=h#4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhQ#2>41111ۉu WVSU1PPWV+k4u Ɖ!Ѓu>4^_[]WVT$D$ = ^4t 5^41)|щƉ^_fUSWV t$ >-uF(s7h]%+V+h2#+艣D$1S6]+S)S\^SSxjy Wh~#À8t>tkV聪tmSʼnD$ɚ$U轚 $ȃ$jP'袷t$PSh%t$UXt$Ah  Sa'Ņu>tVhq"F'U(Uh jWW1FVJ]V'D$$t*P*hoV#y*/j ))3;4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhV#.1N\$h"SG4h]%Q)SH)h2#;)3(1S|&S[jj 蛥1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSxjhV#1KtL tGf;t=ËFHN~ ;F~à tQu VSV=1Vj 谤1GWZWg%e1=;4VZ^_[]fSWV1W41K4t 5u'#ar'G__ _Gt Pd GF6u^_[ËL$ 1ɅV-$t:\4'W.t7^uM"4\41\4\4\4"4 ]4\41\4\4 \4\4t Pa \4Fu,~1S薺PW豺Fva ^F~ ^v;"4t PNu VSWh ^_[ËL$t@;"4tjhV#x)1HËA QUSWVD$T$1ɾW4="49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9\4u \4\4uUSWV\$SκƋ\4t@PPV蛔u\4\4` Dž\4Wu` u^_[]USWV=]4|$,t$0h#WL l$\4\4!ʃtWj UQP"\4u\4 h#Vt\4VU\4PhV#W׼u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=h#49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P^  $FQF^_[]V="4tjhV#&dt$D$tt/uKV"4;m?u7=2xCjh3W#뵃=2x%"4QhZW#l&^jhW#jhNW#{Vơ"4t P^ VޣP"4V] 5"4蛙 ^3"4VD$$L$ t tC8.@L$$Vhce&Q 2>jhhW#2xxPhW#j VkV蒏||P|0tB D$0PhW#;D$$Vhce&P >t.jh~W#1]4L$QhW#$^ã]42V2x$ h#41Vh@BVPRQ_]4^VD$$L$ t tC8.@L$$Vh#Q 2>jhW#2xxPhW#j V2VY||P|0tB D$0Ph+X#;D$$Vh#P >t.jhW#1]4L$QhX##^ã]42V2x$ l#41Vh@BVPRQ&]4^V|$u%t$jVt0PhOX#N#^V|$u%t$jV؇t0PhlX##^SWVD$L$tP\4p="4tjhX#"VP>PR Zt V踘)X!ЃtV谕5]4SW? ^_[VD$L$tt\uoPe03_Pơ03t=(3t PZ VӟP03VY 03QhX#!^V|$uJt$ =D]4tV"4-\4h%_V_h@^^WVD$t t0t$b4l7=tDMtGhuXF 3PX]4b4Qh$$5!Emtwt su!FF3Fb4Fb4F$37X V^_D$u5]46Ã|$"7VD$Hs^\jhX#7<3V)hʵ$&PhX#hX#Ve;3xu'hY#h=Y#haY#hY#hY#hZ#h7<wVȃ=]4utjhZ#$FVPMy0PhZ#^_ÉPhkZ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;8;4~<;4A9s } uE9u9t},u E&| t28;4+4;4x2 ^_[]WVD$Pt t*$TV腇PVLD$ps D$ stopD$Tab =t2|i1Gt$rV=fD,V-4<;4h&r#PS6 G;=t2|VD andD theDen t$V܆5x2hZ#P6 0Ph$$D^_à D$t t+uyL$tJQtQytWjhZ#Mà$2L$%2AAD$Ph[#!%1%2$2$2%2 $2%2 V D$t t]D$t$jhZ_$QVP46h#V芇t5>t ]4 $]48]4tP9]4#L$Qh[#O ^ËD$Hsjh5[#/Åu "4Ã|$u=]4D$u =]4~GT]4ÃD$ u)=]4| PhF[#]4ÃD$ u)=]4| Phs[#]4D$u"=]4t="4t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh[#V D$,L$(t tC1ɉ ^4 ^48,uT@L$,t$Vh~$Ql >tejh[#Ot$5^45^4h?$jV`0Ph[##t$D$,Vh~$P >tjh[#9 ^ã^4^4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$'s wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G^41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&\#1QZS^4^[ÍD$Ph \#҃=]4=^4=^4Ë ]41 h#4+^4t$4Ph}]#h\4|0 \4USWVl$,H ]4t&AUjQD$}ol$,7F]$'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}]#h\4l/ \4FVEŅ8D$EH$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=D]4nAL$,9 ItIT$uWoD$,7\4j+o2Ph}]#\4V*. T$jV%D$,|$?+"4t PsL GP "4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WL |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh]4P ]4I]4^_[]É|$|$ u D$Phc\# D$Ph\#͉-]4ōD$8Ph9\#uA0h|]#j*h]4AËI1Ph]#j*h]4&USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph]#=j UQ xt-u)%tt0Ph]#1H^_[]SWV9toӉQ|@jP ljtG\$=]4t <\u ~t F <$t)\tPSWt GFFuD$Qh]#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$]4Ph\#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]hp#3rtP)~31@USWV\$(|$$1E=<^4uh@^4c?<^4k49<$l$D$l$ =^4t=>4t=]4u3=t^4ubPjD$P D$tD 29PaHD$=T04t=^4tft$,SWM <^4=T04u"t18^4@8^4| j=y!誄8蜄8#1Hpt9=k4tt^4[1<^4D$ D$D$$PD$Pj 9=k4t k4t, k4<^4^_[]øjh@^4öUVVVe^]USWV\$փ0[ SsVs,jUVSh:7#UP腚^_[]Vt$Vh[ uVh"p#hu^4" u^4^USWV D$0щL$l$ |$$t$4PWUhƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S~׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP5Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$SUыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPPe^]fSWVPk4t ;4Z1^4WP(t>1C4$$^4u V WSCu ^_[S=b4tb4 \$3=b4r 3H 3b4[V53^4t(^43VP53 9t ;4^Vt$53^Ã=b4tb4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVmي,p#O u݃|$0xG-Wt$8B ^_[]USWV\$8T$0t$,11|$GUSRVmي,p#O u݃|$0xG-Wt$8ӌ ^_[]SWV|$(L$$\$ 1Ѝt$F,p#NuxF-VQ膌^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Pj ƃ^_[]WV t$RVQ t|$P3GuVMj^_9Hw @sÃtP=USWVPt$|$b4V<$=]4uԇTh=/4 pV#Vt$ P]Eu /448JMp;5l#4| ;4^_[]VWj .^_[]ËL$T$$r#PPh=p# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFub4^_[]WVt$|$ zt!2Ph\p#PhVp#$r#PPh=p# ^_WV|$t$ t%WVra7ft=l#4 ;4 j Qu jF^_fUSWV\$l$=]4u<؉%t1Ug1GWP?[PW1WPPUVd[1 jj1="41Ƀ=k4HPVWQ Åt!W4 |$t8jhtp#'D$ tP:YD$ 04 D$ 89t V4 ^_[]Vt$tPX64 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQeu ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u eD$E ʀ[} ]4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø^&fL$tt"u$ h#4h#4HI h#4Ib4ʋTUSWVD$T$ h#45b4|1Gll\G9uTD^_[]SWVD$L$5h#4b4|F|\\|N B^_[áh#4~Ph5b4o USWV h#4; b4b4th!t 1G31K;)1G1I4:tl!GtˉP0  h#4jQJƣb4h#4b4~PhVo !t\l^_[]USWVPL$\$As h#411H$(uh#41@$1b4<#|tZb44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$b41H; t$z|#=h#4|O1;Ll |C9u^_[]USWV h#4~.b411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5b4A1G1֋l9߻rB9u^_[]ËT$h#4!х1A9Hhm'*b4=D]4't'P b4h)'b4h'3h ' 3h\'$3USWV \$4j4b4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$X'=]4EQ-s4C$ىË $Fw$'#Fw}$'X!уj WRPBBtDt L=]4!15"4h#P a1sTu~-]$PuYQA tLу|=RP螽1 $1=j4b47f1=l>4u ÊCCs|,v, l,uȡ#4!ƒtظ:,u5"4资j W5l>4QTу h#45^4n9|$ V5"45"4蛅PtmƉV+ +1+5Q ic+Ɖ!уRPUVj4=b4H8 j4H=b4wA5"4kP豄 !уRPaٹ ^4 h#4VQRPb[g "45"4,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15"4Mj WP j W1P9;"@|b4$r#9 j4t b4$r# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5]4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^53~V5X]41=D]4tȉt 3b40A#4^5$3'SWVQYNjj4عj49r Ѝj4WVS5 ;j4;^_[VQ!уu$x h#4H9}FV!уtt^^Ð1j4j4j4j4WV|$ =;4t5j4tZ=04ta=h#4|<1W!уtRP虆Ws@Gh#4H9|vuj4覍5j4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=04=;4t4$=h#4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$h#4H9|u $u^_[]Ã^_[]鍌^_[]Tj4K|$thj4m=j4t1=j4j4j jhp#"V΋At P$ FVC^hj4SWVt$>t_w $ W$ ߅u1F FF1Hj4j4j4j4^_[hj4SWVQ1u(\$|$j4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-j4Vt;xH|p$x Hȅu^_SWV|$t$u;j4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=]4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^j4U1tHt$ !t Q9y}1I(t(t$=4^4tT$$1=j4uȅt^_[]hj4j4=4^4tUWVjW7!t"j]jRPWV je^_]Ã=j4u ]4k4j4d j4Vj5<2t2j4jVx 1F=4^4u=j4u@11N^USWV(U ]1Nt$ t$tr:tm1j4PSi( 4^41 ]4t)1V5j4hj4 4^4]4ttxq @3j4 4^4t =]4tj)4^4u=j4tj49j4J\$tP1ػ&!Ѓ1ojhp#D$Pj@t$>SD$$PL$Qt$Tt$V>k4$u:j4 j4!ƒt&9L$L$|D$;j4D$j4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dj4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5j45j42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$: V1 T$1H#E t0E t L$PL$THD$$e^_[]Ã=4^4u?hj4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ l>4L$l>4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$l>4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8l>4;4t$ t$  }tEL$L$H1USWV8=j4j45j4j4D$$8u=k4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}j4 j4ȉT$!Ѓtsu!9t$ƄuYj45j4;t$T$$|@Ut$ 9D$ЉʋD$4$8;4@Ehj4hj4}!8;4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># j4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=j4j4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$j4 j4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ j4D$j4D$$j4D$ j4e^_[]1JЋ4$|$9ωL$}@D$ 8;4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=k4 USWVt$hj4tH>tC\$1EjU1GGGUSxLk4G=k4-5k4t~'V$ uk4;4^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5j4jjSt$DPV5j45j4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@s4Phk4fUSWV T$(\$$t$ 1`3PURSy")ˉ<à uVh$$Kt$|$u u)u%u!1ɃtsQl3Ph"s#oKt Dht#U^_[]SWV \$ hSh@r## uPths# ^_[xEhShq#o# 4$t t$j VJhs#뙿 hl W~/53t$S jW`/|$We[9uR1Vt$c4$xjShs#(~VOAWV|$ 53j/Vt@jWh'Q#QV0N^_1@s4Pj.ÊD$,v3J ,v3;jƉ׉U2^~*9u$h$v3QHEhs#v11f=3tj@)RPhr# jh\t45q48 1hhq4VW" WV('Wj'^_[]j58q42W1Sj&SW&VVhr#AS 9USWV$,v3J ,v3;jƉ׉UR\~*9u$h$v3Q GEhs#t11f=3tj`)RPhr# jh\t45q4X 1hhq4VWB WVH%Wj=%^_[]1W58q4Qj58q4ASWj$WS$VVhr#?W7USWVPh t#s1GWj$Wj$9ItDƅtZW[9uht#s1Vjc$VjX$ ^_[]h|v3Wjh#~hr#Z1Sj*$SV$-3j/U t@SQUVC h|v3WVh#"hr#WWVPjh`K$5q4译 f=3t%53>t=q4VPVW耑 1FVh2#5q4i |$VW5q4蕒 ?nu53hr#m> ^_VPjPVhs# t=q4u.5 3VcyVh s#!>ht#rP^Vt$j5q4芒VtVhs#=ht#qEj4WV5,3t)>t$=8q4VvPVWk j1j{VhVh+s# V3t$3jh:`$5q4 3u3$3%3t$3t$3f=3t53t$$53f=<3RV#t~"Pn3t$33t43t$3j3t$$3f=3RV#t~"P^WV,|$8V58q4ph~"Wt! $#hq4 $ hq4hq41GVW58q4 hhq4Wj8^_WV,t$8W58q4h~"VG1Ʌ#G OWj58q4_8^_V1Vh{t 58q4u j Vhzt 58q4W ^S\$1u,jPď[ESWV|$\$1FtCWPt1^_[fUSWVl$$1tt4`t4$p4%PhP3hmu#t$4Uټ1I~1L$$D$=o48O>HЃ sX 4HЉ5$p4jhP3hmu#t$4Uo߃ufH1K$ '$<tt4뷃EF$<jh"S jh"S h#S[D$QPuV$<h%S+hi#Szh#S$_=o4$<(q41@D$<$XD$t4=`t4$<j/S`t4k<$$YxD$ P1PhPjPP5$< $p4L$ !P5$<hu#QS0q4t44q4=$<W*Shm%h`t4k 1@1H1HD$1@$D$~1HD$$o3)t5|$L$(4hY%V;t5(q40q4t44q41 VjTVjIVj>Vj3o45$p4hiv#j V5V4$jh$v3 N#w` 'P_ D$tu1=o4 1A111ɣ<3 333=t4t 3=0q4t5$p4 uW6uB=0q4u5$p4 u3^_[]xVh%v#Hh}v#Ahnv#:hv#j5$p4hv#!hu#hu#hDv# hu#hu#j˻h|v3jj@hv#j,h|v3jhhv#j,fUSWV,|$@h juW^1ۅo4=0q4ho4Ou.j 1=4q4ȍPU耉8q4j8q4x3=o4u?jP 8q4teQ!8q4Uh$$Wo4WŅ?1GVj=o4t1O,^_[]ÉVQ=4q4uL$ @Vj58q4: 1Vh t 58q4T Vj)1@o4jho4OfWVP=p4t 5p4t$uhny#ƅhy#t8/u33y# P Vh3P) %1 '9uQPt$詻 l 'uڃ=$p4u%h$p4hu9$t$ u $p4%ht4h%t$޽ u t4=t4j:hy#t$ 1Ʌuǡ`t4u'>/5`t4jV8`t4tt45t40q4t4=$p4u $p4%t4Y1ɉ t4`t4t=tt4utt4t =(q4lj:h]$t$I 1Ʌ t4=0q4u6tt4t=t4tP5`t4 10q45t4j:h4Q&t$ t 3j:hHv&t$ï t 3j:hS>#t$袯 t 3j:hb#t$聯 t 3j:h%t$` t 3j:h~#t$? t 3j:h#t$ t 3j:hU#t$ t 3j:h"%t$ܮ t <3j:hf%t$軮 t <3j:hh"t$蚮 t |3j:h]$t$y t 3j:h#t$X t4q4j:h #t$: t 3=t4u t43=t4u t43t4tPh",t4tPh2"t4tPh(v&t4tPhq%ht4h.z#t$3 u t4ht4hr#t$ u t4ht4ha0#t$ u t4 5`t45p4p4t%j,V:tA1ɉ5`t4 p4^_Vhy# Vhz#hsy#j蹴ttu$Vhy#>hy#hy#>j%fSWV t$ |$6Q_ p4p4;p4)p4h4z#Pp4VW8=4q41hu+t$s4t P Vݵƣs43h#Vtss4hi#VtahB#VtShUH%Vteh%Vt1|v3Vh{#Ww, WNs4$11ɺ30 ߈s4Bu^_[ñ1WV,|$8V58q4WV>WV脊#NF=4q4t L$f=3t D$#$d$d$ wfD$ f=<3t $Vj58q48^_hhq4jj SVPf=3tj`nt$R 30utztD$=p4„u30u1f=33몈D$< t< u>jV58q4z f=3t|$ 4#t$r#P\`u 2 <3tu 3tt A8u1f=3t l}3DAt `}3DAD$jV58q4 f=3D$P&/hWأt4NI$ 'Wh"#t4@t4N Q1f~ @t4,v3H ,v3t;!hl&jWh#"!iQWhO# $<PhO~#j蟖u* u4 t5o3)~1҅ S| $u4u8D$Pg,u ho~#q$~# u4 $u4y!ǃu h#}# 't!ϋ $u41Ph~#8  'u s$u40h~#  s$u40h~#>Wh~#+t%th:#|$ DXf|$rL$I}#fw H 'L$T$ t$"VRQPh#ch#h#j+}D$f=313hjD$$P fD$|$<3fD$ $T$3h$$H$ 'L$f|$u#tn#PD$=ufD$L$IL$}1|$D$L$ tl}314/Drt#E9uT$ЃDPhg#~|$ujjPP苁 jt$t$ V VhiW^ u hK#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSW jl$UW^ whΒ#h$v3Wh:it$V~ uO j.h$v3ݭj9Wh:iV9 u Cw8)|$#q#P($rkLPD$$PQ $<1|$Vhے#t$kL4t48 'h #h7#48~1D=PG9uh#['4 D$4!4"4#4$4%PSWRQt$hM#4(h{#444,40k<SWPRQPh#4`h#h#4\t h&#t h+#h#r&4d6|$1A t$t&u/7t$t nu Qh0#"FL9Mt$ $t$qV(GP$t$RV Gh#Ph#h|v3W jUSWV։1hUS jWS3 sUPPp} t'Sh9iPZ tV|FĔ^_[]h(&h#j>wUSWV׉1hVU jSU贤 }VPP| tAUh:iPۺ uGPhO#Dr1FSEĐ^_[]h(&jvVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phg#7^WVhJ#$f>r1D~Phs[& GH9|j]^_WVhJ#f>r91D>Ph# 9} j:G9|h#^_WV$fGjRW WhiV` t Đ^_hX#jSufUSWVu }6h$r#ji h#VW| Hw$` 'v4v4ԃBu|1PP5$<0q v4불v4v4v4v4v4v4너v4v4sjh$v3w_v4S3=o3=v4u.1L$A AAAQj jB =v4v4v4v4v4v4u31O=tv4$3tch#V,t^=v4ukjjVA ƅD$ PVzD$(!=<\$yB  u3u1PPVgA Ɖx\$v42v3=tv45v4PL$Q@ ƅ~E1v4VPSz? i)u5v45v4t$@ ƿy5v4h$$mv4u31O=\$t$9ȉQ\AL$5v4u ύD$ PS5v4r*V v4Vh# v4v4v4v4v4V@3h$$mv43V@3h۔#ˋ$B65v49bPh#h|v3 1@v4$;u3t=h#Wwt1#=v4u32#PW;? \$u3\$=v4 1$ӋFHN~ HVNƒ =v4u u u1G1=v4up=v4u< u7 =v4>h$r#h֔#h$v3 0v3@t>$@$Phє#h$v3mڃ 0v3@ t_  =v4,v3H ,v3;ىl$넉ىl$wىl$j$<$ىY1ɉPXuG o3$T:-u"j9uzuI o3 u o3)t u <$u|$uM1ۋD$Ã<$D$ tD$ 0$4u9>W uTWhQ#D$u5t뢍D$PWGu!Whk#Mh#jj$1 |$ $jSVU+ u hB&P41u8V1CHHf wy$ '|$uhUz4Åu뼋ss  PVh:7# |$u.jSU@ ss ٢ PVh:7# 1F $tCPpQc|$t KP;AmPsT$Z|$Osh$$rd1F7hB&jhPPh|#h|v3ejfUSWV$$6 1h$r#Uݞ -z4-z4-z4-z41Ch#VW/p e'H wu$< 'z4-z4-z4Ńo'filz4뙃prvz4oaz4z4z4%z4-z4-z47z4-z4-z4z4 z4z4z4z4z4z4z4u o3)ǃ=z4z4u-tX1Ƀ=z4=z4tL$H=z4=z4=z4=z4tʉT$4Gx{4jx{4Pxt$lVUhH3!t 9rUhp#\hH3H3 @3QT$/u>t$|9A@3A @3I3vy/th#h,#jet$ D3Dh j=z4u$PhH3cB$PhH3Bu@"8uT\=z4u=z4t@z4 z4t3D$ P6 B1#$=@txUhH3D$ P6VBu6h$$je#D$=@uz4 z41ۉ  t1ۀ|$/uhH3h#.t9Unr|/u (IHr IH9/touɉt$P{4USWVT$juQ% P.D$1t$CHfw?$h 'ss ] PVt$ h:7# Psh#>|$(5D3C,H3)=|5TShH3h# t$VC.1Ga{DuO|$u C(D$?Cj/D$ P t L$)@L$D$hB#Q褶T$CS(L$)ʀ</t ~/t/FD$щT$H3)rPhH3hז#t$PV^ L$@3@3=I3vx/u H@3=z4tD$PhH3?D$PhH3+?T$KP3Qt$31 u@T$(3Qt$$3q u.shH3h#W CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH3h# 1Gt$#KPqt$1BD$ $ '=z4L$ QP T$ z4 z4sHtbffM 4Q 4T$  {4t$/D$ !=@8fushR#jSt$ V7 1G)=z4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=z4t$tjQ\ 4H 4<{4tICPphH324shr#D$ PhH3<1u=z4thH3sh"{ VB*Åc1G18uFV(e^_[]hЗ#hȗ#h6h#h#h?h#E7h$$hB&j_hH3fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV .H#X$hSW^ Wc\t?$ VPh%hWD$PW-a#t VQPLD$PW.Å(5WV1/PVZt@\$L$/PW:t@L$ Q\$Sߣu)D$ )=|\$=5u=5h$v3wWh#h|v3 u3H u3~u3H u3hu3蒢É؃t9 t4u3H u3~u3H u3hu3Rƒ߃Y=5u#D$=@uW2cWu8=(5u WV35 PWQVQtW#1ۀ=,5$-5VPWh#h|v3jj h#|9D$t$QVP覃 Ƅ fDŽ$.$$PQ:+\$4$9|$ t#t$WPS$ D$Ƅ fDŽ$.$PQ*$3$$3$ $3$$3$  WVhm# fD$L$TTPQ#ËD$L$TTPQ USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP訠^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPB^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPܟ^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQPv^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP語^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP_^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP^_[]USWV |$87h$r#j诀 jt7D$Phht@j9 uD$tL 385<5@5[u D5t$41۽ht#WVQ HσG$ '@51H5185l5p5<51H5@5L5P5`5낃w55^5O5@d5105"55@185l5p5X5\5t5d5h5 D5=T5t T5L5551Vx5G|551C+L51H5@5P5<5T5H51@5L51@5L51H5@5P5<555851M55r05c\5X5J185l5p54P51H5@5L5<5o3D$=<5u=P5u =H5thD#^tP L 3=T5u T5x5 L5L$$ ȉD$5 `55 05L$D$ ыt5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uh|5jl,|5 |5=505tL$t*t,uw kL$t;t=u^ RQ K =\5u==X5 t/h (8 !6 =\5u=X5j t 5)θD =@5u/q =P5u! =L5u=H5U t  5t1AT 3U445 ^_[]#Ph#h|v3s jUSWV΋\$=h5 t1PSR ~jP_1ɉ=t5tW L݉t$=d5D$W$ÉL$ CHHf$'ks } PUh:7#A 45{Dt{T.u =D5tw=5uL=5u%sh՚#軽1TSh#L|$|sh֚#菽5VWNʼnى=d5ut jSW W!Å0W ߤ0ؤ8u ^_[]jhB&jCWVD$ qH1ftYT$zHftIf t$f tf9t=t5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$dx5D$ L5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P&{ PSl$$h:7#t$X 1@F F45Z|$dt~T.u-=D5t"fu=t5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=L5t-T$$L$(=5t-shJ&j $WR$D$\l$t$0Kjs袒Džt=5tshJ&j $U jsړŅtщ|$W‹L$@D$9ʉT$@l$ UʼnD$<9L$<=5t/h#sl D$TP辐T$ 9щL$ 1|$PM  à t$Pʮ Ct$ P贮=5t +Cl$TUP蔮U^ ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=5tD$|t$ |$ n|5ʃQPRWG$RPh"jV&VMD$|=5t$ |$ tHVUUUȉD$|$D$<$$SWhGB$VUµU$t$hJ&VU蟵UƎ$=5tDŽ$Mt$4t$ ,v3J ,v3;,v3J ,v3;,v3J ,v3;,v3J ,v3;#D$=@u.$VtP3 9r*th#j%|WP ty/t AƄ/@L$M$D$Sw|/uH9tx/@tj/SZjޅt@VHwL$rSh#蜯1A $'@PVt$ * ٍ$Ct1@$Mg4$HSPPh#h|v3袡j(؋5USWV։π=ȋ5ujVݤt~VWOt9c8uR\$@SVt{SW9Wh$$1ۀ=Ћ5VWh"d VWh# w=̋5u=jWGuWh#H#D$H=@V7=ԋ5/jVD$@PVjWԣuD$1Pt$LD$2x $r#t?%D$1Pt$\v1Pt$`wVPSt$D$BPhǛ#h|v3#D$H=u}1PPW t$HhVk \$D$܋55VʾCVh#T1C؍e^_[]ÉVh#h|v3G u3H u3~u3H u3hu3UuÃtH tC u3I u3~u3Pu3hu3u u3 tuÃ߉1ۃYM@Vh$$'$܋5S0 5t$|$SPt$  Å11S55t$t 9x߉=؋5t{\$(t$,l$( p&$$L$$D$ l$ |$T$ fT$l$\$l$T$؋5RQPVSt$(t$(h#h|v3豝$5܋555t$  Å6|$W\$St$uVh#<SD$hL$l$JD$pBD$tB D$xBD$|BRW)tVh#t$\t$\WF 8tVh ##D$HD$Ht$\$ \$D$t$Ph$$~VջtVh#ct$S1V>5܋5t$t$ЋD$HPWtVh #$Wt8-t$Vh-# WztV|$Wt Wh#H1ۀ=Ћ5DVt$SWVP׉5jWPh t$t-hH#hg#hH#h[#71@^_[%tPhH#h#Ш 5jWP t$th#h#%tPh#1돸P#=Ћ5uV#H#jWVh= &Phq"SSSh$$j[~#jVh= &h#hq"WWUSWV8` 3t P` 3155555P53it$L$@'hjV ` 3Vh#0jG` 3hhVm ` 35hjV< ` 3~Vh7#0jͳ5u 31` 35d 31t~5ttja` 35l 31@5` 35l 31@D}Vh#0jE` 3t5tj` 3 76tQ` 3h5PYxC 5%= ts=`=@55hi#j許 E}55hW#0j膲5` 3` 351HPhm8@5` 3D_ 1ɅA 5-`55\55ˋ 3u\76`76 3v$T'=\76=`76>1jSS5` 3^!ƒuT|8f5-`55\5 a1H 33=l5Gt =}r t~=`76`76q˃u#=\76tPWUVܘ ~jWUV˜ tw߿(=`76u `76~~= 3| 318^_[]111RSWV։ωS/ 3D$t,t\$W3,/4$At$5ctjt$/'Q#1@jt$.#1PW.4$t$jSVVx^_[h¥# hѥ#h#jVP=` 3x=86 86t}=5ut=86tD86HQP~'Q &P5155$Pj A586h#586蘔 586jK=5uKh55` 3Uu4# 5=u"`5 \5u55}5=3w=86t 3~ jP5` 3 3~jQP 86 86t4=5u+586hM#b86586J` 3=5u 5tP155x86t 3 86 86t'=86tG86HQP~Q P5Pj 贖86x86tZ586hʝ#iuC586 |76x76 u l76h76jhQPfRPhϝ#V跒1V586~I5P5^USWV=3$v3t|v3D$WrO+5 5 u1@1ɉ$L$=x863\$5|765x76h#hS<$t$W5|765x76e$h#RPWh#hVÍ$VSh#hW觍}WfPW}tf=5t]t$5555h#hV[$Vh5h#hW;WbfPWjV 3u_5P5<$t$WjV e$h$RPWh#hS$S]Vh#hPŒx86D$= 3OP5D$ #D$5|765x76VSP}$5l765h76VSP_l76 h76 x76|764$t$VPQ>d$h#RPVh#hS$S]$QL$Qt$Wt$$hɤ#hP$t$VdPVj "$PW586h:7#t$蜏e^_[]V~=5u(=| 3~h~V5` 3 | 3~^V51=5uE1jVV5` 3VxRP5` 3a ythܝ#0jd 1N^Ã=5uh#jI&1=5u5865`76h.#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5| 3=5t$t$5` 3 ƃu*~35;5`76tc5`76tU5L~ 5?5| 3x5 3h#j, 1r5 3hl#0j^_USWVP5| 3|$l$1ۡ` 3$WUt$ ƅ~)tދD$9u55!| 35Hs-!r8 uc1h#Vh5| 3:~\%tS1jPP5` 3KTx})RP5` 3_ yPbq8tDq8t:q8t0Ty:q8t q8u | 31pq8Eu | 3xt 515=5uh؞#j腥`tx>x86Ht)t hf#5 3h#jL 1%h0#jp5 3h #0j^_[]USWV1N=5=| 3 3uh#j٤5<u5-5sg5l51jWW5` 3RxXͽuWURPi)jWU5` 3oRyQu t#5@5=| 3:hǟ#Ff@Phm5` 3Q x| 3h#j1^_[]USWV \$$|$ l$(1uu5| 351jVV5` 3Qx\D$ljT$Ӄ=5D$`5\59L$ujRP5` 3IQx+D$T$EU,=5u#nh+#0j | 31N ^_[]USWV~=| 3$(~$$~5t)h[#j蔢I1u)1ɍ|$h~W5` 3s 0|$fGWhm5` 32P fD$D$Whm5` 3P \$h~S5` 3 $h~S5` 3 GfD$D$Whm5` 3O | 3t1<$uzfD$D$Whm5` 3\O f $ `7611F$$~jQUR ы$ʉD$ ʋ$$~) h#b1F|?1jPP5` 3Nxg)y11= 3|!h#11Fs1oOlh#RjRP5` 3N1yK+lhܠ#.lh#"lh#lhB# khl#0jB 1N5| 3~^_[]fD$D$ D$Shm5` 3N ykt$h-#kt$h#0j٠SWV Vh86j y[khR#0j袠 jVj y/khl#0jv 1N=55=5=D96u586h#趟=5hl 3W\hd 3W\o 5aX#t# 3#t&#QWPA S8 3P#t2#P586hu#h#hâ#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5555h;#sWh#T586hu#Ah#4hâ#'h#<=D96th{#j{5 3h#586h#ҝhߣ#ŝ|$h Wf|$.|$t+D$5..L$f tWX= r@h,# h#h #Y586h#Fhߣ#9sWy\Whe#5| 3586h#86 ^_[hY#М5t P% W 5t 515| 3hK#j|53mtt$11Hfhh5adth5pW51@gh#0j臜 1Ht$rgh2#0jX 1HVt$VqufVhF#0j*^\SWV|$$Wƃu[f1~tHNtt 9 tu/zfPWt#D$=@t Rf1N|^_[USWV1Fx86PH{x86P kjƉ+L5Hw> x86SPh5Q@ 85$ <5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PIUPh55P% h$v3WVh5M<0v3@ub85@5 <5 D5QP.t x86P(jh86j, xsZ1e^_[]dh[#0jՙ USWV ( 3x&, 3kL 39|׋yM1II1T51PQÅy19}WDu=3h#j.hhT5OÅy1ۉ9|( 3x(, 3kLShT5 3y݅u=3teh#j迗T51E$sVhU5T5PD )؍T51Eh#ji1IkFL 3x86ShT5#1ɉ^_[]USWV D$x86xGD$S5$1F1T5SQ291Cx86hT5h5P$ x86Qu*D$PUhT5Q8 T5tu=3h#j耖t$hU5hT5! $W1CttUtB:x9u=3tFhC#j,WhT5Q19uh#j1H ^_[]h #th5Q<t P51hi#USWV1Cx86PHx86P yjƉ׃=76t/53t`hl#0j4 e=86t Rrx7t$t4x86P(jh86j  lzbV1ۉ؍e^_[]Ít$\$D$L5Hw5 x86VPh5Q@ 85D$ <5L$ h5kWeh5duy=86tSh5t^86 86tSh5qh5Ujh5Xt@h5Em85@5 <5 D5QP=5/u+?<u"5P[OPh55P7 86 86tSh5 86tp86|NPWt$h5)6Q=8686D$L;5D$P5Ph58865t@t=86u Pl=3t1L5Hr@tZ tUh5l'9D$X;5D$\5?uD$Ph5$Ã|$=86ut$h5Åx86VSh5P@ =86uSh5/!؃=86\$C=866D$86HQPQ 86=86D$L;5D$P585@5 <5 D5QPDy h5j=86\$^=86Q86HQPQ D$L;5D$P5D$X;5D$\5OPj z86D$u85D$ <5L$ QPp5x53586-85@5 <5 D5QPh5ji\$=D$L;5D$P5Pj z86USWVj/h5v>1Uh5wUt>55h5U?L /tOGh5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=x8601F x86t9t71ho#jێmQHbx86P R=86t i<x86x t `m#86 86t#586h#586t 86ujh5^t(85@5 <5 D5QPu1=86th5hxuth5lyx86P(ljgSW, xa86 86t&=86t586hM#2861G*ƃuejh86j ^_[USWV $x86xu d?*1Fx86P,x86@0D$ jD$T$=86jSh59]jh5Q$=86th5~gh5+th52dL5 w's1PP55r $jh5Pƀ=5/u+4u"5PGPh55P =86t4$h5Z' 86t:86|Pt$t$h5s.Ph5086P5h5T$t8=86=8686HQP~dQ cx86L$Qt$5SPD ƉPS?&=86tc=86tZ86HQP~3Q 2Pj t86Ph5%dPj t86D$L$ʃ|QP  <585ʃ|QPxnh5*1C@TPh5Z%U55hR#0jh58ch5)t x86P4 jh86j =86tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=86t cxIxx86PHx11@USWV $$h 586S = u$ /,4ŏ4/t EƄ4/FED$P586d#D$=@`1Gxv%xmlxd=86t exRh5!(ttjh86jQ Gm'1586hʦ#j 1GĐ ^_[]S586h#0j҈586h#뻸 )D$ )D$$h5 X86 86tV1=5/5t$PU? ;D$vh5h1#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơ86 86tD$Ph5I=86t586h5+86P5=86tEh5C=8686D$D;5D$H5h5{L5Ht 1PP55  $jh5#Pt$h5 Wh5D$P;5D$T57wD$ Ph5;86tk=86tbD$D;5D$H5Nh5h5^^D$D;5D$H5D$P;5D$T5TP55hR#0j蕅P5WWWh5!Ph5=86e=86X86HQP~ Q Pj Cn86 D$D;5D$H5UfX76X5\76u x86@\76=~| h~Ph #thPh>#j蜃1Hã`76 355y x1l76h76 X76\76ʉp76 t76X76X5=3u=\76t4=~| h~Pho#thPh#j1H55 y xX76`76p76t761|76x76X76X5~ 3`76USWV=86th˩#j艂1I^_[]Ã=\76`76 3u\761IxՋ=p76+=t76|$\$5 3UVSW&k)9|11UV$)݃X76|Jt76 3p76~H5`76Pt76t76;p76r֋ X76 3p76t761)ȉQPx[X76Ɖ5t76 3ȣp76)=x76|76 `761l76h7631h#jWV1N= 3=3uh.#jy1|76x765 35X76Z1 3~9} G{u'Phc#j~ xI1=|76=x765 35X76~ X76 t76x76|76 p761^_ËD$L$t76)ʉt76QPR  USWVu ]1D$ D$ D$p76 t76)ȉ9؉| t76)։ `76QPVSh)ЍT$RPQ 1ID$L$ )x76 |76|~ p76t76)ЅqxUtX p76t76D$9ؿ|‰t76)ظ|D$L$ 1H1@D$D$e^_[]V1=765 35X76~# X76 t76x76 p76|76V1xC=x86t/x&5|765x765 35X76~761 861H^Vt76;X76v*5p76)QjPE 5t765 3^USWVt$76 76ƒ|]; h76l76}O1h#W}=l76=h76$-X76 3 ( p769)1 -X761ۡ 31PUK; 3tS1l76h76SX76 3p769)QP륉h76 l76Nj-X76S5p76U +t76 3)USh76l76X76 )VQS t76x86Htt861O1^_[]É-t76USWVP\$1~cl$p76$5t76<$)"5 33x3ǡp76$5t769|WUV 5t76)11H^_[]USWVPD$~Z\$ p76 $5t76ŋ<$)Dž~9p76$5t769|WVS 5t76)D$^_[]ËD$)USWV\$ l$؃|~p76D$=t76t$)#5 34x\ơp76D$=t7619|VQWD$ B =t76)Éظ|$1H$$^_[]USWV$  $x$|$D$|=86t7P$`"y#E$ hW#0j.{$|r t761Np76)ȅ5 3  t769غ|PQ$ڱ ~|)à t76 t76ظ| uXP$!$3D$8$3L$4 $ h#jUy hx$ h#j5y LD$ h#0j z'D$ hW#0jy111o^_[]USWV$$x$|$$D$x-D$PQ t"*D4$h#0jny L$|L$1$p0L$1p76 t76)ȅ\$^ t769|4$ST$ RT$RPQ$P~R|$ =86 t76tP;CJ t76)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=86t% u!$9$t4$h#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=86$4t1PW|y#BhW#0jQw1HD$sD$$P$<>4$tAVh#0jw $l$ l$\$ 5 35X76W lj\$11ËD$ 9D$D$D$X76}$4$t$ L$ QL$,QWP$PWP$@ ى9u15 35X76$<^ ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Wh#<$Wh^#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]?$0h#0j8u1K<$?<$W$4h9#0j uUSWV|$7t6|>/u/1N=76MWh#js 76.|$tjh W V $=7676_Sh]#VPU$PyƅE<$8$S x<Sh]#P$U$yyw>0=86t586a$hg#Vjs1576$J $U>QhF#0js1N^_[É:USWV|$?/tGj/Pz ƳUW菹u/Fj/VL ƅuhW=86t$$W jW[y3UW!u%D$ PW)jUPWV/Fj/V1ۅA4t*PWEt1K#D$1=@ۉ؃|^_[]/WVD$t$ $PWyu~<Whx#0j r$tDPvy<$h#0jq$Y 1$76^_USWVD$Et$$^߅tP趩y*<Whx#0jpq=86t<$8$W 1 86tt)$($u7=76uj\76PN7676!UW3 3t%1PPL$H$X$T$W$tJSW/y!C;SWh#0jpWZu$ 1$76^_[]WVN1uA|$ t$t$Wh t(586 :Wh#0jp1N^_Vt$#D$ PV?t%586] :Vh:#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=3t =3D$PV豵t:Vhխ#0jKo_=3u&D$DL$HL$$Mbl$L‰T$=3u'D$PL$TL$D$ Mbl$X‰T$WVIt6}98Nu} u&WVu^9Vh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV耴t%#D$=@uVhì#jm 1HjW |^_[USWV׉L$]D$PSt6St$ƧthZ80wwS tՃ} tL1@_1=86uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h##Vj6m1He^_[]ø#D$=@u%h%S)tS0Sq} D~7Sh#0jl댋D$$u1@Ë $jPUWV}wPV1@xN=86t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $h'586h#(uu=86tlD$PUñuZD$ !=uHhWU> ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU!Ut$ң 4$U臤U5L$ t uu$UFD$y)Q8=86us<$8$U xZL$ A$4t$Uh!#0j3j1H=86t2<$8$U Uhg#Wji1ɡ86tt1Ƀ$ !($t($t$$586hʝ#&jURxN1=86=3=3Uh|#UhJ#j7h 1OD$PUhx=1$ ?#D$ PU1@=86u;L$ ($/3t$h#0jh$ PU1@Pt$6UK31 3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=86t މ|^_[]ø#D$=@u5h%W$1EtXWyĉ#$t Wly5861#T2WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5X96T96 P96L96L$T$tI AQP DUVP 9t_L$ xZjPUQҋT$0y@oEP Džt<$\$MQVPS D$8+$T$0)+|$$>hg#jJe*0t$8hu#0t$8hW#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh76S褛 y%u##\$h0SV0je^_[Vt$ xFP=86t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$( xLX$3D$8T$3L$4 uF1VVV$(xE$($\h#.hW#.h#j%c #.$(hڮ#0jc1N|(^_[]V=86t76=86t76=86t@76=76uh 76t01x&=86tDyh=#jhb1N^WV76tPԕ176761N76t 76tqA76uj1u3H u3~u3H u3hu3tN;4 3u1tB 769G= |+76xx76 PW1t-768j576h76踌 76&1^_SWV|$tR?tMj L tSƋ\$WH~ </u>ۉ^F=76t%76p!hl#j`1Hh#5765761^_[á76t@=86t76=86u0=86t'D$$u76tjP576象 WV=86tB576t;11G~u)uh#jA`6h#h|v3F vu^_USWV =76u%761N76u76}$ $ $L$P|76t#HHf w=$'ph1##"phۯ#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p * 76qhE#0 ph#p j_e=86t\@PL$QL$ Qpp p09Bx876jjt$t$t$t$ph#p j[_ 761N1 $'LJ$Ƅ  LJ$LJ$=86twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 76 VqP>  76VqP 586hʝ#1u76@e^_[]fUSWVT\$tl$h=86P($ T$L$X$1V8$V<$ $r#$r#t4$tVjQjRD$Ph_#S C $u2@$%  RPhq#Uh#^|$x$h|#SBEPD$Ph%SB$Hs Uh#u# Uh"ScB S:X^_[]Sj RUSWV@L$E\$CD$PS{3j9ٰ#|ϰ#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($,WVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPS}VSԳGu܃^_[Ã^_[鸳USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V86~1F1u86h#j9W^ÐSWVL$D$t$|$$<76t76tt\^_[ }\1KZ76teSPti:tdx:o39}j $<@o3sPVW_ hV76:-u/76È76n7676`S6h#o3=S6h#h|v3<?^_[f1Ã=76u1áx860h#jV 76t"H 76p0hв#h|v3q<586h#Lu_sUSWVd|$|j/7g86t@l$x86h#P586#1C|86D96D$ D$1D$$jh 3h#WUHЃJw$4';t$$@$'$<5묡3t 3863r3t c3P=3ܴ#\$86! $<k\76 \765I#5% 3865$<R3t 33\$86t53e|8686L53=86.86 Pt$9 * NL$ $< 76$LF5353535376$<765p$86q5$<[Z 3@K 38$<8-u x5D$ =`86u 8686335f#863765$<WO 86D96s 96d3U86`86?51@D$ )3 L$ ƒ ʺ|v3t$v3 o386ƒu 9u , l$D$kL 3x8676 86q"1$jh8 3hڲ#WU϶/~HЃJS$x'4 3ƍHw$`' 96뫅!$<53D96|5p$m86@X86ˀC8615f#"86 $<@Ƀl~mtKotRpd86SatDeJ1A 86 86 3 3 3"386 3@{pe$<5SH863 $< 76761ɉ5$<"]8686$<L$h jLjh 3Q*x86bl 5$<Vh# V~ 3486 86@5$< i@865865%865$<9i $<E \76N86486 $! $< }86865$< =86@86  3%=386$v3 0akG1A11|$<$t86D$tGNutNj]]h3#S3 1t[hX#S uE7676j576S^ 1AL$y#$]176<$D$h#Sl$\$th32#S 2Džu u31 ðt5hX#SUu376SG I 1urL$tP؅uAJjh[#SN uP76D$t t P CPӹىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#Smt W`=d86<$l$S|$;76,31ɺ G1Fmفt#u41A 03<1A 03!531ɺ.1!# $ 4u x86 3=rnFr0s9-o3D86PMo39}j4NxPo3@o3 3o39 1VV4b xo3@o39| Qh##j?H 1FPhʳ#V(H VF#5$<h #h(#jHj #5$<hj#hh#5$<h9#jG |v3VhO#w%5 3WV=. 5 3WV-. Vh$迠5$<h #0h#jjG!j"mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8Uh3#WQ1D$h.D$1$h#Uth32#U-Džu Ju3tkðtAhX#Stjh[#S tj1ujSðuh#Uxt Wk=d86Uh_#l$}$l$hX#W5]tjWB\$rt D$W 3|$ td^_[]á5t8uh@"5t8u5E"Uh6#j E USWV|$%UWKYUV荻NJ00ht$跩tAtZ/UV YUWM488ht$vu5t$h#0jxE1H1^_[]á76t H 76h|v3h#肝jhWV|v31FWVhhv#=WVhh##)WVhh#WVhh#VUSWVPˉjPQ փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q=$1>tj,VÅtj=Vtmj 茻 tdAE0H@76=76t \86s\86uh#j6B1O^_[]h(#hQ#h(#j B4$ ɋD$L$01rWV586hh#h|v3e( t(ο#Ph}$h|v3=( !uءv3H v3~|v3H |v3 h|v3j +^_SWVPωPQ Lt4Ƌ$| tC$SE t'ǍCPVW/ DG d86 d861^_[USWV$t%t_݊M\tS8uEEhB#j@Ej譹 UEƃjSV t3l$hUVPWUh#j\@S $EE<\t:uCCU莯 $AStRC1fGt,PtStgtstp1B ы$J@u $A=h86tZl86HVV{4$ Wh[#ji? 1H^_[]VGV hy# h86 l861V4$ Whӹ#USWV\$tK;tFj tLNjl$1pSG woD$G95p86t%t86x!h#j>1Nh #=p86=t86^_[]WV5p86t;11GFu)uh:#j^>6h#h|v3$ vu^_USWVp861 l$$=86Kt(=86t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=86tGtlD$@1G8D$@1D$\1GEt$ h #j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh##j59tNjE|$tDD$@t:$t$PVh\#h|v3mVhF#h|v3X $t+Et$h PVq 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7:86|v3WVVj蚡uD$L$ L$$Vj<VjquD$L$ L$$VjVjHuD$L$ L$$VjVjuD$L$ L$$Vjhؼ#蔴861969696P 86t$,NFF FF |$WVj* y|$ujWj WVj y|$ujWj WVj y|$ujWj WVj y|$ujWj TWVjz y|$ujWjb (D$,WVj F  WVj2 0=3t3i=)‹1@?9 tR=96t3<$/>3i=)‹1@9 tR 961QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=96ujh=褰 96#t\u#uGW螤 tjxGj jW - />3i=)Ë 96,t 98t#@u $je t!8h $1(Wht#j9- h#hA#j!-^_[]USWVP|$1N=96ujh=觯 96#t\u#uGW~ tjxGj jW 跞 />3i=)Ë 96,t 98t#@u $jh t!8h $1(Wh#j<, h#h#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh6#j+1H^_[]1j腤 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj诐S CS>tKt^?tYڃCKt6C;C C})VWh#j*S hr#C=96t$96X VhN#jW* 4Vh#96961Whؾ#j** S譳 h#}VQh#j*USWVPϊۉ$tsl}311JDhu.e[YAuۉ4$Åt>Vn,FN4A1R113W*1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1= 96u*jh   96uhN#j1(1N^USWV 961Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj膠 Ël$EPږ $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3\ SS SH hy#j&1NwUSWV 96t"t$4$r$ ws^_[]Ë,$qvщ i )‹ vujg tj1jPP53[WG x[US53D| $#9uG$ T$X$OG/$96$ O<hc#j#DD#yV0j$ WK "\h# Ph #0j$ 1H ^_[]Ë$ T$X$V9F} FN11@USWVPT$D$@~T@Ɖ1r2w1F11ۉ1/,Eu$C/9u͋t$ t$1:CK 3i=)ƋDt1ًP1 tD@|$t6j莙 tx@ LHDh{#jY 1^_[]USWV,96CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj| J1ɉHT$, $$$P HN HF F t$1 H;@u ,96-496096096-496Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@096=496l$T$s}ډD$0! umщjt[496=096 tIji t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,PhX#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=896u*jh=p 896uh#j1N^WV896t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$@tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W h#jj ^_[]USWV 8961Kt$/>3i=)‹/uPVkDžj$y tWW؊tN$$QVQ4y8~V Q(y,~VIlNF <96F5<963WhJ#!WhJ#j V耤 Vh3#j ^_WV5<96t~1F<96=86u~ t v6蚫3 3tWWvvvv 6踫=3t v6ά6 V 5<96u^_jhÀ=@96u1WVL$T$t$ @9611H<>u5Guu%P=D96t@9611@^_V|$ |et$>t\jh#Pk t 3=3t#h#j|j 31H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPhg#j^_[]SWVh1Njh#SCu3h#W.u!3u9H96Džu91FWSh#Voh#h#h #V WSh7#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD ShP96hL96   PhX96hT96  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ賍 7\ 1D$ereRPQ脍 ^_[USWV $ $Hw.$' e| Rh#{=H96x1ۃd|Rh#Q1l$ hVU $ jdPU$, $$$Hrjtr$@ L$ D /f@ 0 wh]#h#h#h#$F1 $F2 jdPV6 fF0 $j j0P, 76 76t86T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U9 $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h##$%$ $LJ$m9rD$ )yQj0U{ 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h@#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh#W% t1H^_jhe#W  u(=D96u\96u\96hm#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQn Ǎ A/G<rH )UhP96hL96o   PhX96hT96G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPpyEtQQP  ƅ(8$VPJyElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxug+& `961$$A9r'$ 0I9޻Ér119rD$)Qj0U $ h#$B L`96فME1$A9r+$ 0IՉ9޻É׉r119rD$)Qj0RM $ th#jF UfDŽ$ rDŽ$usta=D96t fDŽ$  fDŽ$ 00($1l$hL$nA9r'$ 0I9޻Ér119rD$)Qj0U $  th2$8$1l$pL$vA$9r'$ 0I9޻Ér119rD$)Qj0U $  th%<$1l$xL$~A9r'$ 0I9޻Ér119rD$)Qj0U t$ h #76 76$ t86T$HIrm$1$A9r'$ 0I9޻Ér119rD$)yQj0U $ t*h#h#j1G^_[]1GWt$W<$2ƍ$ $r#$r#tٻ SQP9 $-tSUP! 1L@=uL@=u1퍔$$A9r.$ 0I9޻ÉՍ$r119rD$)mQj0R t&$ h#h#jhD$Pf1O$ jj ?d96tT5`96P( `961҉d96`96j%)jPA$  %USWV$׉Ήh$jS $l$h hL'Uz E t u4 d96 Fd96@`96Sĸ$^_[]Wh#jWlWVt$ V;=rVh#j[ ^_USWV̀| uJt?5l}311\=.*t?u.L^u\L@\@G9u1D}/tP\$$Sh#h WgW1NxtSh#h WCWxS|$$Wh#h VV~x$Wh#h VV]1N^_[]USWVPt$>-u~t6h32#V$Džu'0{ PVh3#jHu31FUW t5Ë$rt$VhF#j$_Ft1N1u3t W^_[]fVjh%#8xKh"P{h96t)h32#Vdl961u;5h96蹻VP9=86th%#h#j 1H1^WVPD$$|$t 86t$86 86t"=86th|v3j 86|v3586h"W3 4$VW Wj  ^_Ph96t$L$T$ $RQPx 5h96ʜXSWV|$1N|5l96t,\$OPWS t;j S-1t^_[SWVPD$ $|$t 86|$t$86 86t"=86th$v3j 86|v3586h"S2 4$WS ~V Phg$h|v3 h|v3j  ^_[fUSWV} u7h$r#ju \$1h$WVo LtPt߃95o3D$h #ƀ8/h#Vushf#Vua$PV[DtKD$Ph%DDt4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02Vh$v3芚0v3@uj'hy"jf&Ph"#h|v3v jUSWV$$6h$r#j 11Ch3#VUXn e~%q~3كrtރvt_x96ŃV.PtrكRtwftAit96x96뒃Wt6duqp96z96lt96x96W96I|96;uo39|=t96u 1Ĉ^_[] D$h` ju$D$,$SD I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h#MC\$96EHu]j$8u 96Pj舢96a$8tӋD$t$ VWA 96tRtD$Wj4=t96u8ts8?ti8t_Wh$$_Htj諝 PWh:7#` +D$@uDp96u;Wh#396;;=96uWڀ=t96utV/tD$%=@t/==|96u uWGWLw t96 x96х ˉ4=96u Ő=96t@jPt$Z$ u h=#7P-u8Vf,NjGHHf wO$\'=t96WOwP"{jWV9 GG \=t96uWOwP:GHftIfgft9G =t96u P莛 PW}G  Gwut968=t96uG ?tow  PUh:7# c=|96uO1zuSw@t)t96t 8t18?t'8ut/wh$$\96V+Dž6=96u =96t96ww0hB&j`ww , PVh:7#j`Ph#h|v3* j96USWV΀=x96uLVhM#h|v3 h|v3ʓu3H u3u3H u301C=96l$$#E=jR8D$Pu<=|96uvVh[#1Zhu3~Ɖt9 t4u3H u3~u3H u3hu3>ƒ1ۃYÉ؃^_[]ÍD$x $r#t?%1Pu51Pu蕳VPWSD$Ph#h|v3USWVAӉ΅:#K1jhV- $ǍD$PW諜.D$3CL$3 D$(3CL$$3K #D$ =\D$W,1PPPWL D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW* D$L$D$)T$T$ 9D$t;$SV:96Vh$$X)96Vh$$XWw,1@e^_[])W+u1PPPW< uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW) D$L$D$)T$T$ 9D$t1)W8+1PPPW蒠 h j$PC KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW( D$L$D$)T$ T$9D$tm(W*j1PPPW Th j$P蒹 CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PWS) ;D$t$$P$!P8 L$)L$L$L$ |$D$ h'W)|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW<' 9D$)؋L$D$ظL$|&Wf)1USWV\$l$UEtMƊAuA)k')l:6j赸UGG SѸG96<96 l:6t^_[]Ã=p:6t^_[]USWV\$tKƊAuA)k')Ƌ,961Gt?uS賬tmt&uS蚬u496jVJ1^_[]ËD$t @ъ@uA)k')96WVt$ >tVG t|$u G?l:6wx ww Ww  l:6u=p:6t^_WVt$ l:61<96t96VPs8uG'u l:6t^_Ã=p:6t^_:USWV|$tWBuA)k')961t(l$sW,tu tC uމ^_[]jt$ }t@1ËD$L$ pqڪSWVl:6ƍ1P腶1 96tQ:t @ C'u9 l:6u=p:6t)h jVW{~R1ۋph#)p43HQPP@%3Q C9uW荶^_[h #WV11 96t)96Q:ujPuFȋ G'uƉ^_USWVjB68H B6(11C}t$Ej=Pt)AQUkh&#537(TjUt_Uh#p(w23HQPP$3Q B6H B6(S Uh;#53' u1^_[]Vh=%tauj4B6t$1Pc ơB6H B6@u1^fWVP5@:6l}3DBuFN#'ut t- 8:6]$'NF밉jWV蘘 L:6H:6 N#'j8:6P:61D>GN#'uGPVH:6WVP H:68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5@:6^_ÊVF|uܹո ѹ Ǹ É)B$:@BN#'uVPQhP# fUSWV|$,t$(S脲=8:6jLVHt:xIuxNt@jLPj V'1tE@j P)=8:65<:65@:6"1,=D:6uƉS;^_[]ù#V=D:6)u ^5<:6Qhx#*WV$r#|$ |$wL3 P3 B6>t'F B6QB6RN@>vuڋ7 B6QB6t& @뭅+L3@P15G6VrƉRPh$# 1 ^_USWV8׉ˋ H:6L:6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jVjVt$ % USWV Ջ\$$St$$tƉ׃=D:6%up1҉  ډD$$=D:6&uU1ۉ D$H:6 L:6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVԞƉ׉^_[߹6#G#*#wSWVP=G6P:6G6Q5)Ɖ=G6=3ttxt>uw&e1ۉSPV ƉK9u$8t*:8u+$t@N#' t$@u^_[ùT#%USWVPՋ\$St$gƉ׃=D:6uKh$H:6 L:6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաD:6HwSjP ljաD:6uND$H:6 L:6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THH:6 L:6N"ىWP1Eكra$"ى=D:6#ÉD:6݅~hD:6 H:62É׃'1HH:6 L:6NLىWP1 1H:6 L:6NىWPÉD:6LH:6 L:6NىWPe$É׍EكwD:6|$4t;~l-D:6b1A1Ǎt$WSh"jVjV5H:60't1I1@1l$QPh"jUjU6  ؉^_[]ù#T#J#@USWV֋] $t$ơH:6 L:6L$ D$T$uPV֋=D:6Ww,`''8h''}uPW ֋=D:6ȃ}tً$VPt$ ֍Gwh'';E Qȉe^_[]fUSWVb3$D$ h#t=etuD$ jB60hT:6GVS蜾?S9U.@P谧áT:6)QPSL} T:6)١B6pQ@VPS[$$jhK##ƅ<.u 1~.D0t$xPD$!=@uU $Ȅu VS՚1ɅD$ PQS] ~21E`y\辨18u'I@D$1G蕨8t$膨D$S蚘@PD$jVD$P%1 Åt$ Pt$ h#: Đ^_[]Ê<-~|5X:6u5T:6$cD$t$h#SVh#h#V=T:6t^À=`:6u3`:6h #]PtVT:6^OSVD$ l:6P[x\|$j l:6u=p:6t4tI|$tO=3u =3t=5T:6h#A(1N l:6u$=p:6th#E  ^[SWV|$;T:6tytuW֖@PZ\:6WP 5L3P3B6?/=T:6?GH B6ƊGF?B6Ջ X:6tQd T:6l:6X:6T:6jG l:6u=p:6t=T:6"V5X:6h#: V5T:6h #& /uB6N\:6{Ht/t@1@\:6hB#SRtg;t^h%S;tLB6H B6辥/@;tS B6QB6虥O@?u+' L39r9vB6F~/uЋ\:6ƅ/jh #%1;L3u B6QB6/@=B6u B6l:6X:6t PHb T:6X:65L3T:6V5X:6h# V5T:6h #| l:6u=p:6t^_[á\:6t HQt/tA1A \:6UVutf>/ua$Ph%tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"uB68LtjB68j*5T:6uj=T:653[3f`5T:633HQPP3Q 53 3@u1[h$#[N0z PhY#Ah8#7SWVWϟWPu2\$Vm8"u6W蝟WPtVLT:6V1^_[Åu踡0}y Ph#jT:6tjPh # hd#ÐUSWVD$ 3fa1Ƀ|$‰tpыLh$S$thd7#Su 1t$.4NJ]taM\uNEU\rw$D'\0u!11ЃwxAunjt$>3HQPPe 3Q t$.PN    ȉš3HQPP 3Q<$t*3HQPP 3Q 53W 3Hu 1^_[]ÁfHh#jfd:6u L$ h:6jPV=l:6t p:6K15p:60ppp VPj  95@6t =3ujV@Vg^jpPT$=:6u :6D$ $1APVp:6l:6t1It$aVPL$T$ D$$PD$:6jWVP|$t$D$$a4$ WWV׉ΡX3t L39ty u hL3 =:6:6u蕜Ph"h`3 =:6t5:6h"h`3 t*t$ Wh`3 x4hw%h`3xVeu Ph$$h`3] 3HQPPj 3Q h`3 ^_SWV|$t$\$5SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$Ϝ4$w^WVt$ |$诜WY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQhF&j ht:6 t:6@^1:6:6:6:6WV|$ |t|$wL3 P3 B6>t'F B6QB6FN@>vuڋ7 B6QB6t  @:615+L3@Pơ:6PV :6^_USWV\$0t$,|$W̙5G6jVi j=83thƉ؃$1t7=3u.D$0t Nf $uQVi=:6u"W这j螵=83u11EPiWcu :6D$0u^_[]jUSWVL$,|$(306̓VԘ$'Uw1ۀ=3_=:6Mjw1ۀ=31=:6$=:6jwH1ۀ=3=:6=:6uQ=D6tTjw1ۀ=3=:6=:6t  u8V31tu :61l=D6tUW_j\$0SWh a=D6tWD$,E=D6tt$,WK_=D6tst$,WE\$,SW=D6t@UW=D6t)UWyPh#e hL3k=D6twww. :6@jw1=:6:6 jwa=:6t :61V谖VuL$,=`E6t l=r3t :6tu u^_[]PNjUSWV@|$T5d:6D$$w=*3tttn F65G6P$Ph"#Gtj P53[ KȅuhZ#53Rl$jUth5d:65h:6jm<$t&4$hha#[53|$:6\$Xl:6-d:6j wD$ l:6u=p:6tSwl:65d:6j l:6u=p:6t]<$t&4$hk#538@^_[]j5d:6USWV\$;s3=*3{ F65G6PP'h"#stj V53 vh6#u hE#3HQPP3Q 53Vl$l:6ttQu {tF1ۃjU_|Sl$SP~ tuQV{:6Ju l:6u=p:6tjsUsV言:6 l:6u=p:6ttJ=*3tA{t; F65G6PHPhI#539^_[]SWV|$:6jw1=3t :65:6^_[Ë\$1:6u/? :6ut΅tSw5:6:6t"u8:6H :6K:6jw=3tru+:6H :6:61 1@65:6+USWV1=3t5:6|$0D$Pm[thUS- =:6tiD$:6,$\$4>GG6=*3 F6PQPh2"w 3HQPP3Q=u3HQPP3Q 53juw  Sw5:6=3uZ:6t"u*:6H :69:6m"u:6H :6 :6 :65:6D$P襏 ^_[]USWV|$0t$VR@O G6jPw+ _1=:61{t'GG6$pW Wuuޡ:6[tZtT1=:6uI=3u@l$41; u{CG6Us t=:6u =3tʋ-:6-:6V譎 ^_[]USWV\$K1t@ l:6PSwƋk1OuD$}t 1{PuVy uR l:6u=p:6t~ jW|$x4$jt$jux W}<$t$nmE{t V[v1 Vh{:6 l:6u=p:6tA^_[]Åx W菎0Tf Phs#USWV$$D$1t$ E6D$$E6D$DE6D$Ht$05:6$P辌5:6EG6L$XIEtH1F\$XljtwuGG6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGG6w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=3t=:6u|$ ~ $@D$@D$ )$=*3 F65G6PDPl$41dz=u)3HQPP3Q9}j=WWƉt>u#3HQPP03QFPU 1Ո`1t$XtOË$t)3HQPP3Qv É΅u$u t(PV53 مt ȋN΅uء3HQPPS3Q 53|$ +t$4~jh 'W-| u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$# f=D6t*fsD$= t= u ft$}u$D$@f%Lu D$l:6jU[qD$,ED$D$tD$L$` =z3u f|$t$Ut$4r t@:6|$D$D$`t$dmD$,F L$l:6=p:6tYD$t;=:6ul:6=p:6t.t$` jt$hL$D$Hs*|$# toD$ t$,t:6.u D$ 1@t$,ol:6=p:6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]F6D$(F6:6N<<NjD$ d:6? D$(F6=:6:6Y1PPW 1ɅȉD$PPVB6\$pfB6D$ HB6$B61B6l:6 F6L$( :6L$LF6D$D$hP l:6u=p:6t$jVn0d:6D$ 5d:6|$t&D$1f|$tH E6E6$:6h t$8:6H :6=t$L$QPy :6l:6t$D$(F6D$DE6D$HE6D$L:6hB6B6t$pD$ d:6|$Pt jK l:6u=p:6t=:6u 1:6:6D$@z$jWd:6D$ =d:6h!t$85:6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x33t3|3@L$D$:6D$pySD$ld:6D$ 1D$T$PWt+h:6D$|$D$:6=d:6D$$ E69t;D$=\* t=7 u)F6D$(1F6D$TL$$PQt$u |$ uD$0ufD$D$4:61f|$ˆQP$:6$B6B61@<o3D$:63f`4$t$T$$L$t:6D$ d:63L33`3T|$TtD$(F6:6D$tD$p:6D$D$tFD$t D$f|$t$lQl:6=p:6t|$# t jD$u3F t3)N3|$@tht$DhWh&m $P薀^_[]h#5:6t$1=:6ȍPu =:6u"D$4thB pȅu5:6t$ t$,Pt$=h:6uS葕'h#hB6xB6t$p|$Pt jt$h)D$(F6D$DE6D$HE6D$L:6D$ d:6jP蜀0 l:6u=p:6tVJX Ph#xh:6u:6j:6t:61~WVt$tr|$w$'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF E6QjRp ^SWVQ&4t1OS jjPi t6>F1"jjP? tv^^_[USWV|$41GGG =3l$0\$S]}l:6AjUfjUPCh uAl:6=p:6t 4$1CSt$SU\$t$$w l:6u=p:6tS|^_[]h#VP:6u1PPVPjh3S tF$P{:6t.1QQVPjh3R t:6@=PATH5:6t; :6 3 3^á:6SVh$r#ZB68uj21^[1ۈ335:6thB v|65B6 E6SSQPV:6á:6ËD$ :6:6PËD$@:6 :61:6:6Vt$ |$|vXPh#1@ :69~1Ҁ8cB:6 :61^WV15:6VDB690t\WzB60PjPfH5:65:6:6@:6jw5:6JWz:6^_USWV$E6$j/W)Gt@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVsuD$ %=`uVyjWS ƅuWh%Wh# Wh#L$:6x :6V|$|D$ p膇:6:65:6uu~9} ~ :6:6^11@1USWV4h$r#c|$$W2T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#53(14^_[]UWV׉΋ :6uj'% k< :611D$ T$l$ &D$ $,$<$\$ D$#D$r?6u0uFjh`$W% %W{i|80uHx.t x0@te^_]fUSWV|$7j/VDu#$jVP uaK$$WV4x Pu 1@Ɖ$m=:6ud$$UVuGZx8t8Kx8t.Ax8 uPVSt xV{vju$P OfSƒrtt~ :67PSCPVh:7#jSWVt$|$t$VW wt yw^_[Ã|$u0jWC6tB6:6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$g,89-P3}@v,; L3t,WSQL$ *JL$ |9/u 1xAA/D$PL$Q :6E9u,;E-:6L$Et <:tEL$<:t1ED$(Qqf $+ L3AQs^_[]USWV$1C1D$ 1D$D$D$\$h#Hw5$('\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ B69AB693t$$1CjWtV@wM$|'|$t&|$ t4t=03x'@ |$uB6H B68uE6PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ:6/tPEȃw?$'|$u/|$ u&u |$tf<u t$Um묃@;6r533$@th#1@$$$$^_[]SWVt$l:6:6t5Hftfu9503| Pz1 9p}Ëu̓@;6r l:6t^_[Ã=p:6t^_[USWV$G$$'oE6EjWS PqqM䃼$$twhJ#Vht#FGPh$$l:6w>PQ^ l:6u=p:6t h~#D$Ph#/thb#hk#GPh$$Q t*3HQPP3Q*3HQPP3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!:63tFWP#ctc6|$tTl:6WCaPSnƉf@@ WPf l:6u=p:6t u1@;6^_[l:6@;6Q.  l:6u =p:66USWV$$$j/$;turfEE^E69tth#V裄t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$Ko8o8o$ u=03x $u  \u =03y& u $MƋ$1Mtfyu03YL$$j$P 1OD$V`mG:6tAPh#m{t$t-'5:6h#>{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=:6$Nu$)n8tn8t nD$}o$E$\$|$$t$t'53jS\P$h&VfEo$T$pƋ$$l:6|$ÍD$ uj$HfxT$ ufBuω7 l:6u=p:6t ׅt"G GfEG EG fEGE fEEĜ^_[]l:6T$ Éuj$fxE$ufBj l:6tbiV\C+L3P%jV$ij$t3fxu*SVm$=p:6V$h#SWVP#'1t8|$#'L$8u%tWP]L$ t us^_[SWVP$'1t3|$$'L$8uWPx]L$ t us^_[V$'t%$'jPf@NHu^V:6 03trft fuxB =@;6r^USWVP\$=E61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡03y x5031Ʌx $y $Q503^_[]SWVl:6:6>t+fuwW( ߉?u׃@;6r l:6t^_[Ã=p:6t^_[WV|$D$ l:6jP+@ft*fu vfFGF GF GF l:6t^_Ã=p:6t^_WV t$D$L$ l:6fO 3fOPtGWVU l:6t ^_Ã=p:6t ^_jt$itfxupE%1USWV t$811G$1D$h#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPB6:KBB6*#$1\$ D$4$߅u U='t,]''8uUPYujUNƃ<$t0vh#4$B6H B6(t|h:#-j v3tuhH#vh#B684$t3HQPPJ3Q l4$t%Uh#SPhX#+h%#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$'D$j/U1jUЄ~Qf0> Ph>#:uhh#Yuhz#Bu h#7t.Uh#3+E6 t$|$tJHh#_t$B6H B6(ouh~$돡E6D$ FjUD$PK PcN<$u$r#|$te#Ph^#~Sh#pt$ct$1 ^_[]h##ct$r#RVh#Vh#1PPt$  5L3@PubUSWV|$D$\$=3tD;6H H;6 L3 L;6 P3 B61ɉ P;6 `;6H G6SpB6tH B6~L;6L;6dH L;6L;6+L3Pah;6d;6u%Vjap h;6h;6sd;6UVWh;6-h;65d;6x=tEd;60va5h;6΅u!cL;6B62V'h;6d;6t Oh;6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ tE6t D$3 E6D$L;6+L3D$?~uЃtRWT$4$ D$1@D$ wy< B6H B6fL;6e$!PVVST$0/>u!y@u=D$ D$D;6$B6H B6RL;6Q=D;6unL;6+ L3;L$~[xuUHL;6QB6H B6L;6B6H B6L;6$ |$D$5ЉD$$ B6H B6L;6`T$,H L;6>~=u|$ D$ RV"T$4| uG6B6H B6~#L;6%J`T$,H L;6 X.`T$,H L;6$9Ut$ *T$4L;6+L3jPHPuT$8 _T$,H L;6>B6H B6~L;6 _T$,H L;68 G6w_T$,H L;6G6V_T$,H L;6$^4_T$,H L;6D$$ 4|$tu^_[]USWVt$,\$(=`;6tE6t$D$ 3&j[XNFE6D$ P;61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=h;6l:6l;6u(Q2L9P7Yl;6NQP5l;6 l;6 l:6u=p:6tPh;69t31Ʌt AuQP!u=h;67vA h;66^_Vt$t"h;60v5h;6΅u^V5P;6t1l:66P 5P;6 l:6uۃ=p:6t莻1`;6P;6^USWVt$(PnYL;6+L3PmXL3Gtr}t  KvC#:t /tQ t7=3tAL$,u8 B6QB6ZO@랃tPY^_[]Ã=B6u ZB6L38t!PR tx PXu$hK#ljPXGËD$,tÊJ!'$< t< s4< w*B6H B6~L;6ZH L;6B6H B6~L;6YH L;6Gw/u}/uEI P7 USWV,D$DD$L$@9A|$$D$t1N#'‰T$D$D%D$ j=L$Q7$D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ 0F6T$)11GL;6+L3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ uD;6L;6+L3=3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =B6t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$B6H B6~ L;6ՍQL;6VL;6MPL;6EK1ۋl$$]|$ D$EÊJ!'$< u.B6H B6~L;6 tVT$H L;6B6H B6~L;6 FVT$H L;6]EuKl$ u% L;6L3)L;6 B6\$\$L$ D$E< w.B6H B6~L;6 UT$H L;6B6H B6~L;6 UT$H L;6]Eu1L$ }D$n $Ip$'|$tB6H B6~TL;6R1G>L$u0L$ QV1>t5L;6UL;6ۋ\$uhT\$H L;6=L;6+=L3t$ t$(St$ WV-uL;6=L3L;6)=B6Sg1GL;6+L3t$PS <$t[1@Ftuրut܋ H;6 H;6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#dO)Ѓ5G6h #F׊t!#u(HL$IQWP5G6h%#D$ƃHQWP5G6hH#USWV5L;6+L3D$l:6P;6D$ T;6D$$X;6D$(\;6D$,=`;6H;6l$0U+Q+L3P-PD$ P$jU3QD$,\;6D$(X;6D$ L$$ T;6P;6=`;6H;6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 l:6u=p:6tfhWt$ yQ8tl:6HD$EEt< uD$C낉$L$}1A9B6} RL$ƅ~N$ B6 FK1:B6H B6Q FK1Ƀ=B6 Q1ɉƋ$|$tJ!'$< t$< s< w B6F$ B6Fl:6D$ x P6D$t P D$tP5=:6$u+L3jPt$$ 5L;6 l:6u=p:6t^_[]USWV D$4L$@-L;65L3l$)hP?D$B6H B6~L;6qPH L;6=L3UEWD$ P[NL;6+L3PZM5G6W蝛ljӍD$ P]NL3 L;6L;6) B6 B6 PL;6SWh"jPL;6xt$GF9Iu|$"tjVU0 L;6A L;6B6)B6D$ ^_[]SWVt$|$\$`;6t#9Xu 9p ux2jK `;6P;6`;6`;6Xxp ^_[WV=`;6t$ 95X;6~?=P;6l:6?P= =P;6 l:6u׃=p:6tѮP;6`;6t?9p|l:68P `;68 l:6u=p:6t芮 `;6u9q~)q$95T;6~ `;6`;6P;65X;6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`B6H B6~L;6TBH L;6E63:65L;61L;6^_[ÃЃ w}Aj PV bA8ű$<=tuw~;5B6B6bE6D$5B6ØD$D$‰؃AD$$Z|$ T$L$T$|$,J!'$< u*B6H B6~L;6AH L;6B6H B6~$H $ L;6QL;6 @L;6 $Q$ PL;6$eØt2L;6 $Q$ PL;6$eØt2H L;6B6H B6~$H $ L;6QL;6 .>L;6 $Q$ PL;6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GB6PB6~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rl;69tH9u %8/t F%Q聺D$;5l;6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWV1I5l;6=p:6tt$tWE/Q l;6߀xruX@8tB@9tD$P5l;6x5l;6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W+*@P7WPeHj7p h;6h;6^_USWV\$D$|nOʼnmIWP)|$SUÉps]+x 7u߅u҉3D$^_[]SWVt$(\$$W7C H;6L3L;6P3B6`;6js2B6H B6~L;6h9H L;6L;6+L3Px6jVP W7^_[USWVt$FPh&r#ĩ3HQPPu3|$Q1ۃ|11E4l(E9uSh#j3HQPP3Q|=1C4膤3HQPPޤ3QC9u1^_[]Ðhm#辘hm#贘;6H ;6~;6H ;6#=~u;6H ;6USWVP83H ;6t+u y;6H ;6~xhL3蛤h`3莤 ;6183~PX;6hSp {e68t_83xL68#>WjW蠣 !Pjj  h"#683p;683@1ҋ;6  ;6@@P t 1+;6;683{tXAˋ-;6M ;6~ @لt;6أ;6=3t$5;6D$p53D$;6H ;60~^_[]ø;6;61;6;6h#,USWV=83w l:6^t)kU!%~D(< t< u 83Hc F;6F;6F ;6G $9t V  l:6t^_[]Ã=p:6t^_[]-V ;61~^Ë83r t ~6u1@1z;6 ;6SWV\$t$|$l:6 83y tja1 83I  83A$A ;6H ;6H ;6H XtK =;65;6 l:6t^_[Ã=p:6t^_[RWV$l:6jW=ƍD$PVuT#D$ =uD1PPPV u2jPV豟 u <$ELF1PPPV uZV9t:$Ph l:6u=p:6t菓Ā^_Wh#V]h#ؓVJWh#ēV6Wh#谓Vt$l:6hn VjjV襟 |$ t83H~Q83pxuh/ 83A1;6;643 l:6t^Ã=p:6t^馒83tL$T$9PuHuá;6 83A ;6A;6A43Aj8. 83@1ɉH H$H83WVt$|$ l:6|$t=;6W!;6;6543 l:6t^_Ã=p:6t^_V583l:6Fx PϊFtP ~ u83V 83H ;6H ;6H ;6@43 l:6t^Ã=p:6t^U83Vt$ 839tp;6tPu^h #莑=83p;6t-Ã|$t=83p;6ux;6~P83@fWV|$ 9=?6=@6@3t P袉jh%#蒜@3MPȈ@3hr P=5@3*?6B胟9t jjv1Vj莕Vj胕VjxK |@69tQj1|@6P5@3L+/0 h ?69tQj?6P5@35@3m@31Vj躔Vj诔Vj褔=?6@1V tV@3Fuh?#J3^_L.0 hPh#:-.0 h.0 hPhm#@3;D$u D$@3h$r#DB6SWV=?6jQEƋPh$$Ǟ|-1GPhK$蠞G;|ۡ3HQPPB3Q O5@3+tJl:6V[V l:6u=p:6t{^_[h#ۍh#э,0 hPh#貍Vt$ h$r#C^USWVh$r#vC=?6B61FjPlj+?6i5rO@QPh#Q |,PhK$+E;|ۡ3HQPP͘3Q ڛWB68tH B6@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 ?6M5?6At#~i9:0#I {?6#4$D$D$=?6C1tQ~H$8?uEt$P>uUt$6t #tl#K\$ueZ*t%tS-tU+E#D3x+;?6}#5?6it #\$1|$ t5^_[]áD3t ?6i #뚽 #SU~USWV?6)i5rO=D39u=D3)?6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D3^_[]SWVt$l:6~X1tttG9uމjQ!u4(19}q~5@tu ƆH l:6t^_[Ã=p:6t^_[^+5?6i5rO@Ph#賈+5?6i5rO@Ph3#蘈PV Ph#脈WV11FhU#_>kt!Zu忀ރlt puԉпɁuB6tg8tbPh$$bm=3u =3u@B6tA53jPvW:B6H B6@ujbW53 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh3&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] ?6)i5rOC-D3+9tti-;)t RPh#jl$ Ue\$D$P#$t+,D$0h#jS0S\$ŋCt:tBuM ,%Ph#jQD,ingD,Runn}=tQL l$ ,j SP0 D$xxl$ ?SUl$ ō,@)QPh#w0 hi%jQR ݍ,PWD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁PhK$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =3$tCt>5@3ʙ9t%5@3PVJ$=?6~y\$t$1=?6tEt*t t.<$u u/S0=?6u WE;-?6| $^_[]!0] hjPh#膂USWVD$4\$,tl$0|$WUS ƃuC!8=`E6tl:6?6?6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o?6D$ ?6$iD$ 9T$tcu tQ=@6t 1=3uL$,uP9tPtu 3P l:6u=p:6t^_[]Vt$l:69tP džƆ1z l:6t^Ã=p:6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hY#5t$ntpuB6D$D$D$t B68D$t(1PPSȑ EjS==?6u|$1?6-B6~6@ ?6D$u}t!AH Et{1jPƅt9u ED$u :u G EuB6t Dt111D$uD$?6L$L$t$D$\$l$|$ ?6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$?6C$jU9 L$tc|$tNuJD$1rȋi4h&r#jD$(PR2l$D$D$L$D$u U D$\$l$t0~Ot)D$?6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =3u V 4Ń퀉0^_[]h]#{Shz#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( B6t yjPƅt,1t?6)i5rO@Ph#H$t#tH~1i0 tPh3&轊11G^_[]Ã~1i4hv#腊3HQP~G ;| Z %PG ;| 3Z;|lh#yh#yV1=?6ujt$ St1+^V1=?6t. ?6~$A?61F:uI}^V=3tO=@6tFD$t+ ?6i5rOA1ɋ3u0VQh)#R^USWV=?6u65?6~%=?6Ft WN?6l$?6~"5?6HI}l:6tfiPƋ-?6=?6iPUV ~ ;uKuU* l$hnƋ=?65?6i 1҉AJw)׉=?6 l:6u=p:6tmwl:6fdž=31?61B|iP l:6u=p:6tv^_[]SWV\$|$!ƅtt.VSt$W\$<$D$ #^_[0 Ph3#vUSWV|$ @6tWdW~*15@6d:6D@6V>V}5?6l$t$t%t =3ttttk0hWj~Wj~t uu`mul1V谂Vhf%tOhf%h#vGVj}uV5@3tTWjzWjzt*=3t!WjzWjzWjzu?6^_[]0N hPh#wuUSWVt$ l$|$1ۃ=@6t/t*=3t!ttSVu5<3tEL$ji4DDt QP ^_[]WVD$t$ N ?6=3u=32t=?6jP=?6~?6>f@..@.^_WVt$ 4l:6NJujVj 瀾tW5@3.<u%+?6i5rO9D3t mjVt=tu  ρπtt=ttu ju VK l:6u=p:6tr^_V0 hPh#DsSVD$L$ =3t1ۅ SPj\ ^[Ët$1҅tހu1=?6u2?6u) ?6~?6:tzt IuhD#~?61@SWVt$$1@=?6|$(1@D$r #$\'Wh#bjvu h4V#h?%tjjvjv 1~ hF#21@^tjs%;thi#h˵$jvh%1Wvh\#1Wvha#Wvhm#jvu h4V#xhZ#kjvm~ t+u h4V#Ghq#:jv <u h4V#hx#|#Rjvu h4V#h#7h2"v h;r#jvh#jvu h4V#hh%;h#kFp]h;r#P~tF1SwJhO#.Sw 1> #t#P uh#h`$vh#v#'1D#1###1#N9tQh&r#jWWSxuF x%Ph&r#jVRVjv S h#51^_[hf#hf#jvUSWV fD$ ?6 ?6l$ 1D$U$u1!" $']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻&!$}D$##} u#$%)4$<$zT$tvӃux<'t ur>u<'_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<':'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I ?6?6 ^_[]WVt$ tG|$t jV~t'h?%h?%jVvu^_USWV$t ?6 =?6D$P E6t E6E6 $=?6z1jh'St `P>;Hx@u8/UD$PV臅x D$pL$t 1D$tD$p1ɋ?69?6:6tH1 8t:tGt89=P3Z 9=P3~:65L3WPVD >?#<=B6l V: fiDle cDhangD ged߉V~v3HQPPvv3Q D$pL$t ?6?6E;-?61-?6D$PĔ^_[]fUSWV<1Uj7D$hhh UPjht  9u '9È8@6j Uu <@6j@@6h$r#U) h,#蘾3,$UhD@6^:t$T|$Pd:6D@6||@6@6@fD$PVWVW~=8@6 Àu {=3n$h<#h:6ttQu :6 :6<$B=35=@6(ȃu6衫|@6@6B6$h:6u7=h:6u73HQPPt3Q h`3tD$Pl:6=p:6tcg$$=8@6u>hK#J't1PhI#QPP[V$=3u3 8@6t N=8@6uEt$(VhS#t8t$PTPV$G6=3t =B6tjH'kuD$PB6u/jM=3tFh2#|rh`3s*1ɀ=3ˆQPj=3u=B6t43G65:6+p$$#uSWVD$8t^l:6jPqƅx jVO l:6u=p:6tvex"1=3t=*3t*31G ^_[11=3t 31j蜉V3V芉=3tt*3u3^_[USWV|$(V11C=`E6tn1=3u4t0j53ujh`3q3P=83t.te=3u\1Ƀ=?6 ?6jPPi1;tW1R=3uIu=3t7=3t.hW#hpEVuu$u蔆V#^_[]Vt$l:6jVox1jP l:6u=p:6tcj^Vh#ct1Ã|$|D$pPmmft$ tht#ct$t$ tht#cWV|$ W@P֯ tWP^_ht#ZcSWV|$P39~b9l:6؃P| tr H3 L3P3H3 l:6u=p:6t wbP3l:65L3>L3)P3 l:6u=p:6t?b^_[ht#bD$t L3) P3L3j h#jl D$ H3 L3H P3H B6H B6HB6ËD$l:6H B6P l:6u =p:6aVt$l:6H3;t H3P FL3FP3F B6 l:6t^Ã=p:6t^=aUSWVP3<kl:6-L35H3@6t|F9uuH3PV謸  H3H3+ P3 B6L3=P3B6tG90uC H3 L3H+HH x@WSUPI 5L3=P3 l:6t^_[]Ã=p:6t^_[]S`ht#`D$l:6L3)P3 l:6u =p:6`V5P3P3B65L3^V5P3+5B6P3)B65L3^ËD$ L3) P3 P3L3+D$ȣB6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]hB6B6=B65B6B6^_[]SWVP\$t$t2uhxe%V1C$"h#^Zw%(,3u*23b#03RQPh#^#uȡ3HQPPtZ3Q (,3t"23RV#t~"QPh#h^ u.$(,3tPVtub#VPh#M<$u#13t(813uƁ23u숟23h#1 [3t$Y3t(813uƆ23u Z3@uă^_[V(D$ T$039tub#RPh#Lt#13t(813uƆ23u숁23^WVt$ ~t)~tPZ uvF ^_USWV jA B6t_y 8-uUD$$B61B6P  B6y8-@P1F PơB6)l:6B6=B6~-B6Ft7聨 B61N࡜B61ɋuB6 l:6=p:6J1F5B6P)ƅB699Sl:6 B6B6lj4$މt$\$)1*C/5B69rL$ 9v!\$ۋ4$ P; B6w4$ 9vQ9wB6 l:6u=p:6tIW1 ^_[]h#2Jh#(Jh#Jh#JSWVT$ B6tstm8u'1z:trrD8uAÀ~:u"9u B6QB6 tf B61ɉ B6D5B6>1t6?-u1t+O^B6-uta5B61^_[Phi#:IPh|#/I|$u1PjPPgel:6jwB68t PI l:6u=p:6tjH1ËD$Ѓ w#j jPf uB6B6ËL$~ND$tH  B6=B6u B6B6B6hB6hB6Qpph #CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$r#h0#Y J|$:uUD$8@?jPh0#Y ^jUh0#Y 1|$D$0)@<Ph7#h`3V jh0#f1?\$D$01@11T$4*l$Ph&r#j UVhUhb#Y D$EEjUt$0X u0^_[]À|$:uD$8@:PhK#K1L$0L$4@UjEfVD$ 831qqA1Ʌ ?60PQ83p ]t u 1%8383@j* 83 u^qqhX#EPD$?6/$aQXUSWV'ơ83@tu'tƃ 83 x,$@D$t.$xm$18uWPtG'uD$tKjD$p4*t6NjpVWPVl E$ht83@^_[]USWV83@|$u 83A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq83@@|$Fu6|$uD83@ 83Ap8 u|$u83@^_[]jjX 83ASWVƻt u j pxʡ83@^_[USWV83kE1͋ 83x t*?6,PqN83@ C1Ƀ8Qs s j@83HOH O oKy K9t?U1CSpt ^ShH 'P= 83HO@ G 蝯83!^_[]WV@t$P 83A uyW wWhZ#4h'h#j"Q Whr#j"PQWuL$Lx4h'h#Vh#jPQWUSWV83@1u 1=3tMtݡ83@xuUj @jtÉGpj`aC+t83@tj,(pƉ^_[]h#83t$p0h#O@USWV83@$ u83@$EŃCߡ83@$'$ 83APUj já831Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt83xJjG B u083x,u%@N#'t@/@N#'uh#jÀ=3tjjj 83H0+H8O U 83p0j^@ 83QPI H pGu583~ h8%v:m|$F83xujD$ 83Hu 83H L$ qx0j@83HKH K {@;u.83x }83x|$ T@0GjG 83@t(HS u 83@83x\$\$j 83HK @0Cku83x ux,uh8%pjP@<31ɉH H 83Q0PCAHrAAtejC9t jW\G @:83@ u83@$EŃ!ߡ83@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$83X0j2x@ 83QPI H X t\$|$D$C 83APsVL 83jj 5jj,jj#jj jjh8%jjjjWV83x$G Hs83jpW$ uq83p(x,u~ 83At8 u @A8 @tHA~րxru\tuՀh#83p0+p8j@ 83QPI H pG .Pt83@F 83t1^_jjVt$&9u^jVVL$1N#'tA1B1t AN#'u^uVt$j@ 83QPI H p^USWV |$$tD$ D$$D$l$E1$83xc 83x0$t $j\ƃF 83QVI N ~ut. 83IN#'tAt=t AN#'u1c83H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc43 83A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(83 $+H8N~L$NL$$N @0FEPrj/v襠uG43 83+A8FF83@4 ^_[]jjjjh#L$1N#'tAt=t AN#'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;@@6}X;<@6~P<@6I;-u{tBuG83x0+x8j@ 83QPI H xF^_[F h#lUSWV|$43D$=u ?vl$$5L3P3B6G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4383HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNB6H B63\F u%B6H B6  F43#áB6H B6ƈF t詚=v43菚=t h' u4383HH B6H B6r=L3)FV,83x43+D$^_[]USWV$$1҉T$ T$$D$(54383r0=H 't1$|$ fw|$1/fFn D$j8fNL3 P3 B6=L"'u ƒ=B6‹nD>  $p'=F'u f|>z B643Bס83=F'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=J!'fu B6Bn׍MN|$=@01fD T.fTT.fTT.fTDJ!'fD1AL$!(ljƒ(M B6FD B6BvNO|$s@81ɃfD T7fTDL"'DfDfD> 0 = B6\G_T$ t$>Hff B6T$ Bf|>D>u6t$3 nMn B6}f|>  B6BFfL D$$D$f|>tD>t B6Bf|>u D>v B6BW B6B*Ã{t N#' B6}E+=L3 B6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $ nMnD.=F'u B6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDH 'fD B6T$ B1AL$ I) NjFfL B6B) 4383@8xt ?6 ?6$8W Nf|F\=`4" $"}f|  B6T$ BFu6$( Ft$HFuЖD$$D$ Poſ1۹$'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDH 'fDu6t $ FHF B6B赕= t]H\t 'u 4 t =u 43831Ƀxɉ ?6$6 B6T$ 'uF|F' B6F$ J!'$< u B6T$ BT$ B6 cʔ,t$@  4383xD?6?N#'L$ l}3DAD$D$E|$}~J!'f|t B6 B6B\J!' u B6BNf|t B6B1@D$ B6 B6B݉ý {"XŃ', D$0$躅 nt$T$ Mn B6B1@D$t$C?6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M B6vNO|$@81BfD T7fTT7fTT7fTDJ!'fDőL$ uk%=I =B6 D$ wF B6P?ˀ B6@ww B6 x?ɀtw B6@ B6W?ˀul B6GXT$ W B6x ?ʀtw B6E B6O?ʀ B6Gw7 B6x?ʀtw B6E B6O ?ʀtw B6G B6A?ʀtw B6A B6H?ˀa*B6B6D$D$$B6B1zN#'t.B6H B6LjGq N#'u\KЃ w4B6H B6LjG; ÃЃ D$ u t B6׃Z B6H B6]=Gt/ up}tkB6J B6/#@ǽh#tE%t@Ń:bD$D$$;'¸U1#,W9uڍ1|$Nf|uf|t Ms@ L39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|F'fq fq ƋT$ ;6H ;6~;6H ;6 ډËFD\$D$$;'貔Q1;')G B6x?ʀtw B6E B6O?ʀtw B6G B6A ?ʀtw B6A B6H?ʀtw B6@ B6A?ˀa2 B6AD$ ??B6H B6~2G:B6H B6~$_1c:B ˆB1=F'nD=L"'G=F'tf|cf|.3B6H B6莿5L3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B83L$H,L$H $վ83pM tΉ$I| Nu83xĨ^_[]1HE;@@6} ;<@6~<@6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }83h$ Ή${ Nu=tuS$#$&#43 83A0$N#u$3#b$|#V$a#J$2#>$I#2V 83xt@@ ^Ãx t#?6$@)83@ @8 43H0;6H ;6~;6H ;60諄ƃ~0:=F $ '> t=u럃F~t\u^ 43@43 83A0yt?6 K?6$S(*;|u0d|83@=t*ʆ4$D$D$F'Kuۡ83@1v u4383HH @1@Q&83@-83@83@&tQ;ub83@ 83@؅83@83@ 觅83@u:\u?0 u64383@81Ƀxɉ ?6P&Bjjh^"A ځVȋ 83y8~0 B6QB6@ 83Q8rq8^USWV\ӉΡ83@D$ 1,$d:6D$^+L3D$$UPl:6$~S"ʼn$S5L3P1 l$|$tD$$d:6 l:6u=p:6t?w43D$-L3P3B683x t*?6PL%83@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4383HH s`un=ub\tX`tS43 83QQ NDt""u$B6H B6~E\E \@ŋ B6AB6@B6H B6ٷEL3@|$t~Pt$jP荅 D$pŋȅut$ j轴E83xtH@1D$43D$jNǡ43D$Kt5 83At$ D$AExK83@t$ Ex P39ًl$踵 P39~=L3B6t1SUW蚉 )B6l:6Ut $ l:6t\$=p:6\$t 83T$ Qd:6Nf|u%Du B6QB66@Vt$+t$ B6QB6@~.FB6BB6ȅAJ։ȃՃ\^_[]á83L$H0h#W~<$t 4$ s /83@D$d:6jPMjj#jjVtQr N^V 83$r#ytA5?6t7t u(E6HF6543P5?6#^USWVt$,|$0l$U5P31BW;L3u(VQGB69w&B6WVSt Uڲ^_[]Áw: t9v$P5B6 l tãB6$B6랾#뤾#USWVT$L$ -d:6҂Ɗ*3:6D$1|$083D$|$ljW\tJD$83*3V艂-d:6D$:6h:6$r#jU[\$t$l$=d:61F5:6D$083$V\$S7 !{VhH 'P 83A |$t|$t=3u #@݅u:T$1rIJ$JB *3VVRM -L3=83D$*3t$臁D$d:6D$:6؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV C61t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu B6tu(Mxju PQ.Ex PU4o uF^_[]USWVl$ t$\$|$t|h@VSTe VSheDžt9u 9t Sq9u95D3}5D3^_[]Åy̰0葈 PVSh0#W/WVShJ#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ C6$C6M|$];@@6};<@6~<@6Eu9] uC6tX9X5C6t-pt 9^t6SLF9t S C61tF9Yt? C6tHt 9Y jjSu PkD$($@t 9XjS/1xl:6C6  bC6 <@69|AQjS ǃt;=D3~=D3x jjW jݫ$JBXxp l:6|$u=p:6tuB6t$(WUN mCC1O ntuK5C6jS8 DžD8t 8ujjS  Džۭ0蠅 PShx#\$t 3t3|$t 3t3^_[]j _ PShu#0 C61tT$9Qt uÉVt$5C6j Vi u C6|Qj VK u8FPj V7 u$j j V% ujj V t;D3~D3^h# WV|$ t;G;C6|.GPSƋG9tVPWww^_WV H3 A H31F |71FPWW y w;D3~D3Pgfff  C6^_USWV$$$~l:6 8k$D'n  C6t9i V C6tQt 9j b Y<(O8=3tNnjUƍD$PV聇#D$ =nhh]n$SUxoƅtjV!SjV $/nhh nhh U% ƅV;5D3~5D3|'u" 39uu-jjWc 9t1jPWV l:6uQ=p:6tH A1jPWUy v 0謁 PWVPWR l:6t Ā^_[]Ã=p:6tĀ^_[]< hh j Z PWUh# y0> PWh#k 1F5:6PV0 PUh3#A 48V$8:6j0 PUh# USWVP]xa|$\$;D3~D3oU= VUS 1jSSQ t!t$$^_[]h# 4$1EUj蔥Uj艥UUUjtSj iVwt$ g SЦVD$5C6l:6PV]C6Ve  l:6t^Ã=p:6t^t1=B6SWV5C6t4|$t^tCx P&jV6u^_[SWV|$ D39|ȋt$|9}9| D39tVjjVW 9u^_[3WS~ PVhf#WVC6 |;@@6| pC6t$ Pj V y2ܦ8t Ҧ8u>C6 jjV ;D3~=D39t V^_Vj 迣tL$ T$5C60C6PH^áC6tT$C69Pt uPd USWV$|$<\$81D$ $D$1F5<5o3h#WSL !1tbh$WRh#W<uo1<C6tEl:64C6\ C6t jV l:6u=p:6tF@uD6>hm$W贏thv}"W袏t D$1p@|MD$K}h= &Wjt8D$D$h# j531CKD$D$u}h&# v11 t=t8<C6u.u h#v VaPhw%  GF@uh2#A F@uu=D6tk1uu莩ND$E11P@É|$t<C6tW4C6h#Ah#<C6t4C6 h#{SfPh# Eluh#53 Cu|$tE1F-l:6D$t P1<C6D$t4C66Y D$C6t jS< l:6u=p:6tEt h2#11<C6t:C68u.u h#aVLPhw%   GF@uh2#/F@ut h2#1<C6t?C68t3h#4C6VPh#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=D6t61B=@6tbu^1Ƀ~7t@tuH1=34 C6t1Ҁ9ƒ (u1=3B1ɉσu1BD61t)9t`tbփub1^։PjS% $u=3d1@ָv PSt^uD6u jS1D$ D$D$$K?r 苘 1@ jPj ^_[À=3u=B6u =3=31@Vl:6C6>t8t6U D6rD6 l:6t^Ã=p:6t^eSWVt$u D61ۃÿC6t6C68t+l:6SP l:6u=p:6tC6=D6ru^_[,^_[V1=D6u#C61A:t2>u D6r^WV|$ 0D6u"t$=l:6tg=\D6u^p:6WuS = C6tӃ<C6t>C68t2t-`D6`E6=3tu=l:6u"腖0^_WV|$t$ D6uWVjD6<rjV~uƆD6^_áhC6=D6t1Åt8uUSWV\D61G`E6<`D6u@@uu`D6=D6u΋4C6tãdE6S-:6V.jPaVS t<$tS-:6m \D6^_[]ù@rA<\D6tøWVt$ 95hE6t)1Wj;Wj0Wj%5hE6^_ËD$lE6pE6USWVhD$=lE6upE6)=\D6tdE6t D$D$:6pE6:6=`E6tt$,jVu 5d:6et$,jVzu45d:6=D6u%=C6t?t,1C6PWl:6jV1u5d:6Bjc|$wfs 5pE6角1ۍD$X XXPjESW\$\$ \$\$O?r 贓1@ DD$jPj 7VP_uf53t$WVt$|$ ?t*FHN V>Qu953u V^_53t$WVt$ NfutE6FNtF t0fu^~l:6 ?NQPF N)Nl:6vՏF FF l:6u=p:6t V N^_Vt$F t-)t'VfxQPR yNFN F^53t$USWVP|$t$j'Vq]t~th#V<<k>t!h'Vl1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Qj'Vs[t)19<>^_hL3oh`3bUSWVD$~@|$l$1SWU t 蔏8tF r)~1H^_[]ËD$)D$l:6X3tP3M 1X3P3 l:6u =p:6PD$L$ T$$RQP XVPt$t$V tt$ P4$L ^h#PD$L$ $QP53 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+G6+E6Pqq hP#jhF6 F6SWVPE6t'C PVw u,$$w1CGσCGCuhLF6Vhq#8 u*$ @F6@F6DF6HF6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv t61^_[]ËD$t8SV 趠ƋDF6`uHF6$J DF6|#tu#$#t%d0HF6㟉DF6t$D$$J# ^[WV<5d:61$|$PWMt $D$PL$LT$H=d:6PQR 5d:6$<^_USWVL$T$tHtA|$9t91N#'Írjt/9t+1N#'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U{V藈Ƌ $A$~ C@ $Q$f=t @UP葙WVp ^_[]SVh#WV<5d:6:6$|$jWu"D$LL$H=d:6:6PQ5d:6$:6<^_USWVD$ èu|$=Z3uÍD$PQW Ƌ@l:6Nt$݁ uF @SPуF`u vG F~tuF1Ɏ! s%t É^~E6tE6uE6t j~ l:6uk=p:6tb[r2j賆XxL$H @ $  $#`uW&G `u WG fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=B6u0@=B6tc@=:6tf@=3ti@=3tl@=8@6tp@=3ts@jPh#,WVt$|$ l:6twхVP? l:6t^_Ã=p:6t^_WVt$ t|$Wv 6u^_USWVP\$l:6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SRS迄UPu< ؉G@543S543hT3PaZ ~ F1gjt$,F6uQG L$<=u5E6HE62UjS $81F FFE6,F6~F65F6 l:6u=p:6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ :6t8Q12<08uF=u =ut j=RDQF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVTF61tr:1҃ЉuF6r׍P辂ƻTF6Nj+t7Mȃu%EttUЃuEmŃF6r^_[]SWVTF6>tLGu% uwmB Gu#W]B @tw݁Gg;uF6r^_[2SWV|$tfh#W/W?t9uWh$$V't*tUj'WoOt8)WPh# h# Gh#Wh%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhlY$tUhlY$>=uD3HQP~ j( P 3j)n~=uGutha\#EU3HQPP3Q ^_[]USWVPF6uF6 hF6T$ t$\$TF61<$?tIOt !T$ ttуt݋ F69|QPT$(F6%F6)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPWI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$蟍 t$N19{USWVӉϋuG6fx@$p'$PWo1ۅD$PVWr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW)1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVWi1ۅTVWui1ۅfVWeiVWQi1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]6sQ9-u1tQyt8ytBÄth#QYh't1ha* jjh'Qha* jjh'ht* jj h\'RÆËD$L$  )VL$D$ 2)u AJ)^USWVPuj PV莚 lju8t"uځ8"u 11E9s:$9t( l}3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉9t 9Fup  ^^I9uM1PPI~ōP@rPUI~ LH;NuS2 #~^_[]ÐUSWVt$(h$r#j]I D$,^H $x?-Ok-u)sstdluu~xwGWwÅu"l}3DHt'1Ʌ S覮كh#Ehl}3DH\ƃ~ƀtV)tV{Vh#jQރ $hw&S4e1Ʌt:Suu+$891V53V|-$K$8ʉT$h= &Wd1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWtu.&|" $4Ph% 1@D$l$t jW(;rj D$PUT ljӋD$9t-ف8ur1u q8tQ#x$r#UPh[#3 1@D$\$ $4h6#1@D$F \$ t$Ph#j:6PPPPh#532jWVPΉj WQS 9u=у|=}^_VhE#jQhr#dj53j`WV@h;6;6;65=>t)j=W#<thW>uPh&r#j@VpjVhj# Vh3h~" 2$VWhb# #t%VQhJ# j,ho#hw#q VWh#bL^_=h:6t 1;6;6T?83B61B6B6B69C6tj=C6u3L33`33tPf- 3Vjz15:6 ><35?695T3t\3@8@u jRl:6jD\D6uƀ\D6@u l:6u=p:6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$@&'$`%'Vw vVw d_ t"Vst Vw?w^N@F1Vw q#w ]N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u@&'E$%'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t) Ã|$~) USWVPu }G6 G63f`|j%v6m O1@ 0$G6D$,(G6|$@t$(q%v>%L$ h#V蝳<*u C hu#S|1N .u{*u{ 1HD$Chu#SH1HD$  t$CD$'C`L$&~QF0 $&'. D$׋L$ jj D$tfL$tjWt$QPh@G6TFu$x&'$G6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph@G6i$G6L$ Q0|$$G6H $G6T$ l$= G6uM|$L$ jL D$tbL$l$tf|$ L$D$$@G6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$@G6L$\$L$$X8G$G60$G6E ƋL$ cjl |$D$VPt$w$G6$G6$G6$G61  $G6 $G6Wt$*|$$@G6 \$$G6T$ j54G6F54G6{ l}31:DYt 7GuF54G6\$DF54G6ȋ\$+1L$ jlD$t1L$t5WQgG6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h@G6 PRQt$QP  G6FP 0G6 VjxP` 7s0G6T$t t$L$ t PVRQh,G6>MT$L$ t1PRQh,G6.VWh@G61PQ*t$P PQh,G6 t,G68G6T$z \trB<]*<0tu$<'' ?$''."'#Eu uSh-#G6 4$l}3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#G6\),ҋ4$u|$ uWh#G6 ^_[]WVP$G60tp$G6)_1ɉQPVk Nj l}3#DQt$c#r& $G6+ (G6VQP4 G61^_SVˡ8G6H 8G6 u:3Prp~r0 P{3Q 밅u8G6)3HQPPD3Q^[SWVP$G60t"$G6<'t<"u1B^_[11f]1ɉQPV@ lj+t:<-t6 l}3DAu)$G6+(G6VPhZ# G6 $ڃ^_[SWVӉQMǃArVhK#G6GPVh@G6S D$=G6>G6Ƈ?G6^_[USWVP׉1PPP蒢 ,>U&M@PUQv x$tG9tC$G6+(G6VPhn#.$G6+(G6VPhc#п G6$^_[]WV9t"΀:t9$G6+(G69t\VPhn#Z$G6+(G6Ph#賿DH\8"uD=$G6+=(G6j"3 PVWhK#~RPh(#m G6^_USWV\$$8l$}hE j jh''Ublƅu!hE j jh('UElƅH h]#D$w؃tD#D$uK#؃L$u R#D$uZ#@D$ub#a D$uk#B D$u t#"D$u#D$u#D$u#D$u#D$u# D$u #i]=G6tj fG6G6# D$u# w %u#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u #D$u#]=G6tj ;eG6؃G6#wu ##jw؃u*#LD$u1#-w؃u8#D$u@#G#u=G6tj tdG6G6O#w %u V# ,' ]#u D$u e#Uw %@um#4fD$ut# D$u |#D$u#D$u#D$u#G6tj cG6G6#''tX''|$FTPSh#jdWWb,^ u΃=G6tj bG6G6tj bG6G6''1'' tN$L :Ntl P#PSQal$D$y1Eo39zD$1 o3l$|$HL$Oȍ$WQ$y h u&jt$VhBt @vp* y h#D$tPhht@pJ* y h#D$4Pht@p$* y h#Ert&u+;?UVt$<$PW W19D$@D$<\$SUYu{SU[umSUu_l}3 $1DHu$jh#VA8 VWV4PWVW^D$<$H $xd|$<tWjt$ y h04&s|$@t'D$tPhgtt$( y h#QjU5$<h$$.1D$@D$#uFj PVc A8u$8u؃^_[Vh$$jWVh]#jUSWVA fm6G6 m6ƒ m6G6k m6€ш m6G6( m6G6G6h~#t h#t8ƿ1'#PV2tG uVh#j $$1ɉh#SU P6$8-'G6kj j5$<b ƃu-@8"5G6G6v $<fG6Wj j5$</b ƃ _%G6j j5$<a ƃu?8"G5G6G6G6G61A5$<5$<hS>#V0tch$#V0KG6G6BG6G6/G6#>8"tD5G6  9uG6rCjht#5$<hY##Vh#5$<h@# 5$<h'#ju h# G6t 1ҁ‰G6m6փ95G6u<9G6u2m69G6u#m69 3t 3G6G6=G6u\1ɅQLh# o3=G6t)ͅt=G6ut 1jhhG6P4 $yhG6h$$jN=G6u1D$(Pt$7u#D$0=u G6G61N1$.' $$h"."t$h#Qh%hVISVvth"P($Ph$$G6tM6 $=tM6=G6pK6B=h32#tWt1@$$Phmdt$ hh#h|tWWh# $=lL6u lL6 =pL6u pL6 4$hK6 TG6 $$1 uWhPhK6 1K6K6L6L6tjVhK6v hK6\ $RhS褪K6hG6VW0 5G6VWF5 W)l$t$D$ 1ɉHHD$UD$ Pji Džy#98#Bj趗x߉DžVZmx9ujUj 1|$nh32#$PT<hjhK65 ^ W)t $h#mQh$v3 u3H u3~u3H u38hu3*ljt9 t4u3H u3~u3H u3hu3)ƒ߃NyjUj hS2#D1K6$v3hG6VW4. 5G6VWj3 hK6dtd($Ph$$$P5r1@PyGjUjo P聦Ph?C##tǍ$PWh%V贃D$uh"Z$PqQ%jPh'Q#QQƃu W VFWVθ1#.'PV)t uVh#jKG G6裨G6GG6GG6O1|m6t^_^_WV΃=|m6 m6t>G6t49t0$#$#9tS>#9tS>#QPh#_ 5G6|m6m6^_SWV~#43'3'VSh#h|v3)Q;#ujEVPjj"P豼 th#^1Q1`.'$ =uh} jj"t$ 1$4F"u4$ 1@^WVκj u1H3 r1P^_V΀=G6u6=G6t t41t)PhK60hK6hedAV xk^Ã=G6u Jt=G6t7G6t.hK6hedAVp thK6hrdAVY t=tM6uj&Dh#jh+#jUSWVPύAPjh#h$v3bOGw4<3'h $Ph#h$v38O $v3w(h#V"O w,h&#VO w0h-#VO w8h4#VN w4h;#VN W4O<W8#9tQh#hB#h$v3N$r#OHtQPhK#h$v3N$r#OJtQPhU#h$v3lN$r#OLtQPh_#h$v3KN$r#ONtQPhi#h$v3*N$r#OPtQPhs#h$v3 N$r#OTtQPh|#h$v3M<$f$1۽a$v3Pjjh#(wVh#$v3PMwVh#$v3PuMGtmÈJ9|6{u;[tVPWh #XD$(ffL$(D$ 1ۉa)D$u!)tPt$hM#mXL$4 <)ǘ΋I<9vt$hz#DX$N<.”T$9vt$h#X$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#W D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( lL6pL6t$(L$QhV{W  D$ 1h#VtG<$h#V"w4(1>tYj:WD$AL$\$h#Sv,1tD$h\&WtkhdM$Wh:#W\D$Ph\#WW  D$q;G6efjL6ujh;M&l$!U l$<3'1tUPP QF3'r܉1hD$ Pj <$Wh#UD$ D$t$ <$}trÉD$h&"U t:h1"U t/h6"U t$UWh$#KU F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhD#TD$ D$t.W Lt t uPUWӢ Á.'r D$l}3MDHu D$"91hD$ Pj t4$h# OD$ \$"r)Ut$h#N h#ND$1ۋD$L6ND$L6WH4(t$|t%h#Vn L$1Ҁ<tʉT$D$< w'<$$4.'L$ L$|L6<$tL$$L$ L$|L6|$m6cL$$t D$|$m6L$|L616FL$<$C fF|$m6L$! L$|L6|$m6t8L$$ D$|$m6tL$|L611A<$D$ hK61D$ ȁ(^_[]4$h#MD$ WVPθWEVK6dL6fhL6hK6 fhL6=G6u=G6u#$}hK6hgdV 1hK6hfdV y#8t #8uv$=G6u(PhmdVn xX53h} 71=G6u$hK6hgdV2 y #1G^_ù#h# 뙃=3tt$ t$ t$  A#1HVD$ t$=K6thPhK6w ^D$L$01V"t,uVh#-t"uVhX#Vh$$艼Vh#Vh#4K^hm6hmd53& USWV8 $RPh hxM6Qxm6 G6v|Pt$hp#J lj D$T$1D$ XƉ 11 ‹l$ O6 xm6xM69xM6hWD$P  $;D$$r#=tM6t =}t=}uЉD$$#=G6tȋ G6=WEVuT$tf9G6rD$Pftt=G6%4$t$Uh#I D$t=VEW=G6$t=VEW4$t$UVh#FI=G6|4$t$UVh #"I=tM6$D$PSt$Ut$Vh5#8=G6u $hG6S$v3V 5G6SVI SGSt$VhVW] tM6D$ L$D$11t4$hI#萹8^_[]USWV T$ $11F1Ń=G6|Uh#H QPWD$Pt$9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=G6tUPh #LG Ɖ ^_[]Ã=G6tUh#d=G6tUh#GċL$T$tPhK611@PhU#ht"j QP@ u)8"t1HG61Yhe#jjPh#t"j QP=@ u8"t1HG61Yh#j!SWV։ϋ\$+G6tItEuG61tGtBxM6 O6xm69w1xM6 1tthK6QA1@^_[Vh-#jVL$1=G6T$ PG1ɅɉWVxm6~( WRPhxM6QF xm69u ^_h^#uQVh#j PQVh#jͺUSWVPӉ΋l$|$uj WV> Euk"9"t:M";L$ w,O>t" t9tl}3DJ@t1^_[]WV1t>΀9t7h#V<t#ƍFh#Pd1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#D1۹m6؃^_[]ËL$9/upL6D$\$A/jPU u$D$ L6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#ICm6!Wh#3Cm61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#dfD$$Th#Sut]"P4'W PWS  '> uۀ$U-$T1445'D$XP tpC"uD$TPh#1$T$끹#45'j" $eFMu SQЃ {Sh#0h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$ t&1t! tj VY1@t1H^V"P4'vPh#W-  u `Ph#8-^VPhrdA$d t"$D$h#d/$PQh/#R~$ "Ph#Q? ~5$w$3'm6m6 hw#ZVh#P~I$ $u ~ˍ|$@WVO9t"b&J~PH k$3'1OJH w@$4' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=m6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#"h#x"~USWV|$t$t$h"V$ Gw45'hD"Ph"V$ GPSh "V$GPSh"V$VjjhQ&GXtVjj h%"GXtVjjh0"GXtVjjh5"Vj 3w(h>"V+$ w,hP"V$ w0hc"V $ w8hx"V# w4h"V# w"@D$Rt$UWQP$71w8$Ћo,1lj1l$DRWt$>"P@PU=aUD$PShG"$S"$#a0QShU"$S!<.Ǡ!w4L6'hc"Phk"S!  w$5'5h"_<t$uM55h$r#RPQhr""555WRPQh"SM!7h$r#h"S8! "55RPQh"S!M8tDƔF1Ph"S  F;Eu 1<1A71Au01<  $jj@PD$PXD$ Ph$$rC9u<$u4,v3H ,v3~$v3H $v3 h$v3j _1^_[]h#j&fUSWV $ $ D$-@1m6m6m6m6m6m6$m6m6m6t$ h#US{ c~!P$6' m6˃PtdT]=$<?1AJ5$<3em6뒹 .$<m6h$r#n m6b m6D$m6T$:@=m6l$<D$ Tnt uBxou D$ 1Ɉ m6h%V!tm6h$r#`ء$<$j:WC-m6tWutm繨m6S c$ \Wm6tm6t m6o39$ 1ɉL$tVh$Po tj/U|u Uh#"hPx%h$ U(VDžuVDž7h$P ƋohD#Wt(hh"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tUQlj?,$u1QhD$PQVײ hm6hzd@Pi tq$ PhedAWO Wmj|$ WD8$9",7'uWjxn6,$h3 h 5m6P Ġ ^_[]hs#j膚$Ph$$j袚Vh#jeh{"hz"ʍD$ Ph# D$ Ph#jjD$ Ph#롍D$ Ph#땍L$ Q4D7'h$USWV։ϋl$j̠ VA U6 CCCOK G^_[]!h\8'Ph7$h|v3lj USWVP׉΋tAS}Wr4$4(VSϠ Whk$Vt$ P W蜟 É^_[]USWV|$1_hD#St$hh"Sth#Su\m6toU3t[u=m6t .=m6t%m6toU3Tt [u^_[]USWV$D$|$m6$r#tW3 t CÅushD$t$ uD$r%D$ m6t L$ mt L$ ^$D$ D$h跞 $$ t$h.n%hV$0|$D$4$L$h%Q1G@΍K9|,SPΞ Ŋt><-u(GD$tj=Vt>FD$ GDp#th%D$Pu|$1F1B,$֋$$$,$Dm6tP$r#t"P$h# xF1Ë$4hw%C9uj #t2ƅ|$t t$ 4$ tA710h #ґ|$t t$Ե 4$ɵ ^_[]ÍD$jPVB x!L$ȃtuuh_#b묁tlP^ PUh:7# 끉 m6utD$P$uW$P$u؁^_[]h<$h$܋@s6Ћ$ t9‹-8s6҉T$։鋔$ t$ t $9|ȉ$mNu\$8s6t 9Ct,Phk$J$PZ!u$ȃt1{ $ t#Qw wwhz$$ȃt*t&t!Pw wwh$h|v3 OtHOKt4s6G8=4s6 t$w˪ w W跪 CDs6H Ds6{ t t @s6 @s6I @s6;D$\$98s6MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P\$tq0s6c8$r#t`K$h$Ph$h|v350s6.>2#t#Pv vvh$h|v3\6x$SWV։ϋY Wss ss҃ Ds6t~j IWss ssԅuA Ds6^_[ÐWV1t$|$ ɉ @4u{ȉXȉX\ȉ\ȉzz}z PQ40Iz40<8)z<8D@ zD@LHyLHTPyTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40/y40<8y<8D@xD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7uxVw wbxV FwwNxVFww:xVF^_USWV\$l$EffEffCEffCEffCu uwS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuwSCuu wSCu$u vS$C EDȉCDu,u(vS,C(E@ȉC@u4u0vS4C0EHȉCHudh$VŋFNt6tbSQP t6x 8u6~,=u6tffOfGG@ Չn,~$N()ǃ~$N(=8u69<$D$hP-8u6>N,ș)N,)n$F(teh$V$FNt6tbSQP t6HT$<L=u6tAf=u6t4f.<$ ^_[]s68u6F,)F$N($fOt@ s6븋D$L$t$ QPQPUSWV$$$ $$$(hlY$SV\1j D$SVWUhPD؃r_4u6950u6rPSV Pt7=u6tf%"=@t4n#WQh{%d WhY$T^_[]USWVP|$\$s s@=u6tf9uRu6t=s6t=t6tj:D$1PPPs sQs s6OLs63C Hs63K u 3&=u6tf%"=@t4n#Qhh$胣s s/)SUhv$  s6u =t6t:yj h$s6th $$=s6uh$u=t6u6t7t;f5s6D$u6jhb$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=u6tf=u6tGf"@t4n#Ph$/SVz.=s6t)1=t6L L h $#h$$p$l tRQf@ Ls6Hs6 1VW 3L$@D$DD$E t$|$ t6pt95u6tʋ t65u6T$Htt tɉL$LL$QPh$=s6uh$5153PPPjLs6Hs6  53RPjjt:t6=s6h$F"D$L$ Ls6Hs65Ls6=Hs6 tYjj=t6Hu6tt,fI=u6tftfI=u6tfIfHVW51Ls6Hs69s6t-j  Ls6Hs6 djjQP Ls6Hs6 AQP=u6tf%=@5Ls65Hs68,$t$R=4u60u6 t# Fjj WSp9ݹÉrFND$P9|$P$d닔$hjj RSp )ˀ0^N9wh $訞h'$Ntf5Ls6Hs6153WWWjLs6Hs6 CRP53jj_h$h2$1s61P^_[]Ë$d#Hs6 Ls6$tҍt$PtV$lSUQP4$SUfH1G@u5Ls65Hs6hB#SUu.$l#$pthB#5Ls65Hs6SUq5Ls65Hs6H=t6u6fA=u6fh$s6hS$h2#jj5Ls65Hs6D$DD$L t$\$ VS@@PD$PQVSf@5Ls65Hs6tfA=u6tfA$l$p!fHG5Ls65Hs6qf@5Ls65Hs6SU5SUh{$ t$p$ph$ =s6j USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡt6@4 1WjPQWWRS 9=u6f3 8u6ff3=u6twf3 8u6ff3=u6tjf33f3=t6t3ȃ=u6t]D$ Yf3 8u6f3f3 8u6f3f33f3=t6t37D$ G UV=t6l$$tApQt=u6tRP`A(=u6t1ҋ t6I4-t6teQRP t6xtt$V/11jWprr =8u6=u6tf=8u6f3t6;x4})}jh3W0r =8u6E t6A49rE =u6t<$fGj \$l$u6_=u6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=u6tfUVfXW|$$Wf@t$$W=t6Hu6tt,fA=u6tftfA=u6tfAfH ^_[]UUSWV$$1Q 4u60u69;$$߃9։$PU$T$L1 B(BY $BjZr1B$J$=t6pt$ =u6t ɋ=t6u6L$xtt tɋ=t65u61L$|1ɅDT t$t RP\58u6UVRPa tE{[|$t}SWR\ljUVSW$)SW*\lj_{[ |$t]SW \ljUVSW߭)SW[lj?UVSW赭)Ӌ$xX#UVSW萭)Ӌ$xX D$4PS $$W$VWVhPWV t61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =u6t SW[ t6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =t6<$\$T$|$(t$,DpLtL|Dx=u6RSZTtDpt6D$0X0vvYRPYVFvvY RSYVFt|tx|$8YD$T$Rl$$D(D,=u6tFB\pTtt6B0FN FNDxD$L|׉L$L$؉D(MU =u6t]RQY t6I0VPYU EMhɡt6@0 ȃ=u6t3ȃ=u6EhD,t($t6@0MU EhEhD,=t6L$ tL$D$D$=t6,$\$ 1QOP\$  t19}#8@#pLp0l$$ t6ɋD$taVt$P= t6x4ƍ$58u6pS t6@0fPt$t$ t6x58u6Spњ 8u6=u6tf؋8u6f3t6B09}+^jh3St~1F=u6tf)9F=u6\$tAf)=u6t4f=u6t'fL$=u6fVT$Rt)f~T$JR>>fD>=t6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=s6=u6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=s6t Vt$t$Ut$h$B1Ƀȃ^_[]1A=s6t1=u6<$\$ HfUSWV $8$4}tE1ɉM4M019 t6‹DT 9 u6tRPOM$U(E$f M$E$U( u ^_[]%=uLIt6(9‰|ǃ=s6t<|u=t6tFNFh1 tt6tD$hVP |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =u6t RPN t6I0VQRPvZ։D$D$ ЉT$t t6=t6Q8k=t6L$$tL$D$ =u6t QP1N t6#8t@DQL!!IT u‹$8U t#DT tE=u6t!RPMD t(=u6t1҉EU}@U=}@|$s6EM QPQPh$3WWh;$聇h_$'uQ{u u t6y0ƃ=t6u6t:tMPWL?UUlCD$T$NQt PWL~V ~V h3$u6t6@ 뛋5t6F8E -t6T$$tT$D$ =u6t RPILv0 I)؉$ʉT$t*DT tZ=u6t RPK$8D t6=u6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Ws6E$8I QPQPh$3UUh;$薅h_$<$<t7t6Ht)$|$-t6Cq qƃ=t6t0FV=u6|$$tJRPJ)RPJ4FV =u6|$$t&RPJ)RPJ)FV )FV h3$u6t6@ USWV|$ \$t4u690u6aTs6 Ps6 ‹-t6t9ˉrux9ˉ\$؉jL$QWPUց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סt6t`v0WUL t6t6pxjV|$(WS)Љ Ps6Ts6=t6jVPSК t6A^_[]WSh $t6@ USWV$׉νs y@tnVՃ2v vv $<D$$8D$t6p0vv_ $G t6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPS19rÃ=u6$t$ \$ti=t6t,ۉ~A1_t4GT\$F9uۉ~1O ɋW @9uG W5u6萲t$ D$x, t6;Xt|$#=t6t JًL B tmt$v vh$hWWVt=t6t$$B1ɉL s6t$ $$Bt$ B Ct6;Xt`R5u6踱T$\$1ۃ=t6t%JًT tN=u6t#RP+FBt/=u6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbs6L$AI QPQPh$7W]Wh;$h_$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=t6t+FV=u6tGRPE+D$RPE1FV =u6t*RPD+D$RPD+D$ډFV +D$ډFV h3$u6t6@ 1@$5USWV\$41F~3|$0l$,|!$u6 u69|)S9у} ȃ^_[]Éދt6K89}=s6tOI.A!1‰9)=s6l$,|$0t!t$4PWUhm$t6PVWUyNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=s6!$l$|$ T|$0tN# $ND$T$RPWUh$ t6<$\Ttq!qIVPt$ Sh$$@l$19=s6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$t6t$Sh$1Al$,|$0USWVD$,\$( ds6`s6փσ5`s6=ds611 J ls69hs66 ts6ps6Xs69xs6@D$ xs6=t6\$jD$ PL$QT$R Mց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =|s6s6ts68s6T$ts6‹D$ȉps6ts6s6WUS5s65t6贬= u6l$$-ps6+l$(=t6|$`5s61VV=u6tf%=tjvdv`?VdF`vlvh?VlFht4?TCut4i?TCuG9a=s6t< t6(1s6SS=u6tf%=u1=t6u(x$CS =u6t RP>9Ƹs& ɉ @u ɉ @uG9wt$t$t$5s65u6襬s61Ƀ=t6 Xs6^_[]PSh+$awUSWVl$|$t6jVUW 1ƒ hs6ls6Ts6Ps6=`s6-ds6=ps6-ts6xs69s68#{H1ۃ=t6(=s6-s61|s6s6ډs6t@|s6 -s6=s6Wh s6t^_[]UWhN$Tvhs$Jvs6t Pj s6USWV l$ =t61ɅDT =u6t RP< t6Y0މD$ʃQSRVc wÉD$4t,PY 1ơt6$t6QPt$0t$0@$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ t6; t6u3P5t6c =t6t-t6t6d t6t6Qt64 ^_[]h$\tSWV|$t$t6t6QPWVtH 1P1 t^_[WVh$ tVt6tR t6~%t646ch ;5t6s롬t6PJh 5t6=t6RMT$=u6HRP'9L$0ơt6@0 T$D$=t6D$0T$T$4=u6t$$t RPM'Mt$t$$=u6tȋMD(t6@0T$,‹t$(΃=t6u6t+tMVR&uVFt$t$ &7KVR&MQ AD$:MQqD$T$AQ!EL$DT=u6t1ҋ t6q0RP耐 ƋL$ jWSQӃ=t6D$ t7~SPt$t$$߄NjT=u6t RP &|$)~SPt$t$$訄=u6tȋ|$1҉\$$ t/f t6q0RPݏ xËD$L$ L$0|át6@0 T$ʋL$ȃ=t6L$0T$D$t!D$4=u6t)PQF%D$ T$8=u6t@ɉL$ D$ #Weh$#WOqs6Ns6?s6b%j 5$<fs6Pht$s6=$<h$W݃h$Wǃc$j Ws6s6Ph$4s6s6~m_f#j5$<3=mPh$蠩As6s6/s6$w6$<D$ s6s6s6s6s6s6s6D$ L$uD$t/=s6t=s6D$th$D$1o3)hD$=s6t s6jjkthm jW=s6thm j?hB j0 |$D$ D$4CD$=s6u PZP3Džu6h&$%Z|$ tND$Pjt$6譧xND$t$eZL$9|ȉD$t$ (L$9|ȉD$6h6$)W M K;D$={6D$te^_[] Ph$j-lPhQ $h|v3輩 jBUSWVP׉΋\$t$USX) M9t 9u^_[]WVhP$j,USWV Ӊ5s6QW=s6t=s6t hg$X1SW[u=s6hq$Xu6=s6u<t6Ph${XCWt h$eXh$XXV=t6t>=s6t h$X=t6t h$Xh $X/=s6u h@ $WX=s6u h^ $W3=s6u h $W6=s6u h $W<=t6t=s6u h $WT t6|$Y8֋T$  SP5Du65@u65Lu65Hu6h $Wd,$kdыt6@DWSQPL{D$T$iщډWSUR{jj RP_RPt$t$t$t$t$VD$Ph $2$=s6 t6+0u6 4u6Hu6 Lu6Hu6 Lu6 tQPh6 $գ =s6-t6KC)s, @u6-Du6Ջs4HS8\$ ډD$$+ u6$T$$u6 $ $ډ Љ @u6Du6tRQhJ $ =t6t8h_ $5t6tvvh $ 6j =t6t8h $Ƣ5t6tvvh $詢 6j 軡15t65t65t695t6tmj $ t6405t6h QV - 5t6Vʍ=u6tt6PPҞ5t6zt6=u6t s6j t6y,t+t61TtRaG t6 t6F;q,rt6P@G t6=u6t =u6th $S{61=t6=s6u h $S=u6t h $SGRtgD$Ph%Ru1D$t)L$ jQPh%hr%!;t-=s6u h8 $S_  ^_[]1USWVt6D$45t6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B (u6l$9؉|5t6|$0G;~,$LHN4H~KT$މ)1@ (u69׋T$9|5t61҉t$L1F, Du6@u6Lu6Hu69S,SދD$4HxL$HD$81ۋjV t6ׁ\Tډ\$tQ!QЃQ SPh@t6Et65\t6|$D$Xt1NPSWUkʼnFظ|߃\$ <$w4Ft6<$t LX FuWFsT$ Hu6Lu6$@=u6tfL$fAf|$l$$j ) hX t6t6T$ =s6t| $=u6t RP RPh $l=s6gq$ʋT=u6t RP WURPVht $ٓ($DX=u6tPh $贓s6h $Eh $frT$ '|$@@u' T$t$SUt$A Pu6t$D$, F=t6=t6$@=u6tffu$@=u6tfft}SU{$@=u6t?f=u6t/ȃ=u6 $ApfAAt$f=u6t $ApfAA $AtfA1ɉ v6 v6 v6 v6l$T\$Xt6pt4$9 u6t ʡt6 u6$tt4$tʡt6 u61ɉ$dtX$t $D$LPt$衹=t6=t6t=s6u,$$@\=u6tȅSUh $C h$,p~SUؾ19 u6t1ɉH\H`HdHhHl$f!B=t6,$(E\=u6tȅƄ$E\=u6tȋ t6I0H111҉,$L$ D$t ߋ t6Y8Om\=u6t͋ t6#8߉@DYL!!ÊIT u,$\$lD`Td t<=u6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9t6H4 D$|$׉D$|$=t6t݋AQ=u6t-RPo!Eh=u6tȋt$|$1҉11 ˉl$$WVRPSUh-$uA=s6th$h$m|$t;SU蕼ƃ=t6D$|t1$=u6t RPFVs6=u6tȉFhܽ$|$jj$$$$SU z $A`Id=u6tEQP< $plph#1$D=u6tWUPVhN $  $AhQl D\$C5t6;^,T$$L$ v6v6׃ƃ=v65v6 t69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-t6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H - ƋD$9\$(s+l$ Uh $>j蟃SWUt$@h> $h $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wv6 v6ʃǃv6=v6|$ |:w whk $= =s6h $qjG $D$|$tjVU¾ (u6<)1CVUh$D$,p p*v6 v6ʃǃv6=v6 j  hp t6tHt6 t69tDy1Y1 t 9u,@u6Du6$|$ ,t6t6Q1I1 ы|$ tt6$G0W4L$Aڃ]D$ p ph $J< =s6t)hy$1C+s6h $;h $h1Ct ؃ ^_[]s6jpjʀfUSWVP$T$1B@B0 t6v6t6x,11=Tu6t>Q:t6x,$kd1PWSQh$h|v3辋Tu6t61ۃVU聶tzljl$ t$t6pt=u6tʡt6 u61ɉT$HtttȉD$LVUz8tD$PWbu(Ct6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$v6ŅtTM1ًU1 u3VSh$w wv6HPUMpXv6 t69tmu1 t6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $H9'h$F9h'$eh$ejj聴=t6u6f@=u6fh$8h)$eeU1hPVPVҜ1Bh$8h'$'et21VWhVWVW莜1 tah$+7s6h $du<tf@=u6tf @f=t6tjjxfh: j5t65t6j0T$1B@B: -t6t6  $Tu6$Wt>E6+5t6=t6kdPWVQh9$h|v3譇Tu6uF$h\$vv 躑 8u6A1ڍF$h$cvv 6ǃ=t6F$ u6&jPb1 8u6I F NQPQPhSt=t6F$ 8u6t%QjPSh#$hp$>6#s6QjPSh#$hp$36=s6th $۷=s61F$8u6 I1)щN$uh$b-vv *ǃ=t6F$ u6$Wt jPS1҉GW1҉GW }hjD$\P&g =t6u6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=t6$tD$\=u6tL$Lu$D$PD$PD$XPyTu6;,$/s6$W=u6vu65t6;4$]|$T{$AhjWe -t6=u6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=t6$|$TtD$\=u6tD$L$|$TtD$\D$PD$PW٧;4$=t6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhB#ss oOCK =s6th$ss QPCKhB#QPss fN s6;<$=t6t64~^1ۋ/uu q]]8u9rۋ=t6/CK tS  StQP HKX9rjj轄`^_[]s6j&ej?uPh$/L$D$@, +A,USWV $0 n8$=t6ui=t6t`E=u6tȅtNE=u6t$;0u64u6s&E=u6tjPo@E$F0N4 utEh%PV)$0 F=u6tȍL$A=t6AAhh%Q t6 u6tD$D$L$L$D$h$v v薉 E=u6tfM9v%}EPh$.;$h$4[4/E=u6f)=u6f=u6fEtf=u6t΋$0 AI 1 h$QP辈 h$Z$0 F=u6tȉE$$PpZEL$fAWQU6 $)fEPUV =u6tfD$fXWPU $0 G0W4w wmfH$Xs6$0 =t6t>}t8h$v v贇 h$Yu EBs6F0N411G9 v vGD$@=u6tȍL$A=t6AAhhB#Q+ u6 t6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=u6t2f)=u6t%ffD$=u6ffu6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=u6tfPjU6] D$fEutEhB#PRl$L$Aq $0 JR ωtljhd$RQUW݅l$EMك9v%}EPh$*$hq$qWD$$0 T$ 3F0V4=s6h$NڃD$=u6t΋D$p@ =t6X}$0 ~hL$v vڄ Eh$VJs6Bq$$0 1GPVtXD$T$ F0V4=s6h$耫ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUU $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh$ U4$F0V4=u6tȋ 4u690u6s5h$juv v݂h$T4$=t6E=u6tȃu}uE=u6tȃtb}u\FN U=u6tʋ4$h$jRQPX=u6t}Eh$T1 u6EtjPgC$0 A4y0$$0 t=s6 $=t6JR u=u6tPjVRQ菁h$cSƋE=u6tjP1Ƀ=u6t fu61ہ@€@t f u6fGs64$Crv $0 A4y0AI U=u6tʋ4$h$jRQP褀h$xRs6zE=u6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=u6l$\$tȋM=u6t1퍜$UQUPhScSh+$$"Ph!$ %9-s6th~$趦l$\$ h$zQƃl$\$$0 A4y0| AI KC=t6taEO9tU$0 AI U=u6thS$jRQP%GEh$Pu $ s6fO4$E  ^_[]ËM PShb$"ȃ=u6tUSWVT t6t6,=Tu6t>)"=t6kdPWVQh$h|v3sTu6}ww cO W $T$ WGO ƀÄ:1=s6t4=u6t+=t6t"uGO 1F9ƺw1 tbQPc8uS=Pu6xJ1v6KNj@ $GD$wOG tQPb8u E;-Pu6|E;-Pu6=4$h$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$Dt6pt =u6t ɡt6-u6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t Ls6Hs61JQPFafpt69)T^_[]fUSWVT1ۍT$1BL t6x,@=Tu6t;t6p,kd1PVSQh $h|v3pTu6t6 t6<\$11ۃVU衛VUm`$t$l$ t6pt<=u6tϋ t6u61҉|$Ltt<8tϋ t6u61҉|$PdtX 8Džtɋ$L$HQ$`9'xtCVU誓tV=s6VUh1$^1=t6L L tOjh$st6tuQ1y1 t6 u_VUYdtl=s6tHVUh[$l7jh$$PxyQ t6P, jhb$D$P Ct6L$;JWD$ Pt6t6tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5t6t6t6h$h$ udt6ǀh P5t6C 5t65t6,=u6tt6PP>5t6t6t6@ t6HHщ8<=s6th$n=s6uh$u_h 5t65t6Y 5t65t6&=u6tt6PP75t6't6t6t6ǀ,04ǀ(<HHPLщ8<҉@Dh P5t6A 5t65t6"=u6tt6PP45t6t6 <: $ 1@ Whj# h$v3 u3H u3~u3H u30hu3; t u3I u3~u3Pu3hu3 u3 t u3 t^mNt"YAyt n+j  yWh5 $u61^_USWV 1t6t6t6$X0Shl\t6`t61N5Lt65Ht6Xt6hh-t6t65pt65lt6|t6s6s6s611ƃj$ShZÅ…t|txt$FD$s61_Gs6yG 1HG GG9l$td$X0j$yShÅEtu5s6rPVQ˜ D>/|)Ot$L$6}62}6$!D$h8J}6$ D$tB?JL$h)PRQTSWVD$t$ 4u6950u6r==t6 t6jSPV8)޹394v t^_[PVh!$CWV|$ wu$9'1XD$@uPw w Ph$$*=s6th"$@h!$t ^_Ph!$趽Tu6USWV$\TM@$ 5uh`Xh`VP =s6t h"$@= u61ۃL뀃=u6t\,L$UPQ DPPz$\, u6L$L$UPQ |$u $PP@1LDffLD@9u=u6t8PP\u6L$UQPZ t"PP\L$UQP4  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h"$(USWV\$t$=t6!ߋ,t9Xt6@u|$t&jt1ɉH HHXh1^_[]h)"$VD$ L$5t6#p9tыR9u @^USWVt$|$VW/t6!t7^Fu+11 33 1u{ t6tqt$0|$,\$(l$$T$}6t9PtjRQ }6(Xxp L$ }6t9HtjQ5t6 }6(Xxp ^_[]WV t61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$<'$1Aȋ$sY9Ud:'<@:'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$:'4  <Qh#$h"$脹D$P`wZL$ D$$:'1B(ɀ!1Rh #$h"$SD$H`wPD$T$ $ :'1C%   [Qh0#$h"$衸SD$H`wND$T$ $0:'1C%  [Qh=#$h"$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWƅuWhu"j;$$<$4D$Phd@U tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$ 1 Sh"UU CPh8"U C Ph"U CPh"Uϩ CPh"U轩 CK,C,Qh/"U襩 C0PhD"U蓩 $@D$t P? 1-Uhzd@$<W t1 VhedAW hjU D$ P$4sdD$, 9L$+ L$9u0$S11:8tx$0h"踂b$11҉ $ƅ*ŰP萐 j PU贔 ^_[]$0h"jUSWV81ۍD$4ShPSuܝ 1NtAljSPSWuWU uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS_c$1NHD$ D$(%=@= j/Sxr)ك$0PSQhJ#$hR1D$jPhǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSa1@$D$hh S4S ƅ%D$ PVD$3D$ 3|$$  D$uH$0PS$8$P$TRPV VS D$4@D$1$Vh`#$jSVjSnR ƅxc1GD$ PhFV  8u;VS Wh`#$jSvjjSR Gy hD$t P9<$t t$r1Ox VR e^_[]D$(%= tn=@u$0ShR#$hPS5Ɖ\$1@$D$:\$ D$ PS_B$D$jS/Q }tSJtN$PhF|@V x4D$t P.U$$JhF Vh$USWVP1hUU= ƉRP)9-u6t1@fCM+PUUSF t6;A0u $ytWVC^_[]Ë\$-t65u6SUqRPX$@ `t6ؔؐh P5t6O 5t65t6 =u6tt6PP5t6t6[USWVt$(~Oholu6tUQsՉ 1=t6L$$t| tWVrƉt$$H$át6@05u6QPWVsUC cMhml=u6tUQxrՋt$( }t6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=u6tȋ|$t61ɉSh$$=s6th$*h$lt$" t6QP#T$1RQQD$P1Aát6;X0t$~~1Ƀ=t6T$DT =u6|$t RPmL$ pL$QSRPyǍP֊}6$|$1D$D$t1)ÉعF@jPDD`r9w<$r$l$T1C @<$9uG<$;|$}t6X0l$ot$|$oh\$ىht PU -l$($|$ t$ t31T$pht WP $@$9|$|$|$(1L$t1ɡt6@0)ȃ`T$1ۡ}6ـ#h$$b=s6th$ (h$ ع`֋,$L$t1ɉȉD$ օt$ tH t6i0T$,RQUt$> t6;A0l$,} $L$l$l$,t6@0D$Mt$ |1TT1PD$T$ ʃ=u6t RPkL$(ωQM D$H 9tet$C9\$t$$h$$ s64$F4$;t$SD$`1s60^_[]ËL$ ʋ t6f9u Shp$$褤D$`,t$$h$$ljj t6Ph$$CUSWVT$L$D$0(D$ X=u6tSUiʼnӉ OD$$t6@09ʼn} t$t$5D$PSUt$< t6;A0 t$~QPSUy~t$4SUWt$T$LtL$A L$ Q5u6t9RPt$ƉT$ it$1ӋT$1 t<$G RQhD11 u5\$$9t ;D$t`GPD$ GPWTt RPh$<$G L$;L$t9ta щʼn$;D$t`1ht%$辢^_[]USWV t6$t6x0UWt$0t$0tƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRs }6T$4$1B srl$,$ ȈU1wX=u6t t6!9GX=u6tȋL$,1Ph%$蚡 }6L$ $  h%$y=s6th$!#h$t$D$OPWTP1GTGP^_[]s61USWV|$,a$tf$t61@$t6sll$t6tt6 L$  ƍD$1PQQVK9 t6;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh$$џ=s6th%$y!h'%$Et3s ss3st$Vn[E;,$us6'%t#Ph$$0j.USWV0\$T|$HOX=u6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGu6҉L$D$td$PQldÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQʆC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h($'h'$h ($h h&$Ph'$O4$V0Vh'$hp'$h hf'$hU'$hWVt$ F,t@}6th($F,P装1~,>d9~8uv0腅^_h'$h'$h h&$D$x,u@Pt POGh&$h&$h h&$WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_h'$h'$h, h&$gh'$h'$h2 USWVEH1Bx,T$1htM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vSe^_[]h&$h'$hF h&$芿USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h1($hr($hK h&$zUSWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h&$h'$h` h-'$h'$ha h&$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h&$hC'$hq h-'$hC'$hs h&$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h1($h($h~ h&$^fUSWV\$$|$ l$t$}6t5u6SWUh($USWV5u6 1^_[]USWV\$$|$ l$t$}6t5t6SWUh($USWV5t61^_[]V=s6th)$Œ2j5}6HtahQ)$腌h $+tS}6xL~61 }6 s"@Pt4hq)$ }6}6F;pL|^5}6vj}6t'x,tP}6P}6á}6t x,tt$t$t$t$P1WVt$|$ VW=t6dtX=u6ts,t6`uau33 u1@1^_WV s6t1 }6 t61!`u/aʀs2hlpx1Ph)$ԊPh)$h $gJh)$蹊t6 ǀdƀah P5t6c 5t65t6=u6tt6PP5t6Ѱt6t6!1111QWRPjh}6hh)$h $艶lh)$ۉt6 ǀdh P5t6,b 5t65t6=u6tt6PP5t6t6 t6dPs+aʀu Ph)$Ph**$h $蟵h*$t6ǀdƀah P5t6Ea 5t65t6=u6tt6PP 5t6t6^_j`USWV1L$ AL$HAL$@AL$<L$ L'L$A L'AL'AL']u }h*$SVc ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh<'jƉe^_[]Ãu95o3ujhL'D$P8 u1PPD$Pje95o3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQFWRPt$8t$@t$8t$@W1u2h+$R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Ph&r#hV^D$@w ww7VPhe+$S 1h*$+h@+$WfUSWV1L$(AL$$t$@L$ D$ }] h+$WSb_ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9o3u~]#D1غ$Phzd@ tN|$$tOh<'j[t$ Svt$@Gv1Oe^_[]h<'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SSjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q Pn H @AQ@A$Q @QHALh1$SXh1$h1$USWVP\$|$tus$" $&"$jcQtQ1@PVSjPt$8t$8W E1u>4$h4$W VWSh3$W4$h3$W 1H^_[]UWV} uOʃ$<|RQPh1$VJPR>Dx& $T$W1ٹ|$5$<h 2$ 5$<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhL'V 1OujV5$<>uW?,VQ>~Ih2$Q1$VQ7 t1Ph,2$Qx 1O^_SWVP|$1N?u;j S5$<衺 8u1u5$<h"t$ ^_[WV|$1N?t5$<;1t^_h3$t$USWV 1O1;B։ˍD$ j P5$<[ уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5$<Ax(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,҇jhL't$$ tjVt$$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0whE2$VIz1t^_[]1;BB  FjhL'P 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hU2$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph_2$Q 1HUSWVt$|$ t)l$\$$jWUS tWUSh2$1h2$V*l$(\$$jWUS tWUSh2$V1H^_[]Ã|jWUS/11USWV\$1s3h%5$< t^1WtA'tuWh 3$t$ 1N|A'xA' Ch%j& Džu^_[]WV|$ A'tA'Wh%3$u^_USWV t$@\$ xA'|A'!Љ! tK$\$L$49$r#t#\$8SPQ ? StA't$< ? Ջ\$!$!u Ћ|$4t?t$RSh33$jV٨?$r#t#\$8SPW> SVW> ^_[]USWV \$ |$$tl$4|$0L$,D$( uh:3$S1N ^_[]S 1Nt@PL$$9sPQhI3$S_ɍQD$@ XT$ډL$Y jhL'S  ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(P K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW t$$h3$W 1t$$hh3$t$(d WV|$jhL'W  1Nu.W5$<6t5$<h3$t$ 1^_USWVl$$\$ |$t$jj h$r#USjV yD$USWh3$|$tVhg$j  ^_[]ÐWVo3;$$,(h5$^ $h5$莧j$,(~RPh5$ hx6$VjV p FQPh6$( v,v(h"6$ v4v0h66$ F8Ph&r#hWU3WhI6$ۦvPh[6$˦1$htA'jIĈh6$1HĀ^_fUSWVD$ $t|$$L$|$t$,t$4RQL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh=$P%1D$Bh=$ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh=$u1fUSWVPM(,|$8O] D$1h%>$uS sujsWVVuutqD$9o31t$$u_h$S4T$,D$$\$(ju)t Hth|>$u_1Ne^_[]ÉD$H@ D$ juVjVH A D$ $Y$jV jV tuh>$uD$3D$3L$ u41D$Bh>$u-h50$h>$V\$D|$ ]HL$H L$p $HTHP1ۿ $9s611jhL'V tN(F,9ˉ|ىˉǃ;4$rΉD$+D$T$щߋ\$9ljD$ +D$L$,9t$L$;L$|$D$11CT$09Ӌ\$49щ;L$$|$( $$T$u11҃]|r tht^1B$D$thL?$SG 0+T$x|$yRt$h>$udh?$D$t$thh?$S11A $1A;L$0D$4D$,L$ |L$Vt$VjS @L$)΋T$׋jp jRQWVS 6 $p q ?  yq @N F$FV0~4j\V軻FSȾ H @AQ@Q A$Pƃ׃q0y4QLAHS?D$ ulD$ \$$ $L$(|T$ |D$ fft$Hu1h?$h?$Sh?$SfUSWV0u1L$ L$AL$AD$] }D$h@$VS a~bt1iugD$ PW*u5D$PW$D$PWut3NT$T${lh[&_1D$|$|HWt;L$L$(L$L$$xupt3L$(P3T$$ t @ut$ t 9o3uD$L$ t!T$ T$thPI'jve^_[]t$t$ QPt$WߐUSWV}u 1L$ \$CD$h@@$WVV t4H w]$dI'SuF D$ Puuut%xL$룃L$뜃L$땃L$뎃L$뇃95o3j}Wqu hPB$\$D$|$|=W`t0L$T$xuXt01΋x1 }@u؋\$ mWt9^\vuShA$W 1HhI'je^_[]þJ@$hq% V! h4/$ V  hB$WD$W@$D$P@$v6 \$Sv v S,v3H ,v3; t hpA$whA-$w 1A AAt$Qh&r#hVVhzA$hA$hA$_wĔhA$Jw|$uhusuqVhA$ohU-$"wuuulhA$A$t$r#PRhVp%vĜ;8jmWj$VzVh&r#hWWh{A$vĐ^_[]USWV΋\$$|$ ʉl$͍L$jj h$r#UPjQ yD$SWVhCB$?v|$tUhg$*vj @u ^_[]USWVDt$`l$\\$XT$1 󫡠L'A L'AL'AL'B0B$` hB$VU k)Hw]r$uStJPSu7HsutPD$PS uhI'jD^_[]1Hu߅tjhL'D$P t9-o3uPhCD$PS벃luh[&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh/C$SWm a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uhI'jռe^_[]Ãluh[&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=o3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H H~6H D~6@@~6 <~6h<~61H~6FD~6F@~6F<~6F^Vt$|$uD$ hL~60X~6FDT~6F@P~6F GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$ShJ$M\$tw wjLj L?D$1P腏^_[]hiL$hCJ$h\$j USWVD$X$\$l$@EM}M UMUMT$ U M$U(M,T$0U0M4}8E<@E@MD1҉UHULUPUTEXi@E\L$E`iEdL$Eh!iElL$UpQRP/ 1USVP^_[]ËL$1B L$SWV։ωhjS/ jwS+ G PKSHK@ CjDt%Sh'iPc t#t$Đ^_[hL$hK$hL$jB fUSWV l$4UttQ"DGU@Ë|$\$uohNM$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hjM$ MHtU4uL9rRQPw t$|$t%u@uhVM tI/81tSul|$tDEM9rQWP& u@u`V u@yu@u`V teEptUt$8ЃtEu8uXV t, ^_[]hM$hK$AhM$hCJ$5hM$hM$)u\u\hM$udSh.M$jR wlh$$js fUSWVt$F 1tvt$?H t[S` tCPaR Vt$rJ tPUWK uW S] 1SP WF ^_[]USWVu]Ph&M$SJ t$f1j?1Nt}ǍD$ Phm$S td\$ t\hjD$PA* jS\$S ShiW2 t$E L$Uf jQh&M$P je^_[]PPhm$t$ u1$YVPt$ t$t$V tPhm$V u1$^USWVt$t$G t Nj\$ Pb 9v-? -1N*Ƌl$Wb VPUN )SjU) ^_[]USWVt$t$cG t?Nj\$ PPb 9s9Ƌl$Wmb VPU )SjU( x, k,?1N^_[]UPh&&uR t$1,1H]USWV@uPhM$V ] hM$VF tPa |$ P\$$ShiV\@ |$ jS_ PhM$u tH V ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP_ t!PhM$SH V莀 1He^_[]hq%hM$hhM$$WV|$$hM$WE t;P` u1V` jPV# VhiWQ? t^_hM$hM$jVhM$$hN$j Vt~6h3V V |~6hGvV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhGN$hV>tVh}N$"BVFߋD$t$j7QPhGN$hV>tVhN$AVF߁^UVuPhU$Vf t3$L$ AQhiV= u hU$1e^]hq%hU$hhP$"UVuPhU$V t3$L$ AQhiVe= u hU$1e^]hq%hU$hhP$"UWV}W#ƉPhɝ$W{ tZt4$P<tW@PV\ tGPhdU$u E t>V1e^_]hq%hU$hhP$q!hMU$hU$hU$ hU$hV$j- hU$t$_B tPhdU$t$D Hh"C&h_U$hhP$!WVPt$|$D$PVW tKD$tUhM$WA tPhM$V$D H^_h"C&hlU$hhP$ hlU$hM$jm h4M$j1 SWV$hiQ$SA t]Py\ GAsdW*t^WPhiQ$StNpxPhiS3; u?Vn1}&1HĐ^_[hUV$hjV$hV$j hQ$j USWV 1CCj7Shxi Pi uhT$?,$P^uhT$#Ɖl$D$Shxi W( u hU$j$ $L$9~D$~*1t j =Sh$$=G;|$|j <VZj4USWVHZ'D$@Z'D$ H^_h"C&h{U$hhP$h{U$hM$j̿ SWV\$,hS$S; t`PV GWt\WPhS$STtL@xpPhiS5 t5V1 1H^_[h'V$h u WhQ$j P.D$L$AËD$L$AËD$L$AËD$L$AËD$ 331ËD$ 331ËD$ 331ËD$ 331ËD$H@3 31SV\$ Sh3AuCЃ r"CrCr 01H^[h3 H?r  ؈31ыL$t ă61ÍAЃ r)Aw AwÉ+1HUSWV1t$ D$hVPA 3x̃6t8u^ă6ǁȃ6̃6Ѓ6ԃ6؃6܃66666666@wh3R&uhOT$0h39&uhrT$ht3 &u hT$j耺 $53tvh3%616663tt3$h3$U ƃV B~>CN6F v/FwD$P' 6Au"hO$C$|P'6xu>Wu4D$P1VhVVj V5$< 69t$:*ƀă6l `C Lvms33u$366r6 6D$P1VhVVj V5$< 69t$taY6>6O 6CatTl5$3+wtz39t3 3$ÿ3؉$3o3 6$u = 6uB=ڃ6=6=6u|t = 6u =Ӄ6uftu^ 6uS$ttH)ŋ$L$ T$ RQL$QWPU%u. u&hq"hO$,5$<h %j t$PD$P & u hO$D$t,DtVPyDžuhq"hO$JW WtS)uhq"hK$Wuhq"hCJ$3t H9t@hq"hP$$@ t%VWЃ$WjI'hqP$hq"h*hP$0USWV7- uhV$hO$j Ƹ3jmP$r#$r#tHW$jL3PtNW$USWhV$h|v3+23t VSm#HW$u$r#WWWWWQWhTW$h|v31$VLl jb&V 31tT$q9t Iu^WVΉhjW D$PhU$V@ tZh%V1 tQPAL L$PyRPQ WhiV* u hU$Ĕ^_h"C&hU$hhP$WV hR$Q0 t;PK  u1WK j PW0 Whui V^* t ^_hT$hT$hihP$hT$j h|Q$a1ÃD$ 1ɉJJJ JJ BRhiP) t1hQ$j蕳 $1ɉJJRhiP) u 1ĐhQ$jV Qh3[USWV΅t R, * * 0($D$Pi!\$D$1t$$tsVLsD$tVP/Vhm$W trC=6D$uCt\=6uCuM= 6uCt>= 6uLhj$V  VhiWn( t!$uۋt$$4u=6t ~ j +h$v3sWt& 3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhR$h$VIVUhR$+ jl$U$V蓶 Vhit$ t$,$t!PhR$*VhR$@,$jt$V> Vh~it$ t$tPhR$~*j )ꍄ$P$$ j:QPhR$h$P$t'$UhYS$*UE}uj:$$hR$h$P覹$t'$UhkS$)UnE}u-34$tVWUmuj|$W$V $$ DŽ$@Vhit$V4 u$ hxS$)1@Pl$U%jWl$0U苴 1@D$81D$ƉPV56  ǣ6V1u 6$h#Z1H^_h;%hZ$hhY$WVPt$T$hX$V  tbPA9 V9 PW蜦tIƉPV56d ǣ6V1u! 6$h#1H^_USWVt$T$1hZ$V thƋ-6P8 Ve8 PWt6ƉPWt>Vx ݉-611H^_[]h;%hZ$h2hY$h_f#fSWV|$ t=1H>t$|$\$j@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V5 tE$$PwCt/$F ~G F1g Z 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1S USWVuD$ tV} ]CtP7 tEC tP7 u/D$ Ph&&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V@t|$,$h%W!D$w&tD$1{tj/t$HtAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$DD$4D$4D$ PD$8Pt$ t$ ÅuD$ xK1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP+ t9t1ۉD$=r["11HD$$P&|$1OL$L$D$L$T$PQRh$[$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P©NjD$fVSP sD$ t P4$Wn0 W<4$uM S]s {te|$t^t$Vt$t_@PW/ W船tNVsE0n ߉VuP ۉt3EF ^C F1Vt$hK[$h,[$hK[$hU$ hK[$hV$j葙 WVt$tVAr1H^_V t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>}.1-t PN 1GG GGM1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7A t+{0t>-uUsft>VsVt)ud W1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$8\'4v6 !6 P6  v6 tMtk $t$ 4$UQ$t^hob$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh`$j 1Hx^_[]hSb$h@b$j WV0t$<|$jWh]$V萴t8W t7HfJBRhiV t!10^_ha$ha$Wha$j; h]$j_ SWV\6h3VSd6h3W@VgW^l6h$V3t6hzW|6h{SVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW& Whi$ U $!hb$$HQPۍ\$4|$fGWhiU t$b$f|$*ub$=6t PfD$(WhiU t$b$f|$*ub$=6t PW|$fG WhiU t2D$*=) Phb$=6t hc$fD$(IWhiU> t2D$*=) Ph c$=6t hc$1Shi8U |$Dhc$1tPDL@uShi8U t$HuM1|TuD@uD$L|Cl}3L$P9Dzty:t|$jQh^b$^ uVh"c$11t j,DLxPtT h^b$v<u h"$j $PhiU tDh&c$f$t$h2c$H hRV#9j OPhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRu PhLc$$=tPhVc$j $=tPhBc$^_[]Phb$jFz h|v3jhh_c$oÃD$1ɉJJ JJ fBRhiPm t1h]$jz 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h`$jy USWV,$@$PhiV tr$A jjj"n xgljj2 xi$-hSWMG xB$/uE$0uf$Ciu.h^$t1H hZ^$vtht^$jtWH 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h^$hb%h^$h^$h`$h^$h _$QL$4Qh^$(D$f($-D$](E!L$:!PS E Pp $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q 6t 6E6tIAtcAtCAtPA tSA@tBAyAAT$h6UWt$PVt$D$VPRRh^$,l$ }"E!Ê<)\<$]'=6`Cs|$[VPWl$Ph _$hU_$0#<*<0<2=6<$_$<t_$sQh$$D#1L;$r#y:`$QRPhC<#G%9u<]K%C=PhA_$h$$h=6S<$CPhy_$FKPh~_$0K s k t?L$D$F_$PWhPx% N%܋L$D$(Mu} L$D$D$F_$PtPtPu_$_$ _$"QPhPx%g N%D$ŋL$D$(ȉ</=6%<C<$]'^`$=6CPh _$=6CKSRQPh-_$h^_$C~@sFNuQPhr_$ IRQPhh_$mMuj>}l$ L=6?CPh6_$5(shP_$h$$=6<$CPhy_$KPh~_$Ck tAt$D$x_$\PVhPx% O%܋D$t$)E}twt$D$p_$ttu_$_$ _$"QPhPx%2 N%D$<t$)ƃl$ rPh_$j> <$€<`$$]'E`$rQ=PuJC<u;hF_$h$$=6yCKQPh_$j ]=6PȹK_$6<"<`$N`$ S`$i`$s`${`$`$`$`$`$`$`$`$hF_$h$$=6<$CPh_$1D3 $r#t/`$T3 ׃l3 URWPQa'h`$Auj>Ol$ <`$`$CPCHÃ)gj EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]h0^$h^$jo WVD$(1www ww7fWfGfGwWhiQ6 uh^$Wj1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQb| ;l$D$tD...P7^_[]WhQ$Q3| 1<$tɍGrD$X1.Ph#S4o E;,$sGwUSWV։ϋ\$Qh$$W輿)Ǎ 9~)j<t+~'K1.Ph#9t OE܄u j-j>^_[]ø wDb'ø"øSw\b'ø"VPt$ D$Ph9a$V; tD$P^hq%h6a$hh`$$VPt$ D$Phb$V tD$P^hq%hBa$hh`$WVt$(|$WhiV tgD$Phca$V膉 t7D$D$WhiV 1uhma$g1H^_hq%h^a$hh`$OhNa$j#l fUSWV8~ y hd$vghz%P y h&d$XgjhVd$t\MhL$jQP D$tPh?f$gjhVd$ D31 VPh  VPUSWQRPh`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj7 |$www wwVWj VWj Vj9 Sa9 WS9 D$ @ )T$VVQRWPؠ1I9u 8tމ56 D3tщ1@8^_[]hVf$?ej jj hf$ u8$f$jVt.f$jh$h;f$Vhq"hQ% j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjPڟut$Vhe$< 1t$HFFF FF1G>\$SVjq l$ UVWb :eƅZD31OjUj t:9uB$=h@e$jV6  8uh D39tttn1VSj VD$$Pj D3vhd$@jjja 1VSj VU6he$1=D3u$=|$ u'1VSjG VWj; `^_[]Ét҃t̓ u1Ht$8F FFVb4 PhZe$u1Id$WV?tVd$D$8x xx8WPV04 q"{jhcd$h# Q%SWd Whd$jZ&VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á6H 6t$Vt$V辟Ph8d$ij%VeD3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjv GXWV1N=6tED$@ L$1҉RRQWjP,t4$ he$^_VQ5 jhtb'3 jV_3 tPA\t^Vhe$>jBVhe$)j-PD$L$ $QPj蔞 eXPD$L$ $QPju Fj*$XÐUSWV$$D$D$D$,D1H$11D$hlf$WSl f~/P w`1A$b'5$< D$u[FtR=5$<D$,D$낃g$<8#u(@j L$ QP` $D$8L$<PNk@$)$<8#u)@j L$ QP_ D$D$8$<L$QP j D$ P5$<l_ D$D$8c1Fj D$ P5$<5_ $D$85$<hf$8o3<=6u-6~q561ۋtVPuJVh$$UFtPhFh$?FtPhZh$)j ?-6C 9|?,u)É\$(k <D$j$t D$Pt Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u 8tz`Xt$76u 6-6CPV6t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP$ j8r |$tt$ VUW"t  UW0 f8C|$$8D$@PW<tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW+t!t$ VUWs #|$$tS9u$UW/ RW1 $D$utSPW1 uWh!g$\Z1ļ^_[]Ë l}3DQut$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hn$81p^_[]WVh4"j: j SWV\$D$@u+t$D@t;SP t7V D$@t$hq$謣t$t$hq$藣 t$ t$ hq$肣 t$:7t0hq$cjt$hq$N t$1t0hr$/jt$ hq$ t$ hr$ 1$^_[Vhq$j( WVt$ |$7L WV1^_U0E\$D$,1ɍT$ QQPRhr$ uUD$ L$$L$D$l$Й&\$ D$L$ |$D$ fD$l$|$l$D$T$]hr$jD( WVPt$jWV$ 9u9t x^_Vt$h"j' Vt$V/t@^h#V^Vt$V4t@^h'%V|^WVPt$jWV# 9t9u x^_Vh"jT' WVt$|$ VWS t$?/tWhc"茱Vh|"~^_WhN"j;' fWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉuU PQ40!40<8<8D@D@LHLHTPTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7MVw w:V Fww&VFwwVF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0S4C0EHȉCHu#Woh$#Wo<$t=$<W(@,$<1Wz$PPhPPVІ6Yjj5$< D$,9$<1z$PPhPj؆6 =6=$<jh܆6h$3W/P $<1}z$PPhPj 6$<1@z$PPhPhŏ6r$<6a1@D$(S$<10%PPhPj%Ȇ6($<1\{$PPjcPPh3=$<h'%Wmh#Wm 66=66=6=$<yW!@$<19{$PPhPj?6B$<12t$PPhPjp31Gh|v3Wj>hs$mG=6<$=$<h\1%Wlu6G=$<1#PPjPPd31@D$$$<1"PPjPPj6m$<1y$PPhPh<6P9$<1Ot$PPhPj6 =$<=6j:W`EAj/WME.?y6$<Hv$l$0UU݋\$UW|$Pv 66sl}3DH,WD$h$WkhWX&WkԆ6W 6N1z$PPhPj l3,6 l}3DHWD$<$Ԇ6ht$o3=d3_=6tVhu$z5$<ht$j5$<h t$Zht$Phn"j Wht$9Wh|$.D$ =6u1=6@6$1󫍄$B܆6Al$$+D$ -6t1$ 1D$$$MljL$$ PWQ?t$h~u$6l$Ul$RQPc $׉ȉ 6=61| h4v$$t/$$T$9‰sQt$t$WPhYv$tFtA 6WPU$b u5656t$hv$|$(F=$PUЖ uRt$hv$  A#$=`h 6hu$1=6 $VhMu Vhv$al$VjD$Po 6-6-6݃=6~VUWt$hv$蟋|>9|Pt$t$ C )̓ }4$0\$l$ Ȇ6̆6ɋ|$  Ȇ6=6 656σ|,@σ|1ҿ9  69|щ Ȇ6|$ D=6Ejjh 6 .h 6hu$Ȇ6=6t̆66t&hQhdž,<tx(=6dž dž,dž(Ɔ l3p3u(jh}$耀=6-5,6u"jh5}$T=6,5,6 ̆6N0Ȇ6F4Qt$Qhh}$=6w,5,6F4Ht$Ph}$=6S,5,6F4 69}"QPh}$ =6+,5,6F0=)hPh}$ =6+5,6F0=|)hPh~$a =6+5,6F0N49}QPhA~$5 =6+І6,6;̆6|QUUUU)ʹ3333!!сis{09\~\{0\\5؆6sXș9}%CX=6~Qh|~$~,6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h~$}=6**,6{4$=611F9tA uPh$j+ $Kd=656 u։<8=d3[ WVh~$| =6),6<$C4$8=6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPJRNjs8ƒPVRW膀)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh $z=6'6tm ,6yxH1҉$q1ҋ8$$)$<$$1C$I8$ 6=,6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W%P1C1 t׉Ë$$QPV$$V!9s($$$VOÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP ƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPLË$Ë$ʃQPRS){)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQKj$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh4$t =6 ,6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d3$_|HL!ʉG41SSjhjPSe<6N ,6I4QSPU ,6H @6 <6 D6P44Q5H6щ L6`@#HL 9| Hh h3H< ؆6HX 6H\ Ԇ6PTXH fǀ$%=,6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d35O _(HLJ$6$$$t!LJ^F=6$$߬$$ڌ$t&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$R$n ,6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$$>n=,6O0 9| IУP6T6=6u\Tu))УT61VVjhjPV(X6uP69T6T65T6jPQ =6G6 61ظ|(RQh$nm =66 65X656~ ș)dہ|4s'GuȹC=6tL1$PP$$56V1=6VhZN 61u;1$VhjVu  =X65,6h`VWF' =6tWV5,6x\X6hhPO 1@$=6h!$ҟ=6|o5,6N,I\Tt~!NȃN׊Nd1 t1WPhGB$RRj$2v39u1H$Whht@P15 PPftu!ѡ6t $ Q$=6u$|&,6H,$$DŽ$%$ ,6I,$1$ DŽ$1h$v3#,6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hk$>=6Y ,6j506M 506FU $F +$^,6$~J`^p=d3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=6uFh$ NlK`ڍOȃ$ډFd;v&hM${=6,6506F $11ہ~U uv`щSA,6$~!ـ1@ 06Il ,6506F=d3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\506N uҋ,6B8H!tk)D4,6B8)Nj506$9sE)ȉـ1B~U uv`506F$CHu͋,6B8$؋N9ȉ$J`~U uv`щS,6$~!ـ1@ 06Il ,6506F=d3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD4506;Vs2р1@~U uv`506F$Bɋ,6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$D6H D6V$P V PV~x; H6up=6tL6s4PP ,6@6@@6Kd15L6s4L6D6 ,6q4jPE ,6506{0 9 X6PVQ =6tX65,6P506g ,6y0X6$ryxtG$\$%TuCl$AP$ ,6Ou$ց\TtQ!QЃyId t15X65P63 5,6\TG~8^xN`1?9'T6+$~0lj$Ɖ$)ى$=X6$%GlX6T69wߋ$9w$,6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=6} $H$$$~A=62$=|j.]扄$$r#t?% ,6ׁ\TtQ!QЃYId t1RP$Vh$9^$$;$$|W=69,6H,t =6 $$ DŽ$j \DŽ$C,6;X,/$~ j \=6 $hjPiA d3 6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$AX$h$ld3fDŽ$!3tt3$_ lj$DŽ$,6H4$ $ H5,6D@VL!! $`Nd8WgfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t3@ lj$DŽ$ ,6H4$ $l$h  5,6D@~L!! $߉$Nd t1$Sv4$j2,6@0p9w Au1H$$DŽ$1$$t+Vǡ6,6@056V$SQP$h$l 6ɉ$$$t RP$CPKT$l$hߍ$󥃼$$tA$ȃ=6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$P< ,6\T$$i$$ $$$$DŽ$H0$$_$ ,6@$D$@L!! $`S$h$l$  ,6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h ,6@$D$ @L!! $$R$$$h$l,6Hd t1$S6j$$V ,6$ȔȐG$11F$t =6$$=,640=d30w4w+_1X6$`SWP $PjS9 =6t$W\=6tX6ǀ\8 ,6=X6x\hhP.9 6QP+WV=6t<6 ,6q4PP׸ 5,6HLNd t15<6v4t5L695D6vG=6t,6p4VVx 5L6@6@@6=,6Od1Vw45T65X6B,6@4P5<6)e^_[]ÿWjV8 1=6VW\hB#SBh$j& Kj%Kj(J$6j JjJj'JjJh$Lh$BjJjJjJjJjJjJjJjJjJj~Jj wJUSWV=6ua΋\$=6t6$6St$P 4׋ 6UPSt$$586 9u^_[]:0DPWVh$Rj$IUSWV"=6΅ \6u,6H4H P6 \6 =6;66,6;}FWh s'1I!;HtG#P;Pt;H uV9R_1ڍ_5X6P=6Wh De^_[]USWV΋L$l$=6t=6teUjQG5p׋ 6SPUt$$546x 9t?80PWVh$Qj"+H6$6UPQ ^_[]SI`wD$$ts'1C:Qh$h|v3JS .  [SWV1ۃ=6։ SjQ@4 =d3@fF F)f ^_[USWV Ӊϋ5,6F Nd t1506G=6t065,6PP跳 06yU +y/\$|$y1U =,61=U L$D$uq`|$ G`Ӊ $u щw*l$$s'р4l$skPh6$h|v3Q =,606D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ah $ h$h$P11҉ ^_[]ÉՁ|$U u L$I` L$w$s'ʉـ1@BPhS$h|v3P 8ʍ 6ʍ   1$5,6$~3%)1@ 06Il 5,606K=<6Od$sC=d3CNdЋT$ t1҉t$VQPR#{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRhQL$|$ щT$ՉD$ȋL$D$VW|$RPQыt$ʋL$Vt$QRP"$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45,6;F8|$}X1Bσ) 06yU uI`1@5,6;F8|$|=6t06VPP 5,6F Nd t1506USWV$΋=,6G Od t1506=6t065,6PP胮 06xU t)h $V~=6(06xU ‹l$(H $t@\$=6t065,6PP =,6G Od t1506w,6<6HC, $9r%UQhq$}I =6V,6 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5X6W,6\TudX6jpxt$0t$ 0$<=6WV1L(ɉL(@ u1LXɉLX@ul$X6jpxt$0t$ $,;=6trUV胪1tttp謿TtDpC u1膿Cu) m% $D l$hVUg _m% $D9Pl$,6T$5X6p0^_[]jG>j @>WV։σ=d3ȃ@PQR =6t'ȉGffF=d3u GffF^_fUSWV$8tW ƅuWhu"j_ $$<$4D$Phd@U tj1OLVhedAU5 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h;%t$%H 1 Sh"Uy CPh8"U C Ph"U CPh"U CPh"U CK,C,Qh/"U C0PhD"U $@D$t P? 1-Uhzd@$<W t1 VhedAW hjU( D$ P$4藧D$, 9L$OL$9u0$S11:",8tx$0h"b$11҉ $ƅ*ŰPj PU ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuW躘 uMU D$t$$$Q1e^_[]fWVt$|$ VW7% t$?/tWhc"pSVh|"bS^_WhN"j fUSWV|$$\$(SWt$(t$( )jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP胺E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVB& 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$5o3)=l6u l6$1|$(hjW  ttt=t6u t61;6 69p6u  hPV ueVhku${ohm$ 5$<h t$ja 1Phh6PVxō$PUfu1h6hu$ō$PUBu?Vh~u$j- =p6jjh6R h6hu$ljt$1=p6 |$u =66)j5t65656Sף661҉|`$$P$T u$$j5t6QP $׉ȉ 6=61| h4v$$t.$$$9‰sQt$t$ WPhYv$qt$Vj$u Vhv$ t66%6ʼn߃=l6~VWUt$hv$8|>9|Pt$t$_ )σ}4$ d6-`6uU-d6uY56=6t6@19lj| 19ǃ| d6u `6͋56=6t6ˉjURPs=|6l$ x6uA@19lj$ $t$u h6hv$jPVW v|$wext23$2fs3$ WhG"h6hnt'Vh6hu$} 19ǃ} h.w$ |6t$VUt$  U t 9t V j-USWVӉ $I|$j W\$ SB Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ l8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"j WVd|v3Ph$V7 1GVWjh"Vht'1W,USWVu} D$8jP7=6565d6%UUUU)3333!!щ%i`6Bt699#3#3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=66\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1|6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ|6566#3t$ƺQ=6D$6D$ 66D$661 656D$86ď6ȏ6S̏6Џ6ԏ6N5؏6܏666[6,f63 f66 #3f6\$H$SWD 93rWh6~ 5h6|$t"VYjVh6 166\6X6܏6D$6 6+ 6 1҃r1I156~σRVPW56H19w+56|$OL$)9r΅u 6f5^65d656V6YVjP GD$AD$ 11L$\$66tn6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@6t ^6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ܏6|$11t$66=l6~i d6 i{5`6Q5656PRuh$. 6 d656PQWh$-6@6ĕ61QQjhjPQȕ6I 5ĕ6jP =p6uk6 61! V5t6 1N1Ƀ *̱&Fu  1@D$$=l6|>h$a=l6|(L$ 6 61PQhGB$PP+D$$2v39u1H|$LWhht@P PPftu!ыt$l6tL$QT$=p6uL$L$D$ 1D$L$ 11T$h$v3=܏6t$tX6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f56616 5ȕ6D$ hh6P 566P56Vt$ =6=6 615t6ǡĕ6)؉1t$ P =6Wjh̕6 6H9|$u_656 6)ʍZ9s1Gр̕6B9r)̕6VhP t$ 1Ƀr!11ƃ̕6Cω 9rωp 9ǿs"ˀ̕6CI 9rޡ6L$  61Ҹ̕6Pt$ 56Vj̕6P  ̕6 6L$)QhP  u1̕6@ u6L$ D 61Ҿ̕6Vt$# 56jVw  =6tb1=6t 1#3oO06F;56r6L$ D 61h̕656 G;=6r=l6t$|\tX=܏6te6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=p6|$T$T$|ʉj.'t$몸$r#|$|$t?% 6 6jQt$,Ph$(T$;D$_=l6* 6t=p6u&D$ D$D$j &1hB#'~ j &=p6d=܏616$hjVY  fF쀁"fFD$8FFFU fF56 ׉؉t$ ֍$fBt 6$,F܉VDF81 L$ F4D$4z 61CL$ =6W读D$(\W蚻D$S56tPjt$0L  ^6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ 6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP&  L$ D$1t$V 61CL$ \$^6 6=6t$,9sD$()QjP t$ML$ D$41ҋt$(VW'V($Yj=܏6t6t &3'3&3@1=6à r t$hhjV fFAfF6ÉFD$8FFF 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h̕65656f5(3|$D$1ۉt$ (3x1ɉt$)r͕6RQP  Wh(3̕6V (3̕6D$ fЕ6 61Vt$ \9\$t56(3D$ CiL$T 1VhVD$pP} 95܏6t6t#3$3%3fD$TAfD$V#3ƉD$XD$8D$\D$`D$d= fD$lfD$n 61@D$pAD$| 61h̕656iL$Tj f61ۃ=6 5ȕ6<hh6W 566P56V 56 615t6ơĕ6)؉1WP5ĕ65ȕ6&e^_[]h $h$ a$hZ$P !h$Ph $h$Vh$Rh߂$PRh $hVh7$hVha$RVh$Whƃ$VPh$h$vjVWt$h$gh0$`h`$Yh$RhH$KRQh$B1$1$'h $h$"h $h?$h $ho$ h $h$j USWV6=܏6tr6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ6t ^6 6Ѓ^_[]SWV=p6u0׉΋ t6\$QPSt$ 56`x 9u^_[WVh$h$j2 USWV=p6΁ ̕7u=61 6 ̕7t611;6-6ǡd669v@1Sh w'8!;HtH#P;Pt1A xVWh07h$ h$轇h|v3谿ė81B h8ԗ8@ė8888888̗8 ȗ8 uCء8x88t8 8 p8̗8 ȗ8З8 ؉+88D$HT$Ll$HЗ8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ ȗ8̗8&wh7 88 ȗ8̗88З8ʚ; ȗ8̗86eĉЗ811ۋ88D$T$ ؋88D$8D$8D$5З8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v ȗ8̗85З8=8|$(t$(|$D$ fD$ l$ \$,l$|$,=З8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5ȗ8 ̗8=З8ؕ7t 1Aؕ7y7D7 @79}(8i-@=B'7@9u8e^_[]hd$h$j褈 USWVh8j 7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j* u{(-88D$dD$d5&݄$\$Dė8;ܕ7D$D̗8 ȗ8 t]+ 88$$߬$З8+8D$\D$\5&&s=ԗ8uZؕ7tQ̗8 ȗ8 t5+ 88L$xD$|l$xЗ8+8D$XD$X5&wD$DD$Dؗ87 &w١8 8 t>+ 88$$߬$8+8D$`D$`5&D$Dw\$8Е7$fDŽ$jh8j4S D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PS SD$lD$lPD$,Pj5H75L75Е7OS <h8j L7D$8<BC97)؉D$D$8 T$4x'\$A9P8I؉L$A ė8Iff9uԗ88@88<8888H8 L8u8P88L88H88ؕ7 1D$18 8l1A h$h|v3Aؕ7<1A t$,u PVh$ ΍T$(jt$>Ph$D$ ؕ7t$؉T$΍T$(jt$F$x'h$΍T$(jt$Jhя$΍T$(jt$bF$x'hߏ$΍T$(jt$$Fft$NfQPhq$n ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h1$΍T$(jt$؉t$h;$΍T$(jt$d؉t$hK$΍T$(jt$9؉t$h]%T΍T$(jt$X؉t$h_$)΍T$(jt$-؉t$ht$hӐ${Ph$gL$lL$AQ D$iPhE$0h$ h$h#$Nh|8h\$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظČ$L$dT$C; 8u#Ph8QD$X\L$$ D$L 8PQh85 T$ҸČ$u1GŌ$T$PL$r |$ rI,v3H ,v3~$v3H $v3 h$v3j (  }T$A{^N2D$ˀ) hʌ$AuPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPhό$h$9 |$ sS,v3H ,v3~$v3H $v3 h$v3j   }KF߉Ήs(T$h$L$T$؅t%,v3H ,v3~$v3H $v3 1I h$v3j h$v3Aء8;ܕ7*؅tءؕ7!^L$AQ T$Q=<8 88 t+)|$L$p|$tl$p@8)ЉD$PD$P5&X8X8`8`8)3v)3ؗ8vؗ8\$CfK%h8f!th8 8T$ .KfKfh8D$ 8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$J8@)t2(uK l8ؕ7t1 l8hȋ$ l8 ؕ7 PVh$ Ph$h:$hW$hx$AfPh$h$hΎ$h$h$h$h/$hF$hV$hg$wh$mh$c l8h$1BD$D$pf)3@)f~\ؕ7tSωL$!ȹT$V!RPt$ hC$lT$ D$,ؕ7t1RT$D$fxf5)3ؕ7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B@7C9D$=ؕ7 ؉T$5D7|$77)RQP(V GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5D7)7t$>RQPhx$D7;@7}0u h$Ph\$Cы\$1B\$D$\$D$T$jh$jxw 1Ah4"WV88~b88 ,v3Q,v3; L> QPh$lؕ7tkD>L> QPh͑$F|>uGD>ؕ7ufPh$8"L> ffPQh$ ^_[WVٕ7u8jjV  t'86v PWh$hh|8m"6Q Ph$$hh|8I^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h,$B$t$t$ t$SPh$! UPh7$ t$t$t$ hC$t$r PhU$t$ X PhkY$r0G9s'GPh#| KG9r߃$^_[]fUSWVƀ8-uFh3#Vu 8h3#V1u 8T$,11CD$D$hj$Rt$0u Hw؉$x'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 o31;L$(ujy|1L$ 1ɉT$Љ $PL$Au $AP+|D$t2ڋL$ PWDI W軾f uމ$DTuY|$ujP Džuq~ P_z`$t8=8uIj Vh3#& Whs$T1FVڥPh$$V/l SU< h3#=8Mj Vh3#Х Wh$Vɥ \$$r#"$VWSo jjVWSa\$u`8 1GWWWjWjWjWVvWj kVW: u h$j}k jj9 uÔ$8j* u7 j* j j9 t)qtOQ* j j9 uٔ$8t1Aj jh3#臤 ukWh$jh$t$UX; $QfB0WW9 $t$r#VPShPx%WAj SWh$jAVv&=8u$r#rVPh6$h|v3jGfD$tPh$A9h {'Ph $h|v3j USWVPu } h {'WVq cR~5StET ԡ8͍Hw4$ y'ġ8벃L8̡8둃ftTdL 8tȡ8eء8VС8Gܡ888) o3n8=ء8tjjhf%7 8ND$ jjj"n 8jL$$Qh@hP u h%c8i )ލ<S H $0y'=8t1Aj D$<1CPS̀D$D$ PS趀D$D$$PS蟀D$D$(PS舀D$ D$,PSqD$D$0PSZD$D$4PSCD$8|$ |$z |$o |$ d |$Y |$N F 8D$8gtj5817 rD$ D$$r#D$D$$r#_;-8S-t.H$1ۃ=ȡ8uWh$hp$hX% >hw&Sg =ȡ8uh[$hC$hX%{ 1C8FLCSS H3 VT$W$Xy' \$@1ɍP$(z'81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128#8L$L$# 1AD$ PD$@PD$ D$<+8R D$ Pj$8+38+38+3 88׋t$#D$ Pj8d$zT$ ED$ L$TL$@JL$C8"+3-L$#d$d$d$L$׋t$ 8:88@.@8"(808 H8\$ X888 t 8t 81SSP L$Y\=8j$)/jD$D$ D$$r#D$$r#8L$9a|$u q8 8ta|$  ‰4 D$=8T$tD$1@D$ 1ۉD$0hxSh`8访 atgcuL$c8 h8b88@8t88l888 X8 8tJt$(~A|t18t|$ ObT8آ8tPt$ tH@WVhآ8e آ8=ܡ8t=С8uw$8tMD$tH@Vt$ W#Wt$ {t$${t$({t$,{t$0{t$4{t$8{e^_[]jh(&j[ ShC#h$ hɛ$h$j[ WV)3t#|$ )3WP1tFu)3F^_USWV,׉1l$u58V58+ D$ VPUh8WSS|$G"ww Gw\$VVSVjWD$t2Pj1PPSVjW貑l$=ܡ8t'h$=8tt$ h $1|$94D$=ܡ8tCхL$% D$@8t Ky9=8Cx$CD$CPS58& u誻87t 9D$=ȡ8u{=ܡ8t i5ġ8jt$ Pi$P$tH@$5ġ8P|Pi$Pmhh%`9VxEt7tu$$,$ P萒Ph"$F1G,^_[]Ph@$h՘$ h"h$jX USWV0=ܡ8AuF8,r!4,{'h"Phs$aPh$sPh$bF<5$dz'vvvhњ$5F|$(QPh{'RW3o$v3PWDGh$F({'QPSPWn$v3PW Gh $F QPSPWn$v3PWFV xdvvh$v V!}'t{'~ |'tF\$(RPQhSXnh$v3SjFV e^_[]FPh$Ffhɚ$F h$r#Ph$ F|$(QPhp|'hWmh$v3WEVƘFPh$FHfw6$z'h$ch$UPh$BPh$/6h$'h$ h$hY" h $1H9vh($-NT$(PQRڊ FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPh+$D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$XhN$PSVh$ h$v3~~^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV莁+D$  PY1PPWSjVV|$dt$ \$h$Y D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9+3tE+3P{y$L$t hc$h$QQh%PPhM$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh$ ,v3H ,v3~$v3H $v3 h$v3j T$h9t$,h h$ L^_[]h՘$ jh5$jyH D$t'T$tt hc$h$QQh%PPhM$ ËD$t%u$%tur$Ph$i$|$Ph՚#USWV|$<\$8D$4t$0~u/jUb u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR~",Ph$$PWhk#  ^_[]USWV|$4t$0=8uM8hh8Mt 8'j.h8st@hPh8~T t"^tCt0Wv`rhhxe%h8>T ^_[]1w)ȉPjQ SVU0{ fEu jUZa WUu&Vh8Sh$hh8x8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh8Shӝ$hh88[SWV$L$4D$1G}'t$"tZ@:t9rD$Ph$,^_[SWV|$t^D$uFD$jjP t1Nj0j.Vrt@h8P\u7ut$C xe%hVh8wR 8^_[VD$L$ 1Ҁ0QRRhh8VP謊 thhP%h8q 8^Au yuyt$Qtu ȃP諘 Q裖 APh$hh8膼8SWVD$8Q4ݝ$R84ݝ$R8ƄR8.r|I1AFL$ tWWVWh0'7 u;D$ D$ PEWWVD$Ph0' tt$VĨ ^_[]h?%t$ l tԉ1|$l$Vh$PVSMHt$t$Wh|dD$P z \$tN1D$;D$ 2i9t$sVt$Ot!ʼnD$t$Wh|dt$y ul$$WhedAPy f$a$>ukSt$h#"hD%h$WƄ$t$85$ Ɵ$to$QPW  $Kà9Éu|$$P% 1h?%j Å~A1ۉh"PEujVh#"hPx%h$W1Ƅ$|$t$8\$ Ɵ$t薔$QPWG C;\$ mUS|$l$|$$PUSWV  uj#D$$D$<$sh$VYthj%VG3hUO3 Ƅ$hj%sut s hj%Vztt s h$VZt Pz= $8D$ h$V1tHá(8th$P脆(j,S`tZ SL8,PD$PUxD$!=`ÉUh$$. S7Dž?tG<$tSWUh$h%h$VV tEUh$fZh$T?Uh/$h%h$P菪15(8t$ch$ D$8}"D$$E$:D$@B}"D$$L$t$ }2D$5$D$$$r#}D$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$Sf\$ =08uD$$D$ P$P謣 D8\$t$Ph$ 08PU5 uUh$$ 1@$~#Qh$m1@$\$$$Ĕ ^_[]$Ph$$j% +Phȣ$h|v3{ jUSWV L$48$T$t-88*jh48 88š48$T$1i E$48t!u6$t$PwT$ uF$t$PwT$ tEM<ǃ hu$~1 ^_[]ËD$ t 048$4$݋D$ t 048$$ؾ<8Phh<8Z# uh<8h$$j# fVD$t.})zhza9h$5l8 TY9T?%%P'PQhPx%5l8ӟi#u5l8heL$RTY9^ËD$ H^WVθ%P'PVtvt)uVh$5l8c TY9SGt8tPwh'$j wh2$Xuj whza9Q0 Ga9a9^_WVD$ t;5a9D$=8 |8u 8P';pt8@uVh $j! @u=b9thb9Ph'$赀 Ph2$襀u5a9=8^_Ã|$t :$WTY9Ã|$t %6TY9Ã|$t A$rTY9Ã|$uha9hG$5l8ߝ TY9Ã|$uha9hh$5l8讝 賱TY9Ã|$uha9h$5l8} 肱TY9SWV$$DŽ$HH$pmƋ$ ƒtS!=@Y9Ҥ$tͤ$Ȥ$atσ=LY9 =PY9 PSj $;rtr1Auu($$h$PQ te$P$$h$PQa t8$(1;BQPVW7V?TY9^_[USWVx֋$$t{tp11@=l}3D_t1z\t r9΅t<΄t45l}3AҀ|Vy5d}3TVP5l}3@u΋$ $t`1HhjY9trʄt<$1ۊXY9t8tCu 9siY9B+$=FFu4$D$|$ 1 zY9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ z]9<$؉D$z]9$to\[$uvz$\$-l}3BDEJ<0HB,t ]tVрy$t[l}3BDC$G)=~"B $tG)=BJB5Al}3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5l8h$: <$?uhVW( x^_[]USWV0$Du%$H$Dhפ$PQH y1E-hj9hE(jUh@8 t$H4$=8I1VV$P Í|$0;=8=hj9$H5PY95LY95HY9s =@Y9Ҥ$tͤ$9ƒ=8RPSQGy=hj9uE=h8t<88$Hcthj98 hj9VV$P Å 4$jhj9辩TY90^_[]Ã$D|Ã=8t=8;1 T$󫋄$HRjh4$ |$D$=8ʉǃ=hj9$H[L$05PY95LY9j =@Y9Ҥ$tͤ$9Ã=8VPRQw=hj9u9=h8t0588$H1thj958G=8-=hj9$H$HL$05PY95LY9j ƃ=@Y9Ҥ$tͤ$$H9=8PVRQv=hj9u_=h8tV=88$H1thj9=8$$H4h$D$Pq E;$Dnj =h8t#l8@=u1Hjh2#P8 jh@8Y WV=hj9t@=h8t758=989158=9u hj9^_USWV1@=8S=9Fϻݮ$ͅtUSh$5l8W5l8)It$PhVhu3xdd}3L$DH?u1Hk8Y9RV#Ph%$5l8  =8Y9t508h;$5l8 5l8hb$u 8Y9t 8TY9^_vh$5l8褈 mhQ$h8t$t$TY9h^$h8t$t$TY9ht$h8t$t$TY9=8t 8Y9h$h8t$t$aTY9WVD$ t+}&}.1=88RV#ޛ1Ht$u8vh~"VAt\hRV#VAu$8RV#Wv8vx8hVW =d888=d8t?~"?t5 l85d8>O#t58RPhɦ$Q8#5l8jj6h$i881TY9^_h$h8t$t$ TY9h$h 8t$t$TY9WVD$ tZ}UuZt$~h~"WT@tOhRV#WB@tBWy7vh$5l83 81H_1=|81@1|8 x81ҾRV#t~" щ x8PVh+$5l8ԅ1=|8TY9^_ËD$uD$L$hE$PQ tvD$ph$gu<=TY9u0=8t5l8hV$ D$ph$fgu+4b9`f9`j9TY9VD$ L$TY9t u]H 8HQtsPR t8O=`b9l8t5h`b9h$P藄 TY9(^鑘Vh$WPjj$h$5VO'^ËD$tIDuD$L$h$PQ? t$D$phק$Gfu4b9TY9SWVD$-uD$L$h7$PQ  1G=hj9hE(j谴Wh@8謚 t D$1VVt$4 ǀ?tx=hj9tyD$thWhק$teu 4b9=hj9uB=h8t9=88D$bthj9=8 hj9VVt$ DžaSj˳hj9–TY9^_[ËD$uD$L$hߧ$PQ tmD$_D$L$h$PQl tI|$BD$ph$mdu8D$ph$Tdu4b9ÃtTY9USWVt$ |$.E1ۈ$$蘩tÀ8uq"S^VōpW$V|@EUSPE ,$#9tV8ƅtyD$=ti1PPh"t$VU蒂tFV# >5l8jj,h$ 2% u v1.蒔TY9^_[]TY9USWV D$ #D$$L$ h7$PQG L$ ȃ#D$$L$ h$PQ D$ L$$|<$Dh#t$Vt3$8|t+4$ $H$D$ 3D$$hZ$0VD$1E-hj9hE(j{Uh@8w t D$$\t$=hj91D$ H9=8"t=%9$9t$t$$T$$VVP4t$Qhj9u?=h8t688D$$" hj9tA hj98E_t$j蚯hj9$9t4$o!TY9 ^_[]SWV$tKjjE'tK~S 9uWj1uhq$ 1HTY9^_[þVm FujjϮh~# Q%tj/VE t@hQW =|8t85l8V l8HQP~ Q Pj ݀|j5Y9h'Q#WV~  jWV~ Vh^$TY9jqSWVPD$D$t&D$t$h$PV rԐTY9^_[ËD$ph$^u|$h$h tD$x|$Wh$^WQPjW] uP|$h$ t D$x |$Whƨ$;^W0QPjWD] 1ۃuM|$ Àu*D$p Vhƨ$]VPPjV] 85l8hΨ$- D$TY9}=`j9t =`f9u=`f9t#h`f9h$5l89{ TY95l8jj%hݨ$,ËD$TY9 =`b9u=`b9t#h`b9h$5l8z TY95l8jj$h$.,ËD$uD$L$h.$PQ茺 teD$phh$\u<=TY9u0=8t5l8h=$ D$phg$S\u4b9TY9ËD$uD$L$h.$PQ teD$ph$[u<=TY9u0=8t5l8ho$- D$ph$[u4b9pTY9ËD$t8uD$L$h$PQE tD$L$QPh$r# TY9USWVh$V( $|F$$h1Gh4V 9}hh?%V G9$uVh$$Zu jLT4b9^_[]ËD$t8uD$L$h$PQP tD$L$QPhЩ$ +TY9ËD$thuD$L$h_f#PQ tHD$:D$L$h$PQܷ t$|$D$pph֩$Y Ãt請TY9VD$t$588u h$Y%nTY9D$ ph$rY58^VD$Hr4TY9>588uh$*YD$ ph $Y58^VD$t$588u h$X%越TY9D$ ph$X58^Ã|$u|$t{TY9Ã=8t 1PP)jE=8t 1PP jj|$u|$t"TY9Ã=8th$$%X{V1VVcVijVPD$ D$t}uD$p*TY9$诐tǀ8uq"Wu=Vj=,U褲UWP^ Uh?%S UVS S TY9S V {TY9^_[]USWVPD$uD$L$h$PQ裧 h>$Ϗtǀ8uq"W<ÃPб|@CSWP =8Y9(Y9$-,Y98188Y9(Y9,Y9L$Pjh$qVh2$h=8Y9-,Y9$(Y98V zTY9^_[]SWV|$uvt$>he$W t+hݧ%Wt t hl$Wb u: 1Cvѻtu&6ht$5l8h$PY(t$Dh$$t$Ы $t|$@t$t$@ЃD$; 8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$HD$H|$Ptt$PD$P$t$qDŽ$$t$MDŽ$D$Te^_[]ËD$lt8uu L$DUuD= 8t;P聡D$HL$H+ 8tD$Ej/t$L t@Pt$Dh$t$H5D$t$% 8L$D|$D$81,Y9(Y9$Y9 Y9$$9$8t1$Pt$職u$\$` ,Y9(Y9|$py4Y9$h32#t$LD$|$t$͸$QPRu5$8$<$$$\$` $Y9 Y9(Y9 ,Y9t+t$jj5,Y95(Y9PY=8tPt$Hh?$5l8QV ,Y9(Y9 tQPhJ$5l8+V5l8h2# 1O$=8K8 1O$*|$pu D$TQhޱ$Uc8ht$hW =Tb9|$Lu:|$LD$puuh$t$Hh,$*uh$}D$L4Y9`$|$LD$L8|$dD$t$h $d}8Pj$$W*$<h%V[1A$<$ǀ?tvj:W t=@j $QP[ ~޻t?$9u3;$u*W)9$<r$)PWR t/h%VZDžm1Ft$Hh$$1$t P$$u |$p$$(Y9 ,Y9t$Lt Vhj$t$dخt|$dj%W t Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1h%W)tVh#$`$(2WDŽ$t$D/$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB X8JBB D$(PRW$8n, t ]70RtD$(Z$$PN-j j WhSvvh t%h"PS j "PW =8t+D$(xt!~U$ti$WSP5l8[Qv jv Åx`=8u~PvvS躬x)$P$P$Ph$r#ykSz 1KW$Ph{$ Nȉޅɍ$P[* PW$4h<$5^h1N=8tJ$t$uPҙ$$t$uP譙$8~Rlj9Wh$'tNu1h@h$h84 it\8059ދ$tPDŽ$$t4W$PjW0 $tPzDŽ$$t4W$PjW0 $tP;DŽ$D$(t P ) |$D$$hj$8<tQh$$D$$\t$ εj~8tVj=8tWh$5l8xN t$$tI=8D$tPt$hhɵ$h͵$5l8;N1@t$ht$hh$f |$dwh$VP #h$V9h $V+p8tph {#V ȅu(Y9 ,Y95l8hɵ$? 5,Y95(Y9h$Vɭ5,Y95(Y9h4$5l8fM1F&1t$lhٵ$V菭 $`#=8t"D$$n$t[$QPT|$h$/ tPh$W0 h$h$h$WD$$0$|$Pt1$tɵ$t#tD=8$tPh$5l8xL FWh$$8W襬 $$0t-=8tPh϶$5l80L FSh$Wd t=8t5l8h $蠾 h#t$ 3t$̭1V|\$D$Lt$P523.Ɖ$$ىD$ډ׋$$|$8‹$4$8$ 48ˉƉ$D$@1S$Pd$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$襟$|$`tCt$5858ߢ h#58iM|$`=$@$Dt$h,#|h#t$D$8|jj n$D$@h"Pxk D$@|$@DŽ$@H,Y9 (Y9 m!ڃt9}M#$H5$Y9 Y9$$!;$$=8t5l8jj hȲ$D$T}D$@$v3=8Y9=8,8 (8ƒ089}%l8HQP ;HQ#l8HQP<Q 8tB$ڋ$!t  Y95$Y91ϋ$H1 D$h=%P h"t$;D$@|$@tDŽ$p t$D$@Ph^$hK$Vhm$O"8)PSh$賹h$%Pt$Hhֲ$jkh$hٳ$=Hbh'$1HL$D$ D$8t$4D$ D$0D$D$,T$1@މPj =t$+th$jct$@$=p $#$1V$W$$$$$$t$@Ѓt$@Wt$. u.5l8$PP薊Ph$Vk9 ,8=(8| jj$Y9x& (Y9 (8,Y9,8; Y9u1,8(8D1\$  (Y9 ,Y9PL$T$ T$8t$4\$0r\$ 81tt$hr$5l88 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$ED$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#;7tt$h$5l87 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$#ED$L$ L$8t$4\$0h$DD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h#$$/D$D$8$D$4$D$0t$,$$1@މjh$CD$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h;$h1$hh$CNUSWVD1D$ D$D$D$fD$D$0D$8D$4jhb$Q, t}D$V~ƉD$j@Pt%L$L$4t8@P~ƉD$j:V@Pn~D$ t$D$0|$$jPW4 D$4t 8D$t{8tvD$ t8tj;P th$P`h $WJh$W4VWhH$A VhA$A1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh%V @L$ǃuC=8taD$t$uI$t>thh$V1Ʌ $t}thh$Ua1ɉL$<=t8=8t 1PPӼ=t8|$DhPW |$L$D$L$D$ tD$ D$$=88L$QPp=88t=ut$8t$8t$ 2s t D$,t>D$Pj3D$T$"tQPho$? "D$Pj詓<$l$,|$u'j/VZtG1|$t>tFhh@Q&l$LU l$t$1l$ -4b9D$Pj«9-4b9*x1l$,1Kd}Z<$t3$DSVWq Sh%W" SUW <$hhE%t$LV7 t$l$D$ D$<4uT588=$8X$tD$hP|$LW |$D$Pj58 8uj/U t@ʼnD$ D$$=$8tAD$Pj?>uP=TY9uDh|v3jhh$)1D$PjV8TY91ۃcÍL$%L$0d؁D^_[]1Eh$V=Ph$h$jܲ USWV օ\$ |$$jhR$Q l$t=jhb$U t;jhZ$U t9T$(.C fCPC fC C 1}Gt$j/UN$t9lj)CS0yS\$$UP { uG<$WxC Uwj@V|$$tZ{ u t8w@PwƋ_j:St@PwG_Ot[uUnj]U$tYÊ@t<:uL)SUV V ,$}:1j:V/tEt$t$Vh$1ۋ\$ t3tHj PU4 }t $9ut=s fCt$t$Uhƴ$:CC tWt_uk8KUVhq$: t$t$Vh$:\$ n1HJ38(u$r#U.vC{u{ %t%P vC1 ^_[]hJ$j迯 WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*5l}3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]VdjU\=h8t<Ph$jdV_'~ l8Iu1IPVQk{ jh8B Vd8j[=h8t<Ph$jdV&~ l8Iu1IPVQ{ jh8#B V΋tPFtPFFtP|F^WV΋AtP_F~t,WPjW  FtP,F^_SWV׉΋j:StDS}sP;tj%SrtShP$V SShG$V G tu)GfPu G=tPhյ$Vщ h#VÉ^_[USWVP։ϋ\$l$ 8<tP%ZPUVW誏j Z x.1tETw4s,I  $8 u@$Phи$61@^_[]USWVPӉRlj4$6Mw sEWSU\ 1uCL=ʀw һru$wsME$(^_[]fUSWVL$d$`1@D$1ɉ 8 8 8 8 8 8 8 8 8 8 8 8 $8 (8T$(JJJJ5X8rBJ PRSW t u 0b$@t0hP.P PSWhº$4TY9hWh8z Tb98<$l$\$HWj j UhSww t h"VS# j VU =8t*$xt!U$ti$USP5l8&w jw x6ư=8uPwwVyWVx USh{$+ #$d$dh$3 TY94$ xwwh8k G84$ $8D$HSh8VWS D$H8=8uD$jUjjV h32#V9h"V9=9=8t5Tb9h#$5l87% j}^\$WSjUV WShUV Tb9c$d$dhۺ$蹣 1h$j29t P9t PTY9V#w 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4,8l8hj UD$(D$ hNjTD$,D$D$p8D$D$$$TY911L$8L$\$0D$t$$ 8<tP^TW59=W59r&wW59݁tPhW59tPhhha_$59"59Cà u $E8uw|$5uprk=8ub="W4$j,Cj"=08SVh@$5l84$jBj! ^_[Åu1t P!=8t jB  |$1=8P!=8t j  |$1=8Pb!=8tV 91j C$,y hV$=8t TY9joYVV=8t j j =8t TY94$jAVt$h% t)Vt$h% u=8 jx =8{jlWVd81VA5hj95,84Y9rt suY$w$dWPVI Wh$V l8Iu1IPVQ ` jhx8+' Ph$j USWVD$=8p888jjPݘ 8x8tL$jQjhP@ 8<<=D8w=L8j=8=|8u 8h$+Ɖ=8~&t =8u!h{9h#5l8 =8tCTY9=$ 5l8h$/ hϼ$]1A =H8=P8=8=|8u 8h$eƉ=8~&t =8u%h{9h#5l8 =8yTY9=tT$ wJ5l8h$m ?$tgL8h#$=8 #$3$t2P8h($=8($PASV3Q LPSV3Q QEPSV3I1  $TY9=t$$ <$$T$$$VRQPWhn$hp8R y$$:$:$:$88D$ff8k=858^ 88=8188u f88t P^ 8jjP? 8=8u(QT$ RQhP 8 8Qh8P x8tjD$ Pjh58N D$1888Ĵ8ȴ8̴8д8D$Ph8588 OD$8j58iy h$Ɖ=8" 8$t#/=D8=L8=H8=P81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =8=|8u 8$P$Pt$h$Ɖ=8~&t =8u.h{9h#5l8  =8+L8 8tPV8 8858=88SWVRQPh.$o8$8$´8D$|ô8D$xĴ8D$tŴ8D$pƴ8D$lǴ8D$hȴ8D$dɴ8D$`ʴ8D$\-˴8̴8=ʹ85δ8ϴ8 88PQjRVWSUt$|$$$$$$$$$$jjhE$VX=8[=8N81ۉhϼ$輆1A#h$hо$u 81ɀ=8D$jD$ Pjj58h 1Ƀ5l8h-$y 1E=8TY9=$ w5l8hq$h$58Y 81AJ8;TY9=t+$ w!5l8h$W5l8QNy 뗠8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph9$hp8 , |$ |$|$1-8-д8-̴8-ȴ8-Ĵ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ fD$ L$$T$(t$\$VWRQPShB$hp8 1-8-д8-̴8-ȴ8-Ĵ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ f8f 8;88jPh858s`1ɀ=8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$hp8 \|$ |$|$18д8̴8ȴ8Ĵ888f8L8@uD$ $ ff 8jh8h8d 5l8hν$5l8hD$5l8h$5l8hT$5l8hν$=8USWVX=88tuP~jjPU ƃPj58T t$8D$fD$D$jPq8<D$T$ |$ Mbt$1PWAT$L$+T$ +L$(x@Biy1PjV` u/8t%8#th$uh$8t$4\$8VS58T ǃu+8t 8#uoVS58ZT t׉58%T =8t$jWS ut:|$9uD$0jPjjWG V58EhͿ$58S 81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$$| h$} $tWQhrb#| h$Y} مtWQh$| h$5} tWSh$| U܄W6VjVjVjVjh$j9$<|$|$ $@j:0t$@0<jh8N hj+hj $@0j@V脑txGp5 <hS$ <?u D$PPPh6$h$v31Ph?$F 8P*81\$(ht$Sq t$~$@@FF =8t 1t88$<@VP=8 8tȃujUS 8ȉ8t=u98Ph$5l8 58" =8d8|$|$ t&WWWv$@$@jh8y hj^hj O5$<h$Y5$<h$L5$<h$?Phi$75$<j?PVh:7#5$<h)$j?PWh$jb ރ uR0蝛Jt$$D$D ƃ=8tjWWV P% PVh$WV =h8t>5l8h8P K=8th8hlY$5l8 5l8jh@h8hu3'tEt W=9k\80t&ƅu'G$Q$5l8P9P /2$~ ts$=8t9j 6Wn \88\8059V =9t'~t!l8HQP;H~Q~  Pjhj hj ^_Ã=h8tl8HQP~Q fPj 4fV58u<<23t!@23hrb#P`tFuh$j_ 58$tPhh83 8^SWV|$1t*<23t!<23WPt Cuމ^_[V58u<<23t!@23h$P赕tFuh/$j^ 58$r#tPhh8P3 8^V98 Y9 91Y9 \8A95P5\8d;t9^USWV1|$-+3t}D$+3111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hV$D$Pbt uu ^_[]eP:ơl8=8Y#t$Qhq$P" +3t7+3 8ttPl#PV: 8uV-jV^ D$E3Vxtǃu&Vt$h$ Vt$h$5l8~E|$tw7j h$5l8["j 7t$Vj t$D$PjW Mr^_[]USWVP 9 Y9$t!uLY9t.u=Y9A99!2323Y9 Y9A t tu Y9Y9tu$Y91BY9 Y9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5 Y9 9;$ Y9 91tu Y9Y9Y9^_[]WVt$ t8<23tD23VPxtuVh$jZ G^_h$f=23u F, 23l8@=u1HP3 1;23USWV}uCjh9k999999(Y9 ,Y9 99|$(jWk(Y9(8 ,Y9 ,8w+959G1;9)ʉT$t$999s?D$09D$(L$, 999=9D$8D$"8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSWl ;{{{ {{|$$PS\$j袹U$1ۉ___ __$PWjr 1@G ____SW|$ S\$ l =8fDŽ$ 0Y9t$Ph$$hQ1F$Y9 Y9ƒ\$x|$|l$xЙ&ݜ$݄$ p&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh*$QPGY99|ӡ0Y9tPL$ HL$ )΅~DQ4))h$r#ShĀ'Rh1$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPh;$SWOL$(+ 9T$,9\$0+9x@BD$ډL$hT$ll$h|$@,8 (81G؃D$@5&vqL$`\$dl$`Й&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4'RSt$DhH$QP $Y9 Y9ȃ,8(8D$u݄$|9s0;T$ D$r$|$\$|?؍<)hj$؍<)h]$QP; N+(Y9 ,Y9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRVe $^Ã0D$4L$8T$ 1ɉJJJ JJQRP x$1H0Vdz0j足0^USWVh=8u=8u }t$XjV;c+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5&,8 (8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$r#t4#|$d54Y9PRQh$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$r#r4#+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ 9HQP~ Q PޙʍHr̃t"19HQP~ Q P蕙\t"u59HQP~ QPV9Gdu91G 9HQP~ Q P[~#\uE9HQP~%Q'H wr? t:,u3P辘t%9Gdzh$ 1N9=9ixe%'h9Ptu :v2USWVՉh9Q{tDj.Vbr1ۅt6UP{u&)Wh9V{U u1ۀ91C^_[]SWVD$=8t5Tb9h5$5l8n nD$t$h$PV` uA 88t8t$~Vt. d89PQ TY9^_[Pv蠘t=8t"=8t5d8h}$5l8 1G=8 Sh%hza9Q =a9=a9Sh$ha9Q =a9Shq&ha9Q = b9Sh;"ha9Q =a9Sh:&hb9jQ 0b9=81PPv h`$j0C WVPh8ơl8?snt$h$P¿ Ɔ8 8?)PRQhu35 x?t$|$ 91; \8 ^_Ph$1 ^h$t$hc$5l87 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=t8tDt Wah$.$t Vah$PD$D$ L$PQRSm:4$uu|$l$ 8l8tQShH$PGShW$P6 D$WjPUhu3tU58sƉ$t=8t`VS <WFWt$PN Wh~i$VO WSVO $t P`4$Vh$貟uD$uqh$F# t66hs2#t$hc$5l8;TY9kt$VD$VBPjVV D$Ph$$Ƌ|$WPjW) u{D$ u?h$" tt$VD$ V͑PjV D$ 8Phƨ$覞Ƌ|$ W藑PjW諝 1ۃD$  ˀuPhƨ$bu_4$dj91F=8uR8,=8lj9Sh$ђOuht$a 1$tP^$|$t.WǐPjWۜ D$tPo^D$|$ t&W葐PjW襜 D$ t P9^d^_[]h@h$h8cL \8059Xhh`b9 u`b9`f9`j9V58=|8u 8hO$ߜt>h$h{9J r1ɀ{9.)h{9Ph$5l8djh$h{9N tfjhh$h{9M tN=8Xb9t\b9j h$h{9 uh5l8h$, S=8Xb9t\b9a9j h:$hza9J thza9h$5l8蓹 1HPb9Lb9Hb9Db9@b9h{9hf$5l8@ f{920h{9h$5l8 {9t$1 U2Vh$UjK D$(Vqp!у $ 85l8jj(h1$au=TY9u=@b9u @b9tj=|8ua5l8h{9! l8HQP~ Q 0Pj 赲# |8tUh$5l8 4$|$58=TY91Hƒ4^_[]t$h$j2hL9[tL9h$j1 USWV\$l$jWQhhY#WAhUh"$SI Džu&Uh<$SI DžuUhV$SI Vjg^_[]SWV`j958=|8u 8=TY9h #7`f9u_j h{9n^tL8tGx"uAHt.1Ҁ"ux"u"@`f9ZHt@r1Ӎ`f958=TY9^_[SWV$h$V> V < h%P=1Fta\$SW舌 t?|$/uH$VMPVS@ 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhw&P~ ƅu 4$U~ 1$^USWVHuI\$ $Cj j ShWuu m t "hVWS5 j VSG5 8]t/M I9Nt vuvvSb jjS ƃPjS \$fD$=8~%|$@jWI88O$Cuu S VjPm 1D$ PWhpq" D$ PWhha$h$!81\$@jPPhSvvl thh"S 4 ҇8Shm$!-D$ PWh$訇8$\$=8~N1PD$P@7T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,"8t8#tj}ud8AuZku<FD$ t:D$L$ PQhhui t\$ ۋEu Y 襆D$ PWh$c  1He^_[] t$aZ SWV|$GHO~H0^_[Ë\$1NWnwu4G `f@u$8t 8#ug GHO~막뭅tUSWV|$\$GHO~H^_[]1M;G~ uWS/u4G `f@u<蕅8t 苅8#ug GHO~렉륋t$t bWV|$h2$W)wt.hw&Wwt!t$?tt$ h$1F1^_c th-$jR# Vt$ Vt$ á t^VhV$j,# USWVHE ML$8t$QPVJ DUt$F|$ |$_ $'Cىt KDP@uD$ l}3|$1 ,,C t ^DH@ujGt-Ê l}3DA@CCu 1OD$" 8l}3L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtl}3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =z31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhP 911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P 6 $(4$hUt$P5 L$l$ ȉD$<9 ɽ|$Xl}3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't l}3DQ@tVFu$$  Qσ s[aj $( PSσ ua8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A l}3CDP@t Cu;|kwl}3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =9 hh V EKCDH@uٺ$yG=9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@uH%ƋD$pWXO@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,9t!9}uEpVO*mj 9xt$p@ 9>GWVt$F1Ejhh9f Å1|$څ,5959hr$|$t5959hU$9 911<9t6 uGp5959h$I W߅uFu49t@Py89\9P``9(^_[]R5959h$jt 5959h$5959h$VQR5959h$$P5959hH$$P5959hw$jjUj 5959h$lV5959h$UP5959h$>5959h]$(5959h$Q5959h$5959h&$5959h $jjq 5959h$5959hU$5959h$5959h$n5959hI$X5959h$B5959h$,$P5959h$Sh$$95959h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u49_NSFJ1<9tJ9ouwvScKt?G $pSH|$698^_[]Ë$@S5959h$jW SWV׉HЃ s%j SVH{ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC9\9s\9؃^_[]Ë59=9SP PWVh$jh USWVP׉΋$1m~ w]$Ă' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x 2323>u)jH1҉P523 235ojnH@238 23>u j59h$v3Au 9P`hy"jy OPPh$h|v3kjy`USWV\$|$t$ 91EtB5Ė9WVy 995Ė9@199Ht8h32#pkĖ9 9I 9KphU#jh̖9grf9"9 ...9̖99@Ȗ9 9 =9uȖ98#uxnu 9  Ȗ9W1 t,E-Ȗ9@J}99R)ʉ1ɉ99‹\$k91m1 9Q9u>#u~nu 9tĖ91B C1ɾ8f 9@Ȗ91ɋ\$u9\$t1A ^_[]É2KQh$$j USWV|9uN 919u:=9u9u3u39$ 9$v39y"91NHQPP=?9=u3P==9tC9SS59 th959膼 o9=9tM 9t=$v3tPU=V 959h90 99=9t99 9@99=9QPrf|$󡨖98t0W599V W59V =<W59$V W59$U V U2 PWVh$Wh9'c9h9R 9޻t=$v3t P;h"h9Pg 9rH9tt$t$P 9H9tȋL$!QP 99=9u99 9$v39y"h32#Pf959h$$ 99$@1Q59P 59h9h9 ƅttb9|0 uNt$@ $@ $QV59P91@|^_[]59h$$j 59hp#h$h$59h$jc h$h$ =9uh$ h9-jsYh{$벡9@ u:HQP~ QP:t59PΆ 1=9t 9t SWV9X1t^h32#3dt&Nj@HOW|:uW9[뾋HWPE W81F^_[Vt$Vgt^Vh$jO Vt$ D$tVP)uVh$j' V^WV|$t$ WVt^_WVh$j SWVP\$|$9t P]D$jPSWg PL9VPSWK 9^_[USWV9jh991FD$ 99<9JBtOz T$R uW|$+;A 99d9ыR L$y th|$ 9)щ;HT$7D$t{T$A 99+d9. 9;H@ 99|$tod9u1ۉ91;A91;AT$t1~T$ d9=`91ۉ__ WjWSQPZE|$t4JT$B8 9;H`<9T$d95`91~>~ VjVWQPD1FT$1d9=`91ۉ__ WjWSQPDT$t tCsBtt$u 9;Hr<9xt$t91BtȉÅQJA7$|'= 959$=9FPj WA @) 9QPW 9Ҿ5=X9 X9R҉Y = 59h(v"5 9 _ u 1Pjh2#9S1P5D95@9)1Pjh2#@9S1P5959S%1Pjh2#9S1PS = 9 T$9=9GPj S ƅ $9D$4)أ9$9 509499a89j5D95@9h9j5959h@9 4 5 9rQ  T$99D$<= 9$v3=2311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;523r5 9jjhG%s5 9j$l 5 9j l 1-RL$ tKQD$ ;23r5 9jjhG% 15 9WjS t$ tsQ5tejPh\' tQF;23r5 9jjhG% 1\')$Ph$5 9[ Z;23r5 9jjhG%W 1t$ D$13Ph$5 9[ F9ut$ t$L$)423F9r5 9jjhG% 5 9j$k 5 9j k  9@ @9  ֡9  9u55 959j59 =$9t5 9j j n jh9Y  95 = 9( 5 959j59 =$9t5 9j Aj 볋50949989+9T$JQd9T$ut Q;P 9T$Id9D= 9yBu%hh r蚫 F 5959P ;9 jh2#rթ  _ T$=@9ujjh$r#h@9  9D$09D$,9D$($9(9,99@9$9L$(t$, @95D9L$0 H9L9T9P9= 9_ 9QZ=z399 @ 9 99r 89֍49@PQ89509 F@+6vFt Pn uF6^_ËFp vh$$j" USWV ՉL$l9h9щT$Љ$ l}3`9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B |99r7 |9P5x9x9h9l9$`90D$SPt$V it}ŋ4$L$]\4$L$t&uE\|99r+|9P5x9ƣx9h95l9F1C4$l9l9\$D$ |99ȋ$r+ |9Q5x9;x9h9l9 ^_[]USWV`}$111D$h$u W uu5$<>ut0Gtg$<;u$<$8u o3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%SQ t+8ttDGh$j 1E L$3V th%脠 u3h$$j tD$PW uh&$ۃ|$ tt$ uh0$뼅tt$d uhc$렋Cu/h~#d Q%tjh7$VV VeSPuK QVh:$ -Ph_$h|v3I jc>UVQt@t $e^]VhL$j WVP։.1ɉQPWg V?t$8tm.1H^_Y.8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvP:v F v}vF^USWVP1k<j@3~4j@3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<j@3j@3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph|v3jjCh$j:V1=9HPV t* jjj VVC5X<95X<9j5X<@9jP9t#1ɺX@3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$*ZtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? l}3DAh|v3jP W]@$'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLT=m$ 5T<s5T<胠1QQPSt$V5T<5X<b1U)19}1ۋ$p$)ŊEt9}1< ˊEE5X<h$1VV5X</UVj5X<Vj5X<L 5X<5X<2= d}3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h|v3jM bxu+=9 9σqt$VMaVĽV;u5X<Ih|v3jM ,$,$fUuE 9|)BfUh|v3jL ,$T$4xut EfEuGza|1x(| E9}ED ufMh|v3jaL !}Eu)uE t uPTu詼f;}]D; jtpQD; tt$4UЃF4; ~ttt$4WZuE tuP跸u sE uuosE9,Et)uE t uPWu謻EtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃurEE tPrE ^_[]Ot$59t$t$h$h|v3:ZO$@ t$St$t$ t$UPh$'O $A It$U59t$SQPh"$h|v3R:$j.USWVT$qЉD$ qMGud$ T$T$ $P$ǽ)j PX)1Ƀ QWl$ U|$ WD$p~tS;tNt$Cj S)؃ QSVWD$p~t G}uo $ $l$Atl$|$qbKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth$VSwj}|$Gu1PPw!|$ GL$G)VQwp  w% ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQI =9ۉ9t @tFj-9El}3\Jك@to@uwt uDZ@t< ty< =̟9u =ȟ9tI59$ttj 59=̟9uj 5999ȟ9̟9?=̟9u"59stj 59Xj 59H1̟9ȟ999̟9 ȟ9f)91ۈD$u9C597st$L$4 59s9Ƌt$|259sVUUU9}j 59|$uCj 59zKVW59tZ E߃ @ Ȣ99=̟9uW59rrt7j 59%5959Uȟ9̟99959 ^_[]t$Ph$$VPt$D$ L$ $PVP1A4$^h$r#t$t$t$t$USWVP|$ \$$l$(t$5999D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j591ɉV,$E|$@t[D$@8tRD$u:hY%59(Tt$@59Th#59TWt$Dt$ hw%59S4$59"pD$ 590p59p‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59S59pth%US59T/)PS59> 5959Ã~0L$ZD$  B#͖ L$X1)<(x1 l}3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQPw QtRD$(υ~] $9I\$)RPQ" KOuLuH|$@tAt$t$D|$W Wh|v3jr D$z19Dzf tN;L$$} l}3DXuh|v3j+  $9A)RPQq $8GED$t+)j Pt$59@L$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P 4$踮0^_[]h$r#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59l59l$tKۋ|$,;S[|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P軺tC@j P襺uL$$)݃} 9WUQS59Cƅ|$ 荒V}ƅtV5T<萆4$59PW595JPW[F1PPW޽ WD$E|$ GWUPS59裄Pŋ=9VYPW_=9VIPWE59(99#WUt$ ShX%59^1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV襼4$tWVDV@W蒈UP@W?^_[]h$r#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$r#t$t$t$t$USWVP|$ \$$l$(t$59赻99D$,$VAUPA14$SWt$(^_[]h$r#t$VPt$D$ L$ $PVP1ɉ4$ ^V59g59g^fUSWV $$$ `915:5:9gi%5:W9WVP 'Ft(=9tvvP藗 vh9&B>vuɸ( :9:::hr%8 D$|$ hEY%SU e~o~1pKrtCGD9붃fg5$<h32#VPhWD \$h#W 3 D jPh# t \$Sh|$W u4 ^Z%'W6PWVe t }u몋}tE$th#Sx2 <=u͍4@h#P^2 Fha]%V蝔 04$VW̕ Hd9h:h:hPY%5$< bS=$$$ Fm$<D$/J1Whf]%2du#D$=uD$h|$d}:h|]%h t61W袑 t@ < uFrW&` 1W` jh2$h$ AR5X<dǃ5X<d1FVVPWz 9$t25:5:W5 9hF Vj&Vjhj 5X<~&6hh9cD$D$@VljD$ VD$1Åj2P/L$t|$ o u*t$ %n ut$ [%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVhJ#q ![`9j:j"9\$u誸t`=d9t jǡ jjGȜ/П91 ^_[]Ét$ hT1GQWP Ph#h|v3U VAW =h|v3jj,hY%諱j Źh|v3VjhVY%花V V1Fh|v3VhEh[%hVo UWVV~ hK# PF 6|[=9t>V萙Ph!]%W 59R59T9=9t>VHPh3]%W8 59 59 9=П9uh|v3jjhJ]%se^_]Ã=9tá:tt$P輑 jQ jJ hK# tP3 t h%" Zjh.w hjUSWVB L$Q`b  P Ń j h[%U_ ~ uF t$|$ WZ WfD/UWp] Wjŋ>7Ptn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P4$UV S ŅSY ^_[]ËD$L$I41@fUSWV1t$d9j%Vt$t$ t$t$4$jjVP;=d9P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15d9̯W{, :VPX~Bjhy, :jPWyjhx=9V/Vbu%, :ǀ$jhxupz, :Ph$$jX jtO, :)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5d9jV#jr4PVf8 , :$*tKuKt!Pуt, :$P, :L$$Q3 tXD$t$VSVx)VOu]%u]%t*VB^_[À)ujhbsu Vt5T<w1WW5X< 5X<5X<gwSj X9;xhj_jZjC]jVkJ]%]%!}E'USWVο$WQS~ Wh]%S/ WSUb Whj%U S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQVЇ Sh]%V聈 SVW贇 Shj%We Wit VW^_[WV1t$t$t$ t$t$4$5d9jxVtkjo4PV[5xG, :*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ Q*D$l$1@$4V9D$pPt$V Z$DaD$|$ $%t uml}3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5l}3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8ul}3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04較 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWq 59t@WPh!]%V 59蹨599sh=%h]% 9t*W蚋Ph]%V 59\.5 9|0AtPhQW#hPx%j[1e^_]Ph]%h|v30 j UWVV#p =9t>V1Ph3]%V݄ 59§5959wh"hc^%* 9t81hs^%W莄V虊Ph~^%Wv 59[$0FPh^%hPx%j[1e^_]V1hhPhPjjPj jjhU3hи4xjP訪V輹^h|v3jjh]%i9tPjjh]%NjT SWVD$x1|$9t9Ps1; P]PVh:7#W^_[USWV$$$L$$QPhV $h32#V $D$Wj1K4$ 1G9r6|$  WUŋ$(\5F4$贇 ÃugD$ PVNuH|$dh32#V $t:|$G=9tVh,^%h^%P! 1KS1D5$$t 4$! 4$u9tVh,^%h4^%P 1ۉ؁Ĉ^_[]U袐$$$1K5Q USWVu ED$l|$(PVW  ED$8D$1ۉΊ<'t  j Fj'V裝u VFljt$ t$PSW D$ t$ )VPh"L$Q h^%V> t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W蒴 tWP É@/ WmP É|$PD$PSy ND$+D$D$ .t Vt$W tSy Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ h^%P 뒋D$L$T$;t RPSG |$\$$h?%S G|$\$1\$L$<t$0Vhht@We fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=X<jP|$ Wn 5X< j:5X<蠞j5X<[5X<iX<D$D$(D$$1WS蹫D$ L$VWSPQ31N|$p$ 9h9hptt$$6 =U3\$hU3hbtt$( us=U3ujjh0&j9 hU3hf@t$$۰ =U3t0U3hU3hbtt$(貰 ^%\$U39t P9t Ph£:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@59L$@EL$D$D$9}X=D$hP](=Fd|$u9Mx{;5X<tVcEjPŹ|$ۋ|$t h2#'hP'cu3H u3~u3#hu3H9Nj|$tycj& ;5X<t V|$ t E%u15X<5X<oj5X<Tct$(胆twPquW_D$td$8u-e^_[]D$t$ h^%jf VhG^%P 1S5 1FV5 Sjhf%4 VSg| t$v5 $ D$pL$|PSt$( t$ P]9t*t$h _%P 59w99t*t$h#Pb 59D9h@Q&D$ 0'u.h_%D$ put$vm t$e s h9REtt8tjP7 u%t$V6/ 6h1_%` jf3L$1Ph_%p` USWV։5X<訕1@P5X<R5X<`h 1PSU& 9hP$1:hPS1CS% 9Wh$$薂9h$$FPU6>`5X<cA@)VUPRQ5X<[tcjPt05X<蟫PV襪5X<!PV-1PPV  V_^_[]h|v3Sj+h^%蛑S fUSWV-1@=ԟ9$hd%Pjq h:rD$1D$ $ $?$Vʴ9;%VWo PWt$ S VWfo G|$d% 'l}3D$WsPWt$ c uD$L$DAu >uD$ |$O 4$ ))ht$Pp FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfF8Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p ԟ9 )) hPh؟9n 140'jVh؟9谳 t1GuD$(Vhe%j@$SJ 1PPD$0PD$XPSA t|$Lub44'h؟9hPx%h-jSj"D$L1QD$PPQQS@ She%s1=؟9su=ٟ9lul}3 ڟ9DH$D$$Ph% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV> j!W|$0W. iW&]hhf%QCh09PPji=09 h09PPhh=%hXg% Phf%j+o hf%WohUf%Wohf%Wohf%Wnh09hf%Wn =09t!h09hf%Wn $9hf%Wnhg%Wnhg%WnW膯hLb%jtnh؟9hg%h DŽ$h39VVj~j ha%V7; 39defa1ȋ 79ult1 j hg%h39: 39manu1ȋ 69ual1 391 39none1 79 tlf=39 tb=39t`h39h؟9hg%jtCh؟9hg%Sj~$$'|39ؠ9hhqg%HOh"Ifh؟9hqg%h~g%hL [ 8 ؠ9hs_%D$ Pj3 ~ht$ hܠ9i t$n{j hܠ9th_%D$ Pj ~ht$ hN :ui t${j hN :蚈t=N :t ؠ9hn`%D$ Pj ~ht$ hۡ9i t$z=ۡ9u:h`%D$ Pj@ ~ht$ hۡ9h t${zj hۡ9t=ۡ9t ؠ9hhڢ9^au=ڢ9t ؠ9D$1@$" h/9S$WLh Vڢ9PPjxVۡ9PPjw SWĭt%ؠ9|$$|$ t |$uj٣9PPjye|$t j9PPjz^h٣9 =9u=ra%=r!ƒ}a%t่a%=ujQh9jg j9PPj{hܠ9PPj}ؠ9u4D$D$Pj|$uhN :PPj|=N :]$]$tN :=39a%t39=٣9t٣9|$ti=9]$]$t9=9]$t9=ܠ9tܠ9SVWQRh؟9Phڢ9hۡ9h"h,$L=9]$]$t9=ܠ9tܠ9WVQRh؟9Phڢ9hۡ9h"h(jjj^ xP?' 29a%Ph$$hb ha}<h؟9h)g%hS^ S"jrjQ$H1WWV$Phe%7 t( ;$P$Tsh-e%jPbt^DŽ$ 1WWV$PhLe%7 ? ;$0$4&h`e%jPh`uq5: 1H t$t$6v1t$t$vha%j<$t$jԟ91@$F=N :h"ha%: ha%jft$(VQ VlPhb%ha%Wtf=ۡ9thۡ9h2b%WXf =N :thN :h=b%Wt<:<1ɀ=9/9QPh%hh9N 1^ËL$1Bh :WVt$=ԟ9u jG7Wj 螄u1@l:5:o1ɀ=9/9%QPVWh: =1ɀ=9/9QPVWh9 1^_Vt$V dЉh9$^WV D$Ph9 u:$nfsu-Vh9h:^Z Vh9h9KZ tWj 蔃1F?t[h9h :hMc%jPu>:c%h9VWh: h9VWh9 1 ^_SWV=ԟ9hUؠ9u(h%Q\u9h/9hc%U=N :t ha%˵=09t hXg%赵|$h؟9hc%hW h"WƅVWPhc%j[h$V[=39th39hc%Vy[ hLb%jj[ؠ9uGWPhc%jK[=39tDh39h9h٣9hc%V%[=ؠ9tCh%d%Th؟9h1d%h9h٣9hc%VZhLb%jZh=%hc%XPhc%jZ f%SWZhUf%WZSWZ=ۡ9thۡ9hpf%WcZ h٣9hf%WPZ =ۡ9tPh/9hlY$W/Z hڢ9h#WZ WhLb%jZhd%Zuhܠ9hd%nS=09thHd%XSh؟9h\d%FSt V诚j|^_[USWV։ϸjPPN tCËl$hjWǦ ojh؟9WV WVS蹌 S 1H^_[]USWV$΋$PhU%u tW$r#V ^l$PSU 9<$u:PVUWh>f%hC1Ʌȁ^_[]ÿ:f%fT$L$t$q"u/Átuus$Ãt6u8h6h/u uhP%!w'hhV D$L$FFh8V~ ȃ ^SWVP1ۉSSWSjh8' ~t{4$6V1ۅtjSSWPjh8'}tEh?%V# t&|$\$PS׃th?%j# uVXf VKf1ۉ؃^_[USWVh%0'\$|$jSP5 ƅt Eu$wS7IT wh=%7T G^_[]WV'|$u,'t%|$ jWQ5 t u1^_ËL$U34USWV1td։σS覗PSW虘 t u6P1PhPPj D$PU;. D$t΀8uɃ<$uð1^_[]ËL$U3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E%h%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ踡 $V1VP褡 95d9D$40$X@h"P@tt$45X<?hu3W 5X<F!9r d9ɉt$ =1MD$Ni8D$$11t=i8,4:tǍXUSpN݉|$|$l$$9, :ƀyH1ۉLPTXVUQdP , :" .hQPJP VUhh9;P ,, :L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP, :$()1HD,048Ƃ(1 d9<596W:|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً d9ɋD$L$ӾV W$r#QSPSl$GU , :$H@ VW$r#RPQSD$BP 9t% , :QUHDRhh%P聼 =, :$0@ơ, :$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-d9L$QP5, : u<5, :h_R$Pdž$l$, :()8 9 :VM9VjP蚜 L$ D$@D$9 d9yuƇy$u4P4 44S*$똋D$, :$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$8D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ48El$L$),$|4xfDŽ4DŽ48T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ8D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ8D4B1hPPPPjPPjjR$Pjz4$1K|$$8h$$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2V3H , :V31@멃=d9yud9d9s19dL$w BsÁt1USWVD$$, :*t1G.$ )$Phh%hV r%jt(hfMVhh%h% j$ i%W踢, :$Phm%hVh WVhh%蜥 ]h%Vjj\Q1PP3AhK jl1qX^$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$L'hi%D$P i%D$i%X3|$0tPhh%hW豰 Whh%D$P r%D$h%zh[i%D$P gi%D$mi%i3|$0tPhi%hW0 D3t#Phi%j\$S S\$W D3t#Phi%j\$S S\$W L3{"t2$\1%tWRhi%D$ P D3@h%t/i%D$r%D3|$0tL3tQh1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$r#$j%\$t7ȉL$7 T$wXgi%D$ r%D$$h'$r#$uht$$P > j%Pt$hj%t=uD7L7qQPhj%u`$$#d%D#t $D$ Ps% $T$h%RBT$ D$L$ 1@D$h#k%RT$i%D$L$ h%RuD7#t$$D7$r#@tRk%$r#yWk%$r#t_k%T$($r#tfk%T$ |$$$r#tok%L$,$r#tvk%$r#tk% $r#tk%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h*k%t$D?@غRPhj%t$>ClE;F{Pp\$CPWh SMt$0|$4hh褕L$0QjP7. P8WMtVhj%t$y> SvM=9u#D$@9@@h8Pihk%\$ S0>hk%S">hk%S>=9th9hk%S= $ 1|$@VVPWhn% ;w$r#r#t#Qhl%S= h-l%ٕh3l%̕h9l%迕=9t hBl%評hIl%蜕1hLb%WL=SF~W-`e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ T'hRl%Um- Ueuhi%hRl%UF- U>FjVD1Ktljt$#"hal%x1G$Gr%G w#"Ghsl%F1G ${$r%C(s4C8T'hl%1C<{@r%CDsP$sTT'ShRl%U{, UstlShl%U_, #"U0F$F^ FShl%U+, FT'U0F $F$^(F48ihi%hRl%U+ Utli%Whl%U+ #"U&0F$F~ ^Whl%U+ FT'U/F $F$~(^48+4$iƷm۶|$9U91Khi%賙tzh<$臙tiD$h<$Pj記 XWl$UVt$t$]I6NIOu4$=I, :Ph$$h 1PP}#, :)t5Phm%hU 鋔$ 1$ 91APuDFl9Ɖr:, :Ph$$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhm%hm%hhl%iL$T$jt$oËL$T$jt$XWV׉κr%jujWZh$r#Vh22#蘔 ^_V091ɾ 9r^^VD$09tU@8xtlIuAH1FVVjjhh090QRx tjh09j9 t09^À=09tjh09j9 09USWV 1WWj9 &iP 6SPj S9 t$ xál}3D$1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tER|$$t.jVj8 t l}3L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFh%P9yt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T8m%wEm%Ph\"h%V ^_[]Vt$D$QPbLt(D$t%t!hhPQID$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5:.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh+!h jjAPjQQhU3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h"PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwU vt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ .D$$@$;E tL$ A;L$tI1۸hSSh.ShjU>~`^_[]USWVϋ@PD$ P-hFPt$Vގ x1|$T$RtPQL =`91PWt$$t$$oD$T$1PWt$,t$,n t$t$RPqhzn%|$dWE D$,tjPpW, t$ Wt$ , |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:7#S<^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhRm%h:1^_[USWVu h% 'jVPR uh8j}wy jVw) U3OU3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhvm%hSR ZU|8^G|8PG@$QP"B'$HffsWBD$Bjhm%1ۃt$D$訑衑hm%hm%WC Vhm%SC Shm%Wq S$Ph}Dt$VWM6W}Vۻ$Phm%$8 1ۄ$hm%$衕hm%P苕L$LQh\&P0B t$,04t$jj h$r#RPjV |$LWjl}3r \DZ@uWQVt$hm%ht$ > 1C}$.1ۿ09PSWZv t$L^^^F~ FFVhQt$ ? t |$dJSjVu $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$r#RPjV VSh$ht$ }G8@É؍e^_[]09=}t'fy"f9 g9NuEt FuXt1€1ɾi9( Ӏu A'w'h9 ' Àu A&r  uȃsƄ\$,04t$jj h$r#RPjV $PVShn%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$r#RPjSI W$mPSVh n%ht$ ( -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hXk%q詊 Y|$h%u gDžtohT'6gtkDŽ$v/rDŽ$/dev,$$VuP" D$/devf@/VuP" Q踃낋E\tu xt@@AED$5:$ttt$PуuN, :덬$WPU! t$/devfF/, :WPV! [Sd\asa9aO$CQPU! {PWV, :$t(tt$Pуt Nj5, :,$1D$0$h@h"P5tt$G, :PUetTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS $WD$pV' l$ Uh%VV ǰD$hh"Wdh#WdtyhD#Wydtgh$WgdtUhj%WUdtCh"WCdt1%D$tdn%tD$VPS) VWS Uh%jU DžED$4$v PS} t"vh$$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=`9SWt$t$,`$1PWt$t$`|$u1@G:3s9%VPWSh: wsVPWSh9׃ 1^_[USWV |$ faa@D$D$1C$r#=:thq%j:VrPWhPx%h:vD$PUAD$h6959ht%j訙x:rW!9u:QWh9Vt$D$PWh1t%SR$'D$D$ =mdt2Vh9h: Vh9h9 1$hVSf t$t$t$D$ 9jVV ~;Ƹ PV;!D$i jQP e9]D$|$h^\Ww'o ~#u4h9h9'x 21jio9ލ$9Hf@8tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Ph9w u`~*=:t!hq%jU1:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hnt%h\t%h'hs%aUSWV|1ۀ=9t}h9ht%jŕ ue:+t%%:h9VWSU h9VWSh9 VU&#N@1 É؃|^_[]ËD$L$I1@Ã=:thq%j(:Vt$ D$t PmVj=m5 9^USWVPWj<1F?tihh9h:h]o%j讔uL:9+t%~o%h9VWSUh:} h9VWSUh9} 1^_[]SWVPVj`<>u1@;9o%h9VWSh:} h9VWSh9} 1^_[ù1@t U9It1ùtA?9t 1ùD$?9Au49ËD$49SWVhflhy1$hWV*b 㹔W3WSChWWh;Wj65|9WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW49tI1r rr2X_0u&1q1ur1ۃ0݃侣_r @뜃|$tB 6`BBd`^_[]USWV|$D$L$BJ 0uQ=x91۾;M&-p9B0t#1urF49tux99u'Cϸp99t049l9th90 5t9|$Q-jVPhn%W!^_[]WV|$t$ Nt tuho%Cko%o%2t%jjPWV^_USWV|$=:t h9j;WWG9u:l$}QWVhMf%hUz 1PP` ơ:t3Ѓ<PUuu#D$=ueߋ$$$t\ :P{jۉt{uho%jz$t]PUho%h[Z$t` :hhSjP2 jP W V jUho%h V  Ve tP$td :Uh$$hi jj7ah5 91@|^_[]Ã=:t=:tUh p%ju C491$th :Vt$h.*%VStV:t 99^t$-9u:USWVt$,VQD$j$t$V,to1\$l$t$GSVhVVj UP3 L$Vtu(;D$0s"L$44AQL$|$)L$OGj$Wr,DžuD$@PPDžj$t$0F,|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V3 1D$44Un D$44rP$D$D$ j$S+Ņm<$t$ >tV\$Sn V+P$|$);\$u ^_[]hs%hs%h hs%OYSV5W31/t.T$ W39u9t 49t q/u^[V1ɍt$QQPVhp%/ y1t1^USWV|$(1$PPWVhp% $D$(1PPWVhp% Z$LF1d$Pj%J4$>$\'h}d$Ueh~.hht%ehhUdW5 9D$h踉jU5 9N ‹'PPqhVjU5 9d&VNt PVW 褉WD$ PSt$5 9N 5 9*5 9:Sjhu%: j D$ PU Uh%c D$(SSWVhp% $j h%fMuQ1AtCjVV{ u4Vht%"1ɉtjV2{ uVhu%j) D$(SSWVhp%e u$~h%p%jTȁĐ^_[]1USWVhh+t%9tPjjh@p%(1l :h :d :` :\ :X :W3/u D$8W3ڃ9t49u@X :Q/uD$/u.h :X :19haj芹 W31@|$>Z49M \ :L$ d :L$j5T<5X<5X<=:thq%j聈:l :h :6P5X :hTp%jaa:Wj b0D$ttRN1ҋ0t1t /u oBrg49uƃ49l :149uAuVD$u,D$ \ :D$d :1@49l :^/ d :FX :h :QR5\ :5l :5` :Ph[p%h` jj\/_5 9K]1C9tvhhp%hu>h,_t$FVj.~thp%j軆hp%j謆hq%j蝆1G@9@9th q%jfh%_L$QPu{h9q%_$QPuYD$3$L$3$ t?h>q%h]q%Mft!hgq%jޅh]q%hq%a迪1=:thq%j訅:]$1L$VVPQhp% }t|$ th%p%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h=%hq%{at@Ƌ|$]1Phr%S9 4$WV V&GhLb%S^_[USWV-Y3ta1FY3t&U7Jd1tUh$$h] 111Fo u1tjh1@1^_[]Vh8r%]t$hPV hhȷ9V x(ȷ9ƀȷ9hKr%Qj j/P!@Gr%t :^SWVhTr%&]Ǹ9hPVI V0Fȹ9K5t : ̹9й9PVhPx%hWl jWh%4#/ hZLVRjƣ9^V=9~GtO9Ǹ9W WC;ȹ9t19h-Y 9A ,e9$Ǹ9$V y))L$H 9Jx .@ SPt$ D$PhǸ9=9-_39|uP59 9QjPN P59 9 QjPN -_3D$%=@t=ut-9D rd19D8 Vet$h%t$ =9-9ȹ9Ǹ9P  9D G=9V V $$9B 9fJhejQPĄ^_[]VPt$D$ L$ $tt$VPp 9t 4$VPp ^PD$L$ T$$RQP XUSWV$01D$$hq%WL$Ph$$Qߜ hr%WL$Ph$$Q跜 hr%WPh$$Q葜 4$辊Pݽh$t$ k D$ t$脊h"P<D$\$t$ hSx tt1h#S聘 4$0P?P$4V@ u <.=tSh$$t$t t$ hSCx ut$ Q?t$E?4$t$ .t3h0Ut$FVj$~t$t$t$t$ʽ1Ʌ2jQ#D$t P D$t P Wh$$h3CU jj$T5 9 1N^_[]t$ =>t$ 2>Vɻ11N4$ht$\t$ t$ 4$ VD$FVjw#F^SWVPD$$h=%hr%Wt@Ƌ|$4T1Phs%S 4$WV6 Vn=hLb%S]^_[h$s%hq%SKs%)1ۅtHq"t]q" 1ۅÉ[USWVh#9 P D$1Ʌ$l$h#Un ti\$WPS 9s?hh%S =w%hVS =wjSj t@h#U,n u4$R 1jVj 1Ʌȁ^_[]4$$ 1AVt$VL<1|TsrLc1f ^Vt$h.*%V=tV9t 9 9^WVt$ D$wǃr9t\,tSPQj^1 V5X<0V5 90V5X<,V5 95X<5 95X<5 9^_WVt$ V u.>vJ0"PVWhTs%h|v3e {s%^_WVt$ 0PprPGt$>FFVj F^_SWV=W3/t/t$W3GtPV5<t /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$VPƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V S3OVUP tP׃S.V%^_[]VPT$ D$t$4$=VPv ^À=к9uaк9gq"P :s%|: t%T :D$x:G$p :&q":SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWU4 uD5<w |5L Ku1PPD$P+ )ƍD$Phd@V% |$D$|PhedAV% V贰f$1 GaD$P$,ht%t$V( 1PPV[ $C]su PUhhغ9t$#t.ٺ9CD001 ݺ91 u=غ9tZF9|4$ůja$,h ~%$0uv EPPvP jOh9D$4P  D${O1ɳ$$uƒrL+1Ht$,D04$-t$$,h ~%u EVPh$P EtE @E w-G$9@  V̮؁^_[]1D$L$I@P49wʀu?9Au49 491USWV$$1$hWV= E jShWWh;Wh5|9Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur49A1ËD$1ɋ0t1ur49A1USWV ։D$ $E1$  D$$ ,$D$t% $Eu%u0u%D$$ u%#u%uXu%F\$$x :M \$\$$&HD$\$$)|$=h9=:=x :$ <$D$D$|u%$<$lq|$4$D$ x :D$% |$D$ h9D$:D$u%=ԟ9u$ByD$1Ƀ _3\$pZ3C|$D$$$$D\$$({|$!<$D$x :D$pZ3{=_3$r#|$l$ D$D$cu%$kljl$4$L K=ԟ9u $fxD$|$D$$.$$C\$$'|$u1= :=9=x :$ <$D$D$|u%V<$t|$4$D$ x :D$%. |$D$ 9D$ :D$u%$juLl$ t$<$D$ x%i$ \$<$D$[x%i$ l$4$J > ^_[]Á=m]3ftp]:f%=]3PFSWV|$ty̹9GO4VS-tRV t{S5̹9й9VhǸ95ȹ9h^%hSR jSh%4# fGlZ3~"PptV&zV1^_[ËD$ ȹ9ƁǸ9 9fH 9fH1SWVt$ȹ9Ǹ9V~)S4:Q= F9F9F1^_[ËD$L$01,fSWV1ۉShPS$ StD$$P t V{:8Vk:81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWft/S$SPW3V!y 981ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=`91SWt$ t$L$ T$'D$T$SWt$ t$&D$ ׋9t$ t$(2v%L$\PSWt$t$,t$RPPQN $`91WSt$t$&D$T$WSVt$&É֋=9t$Ht$H迍$PWVSt$t$v%PPPQ=N $VD$`Pjhq1@USWV u C(D$|$8hjWA3 wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ؋'|$D$u$$'B 'B'B'QP׾('B@ tu Ǿh'pЋ$+L$L$8L$9Ǿ'HQQQQRPRPjD$ tjl}31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDhJ&WSRE 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ayw%s\;T p82p,^s nh$r#Uhv%sPd{91F( {9FH@LP`,PSUhv%W{9j5`9vv{9j5`9v$v H59RPSUhv%WpT{9FH1@LQwFHpX59PQE|FHp\5 9Uhv%FH@`L$PhJ&jQ< hw+VjP P5959hv%sV^b.q+~V|$jPWRUvPQd@( m4*WP59hv%sT1hh*P5959hv%s_h^_[]Ës=9h*PWUhv%VҋFHP59UUSWVP $1jlv D$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5:me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|N94$ukGllPwYGX FPv3t~C $i)ىQRP 1D7D77qfD7 D7 N4$~Efn'  V)RQPw fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A ciOu\$ 9fA |$tAqfAAN 1AA tAfAAg A ɂAufAA3) 91jEVVhh?hrjJVjVQPh@94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch%PquF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]h8v%h#v%hlhu%USWVt$ kFllPvuNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ ci{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV, :t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$:"t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0G9GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Whv%QW t$$|t%L$ PSƋ|$ Whv%QbW t$St-$L$ PRVƋ|$Whv%Q1W t$ "L$ PƋ|$Whv%Q W t$PSVW`9D$D$] ٹ}$L$ |D$ L$L$<1jPWSzRPhGB$j$PY! t">tt$ Vhv%D$DPYV D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P |$YtZVo MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV% )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ`9}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP譋 $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋`91щT$1)΋EM M1WRQP/ljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hGB$jV] C `L$rL$DPhv%uL$DPhv%jQ  D$D---D$D$s9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhv%PP SVhv%PP VjWaSX`9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hGB$j$P t"?tt$ Whv%D$LPO D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PWQ{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD &$uR1jPPPhhPj jjj%VjMF4x!t$PW0Va1@^_[]hv%hv%hhu%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS7 t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBx%j"tVE (95(91^_[]á(9t8t9t$r#QhUx%jz" u5(9(9USWV=(9tt$oVUt?t]oVUu19t$r#UQhex%j!u%(9;=(9t؉WI1^_[]USWVt$|$=(9tAj4jTá$9CUWPI CUVP; $9^_[]É^_[]SWV׍$jhPjQqx8ƉhjS jWSݟ Sh{dЀV Va^_[V=49u|495(9tT(99t$r#FPQhex%j V뽋$9NV,V5$9u49^SWVt$|$\$T9t$r#SQoPh$$WVK^_[SWV|$t$9t$r#VQ3WP轃1ۅVhwx%jU ^_[t$h@t$ht$h}t$hk1Ʌt$h@P1Ʌt$h51Ʌ1=(9fVhd1ɍT$QQPRhx%xp t4BIOS3L$T$1 tUEFI3T$t$ u ȅ89h^ÁP% jUSWV41D$D$D$ , :()$tv $D$@9D$ L$,1$ 1D$kT,0 Ut$G|$ T;|$,D$u1VjVQyClǡ, :HVjHDVVQ?, :$wOʃD$$&;DHDH1PPL$8QPjh`3#xt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=<9t@u.1}hGju tEx y%rty%toy%M u@=Uu,>t'D$ L$, :;\M`|ˀuK(Ѓt tu tPjbjWSƍD$(PVQ$1 $$QPVS $V0T9$ul$`=u]tP$PSƹ $5fǃU'VSWh$$hy% uQe^_[]SWV0\$@1҉1 F FFF =89tjP4D$VjRRS0<^_[USWV, :(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hy%jkt1e^]USWV8=89EM 0~klP1 ËE E8؃lklQSP觇 ߾', :$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =|9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS{ F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h~%hp~%heh%~%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$:u o:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$<'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQPkx T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(:u m:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$L't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQuv |$ƄE C ^_[]WVt$ hjP; ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut~%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVs >uD$ D$iousD$fictO4uQG4 t51ҋ5l}3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDj l$(Ph%Uf h"U [Ɖ$Uh%jYu D$Ph%VFu wXw\w`h%V/uPwdh.%VuwTh?%Vu f1ۍ{aE4h'WuWuWhJ%Vt E< t<uEMPWQWhb%Vt$<IG%9|2#PVwtC9z1hLb%WTtVN D$PD$Pt$\$4Sh%hq%WSm 1(^_[]hK%h3%hBhc%h3%h1h|%h3%h h%h3%hh%h3%hh%~%IUSWVhj{{1O1ۍD$ShPS$4z9+ōF,PhedAU豦 l$$4$0$($<$8у|1҉$$g F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$QYo D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$90$$h%jP r=t31>t9>u 9>t0uk9uV.V&OVU/1@19$,|;ЃVt$p/؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'ud FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hK%h%jg6hc%h%jh(h|%h%jih%h%jj h%h%jkh%~%D$T$ L$DrRQPk ËD$Djt$ Pd USWVl$j/Un 1NtbNj\$)CDWPUQ uHD/t(t+t!u GF "u^_[USWVPӉ΃=|9ui"sv|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=:u J[:~V19|(1@@89|~@w1A^_[USWVP=:|$(L$111='"\$uӀt0t u@tӋ;,'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0,' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh'h 9覊  9k911KjdƃwD8'DtGCuޅtH=:PGd:t)1ɀ<t 4'AuVt^_[1V :t(:1t ҡ: :F9r:PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hPx%jQQWRjjh܀%(,1^_[]USWVhu}WWPHD$T$, :L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv, :@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $r#1ۺL$#PWVSh0RQo t$kPW$r#PShPVI , :VL$'Qt$t$t$ t$PPh`g$h$Ǻ, :$0Ͷ$, :$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C &CfCC4=:rC fC*C,BG1ۍD$(huSSSSSSSjjWPh貓48P胓@,Lrt$VWrW膔FuQ1K59mt Pmt$A59mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]hՁ%h%hyh%蒠USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$r#PWVSjh\1U5`9|$ ww茕v%t$R59RPSQVc U5`9w$w Vl$459RPSPU2 G\$skhSjPD P迹Vc9j!h %VQy Vh裫%L$59PRUQ詼 hv$59P%PUS~ hKPSD$Ph*%hh9S 1҃9Q9A \߉$4PWhK@$j$W hWh9Q Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,Ŕ9$EBL$ ;QU9Vh<%WQ Vh9WsQ h$&İ^_[]USWVX] E81h$r#PPPPhA%PP- 9_ vSL$QSWPL t@D$ tWD$8uN 9uhƩ 9D$9H*h$r#VhL@$EpJa+D$8u RPt QPVW҃`91VSt$t$肒D$$VSt$t$iL$8QRPt$ t$hA%Ep`D$V9p1h$YQVu WPTtY$UtOwGD$VP")vVQj P+ W@ )Q$YQPN H LCF;puD$VPh$$Ep` e^_[]USWVLt$`T$d\$1*kvs0C41GPjhta3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59c_|$.9L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾ\'D$ǃ@'SPHD$ $, :L1OًP|T$|$`1 |$0jP4D$DD$ `9|$ 9ϋ$|$1HPPVt$t$WRQjD$ D$PW1u!h0%VPWh$%j跿1EWh:%jA hW h%W赘$hPS7> D$PS u"hD%WPSh$%jA1EhM%还hPW= Whx%j 0l$ShM%hW%jt D$ %PV$SPW= hc%Vٗ$%1PWQU虾h%V踗SPWE= ho%V蟗PW$%PUa %PVPh%UC ahi%VZPh%j ;h%薗hPW< h%VPWh$%jڽh %ShPW{< h %VՖ1BP$h%V趖Ph%jy h%hPW< h%Vtƻ$a3Wh%hU褦 1tVUh$%juŃ|$tjh+'$Ą ^_[]USWV ։Qv 1Ht L$ L$$W7 $f} r= jh%U u&USh%D$P uhg#( W7 Ņu>L$4t&t u$Ut$ t$ h%jt$_LW $ ^_[]USWVՉfD$/D$jh%D$5謔t&裔8t虔SPh%hU VSU#: 991j/Up t5ÍD$9tK9vH8/t@P.B CߍD$ PW5 D$%= h$PW FƄ$/u&踓$QPhPx%hU /h$PU29 hh%U9 e=@uWUA x*|$VW$P8 9r>誌?蟌0|$W W 肌01Ĉ^_[]hUf t}/u }$$tcD$UM|WB|Ɓ`|$tVh%U8 9=VWU8 9%|$W x(W=7谋>1F1S薋0jh*#j SWVύD$ PQ1xVD$)tOjWx@ljj PW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@j m \$hjS jh%DD$ƍD$ PhW@Vl t$1hUS覆 ,$Ԑ'tWP,|u-9D$C E,$ !u1L$PPPPhjPPjjj!Qhm4t$t%j=t$VWf_Wzn6VD ^_[]VD$@t(L$ 4@̐'VhW1k F 91@^ËD$ 9fH 9tPPQQQhɃ%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺g{$L$~D$<P t3$r#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$r#t$DRQPh6%jV D$ T$Bj5`9QPu$r#t%t$DQRPh6%jV訝 D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o59t$hPx%jt$hVD$XP1WWjjj0賕,`9|$4D$0, :L$QW<W,D$DPV[~ljӍD$DPVw|$߉څu D$$H؋Pٸ"D$<ho%t$w|$,] {t+[1h%S~wt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hPx%jt$hVD$XP1PPjjj0?,j D$DPV D$׋D$@tl}3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWM )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5`9PQ|$ RPhGB$jW ;9CVDSjP jPPh9. V8@(^_[WVt$ 5X<[Q5X<~$uFjP59F$1O~(1h9QQhf!h; hRjFj WjPv$h9{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$} C{$t%K0 u G HfG lJul'fG G5G -G G,.G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVhX%jPQ̖ 'u tEj,j+荅L$jPPQ+ h2#7j*fL$QjPT6 h$j-?t$R59Ph$jFVJ j.hl'PVh=%hh9" İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5`9RQmL$RPh$jQ評 G<(\(|(Pu#]j#]L$>PSWhv%j&Q%j5`9SWhmL$t$>QRPh6%j&VE $F|(,u)|$hgPh\%j(W <$1e<(Ou*?D(Ltۍt$h趃PWhY%t$t(Tt(PPWh$j(V譔 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhh%v:t 4$@;|$|$upd^_[]1؍L$>PWhR%j&Q  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWhY%j(V蔓 4$h^VjP lj|$D(dph-PVha%j(WA *USWV, :$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá, :H1WjHDWWQZơ, :$1$ , :@u <@TX uDHXT=d9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$r#WRPPQV1ҍD$*W Q$r#QRhQP)D$$W Q$r#Q1Qh0QP&)ߋ, :0D$pL$$QL$.QL$QPt$SPW/ , :0uNjpfL$$QL$.QL$QPWSSj'B0 h$0+|$pG$DŽ$$T$0<$tT$@BfBB0ffJ B 1BfJB1B fJ*B,1=:r~(uB0fB:B<-1@1L$0huWWWWWWWjjPQh\4t8P[@,Lr$PSMS\$X(؃u , :TXK$X'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h%PgT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5, :R t@D$4D$8GD$ D$,fXC]~1K؃^_[]1USWVH, :L$1$QD$`x_jS(Ņ~ :"IuD=T$ ׋D$`B01huVVhf!VjjAVjjSUhT4G(WPFw(UU.9w0$CPPs$J)NjT$\C$BCHfJkllPs)ʼnCD$DklL$s)Ɖ)$ى@RQP T$*lklQt$Pz 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PJSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP%CtH{hh'PA =rID$$t?x,u xPtlIu&5:t1IHH Pt$$VW5, :, >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh%D$ P^t5ho%t$ ^u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0X9)ދ\9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$ )Ӊ 69T$|؉t$9‹|$}Lt$T$ \$T$  T$ D)L$lj|$+t$()t$T$L$T$ It$\$6DLD$ ȃt<DT<|$|@D$9T$ \$|!T$|$D089T$ *L$ T$$9T$9T$4L$$L$+L$ |$D$kT$4l D$ٹL$ T$D|+T$DًL L$<|1@1ɉO|$L$ D$$xD0 0D$L0vD$9sa\$+\$ D$D$D$T$,߉L$$L$8ÃQRSWc )ӋD$ L$$D$AkD$l<\\$ D$ D$ALL De^_[]USWV׉L$rT$FGD$0D$P4t txuR\$K\$lIuڋD$jlPl1ɉD$‹t$L$ 9։t$t׋t$t$zdtfB0 t`z8uZFdxtQ1ۅtl׋t$ZhBd ؉׋t$hVtQRL D$pL$tOCt$Fd;XrllL$ A|$G9]D$G+T$NiKh9=wK"D$Gw1j0VlD$0E D$,PQHD$ D$<ЉT$(T$8D$4T$B J$3J3B1 ȸtD$(L$ L$$D$D$H1HD$\$01ʉ|$tL$D20uL$L$uX 2L$t2L$ L 8\$t>T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$c L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A5: 1Fh%h%h]hw%[L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S tt<1^_[USWVGD$5:l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX8AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}`9k<4LE1UЍe^_[]USWV1:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=T :t*=(:11M<t9\@u 9DDMHEr=P :tO:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=x::J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@(:D WV?uF<h$W%?1uMF<DWj""F8.Wj#"F,Wj$"F01^_WV|$ 1u+@tOu"h:,x7^_USWVP\$t$1҉V(~1 fF(F,$F08-%F4~$F8$F<V@VDtEF $C8k1AQRQRQU3PWx CF@FDPUt$B ^_[]VL$AƅtιQh:jPVhShShTR^USWV$1ۍt$TjPSVG 9T :tGjhu"P< =|:tGjhX"P< 1N=P :Gjh]D$P]< O1:|t 9Lp=CuSW15(:1Ƀ|t9TtPH= u#Oи0:8zt9JtCu)Ή7(:r4)΃؍L$tu)y8u.q$t"y8uqxu Hu^h #h:%hm h%BD$x8u@h #h:%hm h%iBV 9; , :tD:t99t‹9u€:2t :^WV΋$tRttyu):9tЋ9u:0u1H|$5:,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $k 5:.$r#t22#PS5 >tiD$Pt>Sh%hfT$\$ :$DL$4L$0:0|]t$VAPh%WS :( ( PQVh%WSt$\$ CCa5:.> >,>(>$> D$)Pt>Sh%hTS$$(t$,t$(r 9t P{ `91`9tWWh %CUWhp%h|v3a@ 9t8Whp%PI@ 91Ntjh"%P-@ ^_[]1N =:tt$hχ%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ , :V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$蠾$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx`90^_[]h #h:%hm h%USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tIWV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&r#US* 1USSVVjjt$" Sx xL$1^_[]WV|$ 1uOG Pgt/1; }OX"h:x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h^2t$hPV腾 $$$Е'D$@{tUh?%V USV 8Ouڋ$xhLuhMSPh|%V}C(~Ph&r#hV( }hNHC,~Ph&r#hV~( }hO#C0~Ph%hVY( }hP#VPh|%W^_[]USWV$b3u*11IhuPPPPjj PQQjha3P4b3Nw'$R($'WP\1N1jWWVVjjhQ lS, T0D$4h&r#QPb' 1PD$PPVVjjU D$Pxu x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP  赜Qkd)Qh%V豮 ^_USWV$h^|$hPWM $$$'{hV VPh|%{hWvvPh%W;[hXp1~,t[hYS1~0W[hZ6ǃ4V~ uh^V0FT~Ph^#hW% sh[[h^1~`{h\vXPh%WF\~Ph%hW$ sh]mFd~Ph&r#hW$ sh_HFh~Ph&r#hWl$ sh`#Fl~Ph^#hWG$ shaWPh|%V/[hb1~pPPWh|%S^_[]USWV$@1N R$fT$0' 1jWWVVjjhc|Gl=Ol, :,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&r#QP" 1PD$PPVVjjU D$Pp x1pGp1^_[]1wwVt$F~|F Pt t1@1FF^SWVT$1ۉZBr 1Bl@ZpLQkd)Qh%VH ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hl%hU%hh% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F̘'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWC 6Pw$$$'@21^_[Ã!t*Wp1@<QKWPV親 rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph%Qn D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=p :$Wh0%jP 1t t^_[]Ë 9! ÍD$XWhB%Pj1~jDjjtD$$2#Vt$\kVjvkD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h#W  ƀ8tt1tCuVL$ D$ j jVOp É$qj jV;p t#D$Zj jV$p D$T$C\$ \$D$|$u\$uthh?%S誛 hVS蛛 \$E61ۉSt$,j SVo É$ tbD$ ʉ $tQD$ D$tGjhA$t$}VtPv<fWW߅uvF^_[;hx%ho%hh% D$ph%j iSWV=t95|9t^s3ߥt#$t$j(PV 4$蝣_u9hsj|$0VPh$jxWz WVV &t Ĩ^_hL0&h>%hh% USWVσ=t9u h 1t0?t+t9t!-|9E WP tt/|$thh%S蹌 !hvS褌 u4$$$$$St$h%j ^_[]SWVD$Qt$Rh%Pj h2#t$Z$jh'PH uWh2#jbZ$tAt$h#W 8tjt$2h2#j!Z$ut$補1ۉ؃^_[USWVӉ΋|$|$tBhՎ%Sp h܎%SZ h%SD h%S. h%S h%S h%S \$h#S ǀ?t(+$'WP uE F@j`WV蕉 -j(WȨ tj)P跨 t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&r#WU WUUjU= H>wѻPD$x0h&r#SU SUUjiU< H=wˉ, :DD$H1Ƀ|1M1҉$PVRUO 1Q\$ SRP= 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tq.9Vt$ 9u W. 919vFt=N|:wu1w<: J:^ËD$Hs-s '.h #h%hhB% Vt$ =9u-(t;u2L$ rȃsԞ'$tu@:1 J:\:^WVP|$t$=9uI-j PV =v1t-h;t @:t4<:^_Ë $9u։^_-=86:t46:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCShR-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh%@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F Vh7,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$PhH,1\$}UM;t;Gs} Shm%q} ~Sh%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWS L$D$ T$VQPRt$Vh%h$P $L1QhPjVNx`WhydP D$V ?|$t;jWS} \$;MU}h%h%h hB% 1e^_[]RSQe} Shh%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSR )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H<:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU躦 @$\Cǃ1:k0hWVɳ D$4WhPW$XmD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$((tÉ|$UFd#D$0jPUQt$(a(1 Ⱦu#\$,hPt$ Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PhX P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x PV tn{ C K$;}sL$4QjSPL t_D$HtW<:)1ɉAw Puu2S"j@jP萮 fdžUS#p1ۉ؁4^_[]h%h%hhB%蓫 USWV4D$L D$PhjiƋl$X\$T|$H'WU F|11Kn^؃N$F Fdž?džjh>USq @džPWtwt%D$ D$D$D$F114^_[]h%hD%hhB%耪 USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWN D$vP6N 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h,%h%hxhB%Z USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715Da:5@a:5Ha:D$D$ D$1D$h\%WU> pu $<Ha:e~ft$lt*zD$ƒbtCeubD$벡$<D$ ChjVV5$<hg%!Da:@a:zVhVV5$<hs$Z!D$Vu=o39}4D$$D$l$ t%1PPU D$yUh$$IL$ tHt$(Uhr%V h32#6uRh}%fD$0Pt$s #D$8=$$ Da:@a:jÍt$0ShV u UPVy UjD$0y Da:@a:Sy h%t$(T1|$PyKy h%1 y hʓ%vuWjt$J1St$J4$t$%Sh#PP2t1hؓ%t$t$J4$t$5Ta:5Pa:Xa:$v3|$t|v3\a:2v3tv3=l$u1HL$(Qhht@P x PtL$* `a:t$Buh%lʼnPAJyhF%TN0 D$ yh%@$uBL$$4jPI4$t$V6艱6h%jx3Ph3 j 3 j|$WUt$G x>tq1.SPt$  y 19u2Pa:Ta:)u蝔 8t1FVh$%1FVSh2%V2t$D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj ސ UQL$ɋD$tP V P蠃 h$r#PVhR%h|v3W jݢ V jV jR}7 VP^Ð= b3u  b3\a:@=u1HPt 1; b3USWV}uCjhxa:B xa:a:|a:a:a:a:ha: la: ta:pa:|$(jWOB 5ha:5Pa:la:Ta:?X+=a:a:@1;a:)ω|$$\$ ta:95pa:T$s;D$0a:D$(L$, a:a:pa:D$ta:D$$D$ =Xa:EtQ1$w ww7wwVWVvC 7www ww$PWj蒐 M$1~~~ ~~$PVjb 1@F ~~~~WVWC =Xa:B5fDŽ$ Ha:t$Ph$$hQ 1FDa: @a:ƒ\$\$xT$T$|l$xЙ&ݜ$݄$ p&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh*$QP9 `a:9|ӡHa:tPL$: L$)΅~DQ4))h$r#Sh 'Rh1$QP輦 Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPh;$SWC L$(+ xa:T$,|a:NjD$0+a:x@B‰L$hT$ll$h\$@Ta: Pa:1F؃D$@5&|$vqL$`\$dl$`Й&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4'RSt$DhH$QPŤ  Da:@a:ȃ||=Ta:Pa:݄$|=s4;T$D$r(|$$\$ ؍4)hj$؍4)h]$QP1 ƃ}u 4)h2#QP ơ\a:@=u1H$VQP e^_[]+ha: la:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h%T趆 8t謆 8#u$SjV%Z tGtV $1E48FB$)Ex t$7@[h%h%,2 h%h% 7h%hҔ%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuh%h%{RÉhPKt4VhjPMEuh%h%-R1H^_[USWVp $$$!19L$PVW1Hl$Ut ƃU譾 VD$PW] tb$UYtM$dt $dPU t$jWX tu)$-j4'W~U% 1Hp^_[]Ë$j-UP0 D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9PlDdž- t^[V V 1uł 19^SWVlT$|$$VPC1Nt/ǍD$Pr PSW t Wl^_[USWVӉjh0jQ ǃt{jjjVe~ L$ F[I#t$r#V=1H^_[SWV$uSh]%h%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6j 8 \ 89h{%hq%LNF G8~ ~u3FVh jv S?uh{%h%3Lt6hWv 8 t%uh%LPWVu  s V^_[WVp׉$ftPh %h%K jL$PQW jjP` PjWH tnjjW6 t\PjW" tHD$|PWV t2Ph jp >u6h %h%J"h %JW h %Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW#0jW05^_WVPt$4%@5@u^t8tW%V$%8Vho&j?#45@u`V,2<jP, u hՕ%G,)dž,sh%|Gj?3 t1t3u5$0$ $1Ph%F $ $1PWh%F^_WVt$ h#pG8r4@84^_8t8t uhǜ%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SPh% SUh %F SUh%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pf w_ǍCWt$P#J ;)QjPr hϜ%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhM%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYhx%Q肣~PtVAt(t NLt }#t6%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQLB WtHAt[ƃx t Ph%p;%KFNtTHNUh%;n 1Oqn 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh2%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph%6:11BUǜ%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhO t$hU%hF%9$1Phi%91F\$ MbihS$( EuVh%?9u l 87t l 8 uF띃tVh%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=6uFGGtIO9tA t3@UUD" C6WQjj.>jV(t0<t$VtSB< t<=VS= hU%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/i 7 Vh%h:7#!7T$1|$`F(f9t(~ tωӍV QPRhԗ%6ڋL$tf~(^>8u(F*4$QPωf ~ tcF D$F*|$ <UWSPωT$ P\$Sh%6 <PUt$WPSh!%5T$ V>t*4$QVJ< H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h>%hq%5 j-^_Ã~+ajjj! ̓kh%hw%hO%5 1m9h%h%hO%4 <6Rh%5@hf%ho%hO%4 111dh%h%hO%w4 @+X1BWDPU hf%h_%hO%14 11G1=a:a:6u P9W+a:zh%h%hO%3 t0S vPh%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VW tE9u݋D$ 9t9 u~<$h%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h%W"V .h%W V !h%WU D$$D$h%%WU |$t$<t$S ǃt1Fl$<4S GF9uW$t$<l$US WUD$P E t=1FߋD$@D$PSS Wt$US EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]_ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW1Q tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xhB%W O h%WN \$,hVS|$t\UHrBPt$h%# t$\$ SgV 8$U̐ $`$d$`$do3T$ QR$4 $$`hq"h%l$,<$茄D$ t<t,<ulh%H D@Ug uDh%" LHUL h% TPUCs D$1DU Vh""4$hq"h%"D$1Cl$,$bu Uuhq"h%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PD $ }$nUqq$VU# U+A$;$b3t P%$dP@1uh% !$dt3$Xt'L$jQP uhq"hq%#!$j"$hh$v3% $$d ؁^_[]Ë$r,u'o3Qj$4 $u*$`1PQQw $$c@u h>%$VUI ha%$`5 $d$`$dUh[jj$=t'Uh@[j$($}hq"hz%hq"hi%D$L$Ph#%U$"h#(R 8thq"h%3$`Q L$aQ 8 S$`$d$dl$,hh% u!lQ 8th%hq"hĚ% hhҚ% u!4Q 8thҚ%hq"hĚ%^ UtUhq"h%Uh%1k$`r;$d@ щ$`$dU蒹tePhq"hl%KD$ Pjh0j,U hS2#yUPh% U$`$d҃ ց uK$`$dr>1ro3$L$ QPUM W$`$d%r o3$$r#$r#t% t%VQRh`/&SU{\$,1D$WhPiu h%ShWj$$nuhq"h%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u%ٛ%$4PF$$9|t$t׃z Ru$dh%P_S[$bh6%Jh)&yD$ L$$$XP?UhVj$d$ uhq"h%T $dh?%$dD$ L$$$XQ詺UhVj$d$W uhq"h%7S$D$xhq"hz%`_h%hq"h%9hq"h4%*hq"hɛ%hq"h% $O PhJ%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h]%PJD$,PB't#%@tD$,Pho&Qj$dWD$0P"0$01~ tVhC0jj$$vS&I WVjhf%t*VPuVh˝%MW蹷hf%h#0^_Vt$V褱t$pApdr$Phӝ%NjjtVhqVjdj ^WVPt$D$uPh3%h% jP, tuIh3%h8uM, ,ƶdž,>wt=D$|$ffN(ffOfuj4 ȉG_1_F*N>QPSl F>)^_[USWV$lt pvh%PWj t=wM$lDA 8th%h$$h$u)h@%h%hh&% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U1 =wfD @PUhh%W=udh@%h%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF PhI%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQPI F>4)mC Phl% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#B? 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%h%hGh&%h%hHhգ%08 D$tFL$tt 9Jt >  ~> 1HBH@M1@h%hC%hhգ%7 USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v= 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h%h%hh%h%hhգ%5 L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hV%h|hգ%4 D$t L$HH@Lh%hm%hhգ%4 D$t@Lh%hx%hhգ%4 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hhգ%J4 USWV(l$<\$߾'1|$ |$|$<$E4t.1FM0 I?ry: E4  G9rՉt$@Pjѥ 1Nt91D$ D$D$D$9E4t$1E0jS49 t G;}4r1(^_[]h%h%hYhգ%j3 a:tD$ a:Qa:a:WVjPj1tMƃPj- t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PqNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =a:t'a:H a:a:N8tv|x| @t,'\$$|v3SVUwS Uj ^ (f3 s SVW  ^_[]PL$T$ D$$PXUSWV։3 $VhUSJ SV PUh:7#Wr3 ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,f3ËD$,f3r SWVhS$ 诞 1OtFƃ ||t 12 +D$HP0f3Ph$$Q] 0f3^_[á(f3ËD$(f3@P )f3 SVt$ hjh(b3h|v3(f3 s1fà 0 jSP  tp1 V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhj* t!jhj 1ۃۉ^[ Vt$t'PdžtPٝdž^靄D$t$t$t${ SWV$hjWH, C jPW) Whi3 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv ?/ 7 2/ V1H11Ʌtom $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0n VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV) Fjŋ$@Vā $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4> t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4许 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PV< CG$C D$ jt$ VU C yQPD$|P* D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4诶 F;`|ӰD$|$0WQe~t$\yWh(%e$_w ɺ@r <t5<(<$L$ 1@ut$h(%$1@fG(FG>O*VTPRQ $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVW w_ jVS r& 1N^_[]j:S t/@1UQhQQj QP" G8mt@& (G8GjSPT O t l}3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP} <$ O4G4SWV$WjS! F jPS WSh~i tD$Đ^_[USWVPf!D a: a: a:a:h[%Fa: a: $<  O+VQP 9v1 LJ\$ I;<j,jU@t ǃD h3%Vj,j&Ht ǃL h3%'j,jPt ǃT h3%t$$WhX'V D$9rh3%h?%[H$|$ 7D$PWD$t$h#D$PA ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h3%h:7# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h#D$P? ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h$U h%U hK#Uq $D1)h%UE 1Ʌ<$t$V_ H9t- t u!H\Ht$9u1@$D$$<jPS蕪 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$蛿 `Dd<t A`Nh3%<$Dt&u"t$ $<n 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U' tu;uHUhj%'D$uuUh#t$$t$$P't$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPU t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(o3|$$t)`#L$# $ 1CƋl$ \$18m%sl%Sh'Pt$%`|$X/h%H"D$PKD$P4|$Xt$P jt$\X( D$PD$PL$P׃L$P׃ D$PfD$P|$XHj,|$\W? p j,D$PJt$Xh<%Vp <$h٩%VW hC$VA IVj蔊D$Pt$l}D$!lt$XPVpD$P|$X.h#W t$P'hT&W hݩ%W Kh%Wu Wh%D$PD$PD$Xt$P jP(&h&%D$P D$PD$PD$P|$XH$;nl$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV)$6?mjt$\D$ 0USWV7Vjt$\t$,USWVVjt$\t$$|$X$;D$$\$t$|$ $T$Xl$ Ul$ UPD$$Pt$`l$HUSVW)$>ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W Ê@tC< t< u CCu1j h%W= j h(%W% jh5%W  jh\%W jhU%W jhK%W jhH%W jh~%W jh%W} Pjh%We 8j h%WM ?L$P1T$XPfL$T$t$XVY(1Kj/VO uD$|$PjP L$r L$rL$T$t$XV'1Kj/V uD$|$P jP$ XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$b3t PB11j|$\W6!ƉD$V茼yjW t>thf%V V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h%h%OD$Xt$P jP h%|$Xx D$P$<t$X謱  $<PU D$PX|$X h#|$\W{ t$1VWjWWWWPj L$P9>t$Xh% |$X t$1VWhWWWWt$t L$PA 9>t$Xh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/Pq 1|$Pt@j/P[ tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$tg L$P9>t$Xh!% L$P ЉT$jt$\# h¥%~|$Xq j,|$\Wh * ƀx 9l$Ps%ƅ |$1WShSjSSt$t] ,9h{%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t蜐 L$P9>:t$Xh% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$ft$XE $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J| 8Ut$Xh%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPh fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h;%@D$X  y@Uh!%D$P |$X D$P D$P D$P |$Xn$6t$PvihC%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xhj%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV軉 9]Vhѫ%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t" L$P9>t$Xhp%|$Xtut$1VWjWWWWt$t L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t裈 L$P9>At$Xh%Qh% %P C t$Xh%Wn à \$S螮ƅ|$PPh˩%SV   jvVj/t$\_ AL$1|$P# KD$ɋl$t t OGuh% N|$XoE1j:W l$t2At$1VUhUUUUQ 9.Mh% j=Wu  ED$(@1 t H@Wha%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVhj%>nT$P   xUh}%=D$(h%J hѧ%Ɔ <h% D$Pǀh% 1K$dVh%D1DDD DD.u hɨ% 1D$(1h$Wjhƴ%W1xh"%WhC$Wphh"WZPhs%WDJh~%W.hG#Wzh%Wh=#Wh%W hH%W> t$ hO%W hU%V h]%Vs hd%V] hl%VGY h="V1Z h%VT h%VE h%V6 h%V' h%V hA%V h%V h%V h%Vk h#VU Vhp%  t KC  t KCWh%Ɔ  xt$P1$ƀhuh{%XttC< t< Cuh+%0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%W t-hz%W th[%W t h`%W t@Ch7&Vu thf%Vc D$P@ tsFH t t@@1 t H@ttC< t< CuhD%Ƈhh+%wsF< < F1$SUjjJ tUhӪ%1C CC"$f8l$1USjxSjSSWH~ $D9]$ƃWh%ttC< t< CuhZ%Ɔ L$P1S=flF D$PV<  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h;# 1F؄t  H@h %1K؃<^_[]ù@D$PǀǍ0PVjF whK%F -{]< < Chd%G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWSy L$P9>sSh%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/SG tIGC1L$P4 1D$PVSj2D u7tb\$1SVhVVVVW?x L$P93tQUh%tGShӪ%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh%ItF1tC< t< CuhE$Wt)W賓 Åu"=1rWhԬ%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8U ljD$FWUP >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$V >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=l}3DWtCT41Fu|$ D$ |$jjD$P( T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P҆ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRO j=Pڶ ,$|$D$ Vk 1ۉ\$t?t9D$ 1j=S蘶 )9uWVS7 D$\EuVި4$辎 t5ƍEjPt$  4DL$hڭ%Uhڭ%h% |$$t#4$L tzSRD$h6% D$tHTMPR芢hT%h߮%hh6% Vt$t#1PPV t@Tt$ V0 ^Vt$t$Ƙ^h%h%hdh6%W SWV1SSQ蘧 t&WV訤W蔠SSVt Džu^_[WV|$ t^ǘ1PPWM tPW]hƅthjV ^_h%y1h%h%huh6% D$t L$tHThT%h%hhj%h%hh6%X Vt$t61tpT^hj%h%hh6%# WVt$D$ L$zVP詠9tVd 1^_ËD$HTt1Pt$ ḫ%h%hh6% USWV\$tF+1PPU֥ t.jVUĥ 9^TuVUӢV_u^_[]SWV D$4toHTty9|$0uPLjPWit<Ƌ\$8PWuSh %j Wb VNV ^_[hT%h%h ḫ%h%hh%h%hh6% USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etuu 8Vt h=%跨ňjjU1 jWU Gt ;D$TG9t ;D$TWU WVurGTL$tIѺ!! tD%WWj03u! 8t 8t h%ާW߅11SSVK tLWV[WU葙9t!U h&%舧WSSV Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVHDžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:&tg%SGtr7tCtt-SjJ1 8t hp%Wj1u2 8t(h%ե&tg%ScSj0u] 8th%菥1ɅtWV*W^_[]ËCT@$u Cx;Gx_%WhS%hL%h;h6%` D$t%@<t <u ø /1h%h%j;h% D$t%@<t <u øy /1h%h %jQh% D$tBHttu#xðÃxux uxux /1h%h%j}h%z D$t>Ht4t uxjh'PR  /1h%h&%hh% D$tEHt;tu&xÃxu x uxuxW /1h%h4%hh% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=a:uD1FFFF FFGFa:SVrVW_uPa:މ^_[]Åt 1u19[:Rt1h%hC%hh%k hO%hC%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=a:u+a:W9u!a: /1N^_[]hu%hg%hnh%c SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQgO ^_[h%h%hh%h%hh% USWV|$t$)Ã|UhVS t(ٸFx)PjV$ ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ* ^_[CPh$WVS 1t߉h&h%h{h%h%h|h% D$tL$tf Hh%h%hh'&h%hh%d VD$t&L$ t/fqPp QPI H^h%ẖ%hh'&ẖ%hh% fV$'Phر% u^USWVD$t$V1Ij0V1|$/ooo WVj5't-1C d'I?r   DE9u֋-'t/11C 'I?r   DF9uWt$V 1ɉt$\T$\RVQ2P苀Vt d 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP襪 tbL$1tHhH%h$%hM8| /IG?uWG9rD$^_[]h4%h$%hh% USWVl$t$|$t1ۅu>t7NL6%tL^& }#tÉS1ۃ1Ct:tV>tXtSh\%t؉8txt@HtPt؉CjV.t.Vt!thd%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${tk 1NA~0jhq%Wo uW WV G9rh$v3 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%NS$t^DžtnjSW? ^ 8th%h[#荙9hv%~1HzSlt$h%h:7#R tG11CGt0WJ ؃uhv%h% ?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQ[PWh%h*%辘KUSWVӊB D$ L$$t WP *QPXtNjD$$7@uMh# %tQhز%W o Ph%We |$ t$h%W@ {D$ D$h%$U8 t$h\%U UM |(6hd%U 1>hx%Qڻ h }#$U轻 5h6%U觻 h%U葻  hL^&U{ h%Ue hǜ%UO 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I4@'h!%W +7$@D$o|$L$ uMD$@tBL$qPShO%W"AO%D$ E|$tShO%W <$tBt88t/SQt"D$pHpDShO%WAM|$ tSW3D$ t7t1Ph$$W D$ 0uW W8ǀ|$ WD$(P D$  #t޳%Ph-%W; vKLs%t$;M&tRh>%W AsHhK%W 'CPPhW%W  s$he%W SmPhp%W {Pt;CQt$(stPhhV tVhy%WT {xtCxPh%W3 tr7@OǀD$(hЩ'Pt0ts~ t!V^t&PD$,P9uvh%Oh%B1OĨ^_[]D$D$D$h%W t1PPt$0V~ tc1PPVk 9th?%h$$Wt oET Ph$$WV QjUt$0V Ņu1UVWU hǜ%$V h%Vݵ hx%Vǵ h }#V豵 hL^&V蛵 h6%$ tzh%$g ޳%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSu޳% #( # #D$  # #t޳%Uh%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPhó%W ?Q@thѳ%W|$"D$<uMD$@tBL$q PShk%W0;k%D$ S|$"$<D$@LL$qPPShk%Wtl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPWAm 1tk<.tghO#Wײ tUh$WŲ tCj h5%W t/tj.W) tUWe 1t^_[]D=|Vt$ 'Bء,v3H ,v3;G$t$GMEl 1 ^_[]ÿԵ 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Va 18G 1H(D$ %t%L$QSPWV Ą^_[]USWVt$HD$DD$L$ tk$,C r7 rp  I V1$UWhP\u%Vj 1ɃIUWVM$/S$SWh$$VyUWV# D t$$UWPhS S[9 $tVj L$C @yj.$Pt$j d$Ph$$V E$8u*$@$UjSS C@G jPS-W fC $4CCD V$4P4~ UShip C O*W>RQP} UShipӌ y 1N^_[]WVPRQMw ~u~uF $`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVP tu褓 1^_[]fD$fx(t1ËL$ D$fx(uD$U V1ËL$ D$fx(u D$' V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h%ljFuJ1ۍl$Sh%j UM h@UFuC> 8tǍ\$($PhqB@Wit f<$f|$ jUS> ShlBW+t txD$PhpBW t tZ$$VЃuBD$PhfB@vs t(D$FP>F u+ h%^Ft PV)O1ĸ^_[]USWVt$fFtV)vv vl AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ c FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP|r ^USWV L$@T$*@h t$ Vhc%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P/PVh7%S1I/ދ$0$4Wj$@U t|$r $,84$GPP$0VhH%WwSYGPVhZ%WR$0$4|$WjU $,t|$w1Ћ $ Q5PVhl%$4$4#]SPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph Vt$$@$@$L0 >}k|$`$0PDL$L$QWh Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VS t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$   V1(^_[]ËL$DtD$L$tPVQ"S D$ƅu SWVD$ L$tT$$w .11t$|$X+9sU "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`F`^SWVjh0jM 1NǍ\$PSPhW#atrjSjjWat]jSh@hW`tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWV t WC^_[USWVt$+VjUAChu,$t#tVh"$Pj@^  ra%s%PSh%{PSh%I 1Bh@$ ^_[]WV΋tF>rD&$ GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1Bh@$` SWVt$tgw]VhW$j @^ w$zPSh%H GLhQ ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGHP%_0wF SPhs%H _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$\yw(<PSVh%KGG0GH%% w$yPVh,%G G0GHI%c1HG8G4 w$xPVhX%F 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( l&|$D$ fD$l$|$Hl$D$HG4N PQhҸ%xF ?G0D$ D$$l$ l&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pww0PVh%E w$ww0PVh%Et$6u$HujGtGht:?7%tP>%I%GHPuXj<c@O;Au<t 4%?u0%GH0ts]ShW$w4Q;Shu+w8P;Sh,w0Py;C w8w4PhD%yD 1HG8G4]@uPD$u>C wiVPhr%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h»%h%hh%n SWVt$^ Shл%'BG0+G8PSh%A VhQj81G?6u͹%EHPV Vhֹ%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h.VD$tF9tAtIdtI;u D$ thĝ%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$oPShV%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih芵 D$ɀT$wȈBBV*QRP@ T$(  D$tz tA<t]<tYD$PPj`D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ K ً\$T$ |$D$0 tQL$\$)9C=|$ BRQP'> Ã\$T$L$\$- AW |$ L$\$)9!D$ C<AQWP= Ã\$L$\$T$|$ ‰ʹ ыT$ L$\$)9t$(D$ C+AQVP= L$t$(Ã\$T$\$ D$0hL$|$0ʋ6D$@@ZD$L$)ȃfPL$ы\$tD$0t,ˋD$L$)ȃf2AL$كt,ˋD$L$)ȃnf3ȉAL$D$L$)ȃDf7t$(1D$ ˋ\$$X\$,\$8u1L$,1C\$4t$\$8\ˉt$(r\$$[L$,1C\$4L$\$8LPL$4\$$u4|$u L$,:t!L$\$ 9L$uC\$ \$,B,;A*ыT$ D$x\$ShP# t|$ tsjPhL$\$|$ P,W PL$|$)9 OGPSQA: ߃<øHT$|$)9QGD$ $ GfGGPS0ǃT$L$D$ L$DD$8D$D$D@1T$ D$,D$ЉT$ | T$D8 B9rKruڋT$$T$4u+L$$1BT$@t$T$4Tʋt$(r6L$$1BT$@L$T$4LPL$@u|$u$L$$:uT$ D$,@,;D$8F)9D$T$ 2BL$$D$DD$8NjT$ L$AЈAL$AWu"D$)Ѓf9ffz׋\$  T$tQAY uK˃L$)9 GM AQSP.8 L$D$T$\$ |$fG G|$L$\$T$|$ |$0t>D$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSPP7 ǃL$D$؋L$؋T$B)Á+),PjR_ ,L$1OAhT|$ 1|$CD$PjsǃSt$ P6 G D$G D$ GGDCff_f_1ۉT$SfGEh fGG@D$ffGSf f_ t$WhD$ p\W F Ph%/b ΃]w'6uhmW&V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5&D$\$$%u(WhDVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GHx%GP_iVjhStSE0, pLJ  twAQ \ BjWh^ajP[h%h%7'sY EX>@P, UB( A J*R>RQP,  ]rts4 t*Mq @T$hRQPPV]hV%2C>t2Mq M*T$hRPQPV]hl%% PjfL1wLw w wL$u]rruG XixiF SPh%F% D$h$PS6ΪNRh%%@u3EpCP t: @ NH M plYh/%(%u Vh+%%h%v$u3=u1HL$h$QP t=w:F h%Ph%$ woW 1Ƀ8tmF SPh:7#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQPq* h%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$SPVh%! M1C1G G\$"O0)G4)G8uL$YME Ph% A}w s$QPVh% WuWVt$ VhDjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph %>W0Edhĝ%WWNttxV1ɄutZE tS@;FuK_ PPPSh?% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr fP N@H@USWV׉΋D$$E t @9u ;M$^ PNPShX%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tDĝ%EHPVK#8#4 u2j1Vh"jj؃^_[]ËL$hQWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hQSWV1{\t^_[ÉjhQ蟻 C\t4WhRjpuhd%h%5N 8u"54f3hW% Whd%h:7#> 1NcD$T$ PUSWV$$($$$$_\ftPhq%h% ch$USY t'sPUV`t3_\t,Ct$?tF Phq%h:7# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh~%h%  t `jW0芸 tD$ WV h~%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r PIPVhӽ%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sI%n1ɋl$ T$Et*u4|%& Vh%"%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% WQ} /6uh%VEiP6ΛVh"uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$P@4$teSPh["Vt$Wh%t$( ["ۋD$t$0% P?4$L$ t/PUVt$Wh%QSPh["t$Wh%t$$7 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$>PVh% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph¿% v B1F FFL^L$hGaWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% ͹%GHPVq^_[WVt$ F Ph%g OhGL^_D$ȅtȰ (1SWV\$C r3> 1H4t${GPhVI: ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0hЩ'D$(PEdx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVP& VVP  ƍF8Pbuz3WMhVP^ SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPfVt$|9tV;UVqT1PPD$,Pm ƅuC$t$xhЩ'D$P'1PPV: ƍC D$~dV`Sn8U`?1PP$ 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&(0 G0 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u3.L$( Ʌt ѹ )QPh%jWF ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h^% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr. t$ $ q>YtiDD$ \$fl$Ӌl$ hT%WU_ - 8th%hj%t$@s"j@{Dž@7k D>1ɨ1QSV PQFRC F CFKN\$l$ Wg ! FMg ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF F( oUSWVD$1tW8tQ\$l$G@tjUP u8u@$%@-tPSh%QSh%! Sh%UjEds;M$t4} t.@tUh0QjEd1ۋ $M$L$M Edu[Ch2tKhUP FG8~hg%$E$D$E 1K؃^_[]hg%VD$ t$t+~ t3N@jPQ@ u L$1@tNduFdШ(u1@1^USWV|$\$l$USW& USWAA 1ɉ t&tuttNIHP;JHrƉ^_[]WV|$ Gd1@ur t3uh@uDu HuLtPt$W!wd9t WG1WVV^Gd r1NGd^_USWVE1t$t$4$tC1;PSKu"KtHKUJS#ue^_[]USWVM1D$D$$9?CdEu} t!KtOKUJ9} t&CѾ!! u } tK@} uStPSuVCjQ0 ƅtF;Ct SC## ut PVWSe^_[]SD$t1tKt:t4z@u ZAtz@uzDuzHu zLtB`uI볉[USWVD$$L$utyt$(PdƉpS|$,VD$IT$D$*tE@jWPĚ tmu11D$ D$8E`1ۋD$ $t*EMHMT$4tbD$0jPWV PuE$E E0EVu4jjt @H hu%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjs t:NhVRPh%j.Q1 @jPW t&@`F`Nd#h%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSPt tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h$%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀ]jPj781Fuh\%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPhX% u2 tQd s((th\%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh,'U Sh4'U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS艐 t=m<$hj.PSjl 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh%3 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU趎 tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph6%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$dž|uC4PN4V8@F V1^_[HN1pWV |$G`@uG Ph%=\Vj?VWt(ƋW34PV/h%W  ^_WV΋Gt u={Qr4uhX`V G{Q)VhQj^_USWV L$ AD$@@(A D$A4$1]du$E jPt$蹋 |$$tKu]d]dt$ ~$tCM1V$F4M(t$v΁ƀQ9s)U$)E4L$ +A4ƃr[wE$$M()Ɖu$T$ R 4: 9r)ʉU $AE<IM8E4D$ x$u(tNjMI)1 ^_[]ÉSWVD$0t%|$Fd!=u WVC6u^_[SWV L$th1B Pj6tMxd 1Ɂ HdЅuԅtFe@t fe6u ^_[WV։ϋA hQPh% VWt VP h% ^_VD$t#tL$ Pdt!tPdu^USWV D$ t^(tXD$ $]Edt?D$ 0tD$E@D$}P蒱 PjUWt$t$t$ jV$݅u ^_[]USWV|$,l$(tt@t10t+FdЩu1Vt PW+6ы[뼋?5tC $tp~tfs*tWŋCpExFPD$P&9FPU{:EL$QPj:84$PY:M|UW*6댋sxt*~ t KVtH|PW*6҃{dAsV:-V)ŋCpExܙ(VU9EVP984$P9M|UW1*t$(jj ^_[]USWVt8tT΋\$t=h|t6Ed u@u#t1UtH|PV)mƋu^_[]USWVq q D$$ tc1'' É''ۚ t$9ދ$9t1Fu4^_[]WV t$Wj" ^_USWVl$$tEt^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h% GdD$ D$1xG O4SQPt t $tsOdtYG %t%OhQRPh%hWj[u!) 81t 8t h%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRh Qj螽D$ t;t$(h3% j6Qhd%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  shd%V+^_[USWV] D$@Cxt$rj.VL$0QjP |$,wVh^%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh]%h RQh% \Rh@%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP!s L$  uhj/ËD$CNC KFCF CCj.L$vQP Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h}%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h%|$$HL$Xpx jP$P D$<t$h^%|$rst$h'%$p΁Vt$ h%t$$C$x|$D$ƀt$h<%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$hE%t$ 訾 $A D$PAD$LIL$HD$D%D$\ȋL$AdA`$ D$[A`D$pp1ɉ؄L$@tD$@ D$ \$\$ڋL$T$DSD$D$x$x J\$؃41D$QPt$8 K )rL$ ";t$ |$ h}%*L$F0D$[F D$\ȉFT$0JF$N(BF,t$SD$LPD$p)D$D$P\$CD$LCD$DL$HKC T$0JC4K8BC<JRS0K,C(s {$D$uhT$L$A|BQ|u D$t$D$p 9rt$~$D$ FdFdT$0JF4N8BF<QT$ǂZL$A|BQ|Ѓ@jPt$H tjt$Ju1ɋD$@dT$8tt$~ tT$8tbD$@@tLD$x@uBtjt$u,D$x$t"L$A4PQu h%'D$ D$%t$h%%t$PEt7MT$2 ,Hu܋D$<8t$tNGdtB$tD$xdt4D$t!t$ut$h%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h%t$D$u%D$6j D$@`L@O|$ut$h%몋sLߋD$,9CPut$,t$Vh VGPD$$t$,XGLtbt$,Vt$P= wPD$(À|$$.&D$$h}%ø|$$3WQ%t$4q t$hj%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%$t$et$4t$t$h%|$$tL$11BL$jSD$(D$$UWV}u WYh`0 ƍG 4$D$,$5&D$\$$%ԶWhVjíe^_]WVt$ VhWۭVhWĭVhW譭^_SWV|$G Ph%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWPc tF F^_[h:% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Shz%袴L$jQS u h%$BHJAWhjj*G PhJ%+WhW iSh%|Yjt7UhrjPs@h%h%O)h%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhX%! t#@uUh0%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%j봋4$VUh%. WjDu!' 81t 8t h^%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj< t'OQPh%j.V hq%ر)h*  WhcPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW` uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuhd%Pchd%PMt-u~`?w#F0gF Ph%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh%h% jSWN tD$ SVk h%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh%R PUn!D$C,9r|$t"w 7h% PW8!,Nu^_[]WVt$ tqwgVh޾j胥1GGG G XGft^_# Vh'%h:7#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj]8 \$wWh%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV~[ t0 D$ PSh%+ ^_[]h%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh3%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Shy%$ WShS%藫 F PSh%ت t){4t#D$} t*tu Vh% Vh%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E&%fH'9t Qf9Au<< <\$H $L'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%oD D$ PD$p Vh%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPhl%wD$`$T$B"pF L$ QPh%%P 1Br&$F  $QL$$QPh%<$tD$x%$l$ |$$ PD$$PVhB%蓥D$w 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPGt $jSjj)W+t WE^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV̰ t?jWj$j)Vot"$jWh@hVMu%h%螤VD h%艤1N ^_SWV\$|$1tD$x'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph%ߢWhgW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh %P E]1@EEE,E ]$z t(VhFj jWh,%h:7#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPSh|jPhg%h%Ġ$1ۋ6<$tD$D$$t;F SPh%Ο D$$hPS6V%Chg%6Jh%蘟u3=u1HL$$hQP? Ã37@$:VL$QRP% \$\$TSjjWl D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph9%~T$E|$wD藏S GDtL$$SQP _Hbh%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph%h:7#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh%\ot/kVhyj jۓ1Wh%h:7#b vF Ph%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7Ej%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t)%tPV"ELPu4 u<Udž6ttFtu7@t'P>;dž ^_[]à Vh/%h:7#ٚL$1jSWV|$WhgjdtxWhS>WhyS'WhSWhSws^_[SWVt${Du ?~ WhB%P 1@1ɉKCCS(C|S KtHd sHdit xty^_[Wh`%h:7#k ^_[ønL$xtyBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhWjP迋uh%h%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh%PU D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s = 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$'   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $е'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph8%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H ܙ(|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlRĕ ڃ p7t$ffBfB<$tD$WVPR肕 ڃ L$t3D$fffBt$tVWRωI ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPʔ |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ<t 1fw ')hC%葃R|$Qh/%j W$ D$l$ f9<t1}~ QWhW%PEt$sf<ڵ fu.Whl%z(Ex(Et(Epܙ(El6tj!zD$0^_[]USWV΃|$$w Vh%躂1H׋C 1ۉt$$S1ItU $]h]d]`\$,Džu\$Sjbƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蒀k(UPh%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%4},WVh%Ȁ ^_[]V΋QhyjFw1ɉHH@@ @ @$t D^D Vh%h:7#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VtP6jVjj`v-wx9Dth3%Vu Vh<%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Q|13%8WjjVuD$$Pj跤<$w$'8uJ%=ǃ81%8u+J%8uQ%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%} ؋?ut$u {`<$uhs`t$ h%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h~%u:fD$D$D$PjUVD$0T$4)̓w!B t$h%ufjPD$DPy{ D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$h%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%]s, t$h1%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhX%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%rt}u^_[]8V6)^_[]SWV΋y Wh(%q 1CCCC CC$t^_[WhN%h:7#q ^_[Vt$F Pha%q1B^L$Vt$?N Qh%Po 1B^jL$DWVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Whf%p Wh%ot^_[Wh%h:7#o ^_[ËL$Vt$VhjifF Ph%o1B^hVt$?N Qh>%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPht%h%n tjS0V  tD$ WSV ht%vn`^_[]ËL$kaVt$?N Qh%P?l Vhkjd1^L$L$@yHH=w$)11Ҋb:B9u9~a<u7hH$ʳ ~1b:Ph#诳 C9uj \$$} # a<  a< a<@ a<%a<D$P5$<u$<8L$9v\$$JD$$ؙ&9|$D$ fD$ l$ |$Pl$D$PL$T Tf3Pf3L$LD$Hl$H &|$ T$ fT$l$\$4l$ T$4̆< uhv%̆< a<@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f a<@xEh%j7Qh%Rh%h%Qh%Qh%P o3)΃\$$a<j.S\d u S )1?$QSPd Ƅ<t- l}3CҀ|Qy d}3LQH l}3@u܍$1RD$#jPW  VSW D$8WP|$XWh%j D$8D$dh$VWjV; ї 1Ah%TQh %Z5$<h0%H5$<h$6P.Ph%"{ 1Ah%Q55$<h`%5$<h!%hh %1FVnPh<%VN51uS áa<t=h%P1|$L$8jQj*j)5Pb<Uvu h{%a<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5Pb<uy h%Qa<t+DŽ$j$Pj&j)5Pb<KuuK1ۃ|$$8f3D$,tD$t3S?hb<uh%h%ƣa:a:|$$tF1FFFFF  F)F.N,a:a:9rF t$ƃ|$t.t$L$Aut$h%+8f3D$,|$,tF)F/8f3F a<@;DŽ$jjj5 y h!%b<8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5І<t$PV;hD$$HL$L$ 1x1PPPWJ jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$k ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$g_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$Ԇ<D$PVPt L$@D$D$ 1 G|$<$D$=Xf3$TD$j=h,Q&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h,Q&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=h,Q&P Ņt$,]vd 04$Q"dd 0D$$'߈FHGNm&Þw$ĸ':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4^ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H 1] dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=<u t11jNt<1<<t PY1@h32#hG%w <1USWV1=<MT$ l$(L$DžD$5<hh<苄  |$t$#j h<' D$<h#V7}<tUPTM uTWV}<WV}t7j L$QP} x#L$9u<;D$ D$uL$us <8 <APQ~ PQL  < tuQhh<艃  |$u<1^_[]<<<1Ҋ+~,u"1t$L$t' t" t΅tAL$= <u < t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=<u#<<tPI <t <1^<<tPSI <VtJT$1Aj<ƃ=<u#<<tP I <t <1^t <t D$<1@1USWV D$,L$(l$$~ )$1H$`t <1A\$9|ωL$ tgp9tX tt$ PHJ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$<<tPG <D$,L$$ ^_[]f11f11Ã=$<u /t((<11hhX<PjNt(<1\<$<t P衂1@h32#hR%r $<1USWVT$1=\<+\$0L$ D$D$|$(D$5$<t$8S l$,D$ D$D$t$j SZ" \$1 h#VuxE|$tt$(PH u~#WVKxEWV>xt^j L$QPx xJL$9uAE;D$ D$<u/h#Vwtj L$QPx x L$9t[ $<8 $<APQ~ PQ,G  $< tuQt$8S~ E h#VpwEth#V[wwh#VEwah#V/wEHh#VwE /h#VvE$j:t$ 1@|$ u\<1^_[]WV=$<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhX<h(<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=X<u+\<$<tPL$D L$$<D$$tˉ01C؃^_[\<$<tPC $<PPhhX<h(<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=X<u+\<$<tPL$IC L$$<D$$tˉ01C؃^_[t X<t D$X<1@1fUSWV\$l$t$VC PVW UB PUW SB PSW޽ t$ VB PVWƽ ^_[]WV t$uRt>DžtA=b<t ^_Épxj Ph"O ؀=`<u1F1=a<t,R 1맋5\f3P $r#QQhe%PփN USWV1ۀ=p<t ؁^_[]Q D$ |$GSSPhd<jW&u d<3 t< x<r1H|<$r#1ۃt2u3hWh[%苽 D5l<~ȍQ2w$ظ'<PAu <?$D$-\f3iO h?#L$Qh{%PՃ<`f3@<df3 |<I9@hf3 |<I9@b<`<a<<<y<p<g`f3 |<A9~WH`f3O<Fdf3|t%ƍC!t2)É$)t*<L$ <$)PD$p xPh<=<=<WjD$hpj Ph"Y 5\f3G $r#QQh%5\f3G $r#QQh%PփE 111{PZDWhV)E ESWV 1L$ |$ ru\95<s(>tGǀ=<u.;=В<rN;=ؒ<rDh< DžtVjWD =a<t^9H 1ހ=b<t& ^_[À=`<u1Ffu]pxj Ph" 뺋5\f3eF $r#QQh%PփND NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95В<95ؒ<H_ŋ <!9r؅ <9s9s_x< 8!9t.M9wI9rE<8! df3!9u!=<=<h<Rf ʼn9rPVU:  8!!ōD$p <PVL$uD$PVt$8<Pt$jUV:thŋ$L$Ai Qh<=<=<u=a<%E 1=b<tM^_[]t$h<,O=`<1GDu3t몍D$0xhj Ph"讲 5\f3"C $r#QQh-%Pփ A 9U7)SjZP)MPjS@ :9/ $)QjZP)PjS`@ tƉ111USWVˡ<!9ta)‹ |<h t u9=,$)<l u=<OE$)ÍFu\wlG'xD$X <PW=PWQ=<N V<5<w(ȹ' wG'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=<tGV^_[]ÃWU VjZS> vjZv q> VjZS`> V t$=b<tt ^É01ɉHHj Ph" ҋL$SWVȋ<!9t+)֋ |<| u 9t%)D @A Qh<U@D^_[USWV=<t^_[]þ$r#VVVh%\f3Vh2#h"h%\f3N%=<u=%%=<uce&8#=<u&RQPh%\f3u7&=b<u%"=`<u3#]%=a<uL$%=<u$VRQP\f3\f3$ d<|$gfff̉ҍ4މ劄1u#GO wһ$r#2#SUWh%T$t$|$f4SUWh%\f3\f3$ <Ggfff̉ҍ<߉劄9u#FN wh$r#h2#Vh%T$\f3$ <|$gfff̉ҍ4މ劄1u#GO wh$r#h2#Wh"%T$\f3$ <|$gfff̉ҍ4މ劄1u#GO wҸ$r#PPWh3%T$\f3$ `f3|$gfff̉ҍ4މ劄1u#GO wҾ$r#Vh $Wh@%T$VVVhE%\f3USWV΃=Ԓ<tPt <3!1PT`ǡ< <!)ȉ9r1U0`Ԓ<9tEuótP-x<!1PPjhjUPy t(<t<=<=<-<1ۉ^_[]V΃?< ; <v$1u<Ɖ <^USWVP<<< 0trƃh'PF,=t<=<4$t|n011FEEhĹ'PـEEC<(9r:5\f3S; $r#QQh%Pփ=<h<11<9s[ $,0EEhĹ'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEhĹ'P< <s <)ÉE;ǡ<<<(9r$^_[]98 L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡt<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9<s$5x<!։Ņ9<v6J Љ  ȉ  F1r{@p9<sBJ Љ  ȉ  F<< hf3u%1I#5<!֡< df3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=<t=<uVj1^_[]VhU3 USWV5<1!-<t E<1-<E@;<v@uW-<E@<tE3t,ÉE uUh< =<t"=<t!<E-<^_[]VhVjS2 USWVΊ |<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt${-<T$ |<^_[]1USWVȋ5<!) |<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPhܒ<h Åk jSܒ<WJ SW^<<;-В<r ;-ؒ<1WWjhj\$SU t\tV9tRSP[ uE4 j@\$S0 -\f32 h2#Shd%PՃ=<1lj1<4$9v(< 1QQjPjVQ4 @wg1=Ԓ<jUŋ5<!Ɖ)tPpUԒ<9tut݉<$/ؒ<u1]4$D$x Phܒ<=tA<$ܒ<C 9r09$v+jSV SV<<uɉD^_[]F/ Vd< h<r!1F<u. h<d<F9r^USWVP $1N=<1!׉) |<D$)ot +t=<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVDGWV;_s_u.G WP=<u.M,t <-},^_[]jPR 5<^_[]USWV@׉9 В<95ؒ<jVS;ؒ<u >9uP:S;ؒ<FjWV *1ۡ<t  <8<H@; <v@j<H@ < 3H <HPhܒ<<9rWV跫 u=j0 j@S0N -\f3. h2#Shd%PՃ=<9=<u]<t  <6<H@; <v@u,<H@ <t=<p xPhܒ<@^_[]9Ԓ<u)Ԓ<ؒ<:, flf3ølf3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áz3;D$t$PXWVL$T$ ‹q~y ;q~ t 1~9 QPRL ^_D$ l}3DAD$ l}3DAD$ l}3DA%D$ l}3DAD$ l}3DAD$ l}3DAD$ l}3DAD$ l}3DA%D$ l}3DA D$ l}3DA@D$ l}3DA%D$ l}3DA%D$ l}3DA@WV1F|$ 4Ⱥ'W tF u1^_ËD$t w$̺'1ËL$1t9t1ҍB|uËL$1t# t|$tl}3LH1H rËD$t l}3DA$H1ËL$tT$At9ut1VD$t$tPt$V- ^D$ d}3DAD$ `}3DAWVD$ $r#$r#tƀ>tw%+ 0DPWVhw&h|v3SF ^_Ð1|$w L$t9tøf3f|$3H#t$r#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PSi `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P% t F;'tm'D$'D$'1FthPt$$V~ Ve Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;'t$`=u-( 01H^_[]Ë' r ,$ 't u‰,$ ''<$t9rPQt$ 1t/<$t9vA( |fL$%9 (v\}3fL$#%9 Ȧ(vtp3føÃD$L$L$ L$D$Vt$ t$Vh|v30G hŒ"V"<t"' 0kPhg$h|v3|B |v3Vj ,RVC ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t% 0 % 1$^ÐWV|$ W4' tFu1 ^_D$ftL$Qń'1USWV$п$$ u V\  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#4$Y(Y111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$4' j F H @(N]_?[\;^r~uFF<<C><% ^q{t|~F~F ;^r~uF<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF<F^9րրw t$rI{i9s <$=l}3]D_\,<$t~uF F<<Au~uF <F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Al}3IDJt"m9~~uF <NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF <F"{u@9s l}3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup l}3DAu f'tf`uW~F=@9t8}@u~uF ~uF <FЉL<$USWV t$ ^h.\u/;nr~uFF<<EMŁ'$~]$`'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF<FωωD$$xt~uF <.n~EFx l}3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2l}3 DJt"r 9~~uF <N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF <FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljd}3TXL$21@u"`}3TXL$1t$1ɅtT$T$1=z3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 l}3LAtx `}3ud}3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ% F^_[USWV1y19sC11-l}3D]t#=k)CB9u1Bt=|yuA <Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F<FUSWV\$1=z39v1@(ϋF,@jPv(  t|F(N,QV,fH~<t}d}3Dh z31҃9v1B z3`}3Dh1҃9v)1BuG <G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF<<<^_Ã~uF<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF<F1^_[]É؉D$G%'t$t$U u Uw t/uՃt~uFG롋$USWV 1=z39v413A8 $A,tI d}3L$ `}3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS̈́'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQK o^_[]SWV1G9Qs7ӉjRq tF^~uF <F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=z3|$ r3GtD$WT$ou]t$S` |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4! L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ 1k ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf l}3>|$u l$`\$\z l}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" l}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA l}3D$¿!DQf_֋D$ !DAf|$$_8tV|$ul}3L$ DHuf|$$_u3|$ul}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$8'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ F ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf l}3>|$u l$`\$\z l}3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" l}3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA l}3D$¿!DQf_֋D$ !DAf|$$_8tV|$ul}3L$ DHuf|$$_u3|$ul}3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$: l$T$@C9up݋D$4xD$Ƌ@$L$TAL$yL$A$\$;t_)߉Ήt$ Wt$t V! @wj/Va 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPh<D<ø%Vt$1Ʌ1t э^fffUSWV[xl$(D$$u1vT$8|$0D$L$ 1L$)͉D$,11ȉ$D$411ȋL$$t$t$|$;D$ T$$75@PWn EPWV @PW> PW& tPW |$D$ tH@PW٠ PW @PW詠 i!PW葠 t)PW} |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,18 9r 胼$ t+$ $$ FhPWX D$D$D$j1҉$ xfD$4D$d蛫 /$$ AfAfIQPRhW?2t$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ V訛hPWV j:Wv D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP裎t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl ,$L$ ɍ$ d1,$L$ Lz9s L$4.2qPh$Py$$,$9s|$$$,$9s|$$ ydL$ɍ$ P1,$ L$LZ9s T$hBJ R =RQPUh$PM$$,$ 9sL$42qPh$P߽$j$,$o9sD$l6$,$/9s狄$ @2PQh$PB$$,$9s狄$ @<h, ,$9suF9snF9siF9x|$B$ yS,$9s%NM9D?<$ @< L$|I#t$xjhQPR%t$Ph$P$$,$9sL$tW2QPh$P褻$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ Y,$$ |$jj Rjjt$,$ a$,$$$49s獃H,$$ g\,$QPh$P$$9s獃K,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HPKpRQt$Uh$PeD$hL$HL$0HL$,HL$$HL$ PH @ jl$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@1l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPHl$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$Pֵ`$,$$_9sjjjhRt$,$ +$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F4PQhW说1ɃD$D$ D$1 & fffUSWV`[t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r  l$8D$UPjO tCL$HD$ QPV跛 t2V t+jPj 1ɃىK'l (jD$LPV] U (l$8J 0jUj 6 0`^_[]fffffUSWV< [uD$yXXD$/Xty$/devjPt=ƍD$4PhFtHV~ V@ t|$4l$8$<D$ oD$ $<T$$61PhQRVJAD$ t@D$D$D$KD$pL$T$ t$F9t$D$0l$WzE?tD$pD$ jjRs tkD$tJt$PD$P  ut$D$P uPL ujjD$P k6[ 8[ @ iŋ$\ $X $T $P :)tt$ Po$` tVjQp 1tWhgtQ| < ^_[]ÐSV[ L$t$ t$ t$ PQft+Y4 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[|t>h == 9u8jj襆 tl P 1 4辘 0ǃh 'ǃƃl t芘 01^_[ÐUSWV[$01l uut!j/Vc uSl tƅu誖 ƍ|$6VPQhW=r ?h@VsǍD$ jPW 詗 D$$WtLD, L$Pjhjjj QD$(P>t Ƌ<$t'Vu D$8 tO 8 A L$^_[]ÐSWV[vl u,;P66ƃl $tj/V@b uAR Ɖ獃6VPQhW蔭=r蓖 ?t"l VPR tEFu7hh%@V l hVPYB a: h jj̃ t=jjjcx !ƒt"h PqJ 1u• 0趕 0^_[螕 8#uVt׉ ƐS[>[ÐS[ît$[ÐUSWV[Àu } D$<$ t$u$$D$P.ut=k<T$JL$|D$x$L$x$PQh$$$Pt$_hlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$\1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$h D$@j PW- K 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ]|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR辦ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6pW8G4jjdv6g jjdRPKWPGLjh'v6g W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[ L$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[Ë|$GtB#l$%t$P<t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$P^<t!G t7t9uӾ^_[]ÐUSWV[ëtC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[8t$0t$, ǍVP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP/;tG t@/t;L$uЃt'D$ t$jb…<$uNt$0t><$9tR V PUW >&t1<$W#^_[]fUSWV[t$D$hEt'1PVA:t%D=u1p uVPjmD$@ 8^_[]ÐUSWV[x|$ D$hEt$1PW9t%D5up ^_[]ËD$@ 40tMd D$jPt$V@ ŋD$18t|ud r"u##p u'B"tt$p a(4$WPjуHWPj.SV[Mt$ v!v !V!^[ÐUSWV[D$,8tD$,1퐐8@ujHƋ|$(W' F$"jU]F D$ D$,F>D$Pt$_1}nu1ɀ}ouL$D$j=UD. tǃ|$D$,t1PU7tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8p t 4$ V 1^_[]ÍUPj0USWV[U$4$,a 0(jPUv uj:U'- A(jPUM tKt$}/3t$UhVh jVPUbQ Pt$UD$PR|$ jjWjjV(6mt$ MjjWPjV5t$/KD$PVǍn/$0VPW  FD$ GL$ jjQPjR4tqVUW  R_ 0$0X_ 0G(ks_ 8uj/UBŃt$ $0UWw  :_ 0"(QPWX  111_ 0$0P$4)  11,$j$4V$4WjUpP>PWst$t8HPQm&^ 0G($0P$4  1,$D$PCU:M^ 0^_[]Íg(,$UPVWu1^ (1WP$8$8tVsfffffffS[;D$D$ $L$T$jjPQjR2yD$[fffffS[یD$D$ >$L$T$jjPQjRi2yD$[ÐS[{D$D$ ?$L$T$jjPQjR 2yD$[ÐS[$L$y(jjPQRQyD$[fffffYϋT$u\tÐS[Þt$kSWV[||$Wt$t$/ 9r[ ?(WVPj^_[ÐSWV[,|$Wt$t$ 9r[ ?(WVPj^_[ÐSV[݊t$ 9ƅu(Pj^[ÐSV[Ýt$t$eƅu(Pj^[ÐSWV[\|$WIƅtu)WPj ^_[ÐUSWV[l$|$UWƅttu!)UWPj^_[]ÐSWV[̉|$Wt$ƅtuH)WPj ^_[ÐUSWV[{l$|$UWt$ tY 0e)UWPj^_[]ÐSWV[,|$t$Wuƅu)WPj ^_[ÐSVP[D$L$T$$RQP  ƃu)Pj^[ÐSV[Ýt$t$t$ ƃu)Pj^[USWVP[ZPt$0t$0t$0t$0t$0jt$45 Ɖ׋,$t1X ()t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[ڇPt$0t$0t$0t$0t$0jt$4= Ɖ׋,$t1:X ()t$,t$,t$,t$,t$,t$,Pj ^_[]fX_L$"wÍ0ffffffUSWVDX(D$4t$dT$\l$lL$`1ۈ$<tyD$XD$T$D$hD$t$l$D$D$ D$$D$(D$,D$0|$  tt Z %ju %#jo%#jx|$L$t\$4t$hVWRt$h\$4t$hVWjjm~D$$<$|$ D$<D$81$ |$ <,L$4GD$ =u <$f :<$F<$f ՉʀЀ r ʀ¿d ʀŸV _@F O?1 G<@& fu  $t$T$։t$<1 tl$<1 u<@TP* <$  |$ |$8\$6O? v 1ҸGD$ $ t1#T$#t$ |$0D$$D$,;D$s L$,D$$D$$ O3L$< =u!L$$;L$sD$=D$ L$$L$$HL$ D$$ D$$y|$ t^;D$sL$L$ D$$ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$8CD$,7|$$T$()9%D$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$D$$D$(D$,D$0T$|$)D$݋\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)oD$\$4VRT$$RQPh;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9sD$D$L$$݃L$$L$(D$,D$0T$t$)eL$\$4VRT$$RPQ^\$@L$$D$,T$()9D$$;D$8sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$PjjeD$8 $~D$$|$ $݋\$4WRD$$Pjj|eD$8 $Ƌ\$4VRD$$PjjPe1Ʌ륋\$4WRD$$Pjj/e~D$$$D$8D$ x@uNt$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjbD$$u|$0L$$tB;L$s5T$ >#\$4K L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[yjt$t$t$t$t$[fS[þyL$T$ Pt$t$t$[ÐUSWV[xy|$$t$|$0t$(aD$ j/U: ,$t|0UPt$ WVt$8IuUI 8uF,t$ t$Pt$t$@t$hD$ ~ L$u [ËPQ2  [ÐS[gD$~ L$ u [PQt$ [ÐS[þgjt$ 0 [ÐS[Îgjt$t$t [ÐSV[]g0t$t$V( tD$~ L$u  PQV ^[ÐSV[ft$ t$t$VP( tD$~ L$u  PQV ^[ÐSV[Ýf0t$t$V' tjt$Vh ^[ÐSV[Mft$ t$t$V' tjt$V ^[ÐUSWV [et$4@|$ǃ( <ǃ, ^ǃ0 vǃ8 #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ< -ǃ4 -ǃD _ǃX |ǃp oǃ8 -ǃ@ -ǃ\ <ǃ` >ǃd *ǃh !ǃl f2Ot^t8tjtfxx ؋tvQjPW+ 1 QTpQTtQTxT|=u^_[]ÐVY=1 T$tpqttqtxqt|1=u^ÐUSWVP[J= l$j+GG(ujjIeQPu u0Pj$j3:xQP>ej> 8 j<` j^ jv j# j: j'p j# j# j# j-( j-p j_`x j|P@ jo@0 jp0 jr P jyh jz j{ j| j} ǃ8 !ǃ$ +ǃ` !ǃ( ,ǃ !ǃ, -ǃ !ǃ0 .ǃ %ǃ8 0ǃ %ǃ `ǃ %ǃ aǃp ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ8 %ǃ$ kǃ` %ǃ( lǃ %ǃ, mǃ <%ǃ0 nǃ( %ǃ< qǃ #ǃ4 oǃx #ǃD sǃ %ǃH tǃ $%ǃL uǃ 4%ǃP vǃ ,%ǃT wǃ@ %ǃX xǃ0 ǃp ~ǃ #ǃ8 pǃP #ǃ@ rǃh d"ǃ\ yǃ e"ǃ` zǃ ǃd {ǃ `"ǃh |ǃ ǃl }2NthtBt'zxÀ z ϋtuQjPVpx | 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX7x l$+4+ع x( PPu^_[]fffffffX7L$fǀx ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[N7t$0[ÐUSWV@[7|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:`10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;; 8u1E3t%`10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[ý30t$t$V tt$Vj^[ÐSV[m3t$ t$t$V tt$V^[ÐUSWVL$[$3|$0D$(T$ 2D$ED$4D$D$x ftW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃx ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4x ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃx D$4Pjjj[ 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$ 1|$0fx 4)Ɖ4fǃx ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$xe4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fx f1jD$` `4rփփ19‰4 4fx fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fx f1*Pjj!Q j S[+t$j[ffS[+0t$ [ÐUSWV$[Ø+|$u'2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(*PtjjP_ ,GT*P趰tjjP5 GX!2@@xGX GXO <W$` OT d2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$VL P肦D$$<$$u$PC HuǐuU P D$$鐐<$$u$}P Huǐul$Ut$V VU $|$~"14G;>|2V)^_[ÐUSWV[Å"fǃ hiu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$j T<TV$2@4tV= =wlj<$hVt$ V- V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í(+PjS[ 0[ÐUSWV [è |$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4`10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$薣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ`10vL$Eǀ3뤐SV[Í0t$t$V t V^[ÐSV[Mt$ t$t$V t Vr^[ÐSWVP[ $t&T$t$2PWj $^_[ÐUSWVP[è1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[T$9D$Pm 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[xD$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW|ŃuRG @tGB 8u=D$3t.`10IrD$ǀ3G @|$tmG  f Hȃ  fftVWq=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)`10oǀ3g 룸J+Pjj Q jSWV[ü|$WgƃuOG @tD- 8u:3t)`102oǀ3^_[ÐUSWV[;tt$339}3AP3ٞt' 333343;33PQRPQ 33t331^_[]ÐUSWV[ktt$339}3AP3 t' 333343;33PQRP聈 33t331^_[]ÐSP[Ý$tT$ 2Pjj $[ÐXO tT$QT1øUSWV[TAx43fTFT$P謜j 覑+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]ø*Pjj(+,*PjjQ舯 j*P^jxffffS[N0[ÐUSWV[(|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ,uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[í0t$t$V t VN^[ÐSV[mt$ t$t$V t V^[ffSWV([)0Wt$<2WV0^_[ÐSWV([t$8Wt$@2WVd0^_[ÐSWV([é0t$[ÐX3ÐS[01[ÐS[13t)PtЁ3QP讫 [ÐS[~13t+PtЁ3QjP [ÐX/3u1Ês3ÐX3u1Êu3ÐX3tD$s31ÐX3t L$u31ÐX_L$31fffffffSWV [)D$ D$D$$ t$VWj9 XD$D$D$ $jWj8 jj3:jVj8,^_[ÐUSWV[È13PtЁ3QP\  u j ƃ ~:Pjj $; u jPj 1 }t&jSEHjjQppG@|t0QjP Et"@:t@0Qj8g @0UjK @UjX5 p舝 jjjp蕩ǀ3Qt43PjQ蓡 ^_[]ÐUSWV[è3 uPjA  ƃ  uRD$D$D$ D$D$D$ L$PQj ǃ @HtȍL$Qhht@Pά tBL$t9D$t0`9 t ǁ39tǀ3`(8$9hu9xt WUPgK 9hu9xt WUPJK Qt43PQ? It3PjW輟 t6@$0d^_[]ÐS[þ uPjl  ƃ [ÐS[~ u j- ƃ [ÐSV[J@HtȉQhht@P t!$tL$t` Hwtǀ3^[t$ЃS[ë uO$D$D$D$ D$D$ PQj ǃ [ÐS[; ~:Pjj $; u jPj 1 [ÐS[3t[ËPtЁ3QP蹣 [S[ÎQt3PjQ [ÐS[>Qt43PQ* [ÐS[^[ffffffSV[|$ ta@|$t|u7x1t-0QjP 3p 1^[þfffffffUSWV[KT$2tt6usRRt1u8]RuARt'20PjR p ^_[]ÐSV[Ý2tt6uq IIt1҅u8[ Iu? It%20PjQ% px ^[fUSWVP[t$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,t3tt$P[ø[ÐS[t3tt$ t$ P? [ø[ÐS[þt3tt$Pc[ø[ÐS[~t3tt$ t$ P [ø[ÐS[>t3tt$P[ø[ÐS[t&3tL$ t$Qt$P&[ø[ÐSV[í0t\Ɔ43t)2Fpt9PVlPV(3tP3oV^[ÐS[.t3tL$jQP [ø[ÐX1t T$~93|4 RDÐS[ît3t PWV[ø[ÐS[nD$t3t PV[ø[ÐS[.t3tPUtJ^[ø[ÐUSWV[0Ɔ43t)2FttrPVPV,a3tR3~>11;3}:tt3PpT^_[]ÐS[.T$t$t$ [ÐUSWV[93|$0t$,T$ $u0\MDH@utl$4D$ U' 鐐t$ D$PL$ QD$ PLx)t$蘋tL$9D$)<9u AT$)RU[t( $4T$4R7D$0D71^_[]ÐS[þt3t P[ø[ÐUSWV[x8D$ $4VjPjftSʼnt$U)eƅtMD$ $t$UD$PV*tT$t$$V VVu^_[]ÐUSWV[û|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3\P<72@HX3@$4Ƈ31^_[]ÐUSWV[Ût$3t P3~/11퐐448s0;3|4s^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W! 1Ґ$t$V|$(WD$0P=t$$萆ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj Vn $4D$)Džu |$ $tR1VT$ Z 4$)tWj V% T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP`y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQhNj$D(PƒD$$L$ ;47&ffffUSWV[|$$D$hjjU考 t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U: D^_[]USWV[k|$$2t$hƋl$r:D$0蒂D$4quX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U# 1^_[]ÐWVY D$T$ t$w4  p@^_fffSWV[ìt$VO~~tyы9uv0jv,j9p9p 9pt P譜jVj1^_[v4j9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVXNt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[þ|$ uT${[ø[ÐS[Î|$uT$ L$O[ø[ÐS[^|$ uT$[ø[ÐS[.|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[Ü|$u8t$D$|$% Ɖ81^_[øVX>|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZnL$1~t$ ~9J$u9r ^ÐUSWV[+D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[êt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux hQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p `912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [Ht$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[T$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[͠T$L$ Aq D$t$jVPt$ ^[ÐUSWV[Ël$1t>19)Rju uuu0tPU^_[]ÐUSWV$[(t$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p0 F, fFV8 }![, < fN< 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD9@ t$$@ @ $Pq|V\$UT BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p;@ uD D$Pz1r)1@ $Ph WA\$ ƀw @ $PQR\$ D$@@ L$PD D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw@ $PV\$D$px1ŋG @ $h QP \$ ƀ=r{,t$G@ $h WP[ F$h Wt$ P9 \$ w@ $PQw D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u++k+PQhrR4 $8 USWV [jD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ `;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [$X D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ0) @x H$L$T$ t$`ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j Pox) @ltQjP%( F t3 j PIox) j |j m  ǃ 1;  $l$*ǃ ;  @@ltWjPV' yA t`j t$lnx )ȉ }u D$8o@@lU8 LQj `u ;  "UjP& ; ~U   @@xuă tjWmx) j띍 ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$klx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$jx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$3jx) j f ; ~nUjP" ;  @@xu̓ t!jt$ix) j룉PS[>OD$ t# PQiix) P1[fffXNHy8~DyD~>Hlt htðuu냹tt u1ÐXN@ xÐUSWV [XNAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ChD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[ÊIL$9 ft$9|$ 9l2uCUw$-4$t$sk#w#|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXHH2hT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYkF|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y#f>2~w-s q#f ^_[]ÐUSWV[EL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZ EL$x?9J\~2D$t$|$ Irftf>vf1^_[S[îDǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[+DT$L$l2uI~w-ss#w!#ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐX?Ch2ÐUSWVP[Ct$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[@l2tu6@t!|$0QjP (!G@f@d^_[ÐX@f@dffSWV[\@D$ yOQW~ ;O~ t Q WP1/Wv^_[ÐSWV[?|$D$OQW~ ;O~ t Q WP.W ^_[ÐSWV[Ì?xWt$W^_[ÐSWV[L?|$Wt$W^_[fffffffUSWVX ?tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j oxL$d( $ș)l$T$ $L$$$D$w#x)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H#D$g1fT$t$j xŋd0L$ș)L$4$T$ l$lt$mD$$Յ $$v~x;l$tl$l)"PRx‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K#Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K#Й~ ƃQWT$H ^_[]ÐSWV[l-|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[,  jt$t$t$P1[ÐSV[í,  jVjt$PJ1^[fSWVP[k,|$t t9t QD$P2L$QjPW]L$N|$kK)l$kK) 3;3i)0%PUt;y t0q$t~fuUvIu1 q 4%^_[]ÐUSWV[Ø*D$$L$t@1D$D$>D$PL$QjPW\L$kL|$kC)l$kC) 3;3i? )X&PU^t7q tAy$t+nuUw)u A\&y^_[]USWV[x)D$(L$1҄t@1D$D$8>D$D$PL$QjPV[l$-?L|$ ) i)ʼn) i)k>4{>4lj*SiŠ)Ǎ`'PD$P$t1D$Hd'<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WP-uVEЃ^_[]ÐS['t$ t$t$ [ÐUSWVH[ø't$\dlD$P蔥ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UjL$QjPU)YL$ȿNt$kK)kK) 333i)0%PU$D$$4%ED$j=UtƉH$$D$<$|$WlL$QjPW+XL$Ƚ-?Lt$) i)) i)K>4s>4Ɖ*SiŠ)ƍ`'PWD$5tcL$f <$|$WL$QjPWnWL$ȽkLt$kC)kC) 333i? )X&PWtD$Ed'E!D$\&DXh $$D$ogPUPU+PUmPUUsPU=t+PU)tr+PUte+PUtXEPUu^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$蛫L$uD$ 9D$ tf, UQ,$t'UWp|$BUϰ4+1t$ 1 t]|$uf, FM $QP 4$  $LD=uVQV $4D$ H^_[]1|$t4$1USWV[Æ!hsWT$L$ $L$\1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG$M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$\o 1Pʋ$H $$$H $<<$Rt$W; /$//$H $>$D$^_[]ÐUSWV]X2~:^^t@\|,$n*^ÍxЃs.ÉD$$\D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%\Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[û1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h荗 5 @0t$E4}0u"$hUE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$,σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,/E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $h:ȉىӉl$ |$uGD$1l$뀋$\DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $;$t"A$|t+H$D+$,1$uՋ$1ڃV$D=!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,蒝RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$\t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$t1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,貘rE,u0M4tڍqu4 $01$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,莗tRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[-T$ D$$1Pj= [ÐS[ t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[ý T$ D$$1Pj [ffffX L$ÐUSWV[h |$(t$ l$u~Pƅ>l$$uj˹hjL$tfjVP NjD$uj(P/D$@ x |$(u,VqE\1F4,9Pk1D$tGuP|$(L,x |$(tF|$(mp,V|$(,Phht@Uƾ t$t$tL$t RB(JtRtPYtjjPv IA(tP0tjjPv IA1t^_[]Í+Pjz,VSVP[ T$L$D$tRQPVƋ$t P.^[fUSWV[ t$|$t$jt0ʼnVU|$T$VŸ,Pt$t~Pt$tk,Pt$t[,Pt$tK,Pt$kt;,Pt$TuA1 @VK^_[]ÐUSWV T$L$[m ǃ ,P Ņt'}/u{L$$ t$  ,PЏ/P\}PVSuU,}DžjWWW!tpL$v u\D$ VP$tIT$ L$$ Pt$ ΖV`'u,1V='-PΎ$|$ $~:s1퐐Nt:t됐tÍMwUPW虫 D, L$$ t$ [tu{PtG-T$ PQhR~)T$ L$$ t$ $"-t$ $:uw1퐐Ot:t됐tÍMwUPV虪 D, L$$ t$ [tu$ $ȁ ^_[]Í, USWV[8l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%n\$L$ A ZAthhP`+jj!4G(hhP7|$ Gt\$h(jP|$ "\$jhތ|$ G9ouG)o\$UD$pڍ|$ Go\$UVPȨ W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$POF$ދ\$P4~ F$D$\$jWSF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vmt.)9uUt$VJ t6u0,1(V9ſuUt$VJ ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEP{UWP葡 .,v3l$4uWEED$\$cD$Z-D$|$j|WHtD$4@ T$L$ t017t<,t\$RT$肽D$PztDl$VWQ薠 Ut$P脠  1<$WNjt$D$Pl$8u)EW|$WV W蘊D$D$D$ Džt$v\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$Ux\$8C k$K($fC K(K(|$T$ t$4B-P e>p1\$91\$-4$K\$N-PdD$PȈD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q袇 ^_[]USWV[D$t uy0Z-|$ 1퐐/t <,tQL$u$Pvt2ƃ$UWP菜 4$t$P{ 1^_[]ÐUSWV[K|$ t$FN,9vtU6 uCu;Uvt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[ê|$ l$XhPW uLt}D$x@ȃǃtVot$ UĹ)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$^-WuPt$D/Wqpry-WuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV] }t0EfEfF}WuV1 f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[{|$ t$FN,9vtU6:yu]uUU7ntHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[t$FNy9vtW6xuCu;Wmt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Hl$D\EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1-bGj|UiD$tL$j|U葊t L$U(=r|UPt$P 10^_[]ËD$tPL$ =r-"D$t+PήL$=r-QUPt$T^jjPutt$ $@ 1D5t <,tFPkD$4 VUP舑 D5$(L$tSD$HtJ11t <,tFPHk Vt$P. D5$h|$t+D$Ht"t$wa $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0n$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p n$D$t$HjjjPjfWjQ(.VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$ $ ftGt @1@WG(f hwUSX =wb, Ƅ |)ƋtVPUX 9vD|ŃƋGtVPUW 9s D|ŃE$^_[]ÐSV[t$ tavgiv\ivQiv Fiv$;iv,0iV'i19 uǃ ^[ÐX @ÐY_ @u0USWV[5$(E$$4D$$0j:W vt/jQP蠛 t0V$0W  NjE;$^_[]Ã$u 1tM,ut64ut<x f$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP]$P]Cǃa(RD$O@$$,PQhW蚿 t" ǃt}LJjj($(q XPX XPu.P]t.j/V͊t|$uFA$jPRQV'FAT$$jPRWUQV.VPjESV[Ýt$ j:Vrt/jQP- tt$V\1^[ÐVYNT$փ1ut^1$^USWVH[t$dl$`L$\D$Dȃ=u$<$y.L$VPj@Q3T$tLT 9 $ƅtID$\WU$R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\$1"DŽ$DŽ脥 $;D$Du ЃH^_[]OGUSWVT[è|$pL$ll$hD$P=u$ $t$ u.L$WPj@Qϻt$t$ T$Ijj D$Wt$ $t$j 辡9<$u-;D$PuyL$T^_[]WQU ;L$PtNT$DŽ$DŽ ;D$Pu T^_[]EUSWVD[XL$`T$dt$X}|$@uMu $t9ƀ.RQt$dPj@W艺 tRQt$dVޅ M;L$@uD^_[]9ESWV[Ü|$=uju $tVw@}tL!$cTDŽ$DŽW1^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуucu $tOz=m8@tW=m AT$ vPQj@R x. VPRD bl{<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l$  4()uT$ff׺r$σߺfDfu,$tу$$1蓠E;D$Lu^P^_[]Ët$d$  DŽ$DŽ8,$1,$ BS[nD$u&u $tٟ-[Pf[ÐS[D$u&u $t艟-[t$ P{[ÐSV[ýt$ j:Vjt/jQPM tt$V<-^[ÐSWV[\|$t$j:VQjt/jQP tWhVU  WhV ^_[SP[D$ L$ $L$ƒu&u $t]-Qt$Pe  [ÐS[ÎD$uu $t1[Pz[ÐSV[=t$ j:V6it/jQP͎ tt$V<蒝-^[ÐUSWV׉[R胍jj 腚D$UWt$\ t$j \19tG4$$  DŽ$DŽ^_[]ÐUSWVL[&D$D$H1,<jU$ u} t @u D<@u^$  DŽ$DŽ0D$;D$HL^_[]Íl$ E< us{Uٛ8|$jW$! u|$ u}Fu$  DŽ$DŽIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:p# D$t$DRL$Dp# A @`? .19<$t# D$D@ @`ƒ?.91s# D$D@ @`Ń?+.9r# D$D@ D$@|$`D$?.;|$  ՋL$q#  <$‹D$Dpu# D$L$ D1 <@4$T$<`Ń?|$_u+.19QL$ T$D $L @`ʃ?|$_u.19 l$ D$L(D$<_D$$D @`Ń?+.19 ՋL$ T$D |$_$D @`ƒ?.9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t..;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3.|$D/? .D/ ?.D/D$./T$T$L$ t$ ?3.D/? .D/ ?.D/D$.D/D$L$ < .L/ ?.L/ .D/D/ p# <$<$5USWV[U$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# v3Xv4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# v|$| t!qtAD>1tBD>׹@# vD,|t.tkŷ< s݃1@tt# tр‍ p 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# v|$| t!qtAD>1tBD>׸@# vD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;p 1ttD~t# v  fABv w~4ABv w~4ABv w~4ABv w~4ABv w~4Av wʼn41 @tt# tlj瀍 ;p 1ttD~tw$Qv$A# v$B# $u1 @tt# tlj瀍 ;p 1ttD~t⍃v# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف@wр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځp $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t W 4$l$T$ L$ Ń4p x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]$USWV(]D$<X%UUUUʁUUUՍ4P᪪p t x   x p t x   x p t x   x p t UUUU $؃p t x   x p t x   x p t x   x p t T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yh $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3p 3p 3p 3p 3<$t$3~3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 1#t$t$D$|$811t$3=p $3=p $3=p $3=p $3=p t$$3=p $$1L$t$|$l$3l>l$|$l$ 3p 3p D$35p 35p 35p 35p 3p 3p 3p 3p D$t$D$D$$7֋T$ Bl$l$l$$xl$ p t $x   x p t $x   x p t $x   x =p =t $x   x p t ȃx   x p t x   x p! t! x ! ! x 5p" 5t" x " " D$@P1(^_[]ÐS[[D$1ɐȊt tT Tt t t4 uP1[ÐSV[ګD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[ЪMD$$D$DD$@D$9\$6D$L$T$@jjPQjR6PqD$HPj mZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPD$0Pj%m\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjlt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]GUSWVd[å$|D$<$`# hjD$@P DŽ$@D$V$@8$u H$@D$/$@UVlljD$Pgt;uH.WPsi.WP[iuD$.WP=iD$UVljD$3jPWQh D$,u:|$$@PW#x$@L$,UV蟘D$l$0t$\$UVD$ D$D$ D$$$@&D$ \$UV0tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWRD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUc$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-8/PQRc_h$DUt$@VF j jW  hjU hj$P D$@hjP D$<;$`u`d^_[]D$RW菔D$t0T$@PQhR證l$ $fffffSV[D$ h`rƉPw)Ɖ^[ÐUSWV[èl$0L/jD$PUFc th%h`) $)D$j PUF $l$1}$K1D=t<$t h`tt$,aōS/& 4$t$L$QWPjbVt% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃\/t$ Wt$t$Pjbt$(V& % %  % jQPR ;& % %  % jQP ; & % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % &  & jQPS ;& & &  % jQP  Ƅ; & jjt$X ^_[]fffffUSWVD[؞|$\w ao2t$`tD$@jPV蔑 NjD$@9t8t-oD^_[]o8"u trWD$ID$ ;D$D$+D$<D$8wD$X$2a$g/WQjP艅0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ }jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[|jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Þ|jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[N|jjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[{jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[è{l$hUK<ƉD$ D$PzljD$VkD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$k t$ _ UV T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[yt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[yjt$t$t$@[ÐS[xjt$t$t$[ÐS[îxjt$t$t$[ÐS[~xjt$ [ÐS[^xjt$ h[ÐS[>xjt$ H[ÐUSWV[xt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[8wt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Xvt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXuL$Q##wÍ3ÐUSWV [Hu|$(l$$t$ D$45D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[îtD$ hPt$pA [ÐS[~tht$t$a [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[sD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[HD$pML$LjPt$lv D$h|$df$D$V`L$)L$D$PVW{D$ |$$v=D$ t$.D$lp8L$ QjjV V|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V. V|$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>V V|$)Ƌ $PD$2PL$Q, rg $ $,p=D$D$lp0t$ jjt$>VT V|$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7zL$R)уtuÐWVt$  r!̐cw^_fffffSWV[lAt$|$G@hjP $j@PW" g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[E?$$N$@r8hUtE\EXETEP$t$tAsE@hjP  Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV  h$$VLhVU< hV1;$u Ą^_[]<USWV [Ø=l$(16t$ %T$$NP NT  ()`N`L$$WRP# ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPT 1 ^_[]ÐUSWV_.<$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ Ws hj$P< g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVd D$hWD$$hPD$;$xu D$e^_[]蜞ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[X*|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[Û(D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[û'D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]X&$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$44L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$4$FQ? T$‰ً$|$D$G<uD$ $4 $#u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? nX4 T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍u4FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N 5FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Qs l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 14&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B 3Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅGPGX GTG\GG?$L$u aD?E4FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  5FL$Q? s5FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$?5$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tU5D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$#5~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=#4$FL$Q?P$4$NL$Q?D$T$ ߋ t$4$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $sUSWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP覤 )t]D$)WPu8菤 }43M(U,E4E09w)RVP^ E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[ t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ÛL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU< F4n0)Pv8U' 1tN0^_[]ÐUSWV[ t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R肝T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@ƖD$?? u)D$(#5L$(?5É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+8T$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[È|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw w o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw v o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw %s o $ho)o)hu $AA~+ Nl$("ȟFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQr F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw 0r o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQqL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw q o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw o o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw $o o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw n o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq m $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq j $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$Xx$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv $Y n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv tX n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv W n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu S } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu GS } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu *R } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu Q } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X?DÐUSWV^L$4t;T$8\$0Ӄs3I͉у1&Ӊi913DƒT$4zR13DƒT$4zR13Dƒl$4M1ʉ3DxT$  1ϋL$ 3DÃ1ؐ\=13D\=13D9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3D3D3.D3D $3QD3D3D3D $3AD3D3D3DD$ $3A D3D3D3D|$D$ $3AD3D3DЉ3D|$|$ $L$l$11D$D$33D3D3D3D3W13D3D3D3D3G13D3D3DȋT$3D3W 1‰3D3D3D\$3D3_1ˋT$ )3D3D3DÉ3DϐÉ13DW13DW13DW13DW13DW13DW1Љ3DO13DRЃ^_[]ÐS[Υt$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$D1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$D1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXڣ$T$tfǃvEt $D1ف 1υt1Mu밸^_[]ÐUSWVPXJ$T$tfǃvEt $D1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX_>ÐUÐX/T$J r (ù)ы(ÐS[D$D$ P[ÐS[þt$ /+[ffXL$ P $ d, | 0 x8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P<L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$DĺPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y"L$ 1 fщ;)t)T$l$L$ 1Ĺ\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ ķ|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +|0)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXk\$T$L$o>o4>o>t>Ĺfr ķ f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[zt$xƅt|$7Vs;G CK ^_[ÐSV[Ízt$ )tt$P&;F1J J^[ÐUSWV[8zt$ԯtLƋ|$$l$ $P:D$PWU, 1uJ(V_u gJ(^_[]ÐUSWV[ëy|$GtE/D(U8]wUZt#V譡=yarau D$0VSI1^_[]ÐUSWV[+y|$GtE/D(U\wUt#V-=tcidu D$0VӞkI1^_[]ÐUSWV[ëxL$A1t3)D(U6\NjD$pUTt D$8I0^_[]ÐUSWV[Kxl$M1tMuD1V[uVt(WJ=yarauD$8H W1^_[]ÐUSWV[wl$M1tMuD1Ve[uVt(Wڟ=tciduD$8%H W{1^_[]ÐSWV[iwPt$ t$ >* t6D$t7<$D8WZt$WtD$ 01GG^_[SWV[vPt$ t$ ) tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"GVq G^_[ÐSWV[IvPt$ t$ ) tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"{FVћiF^_[ÐS[îuL$T$ jt$t$ [ÐUSWV[vuQƋl$$P 6D$PUW'( tgVD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6uE 4cE8V@u 댅t D$ 01?E^_[]ÐS[~tL$T$ htcidt$t$ [ffSV[Mtt$t$u_Pj=tciduL$1=tcid^[ÐUSWV[st$t$#_P=loobul$VEloob^_[]ÐSVP[ÜsD$Pt&Pt$t$` D$VbD$1^[ÐSVP[Lst$t$Vt$t$` D$VD$1^[ÐSV[rt$t$t$!^VP8^[ÐSV[rt$t$t$]VP9^[ÐSV[Ýrt$t$t$]VPg9^[ÐSV[mrt$t$t$]VP9^[ÐSV[=rt$t$t$a]VP':^[ÐSV[ rt$t$t$1]VP7:^[ÐSV[qt$t$t$]VP:^[ÐSV[íqt$t$t$\VP:^[ÐSV[}qt$t$t$\VPW;^[ÐSV[Mqt$t$t$q\VP;^[ÐSV[qt$t$t$A\VP;^[ÐSV[pt$t$t$\VP<^[ÐSV[ýpt$t$t$[VPw<^[ÐSV[Ípt$t$t$[VP<^[ÐSV[]pt$t$t$[VP<^[ÐSV[-pt$t$t$Q[VP<^[ÐSV[ot$t$t$![VP=^[ÐSV[ot$t$t$ZVPg=^[ÐSV[Ýot$t$t$ZVP=^[ÐSV[mot$t$t$ZVP=^[ÐSVP[L$T$ 9t9r 1;q u4r0ЅtItRP1^[ffUS[E>EM L$$D$e[]ÐUSWV [>hPQH' WY' l$UV5tPvcW- ^_[]Ét$Wj 莻thʼnPUc|$GEOM,$EVӀW|$Wt(PbV譀4$p1l,$UW9uVM777PQhMRUS[<EM L$$D$e[]ÐUS[Õ<EM L$$D$^e[]ÐUS[U<EM L$$D$e[]ÐSV[<t$ 1t9u Va^[ËD$@$ÐWVY;T$ 1t 9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZ.;L$1t91t^1^ËAQ^ÐVZ:L$1t91t^1^ËAQ^ÐVZ®:L$1t91t^1^ËAQ^ÐVZn:L$1t91t^1^ËAQ^ÐSVPY,:D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY9D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY 9D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY|8D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y7D$t9u@H@ty1ËT$ BÐSVPY7D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY7D$t 9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY6D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPY5D$t 9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Yo5D$t9u@H@ty1ËT$ BÐSVPY,5D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY4D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY4D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY3D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX_3T$t9uBJBuy1ËT$JÐSVY3D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY2D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY<2D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY1D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐXO1T$t9uBJBuy1ËT$JÐS[1D$t9u L$ t9t1[QP*Y[ÐVY0D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY~0D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY.0D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY/D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [Ã/u t1D$D$ D$~N~(DN+t 0tV-usD$WPv^$ T$ D$1ɿ98"yxubD$j\OD$WPv# T$ D$D$9T$rF 8"u<WD$Pv T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[-' jPq' PQ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[ý,D$0' VP/V1^[ÐUSWV [x,t$4NswD$8tZ8@tSr@uppQj WjUVEZ tWVWWt UVI[1 ^_[]Í877PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[n+hPQq' Pn[ÐS[.+' Pn[fD$w sÐS[*D$ ;D$uPt$t$Kw [1[ÐUSWV[Ø*D$ t$tP;D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPu 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔tNx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í88a8PQhRUSWV ]'D$ \$$p1}<"$N<\u< $1ۃރST<$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ88a8PQhRUSWV0[å#$Du wj0r11<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w $B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p29D$89D$Ews 搐<<}jt$W tfjt$W tSG9jPW E $AEtLt@<-Eu<-u}>u$h\t u94$&10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U蚭D$m$hōA9D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$0D$ jP^F,F0F4F8F<^[ÐUSWV[ t3Pj誠tjj@ݖDžuUQOj@–1t=lPW8>GjPj]o,w0G4G8G<1^_[]ÐL$WUSWV[Xt$1l9nU(]N4 Džtbl$~4<$tC1퐐F,t1t$$9U. ^_[]ÍJ=(=Q9PQhRS[nPt$ [ÐS[>jt$t$T; [ÐS[Pt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(99Q9PQhjRGQ覕GPLW葕1^_[]É.99Q9PQhhR?9Q9PQhyRU:9Q9PQhRS[ÎL$A4tPQ4I,Dt*Pa,[Í:h:Q9PQhR]U:h:Q9PQhR>USWV,[D$@xl$DuVJ}4tS|$(jWl$HU3 tjU3tlD$D9(t9$VJ$,V~JPt$D54^_[]jjtt$ \At$DVL$*L$ql$$9.|$FWUPО jxDžt!PW> Gwo 1^_[]ÐUSWV[Èl$19}EuBM1tDm $t: $U2xt^Ut$D$P U;1$D$jwt"WPt$ED$E E^_[]ÐZ¿L$1t 9tËA ÐZL$1t 9tËAÐSV[]T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDUvt؉Ut$P覜 ąt===PQhR>==PQhR}ZOL$1t 9tËAÐS[D$t9u L$ t9t1[QP: [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVq.D ֐USWV [Èt$(>t~(t  ^_[]ËF@_jQvPgt҃~$tD$jPv  ʼn$u 8"tD$N N$9u8"t=E>.>=PQhR1jPj N,$Ut7ǍFPD$PU tcD$;$uZujPV tD|$u W1,$jPtƅt-PVF~n W襄t W蓄D$$0USWV[y1D$4$G=w ՍjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[D$0FuFt P~Vu1^[ÐUSWV[l$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í8Q>=PQjtRJSV[L$t$ 9t8V 1;Q u.FtRqPv= 1uyu"^[Íz>h>=PQhRǺ>h>=PQhR診ffffSV[}LPQ6|$ u( ( V^[ÐSV[-t$ 1t 9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[ÞD$t 9u L$ t9t1[QP[ÐSWV[\t$~uo~(tijPvvMt( !jPvv*t1( |$LPQF5V7^_[Í??>PQhRӸSV[í ( VPƃ ( ( VPƃ( 1^[Ð1ÐS[ND$L$ yt,jPb2F,F0F4F8F<^_[ÐUSWVP[Xt3Pjttrj@,kDžuU{Wj@k1tE,$LUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[Ø|$1tvL9uloUp1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[Z*։ $|$?uwG8]u<GcjjWr tCjPwwt,t1$jjPUt$t1U^_[]ÍW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%B@@}?PQjmR菫QoGP]&Wo1^_[]É."@@}?PQjkRC?@}?PQj|R'S[D$H4tH4[Í@@}?PQhRUSWV[øD$,hUt$0~W%~4tR,$ljUt$4V tjV2tLD$090t9$W@%$W/%lPt$0\ ^_[]jjgt,##AD$0t$PL$T$rL$9Al$ F9(u:G@D$PYt[ÍBBBPQjpR!USWV[D$P.jjj$0PD$P$$HtыxnUYtt띐$$QL$ QPƅtׅkUXtT$$4$1ɉL$Htыh~WsXu5PjQt%tWWX$ƅurtՋL$QP^_[]ÍmBBPQhR脢BBBPQhRemACBPQhRFBACBPQhR'_CACBPQhRkCACBPQhRD$t1S[îjt$t$ [ÐUSWV[u$4$0$,D$P+ tD$$;Et$L$QL$QL$QL$QUWP$0$,u*PD$PWUV tr$,$0렐4$t$$8$8V t8|$ $,l$$0D$$1;M@MI$4t*$4$,$0PQjjWUV u1^_[]ÍCCBPQh#R S[D$P[ÐS[þD$PP[ÐSV[Ýt$ vVd^[fffSWV[lt$NtFt\V9wqu QP(^tFVL$z~ ^_[1CCrCPQj9RCCrCPQj:RCCrCPQj;RܞSWV[ìt$t$|$PWtu^_[ÐUSWV [Xt$ F|$$D$/wbg\tbwtRt$jD$P|D$tml$PVVEu:t nfrj\V&PVL<;~)<j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð8#DrCPQhR蕜SWV[lt$~ t 1j Vt ;~ r^_[ÐSWV[,|$t$t0t*PVtuj Vm^_[1SWV[t$F|$uLPVujVm1^_[Í8GDrCPQh$RӚSWV[ìt$F|$uEPVtiu]jV}1^_[Í8eDrCPQhERUSWV[ût$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í8DrCPQhdRsUSWVP[JD$1ɅQh Dt$7jL1Ƀ#hK$GGG wtHt$WՃj W=tjW$$E|PQWq tDj Wt5D$h V|PW`tj WZ7t[Wk[ $ȃ^_[]ÐUSWV [$($$WtEPXx=ŋ$$t$t`?t[W5t.H|/t+1]$,9/;9sfD$ .t$ VόH r蜜?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$D tYjLPLUt$u t*l$ WU $t1$t$2$l$ ӛ8t$H t U賛8講8VY蜛8$ ^_[]É,$9tG9t iy/t)rD$ UWPn D, ,$S[Îjt$t$ [ÐS[Njt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jGtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1EEZEPQjARnEEZEPQjBRRUSWV[+T$t]D$ |$L$tKutUtMtM L$$tEUAWL1Ht t L t L |$$t L2 ^_[]Í FEZEPQjZRhffffUSWV[8D$8t|$4D$0u$HL$HL$HL$H L$H L$H $x p PHQsl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dVA4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$[fffffS[t$t$jt$t$t$8>[fS[þt$t$jt$t$t$(>[fYXZQ̀QQrS[Ãt[fffffffS[^t$t$t$t$[ffffS[.t$t$t$2= [ffffffS[1;D$[ÐS[μ1;D$I[S[î88t j葋1[ÐS[~88t ja1[ÐS[N88t j11[ÐS[88t j1[ÐS[88t jъ1[ÐS[þ88t j衊1[ÐS[Î88t jq1[ÐS[^88t jA1[ÐS[.88t j1[ÐS[88t j1[ÐUSWVX˺( ?) R4(( ѐ>t1 @u~1ɍ(( >t 9u#;T$t$1 ^_[]Í}hI/IPQj>R{wffffUSWV[õ$áL$(3L$,I9L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í0QPj=S[ÞL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Tt3T$8tOl$@toJVPt$DR誌JJTJPQhRo멍JJՍTJPQhRo뉍JJTJPQhRwoT$Hk\ODH@u uD$ j PW誙 $T$t8"u,t"t0LFgPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)JWVPQt$H11҃^_[]Ë$T$|$(9ыl$,}J|$09Njl$4}KUWRPVQt$Tt$Tĉ 맋L$8fffYiȟmNA90ȟ%ÐXL$ȟffffUSWV0Xȡ$t$DL$H|$PL$%1|$L$W}D$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$C T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ G*1$Sl0^_[]Ë$KK1KPQhRNf$KK1KPQhR$fL$XUSWV0X8$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU< T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U#1$e0^_[]Ë$KK1KPQhR_L$XffUSWV<[l$X|$Tb D$\}  |$T  D$u D$4tǃПǃԟT$PT$$9L$$0T$,8T$0\$|$ <$D$(\$ԟǃП|$ l$XL$1L$u̟HD$4;L$$D$T4̟>-u FD$,̟t$0VE<+<-~ԟL$ ПXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Őԟ<0̟Пԟȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$ԟ+П|$ /VԟtПuП̟<-u ~̟4$<:tkE$<4$Pv,L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P $? t/ǃПǃԟȃ<^_[]À:uL$:tVL$D$X:L$u^W0̟D8t}:tjWP腈Wx:L$T$,̟L$ $_D$p70̟:t%j=R+@)D$CПȉ $ԟ|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VWND$\(pD$D$ 1T$ $ $.T$tf\$QURO uUM $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:8RQP \$ԟ+ПL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tQRQP` 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tyRPN1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80̟D8t}:t4$Pփ $E<-t<+u:}:1<: :KKKPQh_RUwLKKPQh`RTD$l]LKKPQhaRT|$T;KLKPQhRTLLKPQhRqTK%LKPQhRJTnK%LKPQhR#TfffffUSWV[;T$t$(+ ǃ(+ ܟ;D$}? 9-u7yI,+ t8--?ܟ0^_[]Í0j-R$tǃ,+ --KL׍2LPQjRRS(LL׍2LPQjSRR(+ ,+ ::tlQR#tXx:?u'1x:tܟHܟ;L$|鉻0+ 0ܟT$?uܟ?؟::~VLUPQRrǃ0+ ?tqܟc0:D$8:E?؟3VLfffffSV[ýt$ tj jV ^[Í MLPQj/RNQffffSV[mt$ tjVrO^[ÍIMDMMPQj/RQfffffUSWV[t$l$tyjj 1trjtkNjD$oGG E|{zPjQRjWtKjPj V1^_[] V8l$uEU8U(W|$7U(릐USWVP[ t$ l$ME 1҉s9r J9sAEOQ0 t`U)ƒQjRD$ Q E $}E T$)9w΋MVRPt( E E MU9r‰^_[]ÐUSWV[;T$L$t$ D$t0tUyyMMWMPQhR NpxA)9}8iTTi t?MMWMPQhRMx3rH HPp 9r@ 1^_[]S䐐S[>t$1[fS[Xt$ t$ P s [ÐS[Xt$t$t$P[fUSWV[ûl$|$t$t1UPWV1^_[]ÍwMMPQj4R:MŐSV[]t$ tjjjV0^[ÍwMMPQjARLfffSWV[ |$t$t1hPWVo0^_[Íw:NNPQj6RLfffSV[ít$ tjjjjV܌t^[ÍNxNANPQj0R4LfffffffS[Nt$j t$t$0[fffffUSWV[t$|$tBjW+~G0t ujW,^_[]ÍwNNPQj/RvK띐USWV[Ût$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H P1^_[]ÐUSWV[j1L$,l$(D$$t$ T$wGo Ouu u&t,t+$ tltڍ̀uft?$L$5t: $fH f@xp$L$H,h(@DH OW 1^_[]ÐS[.L$ D$T$rRQ0P [ÐUSWV[~|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[Î~D$t$t$t$0P [ÐSWV[\~D$8pP tWփ1^_[ffffffUSWV[~T$l$t\tE0~-},t xr }$t jr2U*1Ƀ^_[]ÍwN֍NPQj;RZHuON֍NPQjz(WSwSPQjwRk>VSV[Íst$ t ~t/>SSwSPQhR>~uр~|$^[ÐSV[st$ t ~t/FSSwSPQhR=~uN .wu^[ÐSV[írt$ t41~t^[ÊV u.wL$~9|ԍSTwSPQhR=먐SV[=rt$ t~t0^[ÍS%TwSPQhR<~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[Üq|$t$t@1u6T$L$9w"QjVB> FfFF^_[ÍS;TwSPQh.R;뜐SWV[qt$t>~u/L$Fy |y|9IL |F1^_[ÍSKTwSPQhMR|;랐USWV[Øpt$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍmTZTwSPQhhRA:xTZTwSPQhiR:SV[-ot$ t"~uDNu;V9r1-STwSPQhR9~t^[ÐSV[ýnt$ t31~u(NuV9rT$x 9v ^[ÍSTwSPQhR(9fSV[Mnt$ 9y ^[ÍTTTPQjTR8אUSWV[mt$|$t.l$tGMϸwG)o >1^_[]ÍSUTPQjbRj8뱍UUTPQjcRI8또USWV Xhm$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ9D$0 28t p׾$VPUx 7+D$p)t5u+VQA$RjP9 7D$)smH1 ^_[]Ë$S(U֍TPQhR6D$4$=U(U֍TPQhR6g$KU΍(UTPQhRQ6D$a$8VL$$VՍTPQhR6L$USWV[(kl$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQi7 D$ }+$x)t6u,WQARjP7 l$}<$)s8O^_[]ÍSoU֍TPQhR4KU͍oUTPQhR4렍8VL$$VՍTPQhRf4L$;SWV[|it$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SUTPQhRj36UUTPQhR@3)뒐SWV[\ht$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1SUTPQhWR'2UUTPQhXR1VL$t"T$ tփuQ^ÐUSWVP[f|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP2 D$$L$(l$0O}^_[]ÍUU$TPQhR0T$L$8D$4VUUUՍTPQhR_0\SWV[|e|$L$1uLwt?;t$w6)w*t$uQRjQ1 ^_[ÐSWV[dt$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [c|$$D$(t9D$ L$,ň̍VL$VL$T $t4EtM9wEM )9w+8t;9rt$t$ht$ -d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[bt$|$D$VPt$  ^_[ffffffS[Þbjjt$t$t$t$:[ffS[nbjt$ t$ t$ t$ t$ t$ [ÐUSWV[%bD$$$$$ $$$fzt$pPQj V4ID$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6,'t&6P}&FgPVQ\Z D$@t%8+ hPV $0$$OPQ#tO9xuJ.P}$ $$6`L$U$$$t$%D$;$?Ĕ^_[]ÍVVUVPQjiR*$VVUVPQjjR*$VVUVPQjkR*VUVPQjlRc*ƍVXUVPQhzR:*D$VXUVPQh{R *D$(ƍXUVPQh|R)zX$T$@PhQRW<$D$Pjjj:tD$PjjjxkD$Exit$蓜t t$ 胜jjWy t$XXWPQfW XY XYPQxt$ jt$xjjyX&YPQ%j,t$›ujjx*jt$~xt$莛t$ 肛yX/Yu^$puSP$0uP$$u6$@$8j1,$X?YpQRj/V~tDžto]jPQ $t$u5Hygyj$$2$PQWV ^j$$1$PWVf8]Lj/Vt3j$PQV,XOYVPQE j+USWVh[ó[E$dL$$|$$t$.D$LD$PD$TD$HL$8D$HQPj; l$$D$ WD$$D$ D$l$%XP9mjuD$PQ Džxt$ ~Nƃ|1 V҉$t`L$FшT$?r?鍋=1 $j@UPQL\$+=1 ~t0|$>L$:$u =1 uL$>͍ >T$1ҍ|1 -9si$:WU;L$s>t 9sE.9r9s34$Wh9s맋 $|1 9s$=1 ^_[]fffffUSWV[ =t$|$pUl8PPWVwEUL^_[]fSWV[ü<t$ W!PPV W^_[ffffUSWV[h<t$tLD$F$V~nF<}1 PUWRt$t$QjV#$^_[]ÍZWZPQj3R듐USWV[;|$,L$T$ |$l$捃ZUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]ÍZWZPQjBR[USWVH[;l$`D$ D$D|$\SrE$MUu}mZUWVRQt$PjD$JP/"$$ZPQ&jjjjPvoƍ+0 VjjjjW>oƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$kƅbt$$V$L|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$rD$$LD$ AD$AD$AD$AD$AW$L/D$(PpM[L$QL$ Qt$($TPt$hh@Vp 1lj,$t$\hVWo Ņ~UVD$ P> %0Wp0,$xj$uj!Wƅth$\L$QPjG1\F LFuF E;$lu5p^_[]1㍃x[o[,[PQjNRGUSWVl[è1$D$h$Ud=$$U= uj!QƅtXD$XUPkF1LXF LFuF ;D$hu2l^_[]1ꍃ[[,[PQjhRJQS[þ0t$ t$ v[ÐS[Þ0t$ t$ V[ÐSV[}0[1 jPV- D$ jVPj Y^[fD$ȉty!fUSWV[0t$0l$,D$tjuj)ܭƅtRUP1 F LFuF(;D$u6^_[]1ꍃf[[[PQjFR/urޡUSWV[5/$ $$P'h@V9l1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$?k ƅ~.V$P$P |) u84$l8|$$uj)Ϋƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1ؠßS[.-jjjjt$t$[ÐUSWVt[,$D$p$U$$U= uj)衪ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃ[[[PQhRG螞fffffffUSWV\[+|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í\\[PQhRy\\[PQhR$HffffUSWV[èt$0l$,D$tjuj)|ƅtRUP1 F LFuF(;D$u6^_[]1ꍃf[\\PQjFRur~USWV[$ $$Ph@VT1$|$$ $ u#D$P|$WbP|$`l$d$$ʃ|&jQPt$ 9|=P$Pt$S ƅ~.V$P$P` |) uC84$T18|$$uj)nƅ~$$QP1F LFuF(4$W T|$;$u^_[]1xcS[jjjjt$t$[ÐUSWVt[Ø$D$p$U$$U uj)AƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃ[\\PQhRG>fffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Zt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP蜷 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [h|$$D$OGD$ $?17l$ )ȃ8 PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWb ;D$u ^_[]offfffL$$Yai qyD$A(tQS[8RjjC9 [1ÐT$D$ Zbj rz $z(t RPS[jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[SRjj^8 [1ÐT$D$ Zbj rz $RPS[jRj8 [Xt@ffffffSP[D$ L$T$$RQPn[fffS[îjjt$jt7[fffffffS[~jt$t$jb|[ÐS[Nht$t$j/|[fffffUSWV [t$ D$D$$|$jjUVjW螠1D$D$ $jjUPjWgD$D$$jjUPjW0D$D$$jjUWjPu8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRm1u ^_[]ÃtOw OsҍH}4]]PQj81^_[ffUSWVh[Ã} 5 uj'NX5 D$Pj5 L$@B1lj1L$ED$$1Mt$ƉqD$PjOxx5 L$@B1lj1L$EHD$$1t$ƋEp jPvu(5 L$@B1lj14$e^_[]Í]{]PQjHR5 USWV[(l$>jPUZu u @t tQUXu]jPUu t 1^_[]ÍujPVt DžtDjPVt 1uú!?E1u<-ut<+u\MDHt$}D$j PW{` L$9e9$YQH}+t؍ ߃/Љ(!ffffVZL$?w5t<t#΃? ?9tA|t^1^fffffVYnT$r1>w ^ffffSWV[9t$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVJ ^_[fffffffSWVP[Ët$tB$5 PQhRx>L$ $´5 )QVWR05 PQhR5 = t@= ^_[fffUSWV[t$D$D$I@t NQw Lى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í]]]PQjbRsUSWVX[ÈD$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í ^^]PQhtRSWV[)|$t$t5$D$ WVjjjP軍1Ƀىȃ^_[Í}^^%^PQj:R葲ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tP)rjt4)0sD$(8rl$ ugPt$Yŋ$t$bֵ0rD$8tP(Ws4$&#t$#蒵01UPt$ŋD$G6"oD$ G = = D$8tP(G^_[]Í^k^PQhR@^k^PQhRT$(#I93á]LjUPQRV?jUUSWV׉L$[2jeVj+Vt-1 |$WjPj%eyFu<$|$1jrVAt?b $UW`ft1jSau%07\!wQ!ɳ01^_[]ÐUSWV׉[= tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[ht$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$ŋ$t$]p0D$8tP9%W5p4$t$101UPt$葞ŋD$G6oD$ G = = D$8tP$G^_[]Í^k^PQhR߫^k^PQhR赫t$,|$(T$0VWU jUSWV[èt$8$8tP#= t9ut>mt9uu+$8tP#԰h1V蟠Eu= $8tPy#|$jWu U ƃu v8tUPntt$^_[]Í^^k^PQhRffffffffUSWVH[xD$`|$\t$$UVPW WtUVt$aǃu.Ư8uj@~;$} VPaǍD$9tLVtmA$jD$Pft&UPt$hWV{D$$oH^_[]Éƍ_^^PQj>RQfffUSWV4[hD$\l$HSt$XoL$`u0tu>u"t덻0tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0KL$ VR 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$蹛Ń|$jt$ RU蜛|$tUjt$ RP腛|$t>jt$ RPnl$t%jt$ RPUtjt$ RP@T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQwщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP!Ɖр|$ul$э[_4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0z0赚L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$}zL$,T$$ Qf_4$Qt$(V0WRUt$h$[4$|$2jjdQUјыT$,t$$r[_4$Rt$(QPVt$dVt$d 9wijt$ QRtщ9|$}T$ 4$T$\jt$ QR?щ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRݗщ9}T$ 4$T$\ijt$ QR謗D$ ы4$T$\BJ_PQj8R订D$lP__PQj9R膢mfffffffUSWV[Õ$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í<`ύ_s_PQhRm>USWV։[Á$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQx D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í<`_s_PQhR蜝[__s_PQhRr4__s_PQhRKUSWVT׉Xa$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVQLuD$t @ t$?D$ h |$t$(${PVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPSL)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPYt$FP~YF^_[]Í__s_PQhR蕕USWVYT$tht$1BtBظkw+LtրztЃːt *u1^_[]ÐUSWV։[$]F,F tv芚FUPRl$~D$uNtQjP聖D$ L$$t$ F1퐐f$t=tsAuE @u1$P-$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu׏$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=Y_`s_PQhERنM lt$10脌D$/ Njt$$E @D$uPPUu 78t E u;$6Ĥ^_[]ÉNjt$몍_2`s_PQhR`2`s_PQhR|<`2`s_PQhRÅ$c8`2`s_PQhR蕅O_2`s_PQhRn7_`s_PQhERGL$ _L`s_PQh/RL$,USWV[&T$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍}΍s_PQhRV`΍s_PQhR蕂T$8b`΍s_PQhRcT$8ffUSWV[u$$c$$tuӇ1D$$tŋD$3l$ 11h@P4D$(D$$D$ iL$L$\QPctYD$|$D$0t$\ d$<0fD$PPjuP] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPvPWu uh3D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P` (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$`jPv? u|$1D$Wt$F;Ƌ$6yd$t$\D$|Ay DAD$$uD$*\ՋD$DJtDHD$D$ $@uP \ DAթD$`jPD$p)NjPD$p D$ |$t$ztG$`L$tZ`jPq@jPD$p /1ҋ$t`jPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8̀< 貀Y1D$ D$l$t)萀D$D$\PjuV |$n8|$ $%|$tcjPu^ |$t&/D$u|$8|$ $tt$Dtu VL~t$jl$ U| 1$u U=;$uEČ^_[]Ë|$|$[|```PQj_RyyQ!S[þjhjt$t$t$[ÐSWV[Ì= t-= jhjVPt$$t8= 0jF3= = tP),= u^_[ffUSWV[ |$= jjj` = l$= tUQ= 3 = t]1i = 9= wHt Q< = Wo+= t$UWP؟ = u 1T$ Ɖ^_[]Íaa`PQj= ^_[]ffSV[-= u*ǃ> H1PV= tt> )VPA1^[ÐSV[ýǃ> = tPX9H1PV{= u)VP1^[ÐUSWV [E$ǃ> ǃ> ǃ> ǃ > ǃ> ǃ> ǃ> > = hhU蹠D$ 1Ʌ$t$L$l $t$ > L$l$<ǃ> = hhUPD$ > t$P*oj\WVO t8t剃> 8#tj\WVWO t8t뉃> j\WV7O t8t뉃> j\WVO 68t牃 > ǃ> ǃ> j\WVN tD8tP5> j\WVN t8tP> h > |$$W" |$j\PD$ P]N ǀ8tWfu͍tUWPhth.UW E5xxMf l$<$j\WVwM 8t牃> 8#j\t$VDM t8t艃> j\t$V$M tOǀ8t扻> 'PW#g" > PWgtbt` > D$H1;b> PQ{ > l$tэ'QPfu> <$j\WVWL t8<$tP> j\WV'L X8<$tP~> t$t$1ɋ;$u ȁ ^_[]SWV[lt$ǃ> = t P&H1PW#= t*t+V> {eu䍃> )WPO 1^_[Í}%baPQhRmZSWV[Üt$ǃ> = t P+&H1PWS= t*t+V> du䍃> )WP 1^_[Í}0baPQhRlZS[Ρ= tP3bǃ= [ffS[ÞL$T$ j@t$[ÐUSWV8[ft$PT$$t$,ZT$L\D$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$ jHS[nyD$K );K t P[à QP[ÐS[.yjPKK uP>k[ffffS[xlPt$t$t$ [ÐUSWV8[ðxuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y\DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P7Pt$t$= ZD$x$W7Pt$W @D$x$Wg7Pt$W )D$x $W<7Pt$W D$x$W7Pt$W uD$x$W6Pt$Wf zD$x$W6Pt$W; `D$x$W6Pt$W <D$x $We6Pt$W D$x$$W:6Pt$W D$x($W6Pt$W D$x,$W5Pt$Wd 1D$D$$T$EHL$D$D$D$ P5Pt$t$ D$@D$ PO5Pt$t$  D$@D$ P5Pt$t$  D$@ D$ P4Pt$t$j  D$@D$ P4Pt$t$9 D$@D$ P4Pt$t$ D$@D$PZ4Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ McD$ Vc|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$_c|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ Vr-D$Pt$V ID$ VC-D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$lQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$,ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$@A(|$€´|dddPQjIRh!USWV[ËVl$L$t*t$1Ґtuщ )4@tRjP # ^_[]fffffffUSWV[Vt$$|$(9jVPƿWLjVt$, t$(\D$l$,L$ t-|$,RUT$bT$t .l$(RRl$(T$tX$|$  tQ`T$ <$EFt P=F tT~tE1t(0F t(( F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]ÍPfePQjKR?effePQjMR?efffffffSWV[ìKt$DWL PVnW^_[ÐSV[mKDV֎L P'mV辎^[ÐSWV[,KDW蕎L L PQmWt^_[fffffUSWV[Jt$l$VvZVt$z[1u<$Vt$R[DžtpU7 t]wtуUP t u막t$~utQ ^_[]É1ԍ}vf8fPQj1(\DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsfgfPQhRV 0gg֍fPQhR- USWV [H@L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2$gfPQhR  ^_[]Ël$ u렍΍$gfPQhR ΍$gfPQhRy S[Î>t$t$jt$ [ÐS[^>jt$jt$[ÐS[.>jt$t$t$[fffffUSWV[=pL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉtL uj(聻ƉDl$Utwn$Nj 0Q 1L utjh=ʼnpL 0ƃL LtMjуtL @1t*n$F UQj Pa$|$z^_[]ËtL )USWV[Ë<xL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉ|L uj(ƉDl$Utwn$Nj 0Q謸 1L utjhtʼnxL 0ƃL LtMjу|L @1t*n$F UQj P"|$z^_[]Ë|L )USWVP[;l$UNjL $tOs;1҉vL ljh=qL $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$|t0tL tuR:t!jуtL tiE$StL uj(袷ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[*9l$UNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0|L tuR:t!jу|L tiE$S|L uj(貵ŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[;7t$|$ tЋpL t61=tDtP\ǃpL D$L$ƃL L t?1=tDtP ǃL D$L$ƃL ǃtL D$ 1^_[]ÐUSWV[+6t$|$ tЋxL t61tDtPLǃxL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃ|L D$ 1^_[]ffffffUSWV[5$tA$1uhƅtcD$E/$tt$$9ux/Ĕ^_[]Z?$9u/8(>?USWV[[2t$tD$tdPV$xaa1ɐ΍,?UQt&UP$y.w8"tVf w1^_[]ffffUSWV[û1t$V^L P莯L ƃL \ tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t P[ǃL ǃL 1V ^_[]ÐUSWV[Û0|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]ÍJllPQhR]lllPQhR6USWVP[Ú/|$t$t#l$ t?tajUjW^_[]ÍJllPQhR빍lllPQhRu}llPQhRxUSWVP[.$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh۫$p $L$1xjjjU|$ `UmPQhl$XU jjjh@Ujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$}llPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP2T$ )ʼnl$‰$L$\$(l$$|$ t t$it$,D$l$ tEF4$EhD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$9؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUݱ5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP^ Wt$DUP t$$t$ t$0/L$0\$|$8T$L$ D$ɋ,$tt$T$lfT$Ћt$ 9v8)PU|$u(U螶|$ |$L$1|${04$Vi0rL P賥KL PL L$ <$14$$lyD$0P |$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xWʤt_WVPg UUx~1L$ ȉŋD$8L$D$8B\$W |$ t$dUU |$;$LP^_[]0WHlL$lՍlPQhRL$,8ImL$lՍlPQhRꋴ$tL$,lL$|$lՍlPQh RU|$L$,}L$|$lՍlPQh R$|$L$,Ń|$ \$t t$;c4$蕳}llPQhR$|}[mlPQhR$|Y\$U*|$ t\$t$b\$t$0Xo$L$ÐSWV[L$t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍJllPQhR}}llPQhR[VSWV[|#|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[ÍJllPQhRulllPQhRpS["L tP3ǃL ǃL ƃL ƃL 1[ÐUSWV[u"$,E$$$(L uL ȋL u!Q0 L L t%1L L PQ1t $D$uz1L VMVǃL L HL @MQPB L u<\1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$V` tfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$VmǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL SmlPQhR]$<ElmlPQhR,$<ؐUSWV _8T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdpXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWjƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPUtL$(U$W^ ^_[]ÍJ m֍l$PQhRs|$l m֍l$PQhR>|$|$(S m֍l$PQhR|$&Jl֍l$PQhR$ll֍lPQhRUSWVYT$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdt]ƃdNJD$$ƹdEt#<:tu)FdPW蒢u`)nu% N$UWat1L$$8$m*mlPQh`R$W跧^_[]ÍJ*m֋$l$PQh"RL$Vl*m֋$l$PQh#RL$|$$&*m֋$l$PQh$RVL$Jl֋$l$PQhR$ll֍lPQhRUSWV[ l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPj F(N8D} '~wF^ FPB^ uWv$R tƒN ~?:V|@uH)ƒVԋ^ ]LFF$BBQWP菷 uvv^Q K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 蜅S[0t$t$ [ffUSWV [} F FEFUVzRu)ʃԉF:FJFx9u0RuP N ;Nue^_[]賄fUSWV0[D$(}LPQFXL t$M L$ML$f|$ L$T$|$QRj WP'BuOt$ rF|$j WP^ u0O L$FD$D$ PjL$Q袵 79_t$} urP tgM9uWM % mBQPR}Wu19r"y";L$(L xjjP@ PVJD$t$L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPuֳ 1ɋt$;D$(u ȍe^_[]FS[îmjP;L Jh P>P [SV[mL hVt$t$t$%t1^[fffSV0[*t$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[<t$|$jW1j VWU) jW(^_[fffffffSWV[t$|$t PnPQ ~^_[ÐSV[Ýt$ tPFtP}FFFtP}FF^[ÐUSWV[(|$(?u nPQt$$oD$t U[}jjjj|$87#Gʼnt$Ptqt< t< tt$WHqt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P-E D$ 聾L$ v8ukD$ $FD$,t$UpmŃzAA jj t$D 8 8tq0|$(tPϭ$tP{GGGtP{GG製01^_[]Ë$fffffUSWVP[l$t$D$ $ t t@u$Ao-onPQj8RZ@QUVwЃt 0$^_[]ÐUSWVP[Jl$t$l$ t t@u$Ao-onPQj8Rȶ@QUVwЃt x0$^_[]ÐUSWVP[út$ l$T$D$$$ t t@$u0ouoՍnPQjpR2t$0@$QVURwЃt ٻ0$^_[]ÐUSWVP[t$ l$T$l$ t t@$u0ouoՍnPQjpR萵t$0@$QVURwЃt 70$^_[]ÐUSWVP[zt$ l$T$D$$$ t t@(u0ooՍnPQjyRt$0@(QVURwЃt 虺0$^_[]ÐUSWVP[t$ l$T$l$ t t@(u0ooՍnPQjyRPt$0@(QVURwЃt 0$^_[]ÐUSWVP[:t$ l$T$D$$$ t t@4u3$p pՍnPQhR诳t$0@4QVURwЃt V0$^_[]ÐUSWVP[Út$ l$T$l$ t t@4u3$p pՍnPQhR t$0@4QVURwЃt 贸0$^_[]ÐUSWV[t$,|$0*T$>t .$ tEt@u%ppnPQjJRVE@NT$RQjjjuЃ>T$u-TqGq[pPQj[RT$,$ t|$ tEtHHu0qp׍nPQhR踱|$0EHHPVt$0t$0WRUуt Z0$^_[]Ípp[pPQj}RaS[~lPt$t$t$t$t$S[ÐUSWVP[:l$t$D$ $ t t@8u'qrqnPQhR跰@8QUVwЃt g0$^_[]ÐUSWVP[êl$t$l$ t t@8u'qrqnPQhR%@8QUVwЃt յ0$^_[]ffffUSWV[t$l$3$PQWz t"t$ VW WjjPԁU''PQW: t$fffffffS[Îjt$t$t$P [fffffUSWV[Xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~VUSWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPjD$tk|$jWjD$,D$ tND$1ɅujWjt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWKx9!xt19)u|$T$(l$);$Pw|$$XD$0P螢ƃjPitQ$1 T$|$$T@uX$L$0PVQWCt5W蟅D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ F‹D$$t $uCr.蠯|$茯1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V} DžL$~9t/;$WVQL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j|$l$t$D$Pjt$ jUjVjl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$2jt$ &jt$j넍CrqqPQhR葥7rqqPQhRr]rqqPQhRSqqՍqPQhR`rqՍqPQhR跥ꋌ$hR'rqՍqPQhR腥2prqqPQhR謤rqqPQhR荤LUSWV[XD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]{LUSWV[l$ |$t$t Vz1L$1jUWPV^_[]ÐUSWV[Ël$$|$ t$t V*1L$T$jUWPVp^_[]ÐS[>L$1jt$t$t$t$6[ÐS[L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[ÈL$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]JUSWV[D$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[])JUSWV[Ë|$t$t V.10L$1jUWPVp^_[]ÐUSWV[;|$ t$t Vޗ10L$T$jUWPV^_[]ÐUSWV[|$t$t W舗101jUt$$PW^_[]ÐS[Þ0L$1jPt$t$t$[ÐS[^0L$T$ jPt$ t$ t$ Q[ÐS[0L$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WxuGكs^_[!t_t$t%<FF ^_[ÐUSWV[[|$ u ^_[]l$ t$Wxt t- t(Wxt0WP u뵃!}/=<dFdF ^_[]Ã=t̃~~ŐUSWV[è|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv <$|$Dփ 6D$4)D$4@u \҉L$x MVavt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉv$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/\DPg%0W$\P$D$4@uWuu#\DxuGws>4$$^_[]ËD$4  !rfUS [eE$D$D$D$PQD$e[]fffffS[t$ t$ [ÐUSWV[$$%= uRl$l4$NƅtS~D'FLfui9t̍rrrPQhR蝎FJt v$Gt!,$hPRuG,$fEfVjfFHf4G(*jh@P6 F$NJpPZR~D*GN(~DFFJVVrPj(G(uwgHF,F(nTPUw7 j/l$Uwt5;$u~Ut(UD$HQUt$6 D$F,GFFF8N1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHlG D$ D$4L$ $Љj0)t9D$"D$ <u !G OJD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw PS<ōG UTD$t1 .YMPNQPT$ Rb u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRzF4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$踉1єsrPQh1R較D$u‹.x1F)EHftf },$FtpPGu|$t$u N)$xDuW@8/tOF(uIjh@P tFFU$U@<$u~yljF^_[]FUSWV[t$tf8}t v$D>V }t!v$"v$v$FVFW^_[]Ís|sFsPQjBR&vfffffffS [;lPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[ζL$T$ lP[ÐUSWV ׉[ÔT$4xtb=t= T$4t=uD T$41 L$L$L$L$ D$l$ L$RPQUWV-=u蔆"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[~L$T$ t$[ffffff̀rS[Dt[̀rS[$t[ ̀rS[t[SWV[|$t$t-9t!t F9u1^_[ÍssPQj*R\fffSWV[||$t$tt1WVv^_[Íd tsPQjBRuύd tsPQjCR~뮐SWV[|$t$tt1WVZv^_[Íd tsPQjBR~uύd tsPQjCRd~fffffffS[~L$T$ lPt$ [ÐUSWV(T$ [BL$<\$%t$@|$t;D$<|$"v+覃1t$ \$VPo\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXȧD$|$tt$ht&L$ptCwm\$7x\$'utPQjxR7r뵋\$~'utPQjyRr$vl$l1 D$͉L$4A\$P%gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$~XtPQh&RpV\$4uXtPQh'VoXBuPQhrVt$xo$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPS  \$R'1T^_[]Ë\$~ButPQhsR4c$\$~ButPQhsRc$LUSWVTXD$ L$pT$htwL\$ h ֋\$ 'utPQjxRb$vl$l1 ШD$ʼnD$4֋\$ P{:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ 4uXtPQh'V`XBuPQhrVt$x`$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Q1T^_[]fffUSWVP[|$88tqw$HG$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$ojUTƅtF PVW) u$>*jU!t@ PVW) 1*V8t uVV $tD$ 81^_[]fff̀rS[Dt[ḃ̀rS[$t[SWV [ t$ |$t[D$D$4$zU0L$jjPWjQ*1uSU9 u BU01 ^_[Í}uuPQj񐐐9t uD$))t8t)Pt u+D$ PB^_[]Ív8vPQj@RLD$(Sv8vPQjARWLD$(7fffffSV[mL$D$T$ y9vRVQP Q6Q4P 1^[ÐS[D$y%9vP PQj@RP P j@4R P [fUSWV[ët$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JdvvPQj?RJ눍dvvPQj@RJq1^_[]fffffffK̀rS[t[USWV [øt$ ̠D$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV]~|$0||$4̠D$PVt)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$^_[]ÍWwLwvPQhYRF[USWV[8{t$D$.̉)ō̠$Pst)1ҋPTht14$D$^_[]ÍWwiwvPQhR EUSWVP[*z̠W蓽tI010$9r$9r$i0mNA900W^_[]ÐS[Îyt$t$t$b [ÐS[^yt$[ffSWV[t41 |t$t$ t$ W8 uD$ <=u.|$$ Q 9ttD$0Q M9u;Q s|9v9tfPSǃQ ǃQ $jWP ;F04F8uyPD$0t$s )$jWP E0E8u4)  $PjQ B $Q L$Q ^_[]ÐUSWV[tQ tQ 1t0DtPVtQ Hى|$jjD$P tE t5jVt$ F:Q tVt$VŋD$Q 9tPǃQ ǃQ Q UjP@ ^_[]ÐUSWV[s81tR/tL,t4t$t$UX5 uD$|=uօt D$1^_[]ÐUSWVP[Zs|$1|mPWtfƀ<=t^tR)tI1 $ $lt+Vt$U4 u|5=uمxD$8.1^_[]ÐSV[írP薷ƅt(C0^[ÐSV[mrPVƅtB0^[ÐSV[-rPƅtB0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ÊqD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[(qD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[èpD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[(pL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[hmT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVMtGPVܓtۍGPV+tʍG PVtWV 묍xz_yPQhRmSz_yPQhRFUSWV[Nt$|$Gt/uTot^REwn|1o  u-GFGFFnFn GFG    Sz_yPQh$R+zz_yPQh%Rt+zBz_yPQh RMGFGF^_[]Í+z9z_yPQhR S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[tLt[v̀rS[TLt[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[ëK|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1dzKzPQj:R]zzKzPQj;RVAUSWV4[õJ$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFzl$0PQjU!1UH $\9ȋ$QU$`- FfNQPR$`U$`01Ʌ9$Fx$P$T)zPURQw0*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`/l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$0{PQ|$W$`Uu.t;$Tg$P$T)D$D "P|$Wt$L$QR".L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$Rw-L$r)D$hD Pt$t$t$R>-L$9)D$/DPt$t$t$R-L$)D$DPt$t$t$W,19D$F$PED$1$10D$ "D${D$׋D$ tD$ $ 1QPt$t$UI,H)D$>Ń19t$un 1f$PL$$T)fv fD$ zVQURt$+L$ ;$T$T$0L$RQPWt(8W$\9vpD$0Pe;fǍz$0PQhWC+Wj$\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGzT$ PQhRx&= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í zzPQhR2 (WzzPQhR $$bVzzPQhR;苰fffffUSWV[=$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPKt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t菮fffffff̀rS[;t[USWVP[;PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf 8^_[]ffffffSWV[,;|$t.jW!G=tjW^_[ÍwD{{PQj@RfffffX:L$rÐSWV[Ì:t$u8}{L{PQhrR*VtF~tP^_[ÐUSWV[:$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$~~L{PQhcR?F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$0JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RYNjD$$fxxt$ T$@>PL]fD$>P8]fD$>P$] f|$fD$f|$"D$<$$!|$hVWt$8RXgD$D$$fxxVT$@HVNjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$PVWP$Pj%Z΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WM~Pt$t$t$DQ$Pj%詮T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FP ZfD$FPYfD$h$!Pt$ Vt$8WUfNjD$$fx$!xV^VAV=*h$L$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$ht@\L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V7L$tL$8$tYt$`~l$(u2D$4t$%Ut QtFUt$`)L$8uBffU01l$(E;$%b%^_[]Q}pUǍ}΍}׍L{PQhR}΍}׍L{PQhRc$%]}΍}׍L{PQhR+.W΍}׍L{PQhR$% }ύ}L{PQhR$%~ύ}L{PQhR$%MT4qWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jP螅Ņtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$Pr ^_[]Í};~L{PQhR@B~;~L{PQhR|$(W;~L{PQhRUSWVT[1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$QKtL$t$ t$~e t tt,…tt$ P~u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RoT$GtItu܍}L{PQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1u~j~ύL{PUhh RA}j~ύL{PUhi R~USWV T$["L$8D$ l$4"t$@jV1]F1t 1Ƀt @u\1<$L$D$ Pl$ U,1~PU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ PQ 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UlGt!D$881<$;D$ ^_[]ýW迆t‹GwtP覆܍}͍~L{PQhRW͍~L{PQhR}~L{PQhRt}L{PQhRMifffUSWV([U$H$<$$E UPM 1U4$Um$DUtڋ$D0W+t4$DptPW tu뗐$@tP$Hp ոj$DWH1$@T$t.$@öT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$a4&t$$DP藙 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$uAT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$@T$L$ ut$t$$LU}`#PQhRffSV[ t$ t,FF#EgFFܺF vT2^[Íy\qPQhR밐USWV[Øt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ! L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPÖ^_[]Íy\qPQhRlqPQhREUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWζ ;D$uY ^_[]Í\qPQhR茴y\qPQhRb\ffSP[}Pt$1Ƀ $ȃ[ÐUSWV$YHt$8D$D$ L$\1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RUWjP蠤 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-{ Pt$l$ U{ t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjR薢T$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rhy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$yT$ L$E E$\$l$TUcc/4$UPc$L$$9sD$DQ/c1ɉȃ0^_[]D$D捃JPQj]RAW\$萡SV[]t$ t Vb^[ÍvJPQh/RfffffUSWV|[j$/1tGljPWڀt)l$XD$\|+WQ W1|^_[]jjWjjUjFWt҃/D$ l$<$D$ƅuUW뚐USWV [(|$$(rl$ NBCD3EB 3M t虣1 ^_[]Ë|$,jF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj[=F4~F:F:t1F;pS[^t$t$&[ÐD$@ ÐSWV[,T$|$9W v#wG,ʃt$<u0 Ћ0茠L  )r;GvQD$Ot$1^_[ÐUSWV[xt$,~$ED$\$Pv(t$Q 9quJi$+qD$D$4$9\t$2D$<$8L$HL$D$ l$D$$$$`$ttl$$;%`t %)l$ &$D$D$et$L D$0Fvt"l$ /$D$D$dt$L D$0vt"l$ 3$D$D$dt$L D$0ut"l$ 7$D$D$@dt$L D$0ut"l$ ;$D$D$dt$L D$0Fut"l$ ?$D$D$ct$L D$0ut"l$ C$D$D$ct$L D$0tt"l$ G$D$D$@ct$L D$0t$t"l$ K$D$D$b`t謆|$4t؊"L$DL$ D$OD$,$t0dƁ Ot yI u2D$4$D$E5L$@L$ D$Xl$$$记Ɓ Ot yI u2D$4$D$4L$6و.&Ȉ^_[ÐSWV[ì|$xuƁYjVWu yzWPVr$ ^_[ÐUSWV4[X$D$0D$IuD$HL$j.QPjT$PQj.jR_y$tEL$PQVP D.0;D$0u 4^_[]S&USWV([øt$L$-uAD$QD$ +tD$ +u AD$Q\x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXȭ1D$\8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$Ӊ֍PQhRvpːUSWV[Ã}PfD$|$D$ D$PKlHHPP0ppp RQWjV譌$r D$ƀe^_[]USWVP[l$2PU^EBPUFaPU.PUgPUnPUPU΃zjPU# 1uR\MDHt?tj PU t8u$8 L$A.&L$0t9^_[]ÐUSWVP[jl$ZPU蹂txF u6jPUg" 1u[\MDHtHsj PUҕ xs8u $8 6D$t8^_[]fffffffSWV[Ì|$t$jWLGHO~;G~ t H WRYjWLN^_[ÐSWV[T$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[ɡ|$(D$$u$PcbD$D$D$D$ jWKG0u ǀD$PW>?jWqM^_[ffSWV[<aHt Jt @t A ?t/t5Gt t$t$t$t$Pת[ÐSV[  Fu t VVmjPt^[ÐS[þ o hPt$Q'[fUSWVP[ÊT$L$I):t$ 4$ t$,t$,t$,t$,WUVt$$QP4^_[]ÐUSWVx+[E4D$E0D$ $p+E E$D$M,E(U\$t$,tI\$RPl`M,\$ u+L$ED$ @ f PU0M4:tUׅt1QW`O\$M,wt!<\tt<.uwu)ր:|$tk9E\$VRt$(>U\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$D$E0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4sKjD$E4D$ Cf U0}4D$u0}4WVu`Z C)ljD$ s2\$L$jQjhRD$(D$ Ɖu0}4\$uuE$+PWQjdjV8^9E4BPVu0< E49s)\$jQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$D$ E0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4snhD$E4D$E0A\$Af E4w-\$jQjhR\$E4M0QU0E4A E= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W\9E4@PWu0: E49s%jQjhRE4M01U0)E41E4u0} MU }$"u D$ E HM HL$HM xQƃE t$ HkV|$Wt$PQjdj$$+W2[ 9E4?PWu09 E49s%jQjhRE4M01U0)E41u;D$ !u <E PxPL$ Qjdj$+WZ9E4B?PWu09 E49s%jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu08 E49s%jQjhRE4M01U0)E41u E PQjdj$+WY9E47>PWu0 8 E49s)\$jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$jQjhRE4M0QU0E4AD$X`/}$D\$u M QU Qqu It$K\$QRPVjdj$ +PX\$ 9E4<P$ +Pu06 E49s%jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-\$jQjhR\$E4M0QU0E4AXD$#M }4E0T$WP=;SE }4;E0 E4u)\$jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+W/V9E4:PWu04 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0;4 E49s%jQjhRE4M01U0)E41E E PE Pt$ jdj$+W+U9E49PWu03 E49s)\$jQjhRE4M01U0)E41M AE  L$<%\$AL$ L$L$L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$ST$T$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru E PQjdj$+W`R9E47PWu00 E49s)\$jQjhRE4M01U0)E41\$ E HM L$HM pQJE T$(|$$VPjdj$+WQ9E4H6PWu00 E49s)\$jQjhRE4M01U0)E41|$\$E AL$ L$L$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu09/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E PQjdj$+WO9E44PWu0q. E49s)\$jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)PQjdj$+W_K9E40PWu0) E49s)\$jQjhRE4M01U0)E41E E ;D$\$$+11k}$u4u0u j!}0WFƋE49s,\$jQjhRE4}0}0)E4 /\$u E E \$PM QU IT$y|$0\$QPVRj(jWJ\$ 9E4.PWu0( E49s)\$jQjhRE4M01U0)E41M t$)΍VUUUЃ=x E4\$8.M0ArintAto pA ong Aoo lArd trecoM0E4-E4u0} PVu,W%.-M ;L$-AE AE IL$1\$$+E ;|$8t1ɉ|$ ਀׉L$ PPQjdjVH9E4>-PQu0' E49s)\$jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$jQjhRE4M0QU0E4AE L$) \$PXE M4+U0B  ru0M4B\$ PQjdj$+PF9E4:+Ƌ\$P$ +Pu0% E49s)\$jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$PD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ L$L$$+р਀tsRPt$ jdjVD9E4g)PQu0:# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$7|$X\$PVQj2jWC\$9E4(PWu0l" E49s%jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$jQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+WA9E4&PWu0U  E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0 E49s)\$jQjhRE4M01U0)E41E E ;D$%L$AT$T$ T$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-\$jQjhR\$E4M0QU0E4Au 'E PxPL$ Qjdj$+Wz?9E4-$PWu0 E49s%jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0{ E49s%jQjhRE4M01U0)E41u E E PE E PE 4PWVQjdj$ +PC>}$u E E PE E PoE 4T$XPWVQj2jR=9E4"PWu0c E49s%jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W89E4!PWu0 E49s)\$jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0k E49d\$jQjhRE46?D$E4D$W\$KL$D$L$L$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$W/\$9E4Pt$u0x E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  KL$D$L$L$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0? E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$9=}4E0)E4u)\$jQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W[19E4PWu0 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0g E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$jQjhRE4M0QU0E4A ދg}4+E0-E4u)\$jQjhRE4M0QU0E4A}3}4E0 E4u)\$jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7$+t$$ +f@======2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$֜$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$KL$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$%\$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$\\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$KD$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$#9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u ηE M4 U0B  ru0M4B\$QVP"  ƋM49s)\$jQjhRE4M0L$M0)D$E4z|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P蒨PQjdj$+W%9E49 PWu0 E49s)\$jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj?}0W3 ƋE49s,\$jQjhRE4}0}0)E4E \$u4u0Pjև}0WƋE49s,\$jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$jQjhRE4M0QU0E4AD$Xw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$KD$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0j E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u %E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$jQjhRE4M0L$M0)D$E4|$t)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u xE M4U0B  ru0M4B\$QVP\ {ƋM49s)\$jQjhRE4M0L$M0)D$E4|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u ǭE M4U0B  ru0M4B\$QVP ƋE49s)\$jQjhRE4M0M0)E4sf )E4w)\$jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$|&D$,;$p+u ȍe^_[]Ë\$?USWV [ØUt$,|$(D$ .ʋ7l$Ut$Vt$40RQĦ‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s7%D$D$Q@(D$ 9s$jQjhR)))x ^_[]1))lj$|tPQhR뽐USWV Չ $[ST$8D$4 D$L$D$"u$jQjhR|$4QA$93<$779$xpD$D$D$ D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$jQjhRMQUA+<$-i"^"D$4L$D$ ^_[]ffffYQT$4D$#hlÐUSWV[[Q|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v!(+t$^_[]ÐUSWVP[P|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ } (^_[]E ffGftC,$RWסxǃ9w,$)xD$ hHGftf,$RW腡f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衠 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [HN|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.Q ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[øK|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U远x(ŃtߍE;$wMȉ;,$v [(+l$xD$$h,h,L$ H(ŋT$0PhRQuu苪U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0M(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV XI\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō PQhR|$  PQhR PQhZRgfffffffUSWV[{CD$$L$1w|$ u 00RPUWVt$(t$(QR. 7XBL$u|ÐXBL$w1USWVXBD$|$4t$01>0N xtNi|$|$8Z~D$D$\D$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$IMmPQj>R ;\$mPQj?Rl USWVP[Ê@t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]ÍčmPQjgRr 1fffffX? s ÐS[n? s ht$ PN [ffffÐ1ÐX?t ffffffUSWVX[>l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tPUD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$iD$lj|$)ƋT$ D$kD$p\ txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[;l$Uƃ;D$vS (`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[5;$$$hWP! x3l$hU$( xUWL1Ʌ;$u ȁ^_[]5ffSVP[Ü:L$t$D$T$ $xRQVP!x9rRQP ^[USWV[K:|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[9|$t$l$tt$$PW%t/ ^_[]VW t W LJWVUF ͐SWV[L9t$|$jW1Ƀ PVW ^_[ÐUSWV[ 9|$tt$O#PW$tw 0l$VW/ t WRLJWVUM ^_[]ÐSWV[Ì8t$t5|$r#u#jV#tjV$F1^_[S[.8D$tL$ ttu H1[[ÐSWV[7t$t_|$G?wS\>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[L7t$tAjVq"t2|$jV"wsf~ 1^_[ffS[6L$T$ lP[ÐUSWVT$0L$@[Ø6uD$\VzD$ P-ǃx\$D$t6bf=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$d$\$X$T$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$gt$,PV1D D$,\$hPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Mt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[ÎD$ L$t9u[Í0"PQjpRiS[>D$ #L$t9u[Í0"PQjpRD$t&L$tu1u 1tÐS[îL$ D$Qss)ǀ[Ãuu ǀ[Í0"PQjpReS[>D$tL$ t 1[[ffUSWV[j 1tQ@@jjPj V(O8tE(W"5(^_[]ÐSWVP[{|$tcOGQ9u0$jQPi 08t  G $GT$pw1^_[ÍNPQjZRySWV[t$tRtC|$t3~t-04~r4;~rPV^_[ÐUSWVP[jt$t@F$t*.1tt$Vt 9<$u1^_[]ÍNPQhR뜐USWVP[T$J $Ћ*1|t$W2t94$u|$ l$tW E$F;$} $)Qtu<|uprP $كU|L$T$ t$t$[ffffS[L$D$ wx9wt$Pt$= [szfSP[D$ L$ $QP [fffffUSWV[Øt$$|$ ?l$ jVyF0u ǀ萐<$~V~~.9~ ƅD$Vj U? u3)D$$ʼnx1EVQ|$W٩ D$)u+))L$$͉yVR|$W裩 7|$jV讱^_[]t$$N @1ԋ<$;|$u1ǍJdPQjBRwdPQjCRfSWV[ |$($PQVo tt$WV Vj ^_[fffffSWV[ì|$t$jW衮GHO~;G~ t H WRyjWl^_[fSV[=t$ t*jV2jjVE f jV&^[ÍwPQj6RfffffffS[D$ t$QPt$3[fffUSWV[Û|$$trƋ|$twD$F t2t$$t$$t$$PVŋD$t V4t$$t$$t$$PVSVx 1^_[]Í}ՐPQhRbUSWV,[$H$($Pt#,$t$;$Lv,$t$;$L$DT$ Ph j.WIl$u D$(hPW$L tNj$L\0|$DFŨteD$tQu<.uOD$t)DNu.t"=/1x.u<:t+uj:t$y$Tu<:uVD$tBD$u,lNu:t.uuـx.$P$DD$$D$T$ L$$|$W8Pt$ PWQRVUD$4Pz 1t$$P$D$P|$l$֋$D $H $A$Hу$P$DB$B D$$HB)rY4$t$VUt$N# ~q$DA0A@$H$HU{$)‹$Ps@<1t$;$(,^_[]Ë$Pщ$PUVZ $D7$H$@@ t4$$HV $P{}Α,$ՍՐPQhBRl$ChqSWV[|$$t/ƋT$L$Wt$$t$$t$$PV1^_[ÐUSWV[hl$8|$03L$4uRuM?u!Wր1?u5u/ -t/9uqD$DT$@t$vx ux Pt&D$j.PWV!tl$t$x D$P賹L$QRPD$PWU $t!QPl$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j5D$0$Do4Vd4~PW|$t$8t$HQj%衔T$T$@t$$P6Stt$6Pj%d$D$@9F f|$0u D$(8gt$|$u$L0V1ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WPT$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PR]s l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V說=~ $!D$1$D$$1D$\$|$$Rx1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<Ĩ=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPX 4$ul$l$$T$8)ƒ)19s@Qu蹷1$X;$(,^_[]Ë$LnRPUՊ 1‰(}}֍ՐPQhRv}}T$$ՐPQhRIT$4z?|$4X聳USWVT[C$h>Wt1T$ T$G j(c¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vnhǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tBPWgt1ɀ8 L$L$D$D$L$ t WPStT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]Í8PQhR]8PQhRBKUSWV։[_~\LZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUt$T$ E ulD$;tM gE=t܉t$L$4QP{t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPH{L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR3[D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQZD$e ߋD$)D$Uyu E;D$U_otjU xİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t QBZE0EEEe jUw1뙋t$uyb)Eۍw,PQjGR/4,PQhRD$D$ D$NK,PQhRѕEtfffUSWV [t$@|$4uE>FD$FD$\$jt$8t1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$PQhRuG>PQhRۏdUSWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxRPQhRAu]RPQhRdSWV[<|$t$t:t\ttu FWVPFWV1^_[ÍxhPQhR蜎uhPQhRv뀐SWV[Ü|$t$t:t\ttu FWVPFWV1^_[ÍxrPQhRu~rPQhR֍뀐USWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxPQhRAuPQhRdUSWVP[:|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxPQh%R职uPQh&R[dUSWVP[z|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxPQhER辋uєPQhFR蘋aUSWVP[ú|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxÔPQhdRuДÔPQheR؊aUSWVP[|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxܔPQhR>uܔPQhRaUSWVP[:|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxPQhR~uPQhRXaUSWVP[zt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Íx PQhR豈{f PQhR臈Tx͍>PQhR^4USWVP[zt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]ÍxPQhR豇{fPQhR臇Tx͍RPQhR^4USWVP[z|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Íx PQhR豆{S PQhR臆TUSWVP[Ú|$l$tStuEt8tu-$EQUPEQUt$1^_[]Íx*PQhRua*PQh R軅dUSWV[ۺ|$T$tL$t )ŋt1tXuQBWQRP t?t=Gظ UQWP%BWQRP ttGHUQWP 1^_[]Íx4֍PQh*RFf4ՍPQh0R资L$(,USWV [ȹt$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u.u^[ÐS[^t$t$t$t$t$J[ÐSV[-t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[D$t$ P[ÐS[þt$[ÐS[Þt$Z[ffY ÐX_L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXة$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$JPQV ƍGэ}L$,|$ U(!Ћ$%W|$ƀހ:w7$Lw;t$b\Gn߃^rxo;l$1\,, $*8wkdT$Ɖ*t$i $*8wi (Ћ4$8Wm;|$Yȃ|$ U(!Ћ$JPQV xuD$ ƋL$$)QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$;w(^_[]Ë$wᐐS[njt$t$t$[ÐUSWV([8|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ l0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[îL$T$ lPt$ [ÐUSWVT$[rɉ$t$4|$ |$0t=D$0|$ "v-d1T$VPP\$u+t-t$0u#D$ D$t$0t@D$u20u- 3 E})Elj4$|$t$(VbQ~6Wt$(V73 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2mtL$L$ ) $^(D$(H @^_[]F @4$utD$t0ٍwPQj@RXD$,cUSWV[t$l$|$ jW7WUVt$ jW9^_[]fffSWV[ì8 8tfr4PQ Džu:ja t.P *GGG ^_[ÐS[ PQ0[fffffSWV[t$|$t]WV0 ^_[ffUSWV[ûl$|$[$PQVx t"t$UV| VjjPt)W4'PQVw ^_[]fUSWV<[5$T$PE$8FNt,$ @QP0,$NolȃFFD$$vD$$Vj Pl1Ʌ,$t$ D$D$D$ D$PD$XǍ×t$8jWPhVr=hVl\D$t}ƍЗPVr\tGL$T$RQWЃ D$ t2L$t*tBRjQPv-,$V D$;t P[D$ u QP@tj t$|$|$|$ |$|$l$l| |$||$|4 ,$t t$ jQP1Ct$]D$t*L$tt$t$уD$;t P&[E;$8u^ȁ<^_[]ÍʖPQh~R6T_ʖPQhR T8S[D$ L$01h[ÐUSWV[t$,INt@0&RQPWq~1!D$8D$ D$kD$ZD$J$ t$7q;~F4UqFDtt$qFDtu&u8tMt$ pFDt4$pFDtt$pFDXt$pGj o^_[]ÍʖPQhR9RUSWV[[|$ 11 t5D$0ft$ 9rԋ <.D5tDot-1t PH9tGGP0GT$JRWO|ʖPQhR9Q !1ɋ I `QP.t8 Il$u}ml|4 t  1^_[]ÐUSWV\[L$||$x$+|$x8D$8tvkƉD$TW tgi9t uD$tL$HD$  D$ W9$u8; H u(!D$D$  D$ WgpD$PD$xD$<L$Bu 76._^_[fff̀rS[Ôt[USWV[x|$ P$D$l$$lt$L$T$(PVUWt$<9tO $+t$ O"1^_[]ÐUSWVP[~t$vO8$l$ L$T$$t$,PUVt$8=9t5^_[]Ã19tiF9udFqF9ulFyF9utFF9u|F뫐SV[ dV1dPmVר^[ÐS[c1dPw[?SV[ÝcV膨1 Vv^[USWV [fcP ɉ$tG$W$\$1=L$T ~5X $WP%\$uD$T u $hR\$ƉP tPj3t0jdždN-00|$~X hWPO P tܪتǃ @V҉t$>iFs0hFށdN$تt$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$تt,>-00t!t$t=J11ɋ\$+\F$ >-00u D$T ^_[]ÐSWV[`hRƅt(T$j!tV':181^_[USWVP[È`D$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNP Ń=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[>_t$[ÐS[_t$jt$t$[ÐUSWV8[^M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}jت[1+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$-1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[[t$WѠ1dPH$ PjVP W蘠^_[ÐUSWV[{[l$t$W\T u1dPUjVP ;W ^_[]ÐUSWV[ [|$t$UX uƃX Uӟ1Wj(t H(^_[]ÐSV[ÝZt$L$t$j'ttH(^[ÐSWV[LZt$W1X uƃX W$ 1PjC't H(^_[ÐUSWV[Yt$|$U輞X uƃX U裞$ Pj&ttH(^_[]ÐUSWV[[Yt$|$U<X uƃX U#t$jQ&ttH(^_[]USWV[Xt$UН1dPGP t jP.U蚝X uƃX U聝\jjƉU`^_[]ÐSWV[LXt$D$t jP4WX uƃX W\jj/^_[ÐSWV[Wt$D$tF t jP4W衜X uƃX W舜\jj^_[ÐS[^WD$t@ PN[ÐUSWV[+Wt$tF |$UX uƃX U\Wj^_[]ÐUSWV,[õVD$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ" G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ dUSWV4[SL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(VmX uƃX VT#D$|$\L$jWjj'|$uL$jWjj~'|$t1ՉNjt$#0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[ZR$P@T u1dPl$|$P tABR lP~;yQq|1)͋$P–^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[OUĔT u1dPl2|$t$P tWVP ƉU{^_[]ÐUSWV[SOD$D$fBt π?:t D?:u$,?/4$\$u(\$jW=\$ W?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pet59tx/ux.uHt/uэ|$H4$$," 4$\$h@ WEǍD$HhPW +&y \$n0\$WD$(WЋgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$躳USWV։[AtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR' $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i$QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $X2D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$7)jhUt$ !T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9$l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$ћL$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPI)jhUt$3U\$T1ڽT$\$jjdUR)jhUt$ޙt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4X|+D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]͘PQjFRq˜PQjGR|$$bK˜PQjHR>ffffUSWV[l$t$|$tU6^_[]Ína*PQhROʐUSWVP$[et$d U`t,j6tPx $Hp  17"  xuxt)txu8u밾UR`^_[]Ã듍z*PQhRqKUSWV[Èd D$ P_   $ L$ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ ^ u#t7W轩u^_[]ÐSWV[t$d Wy^"  xuxt&t xu8uj踘u $p@@  1W]^_[Íz*PQhR&IfffffffUSWV[5$$$$$tD$$DŽ$DŽ$ $$jP]$@jP]DŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^֙PQjPRn֙PQjQRqT $ ;$u ^_[]8S[Þlt$t$Pt$t$7[ÐSWVP[kD$L$T$t$ 4$lVRWQP^_[ÐSWVP[+D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[t$}XjWE`HM`~;Ep~ t EXHMX WRjW^_[]ÐSWV[lL$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[ D$ L$ $XQPR[ÐSVP[D$L$T$$XRQPVD^[fffffUSWV[ØT$(t$$|$ t&t"qTN @14$t8t$jR/L$0A uy$‰Ņ1@<$1qyQ0uE)ljuދt$$$)1t$ ƉACAAAjQw֍PQj=RCJ׍PQjQRՋ)v1WPV/ L$(9l$QhuC}T$RPV |$(Gy<)ЉAjQt$$jU$+D$1t$ Ɖ^_[]Í.PQhR[L$8AffffffSP[mD$ L$T$$RQP[[ÐSVP[<D$L$T$t$4$VRQPEB^[fffffffUSWVP[t$|$PVG1sht$t$ P x=|PQ+fF FfFfn vF$F,F(F $tjjjV^_[]ÍNPQj>R)ffffSWV[|$t%jWw jW^_[Íw̚PQj;RxfSWV[Ü|$WG;D$w+t$9w 9w9w 9wPWVY ^_[fffffSV[=D$;D$wt$ Pt$VɅ ^[謅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[t[USWV[t$F0u ǀFFF tVu"Vut) aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍwӚPQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P蘐D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q ,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P`\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$w$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$w$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$w$PQhR=EL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$w$PQhR2U|$뉐|$UD$xT$ Ӌ$Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PDE|$8E|$8|1 uT t$ 9wS$w닔Hwl$Pmt t$T l$PU\ / U| 룋$L$19u $P;T<^_[]þUSWVP[ØD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$肑USWV [FD$ 069rljT$D$uj$jWPH 螔(藔9$T$JHJHJHJHJ H JH RPE$jWP 8(18t!'0t$R0*)4$PjV5 $L$D$ 81 ^_[]ffffUSWVP[#EET$@t$DT$$dpU }jjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP  )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]裍USWV׉[gl$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[Sm|$hE t$p |$<$ MM$Ujjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPD )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[ðEx\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(w D$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػx|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃xL$T$vثxv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQUY1$t?$L$U6$1xL$^_[]þTx0ffffSWV[ t$|$ty8L$tu1 1 ^_[ÍPQj5RhrfVL$T$ tu1 ^Á1 ^fffffUSWV[0M1ЃωT$(ЃM$U 8E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmLD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػxD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃xD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثxv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[\D$1r 1 9vW<t8Ɖ^_[ÐSWV[D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[mD$ PHpR=^[USWV X8T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[n5SVH[ED$0hjP Z D$(D$,DŽ$@DŽ$DD$ D$D$$jPj 0L$(VPQj5D$$D$ D$D$D$D$D$jPj\ js[j[S[^YS[>fffffffUSWV[t$|$tK1tt (h1^_[]ÐUSWV[P}uu5)\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋlgt$(PV'T$4D$(hPV'uD$(D$D$(L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQJ D$p '3 |$4t$N  D$0P QVR  t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}E("P"L$D$ffffUSWVt$F98[mW |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[ÃVu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ÛUt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXTǀ ǀ fǀ ǀ9 fǀ= ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ÌSD$H~( 1u 9r1$PƉ^[fUSWV[+SL$8?tP胖 wܽ t{ܽ ?u1>PƅD$t/Fn?tP#FF ^_[]1?tPd )ʉʁ oΉoUSWV[+Rt$tbF!r VO8}t3Wm}Fܽ ܽ tWKܽ ܽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[Ql$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UaE!r\UK18}$P}T$,Bܽ ܽ ti4$\8}th$PӒ1}Fܽ ܽ t14$譒$ܽ T$, ܽ D$TG^_[]Ëܽ ܽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[nNj,tL$H@[ÐUSWV$[8ND$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V譌?Eܽ Mܽ $t#V舌D$ܽ Mܽ $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[xHD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [EE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[B$t|1a1ŶzDPQjERh P$1D$jjW+ ʼn$tƒ9tt#D$PW&to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F UOĄ^_[]fS[ÞAt$t$jt$0[fffffSWV[lA|$t@jWaGHO~ H0 WjWB^_[ÍwOPQj=R 럐SV[@t$ t%FHN~ H V^[ÍwPQjIRi ffUSWV[Ë@t$atrt!w 11ҊNtgtGɍyw|@ؐ+u˽뿁뷁 ՋL$) `1^_[]ÍĝPQj>Rg fffffffSWV[|?|$f jWbG0ǀǀ 1G t WzƋO twуy y wG0tW@9t QkG0TG0ǀǀjWG GG:wEPQj8RG f  ^_[f̀rS[D>t[SV[->t$ t;F0u ǀVNuFH^[ÍwLPQj;RfffffffSWV[ì=|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WXG GGfG u WG t'DVPV訁GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍwPQjJRSV[-<t$ tF Ш u V[1^[ÍwȞPQj;RSWV[;t$t` 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPƈ6@VRQWPL^_[ÐX?;L$AA A AAAÐfffffUSWV[:$ut hj|1$džt.%u%D$PQ?1t+ 8$u! 8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVu VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFϞj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC/t(1Vu(1^_[]14dž$j$³tJp,HlHH H lHHH 88oUSWVՉ[D5jqlj1&NL$jP踼$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[34jQ@# t D81t>0rPt_t u8~)1 9}8tQ݋t PqVxt81^_[]ÐSWV[2|$tOW.^_[ÐSV[Í2D$ p|$s t.jt$ 1dž,dž,^[S[2L$tAt[[ÐSV[1D$ p|$t_dž,1t$t$^[ÐSV[Í1D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[1l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNS׍۞PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $w"aύ֍۞PQhR1Vǂ $ǂ(#idž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[-|$te^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[h-|$(o(o(OG0!D$;G9} $wD$D$ P $L$L$D$QPt$荠 $L$QjP t$A$D$ Gjw^ $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wy ^_[]ÐSV[-,t$ t$t$ #F,;F(~#F0^[ÐSWV[+4aAϞj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV2uD$`뒀gt$l$UV݇ ut$f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr{PQjbRvrUSWV[ÈD$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í{PQjbRrPfffffUSWV[Ë|$oEtjPu7 EjWu,EtP訥E EtP臥DžDžtP`DžDžU=W4VT^_[]ÐUSWV[È|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[}D$;D$wt$ Pt$V9 ^[ffffffL$1s!t11҃9rfWV_ D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[HL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T${PQjbRvT$(L$?{PQjbRJT$D$L$ {PQjbRD$L$_yffUSWV([(D$D$른O{PQjbR$u 1(^_[]Í{PQjbR{PQjbRUSWV[èT$0t$,l$$E( oM;dM9X$E(  D$($I҉t*t$BfD$D$Pt$UmT$< Pvƃ9Љv*t$BfD$D$Pt$UlT$< vƃ9ЉuXAtQjPup ƉD$fD$D$Pt$UYl jVu# T$0L$fT$|$(u 0t$fT$EL$jjjPPQUjT$LM(|$fT$MD$jjjQL$QPUJjT$LGM(FjPu臕 ƉD$hfl$D$Pt$l$,UVk t#jVu$ T$0M(E(jVu T$0D$ED$fEDV<DtG PU7ntkGt PUntNO, F)WPPbo ,$fnT$0|Vnft9uf&BMf9s $fMnfuvv9f$+t$0ftpt$ 1fuf9tL]4$f9r1ߐftMf9s $fMMf9s $fM)ȋ$t$ fs:t$,fFT$$J( 1uJ;uJ;L$0vfJ^_[]1ftMf9tTMf9r1ftMTMf9r1ftMTMf9r1ftMTMf9r1뢍{PQjbRT$@{PQjbRT$@{PQjbRvT$@{PQjbRNUSWVT$[bA,D$L$;t$cFjv7 $FD$Du (Dt&A PWl$kl$}sBu`}U|$W UWfz;L$ {PQjbR&L$땍} ‰D$E)QPPk D$fEDuf$ftNL$uKȋT$fafE|$fEE jU7蛒 Af.Af; $T$sfL$fD$ufL$ 0D$ftpL$ 1ff9tOOD$f; $r1ސff; $sfOf; $sfO)T$L$ fslfE|$jU7蠑 D$8ujP7芑 $,PW$ut$Wox1Ʌ $$^_[]1ɋt$$fDOf9L$hTOf;$r1fOTOf;$r1fDOTOf;$r1fDOTOf;$r1뙉D${PQjbRD$QUSWV[ûl$|$Et$jP7w tBMHjP7P E1t+jP7J tMHjP7# ^_[]f1̀ffff ̀rS[$t[SVP[ t$t$jjjPV:1Ƀ $ȃ^[ÍNn7PQj5R艿ffUSWV[å$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W00 $t*+$hW>P1Ƀ89t$1퐐$(j?Pt$轖 taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ZNՍwPQj?RWꋌ$1Ƀ8cfffffffSV[MD$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVx[D$tD$pD$lD$hD$dL$$T$dPjD$@FD$h9tC;D$$uL(^_[]ÍPQh<R j$jU0 볍HP'VUSWV[$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍ<T T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø荗USWV4XHD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$PLB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$bԡuPQhRے\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$bԡuPQh|R趐\$T$\${PQjbR腐\$T$\$bԡuPQhRQ\$T$\$bԡuPQhR\$lffffffUSWV[(|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc{PQjbR蹍I{PQjbR艍w8{PQjbR^;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuE{t$PjbQ螌ujWu\ rF(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tT$ {PQjbR膋T$Hb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPNE EE($}fu E(jQt$xsB t{t$t$jbPwэ{PQjbRTD$T$ {PQjbR(D$T$Ǎ֍{PQjbRUSWV[ |$l$t$FtPlKF FF($nf~ F(^_[]USWV[öt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7{PQjbR;몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ{PQjbRB!fffffUSWV0[Su~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍{PQjbRƒD$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$${RQjbPT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$D$${D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$P PPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^L$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPIz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$0P,P(P$P P PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[ît$t$t$ [ÐS[~t$ t$ F[ÐS[^L$T$ j[ÐSV[-t$ tA4j@PV O FPhjPw F@FDFHFL^[ÐUSWVXŪ$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8tD$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPm FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[Ít$ tAj@PVkD FPhjP8m F@FDFHFL^[ÐS[.t$t$t$ [ÐS[t$ t$ [ÐSWV[ܟt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVl ^_[fffffffT$D$fUSWV[MD$$&yd4Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <h 1D$D$ D$D$L$8T$jjPQjR@tD$8h D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$.FL$=L$UL$mL$hjjjPQRCD$L$8T$jjPQt$Rm?L$81 u/jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR>t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjRw>D$XL$~ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$R=tD$8he^_[]fffffS[ [ÐUSWV,[ؗl$@D$D$ D$$D$(L$ D$QPj( W 1|$D1҃|$H1‰|$l 2t |        t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áp uH< |$9T$vQ׋ jjjhjPj! l t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tЫuԫЫ|$Dtܫܫ1|$Htt$jWj ,^_[]þ |$ $ jjPQjR:<$ ȅUSWV[{WЫtV6ur#dP7ƅt3Z#ثtUmuW0(#tUmujW^_[]ffS [û uoD$D$$ T$jjPQjR=9t1 u,PQjAR^  [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[Ël$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP@t,NQW QRP FEE1^_[]ÐSWV[ D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [øT$0|$,D$(L$$)q092sVPw$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[ȎL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[ø|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[t[̀rS[Ԍt[S[þt$ t$ jt$$t$$t$$t$$t$$  [fffffS[~t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[ȋ$D$D$huET1}8XM4tI$Ph E8*$$E4E0|$ 1D$L$j`QPu8VR0ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$84<|$ Wv$Ƅ$D$TtPWt.$Ƅ$8u$L$ThPQ  $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU 8 ʼn`UD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWx h$PWb U|$|$Tt$h$PW/ |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8ISltC$($,2D$XP$06 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPyB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPg t$|$ t$$tP2A$$t P"$($,uWP t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PA@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[Ì~tM΋uA~8t:~4~"`N4F8 I9rP F8^_[ffffffS[~D$L$ AQ jQ0 [ÐSWV[}|$t$t+jP6 tH  W6,^_[ff̀rS[d}t[̀rS[D}t[USWV^%}$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLX8|D$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqo91pjPQwê1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[Lht$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øjPjj%Q4SWV[ÌgD$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[g|$ l$9v`wDt9xtNȅuT$81$Xq3H7<871*׋PtIQPEjPQD$ pD$,蠨L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yk6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p&2 D$ L$Q$ЈA1ÐSV[ et$ V PjtHP tQ P VI1^[ÐSWV[ìdt$>gthGt tww$Ѓ gpNjPQwU;u<tww$Ѓ 財4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[\cD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[bt$0|$,ttqP3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P| Pt$8=t +l$1jt$8_1^_[]fffffffUSWV[b|$(T$$<Gx:B tzu?Rt*d2 O2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj WV t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$xT$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPST$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍwǣPQjGR(T$4ңǣPQjHRm(T$4USWV[Ë]|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;DWLP=Wx- jW^_[]ÀO @1USWV[ë\t$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍwޣPQjVR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[[t$8uN uRt8F0t~@9tREF0N FFfN ~u VkN u1uVVF11+NN^_[ÍwSPQjBT$B=s\DP%[Í&[ÐS[AT$B=sD$ DP%[Í[ÐS[ÞAT$B=sDP[Í[ÐS[^AT$B=sD$ DP[ÍC[ÐS[AT$B=sDP[Íŧ[ÐS[@T$B=sD$ DP[Íͧ[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[T?t[D$t8t9@€tuuuuH+D$ÐffSWV[>0t1jWQw t u1^_[ffffffS[Î>Pt$t[ËD$|1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[ë7l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[6t$t8D$ t|$tT$t121Ҁ9 11^[Í/PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[5$0Љׅtϋ$tZRWPQ$$$4UhVH$yPVj#q S[N5t$jt$t$PUSWV[%5$$$$0ЉՅt$ tZ$RUPW$,$<QhVt$t;l$VPQhUJPUj%p tWD$ hjP' D$D$DŽ$DŽ$ 0L$VPQj<$;$^_[]ǃJP膺҃¿+w狔у̃ǃƒS[N3t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[2D$ D$D$$jVjn uƃ tjljj0jVjsn jIjfffffffSV0[*2t$̀rS[t0t[S[^0|jPt$t$t$[ffSVP[,0D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[ä/t[PS[Í/[fffffffS[^/88t3[Ë[ffff̀rS[$/t[S[/j1[ffSV[. u# V>u@1 ^[Ðfffffff1ÐÐ1Ð1ÐXO.Ð1ÐÐUSWV,[.l$D|$@ |ƃѱ =sdf Fw% =uɋ 뿐 QUhWL$L$뀋 |$@l$Dt1 t& 9s8u+p ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÍѱPQhR]fffffffUSWVX,$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$W8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$WD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$WD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WP}T$$4$4$4$4U$0R&U׶=r,j$ K;$u;^_[]Åt|.u|$XpUPQhWKft$|=TPVt$|UQ2$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$ExnNj$L$|PQ J$L$xPL$QI$ǃ$fB$) $W 9$A A L$|PQlI$L$xPQQI$Pj\I$PQ%I$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbDƅxՍ7Pj H7Pt$H7PjH7PjdH$ 1۸$IUSWV[;l$ |$t$D$@tP) l$$FPj)GF|PQGfFD$@ u1ftPVPyGVjkGG fffG )^_[]ÐUSWVP[Jl$0t$$T$ |$D$@t PT$$։)͉ $9L$(B99t$4D$,WPFGPl$UFGUVP誔L$4 )΁r&µuPQh=RCL$8QPOF+l$ ^_[]fffffffS[>jt$ [ÐUSWV[$ $D$0$jUEEt U uEEEjmU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh mtkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+DD$ djVU )P!uƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ PtPǍ$WhhPhE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #5j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  s鍔$P5 $< t< 0$< w 4 A< vhQt$H ƅ_BPt$^nD$ kc$< t< H$< w& A< vhQt$V赇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t@PVe< D$<@@@@ @@D$@D$8zj5Pj j$P-D$PD$;t$ s E$EtJ*P|EDt%uHOPWYu퍃PPAVPkt#V[ML$0 ;$u ^_[]VUSWV[t$xP!džft91 9s)tQ!DŽͅtMtt|5X9utf!xt PR!WqdžtPqdžf^_[]ÐUSV[Eu jPc$D$F$FWfF e^[]ÐUSWVx[ÃEL$ L$pu D$jPbD$3D$fGt$V jWV VWJGL$ ;L$pue^_[]TUSWV[t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$Atbt$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ j PV¡ ^jPV訡 &j PV莡 j PVt IzjPVZ  jPV@ jPV& j PV jPV jPVؠ jPV辠 jPV褠 j PV芠  4jPVm jPVS $`FPC5d$/FP#|Gt^GddGtAPt$'F P|GGtPQ7< < {$H׋$uʶt$0UP $[Py뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVX?r?D$PVt$y D$L$Ƅ|$PVnX?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[È$$l3 h3 p; t|P9h@tP|x$D$D$%D$ D$D$D$ PjjjQt_ett. T$F( th 9tF F$F藋( r R p  ^_[]19u뫐S[Þ'QPR j萚SWV[lt$8 t3 9t^t, z t7 9u ~t vGVG^[19uΐS[Nt$G[ÐWVX-L$ tsAQQBQQAA, tD 49u4 4~ v p  ^_19uSWV[Ìt$trT t/<t) z Y t$ $PQj[[ffffSV[t$ tjV\f jV^^[ÍwPQj5R}ffffffUSWV[Õ$t&j$$P9$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjr菌Njh$t!A3APjhjjEt{Njh ʁʀ $4$jjjVOd!ƒu.Ё8u$$! P讁(p$t u|! D$$Pt$]-D$| $W?bPt$m @ &l+(ɀ GGPG G GGGjjuH tTP у1uP VPuJ $tMtH! u?jUu.B(W $t 4$(1Ġ^_[]À!SV[=D$ pFtjP6I F!u^[ffffffUSWV[ۮt$ D$hEtjPuI EwL$d8uL E(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUa !@uEIBj7uH 1WUƅur}$O^_[]ffffffUSWV[kt$ D$hEtjPuH Et}^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPUG !@uEj7uvG yUSWV[Èl$(9s$QPL5D$ L$t$;t$,w D$,D$1;t$t$jt1tKkjutWVx $$t$jD$PVU8u&<$Q;t$,s!^_[]ÐUSWV[8L$,|$(19D$t$ity;D$touF$WV3)L$(žϋ$Eit ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$6L$uu D$,91^_[]À!USWV[t$(9s)QP2$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Qu $jD$PUV5u;l$,b1 !^_[]ÐUSWV [èL$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,4u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[ۧt$D$xGtjP7B Gt\u^D$tR;wUjPW, t=(@PUW 1PU7"B ujG(uw^_[]ÃtRG$jPW tՋ(@PUW? 1PU7A uG$ 1랾뗐USWV[øD$$L$ l$DA4DtFPUL$(>A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍>2PQhRyoL$4T$0^L$YPQjbRIoL$T$0z>L$2PQhRoL$ffffffUSWV[+t$nEtjPu> EjVtE 1t u1@u)d1Ƀ Vt^_[]ÐUSWV([ht$@l$<}GtjP7> G ujU蚌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[{|$ t$tGw#jP;*džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP)t2MQUQRP$ EG/1^_[]ffUSWV[H|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$׍YPQjbRi\$8=$roD$L$,td;l$tX14Eju7k7 t%MLH4jP7>9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [(|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RE $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Í߻ջPQhRgT$믐USWVhXȜD$|$|G =tŋ\$jj$W?{$jj$W\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$go ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WgO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhSR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhR|a끐USWV[ÖD$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p FL$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V 1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08_1\$$ PQhRzX\$T$ D$4@USWV[ÈT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJ] PQjyR'OT$>]t$֍ $PQhRN\$L$$t$|B,1o9wl$t$uL$H;qu LJ)L$*Vt$PT$IT$ t$|$)Hf,Jf6ŃsxflBL$fLB|$t(fr$t$t$@ŋP frl$M|Bt$sFD$D$$g$>] PQhRMT$W$>]֍ PQhRaMt$닸1(^_[]Íj]׍ $PQjbR$M\$D$XNL$]֍ $PQjeRL\$D$Hp>]t$֍ $PQjkRL\$L$$t$>]t$֍ $PQhRrL\$t$USWV[Èt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UlƋD$cPULT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σsZʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]Í> PQhRJ$E vUSWV[ø|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ uhDnjt$Pt$0VjtRV tm9u.NWRV? t ^_[]ÐSWV[|~t$|$LQjPQWjt2HfyuftfDHjWPVFi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P= L$,1TMGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[|zA =tl$$G)B fT$L$D$ uf͋t P9 ,$Uje|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVmf t׋@f8u$dž wSWV[Ìz|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[6zT$$wA =tF)G D$ *$Ffu^L$t Pc4$jL$t$,t$,jWQPt$DFjWPQ,etjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[xt$0l$$D$jPj |$ PQh}RYA>fL$ PQhR*AL$fffff̀rS[4vt[USWV[v|$0D$(pFtjP6 F!Gt 9u7L$ L$4D$ _|$,(?99s$QPmw7P G)RQB D$ QF(n$M1ҽtňʃ0(;wI( t`9! u $UV $9 $!u'D$D$@DW<D$t=|$WP@ |$H9vjWPVtl!|$, $tt$WL$E,$ύL$ WQPVD|$u( t u~$!jUWjV^_[]ÐUSWV0[hsl$Lt$DD$,9EvHD$PUVa D$$D$D$ D$D$$ED$(D$ D$$ D$ ,$T$Pl$H9¹)QUVg [|$xD$Ptu,$<1L$DD$H9,$vPT$RQT$ ,$uBj)N|$9s6WVt$t$ jRl$\Uƅ|$1f9l$s*yL$)ɋT$zQPRdL$ fAA)fAfDy$΋J L$ LDr2P$ D$D jV0% 1|$;D$,uM0^_[]jRD$L0 ׍|$ύYPQjbR;|$ fS[p1 uOƃ1 ,t%9HuHP 1 e@[fffffffffffUSWVYkpT$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[oV跳jV|d VP ^[fffSP[ío u;$ djjPQjR&t<$ t ǃ [ffffU 3}NNNNNNNNNNNNNNNNdINNNNNNNNNNNNNNNNmtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20251207195951Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20251207195951Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20251206%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.99.4 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.4 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.4 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.4 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.4 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.4xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist