08P'i'&<  ''i)z5P''`'&. &.'i'&P@@<@T 08P'i'&<  ''i)z5P''`'&. &.'i'&P@@<@TU 'i`'&.yA'i'i'iQ$f 'i'i'iRA'i'i'iVA'i'i'iWA'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'imK2%'i'i'iX`hpx$'i'i'i (08@HPS$c'i'i'iX`hpxP${'i'i'iSQ$'i'i'i (08TJA'i'i'iC'i'i'iA'i'i'iA'i'i'im'i'i'i@HPX`hpx\$'i'i'i$'i'i'i$>'i'i'i$'i'i'i$s'i'i'i$'i'i'iA'i'i'im 'i'i'i$'i'i'i $'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'i$`a'i'i'i (08@H$'i'i'i$'i'i'i$'i'i'i$'i'i'i$'i'i'i$'i'i'i$'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'iA'i'i'ib8e\*n_Acmnto1aygoW$ Z iPM<\E.b!˛mv>DE>|$f_* o>ۯ `gw&u&. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4/%4 (`"`"ww]$224 TTT,,]$22Ptd(QtdNetBSDPKwGPaXU SR ffffUSWVP[/.t$$ujPjjjj 0F $u0& Q/tuYXuk;(s(9rD$t P"P";s9rHP"$06v@ PUSWV [È..A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[] USWV[û,.; s' ~*u.UE9r^_[]SWV[l,.;s9r^_[f$SW&,.5u1ƃ5 tЃ t0$k_[SW+.4uYƃ4$t|$0<$kt$?t<$ktЃ_[WVD$0tP>tKj/Vt@Ƹ!a"}&PVt&uVh`"h`"h|f3%^_`SWVh`"h`"h|f3% 1۸!a"}&PCPrFh|f3j 5whg%h|f3?% uh|f3j 4jD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5,n3 u$1^_[Vhc"Vhc"1 5(n3hc"j謧wVhc"jlUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S&tutD$D$$D$% D$t$@N D$l$t$8hc" t$8hc"0q 5(n3h2d"j;SWV \$ t$~d}g|$$D$ $O D$tO uXD$Phc 5,n3 u$1 ^_[Vhc"Vhc"/5(n3hCd"j藥wVhc"jWUSWV|$,1AA AAQhc@5,n3B (n3D$4#4#$b#\$|$4#$b#$b#VSUWRPQh~d" D$ t4#$b#QPhd" 4$5(n3hd" 1^_[]t$(hTd".Qhnd"j苤P|$ u5Phc@5,n3` (n3u+4$Qhd"E 1Yt$hTd"p.\Qhd"j+PL$ D$~0u3D$Qhc5,n3 u1YPhc"Phc" .5(n3hd"jUSWVh$1ɍD$THH HHD$$Phc@5,n3m  $D$D$1$D$ L$D$;W&tulm3DHu;D$9D$<$|$ aD$ $GD$9D$r<$t1A $D$|$ L$ D$tr1A $D$D$N2D$$‹|$ND$ $11D$,"r1@D$$|$D$T$9D$T$ʉL$L$XT$$H&L$\ L$`L$do1A|$ t׋$Åtϋ\$ 9klV蔰V1VP_ D$D$<\$@|$DD$$D$Hl$Lt$PD$h0n3h$$HD$ @l$0tD$Phg$#j 9D$  |$\$4t$,s$L$)L >QPhe" D$  L$s()@L$L bQPhe"L$ D$  s D t 4X&he"L$ D dtPh f"oD$(@9XU\$D$T$T$9tt$N9BD$4X&5(n3h*e" 1h^_[]t$|hd"9)%WS$h>e"h[e"j赞U`5(n3hye"jʞt$|hc"5(n3hnd"3$he"jhc 5,n3 u15(n3h-f"jtSWVPD$Hw#t$>8&Wt ub<&$h"c"Wt N1AQhc5,n3 u 1^_[5(n3hBf"jߝUSWVP|$t$7+;h>c"WV| fu $<(n3u _3)u (n3uhAc"@Ic"t (n3hjQk ,n3u 5(n3hRc"Ihu3$(&SUt uUh{c"jќh[c"j$NPVS& P V|f3PhVf"VU Vjjhf"&&hf"h|f3  uj 5,n3kWVοVx&tuVhc"j|&^_VPΉj PQ| x $9u^Vhd"jۛWVοV&vtuVhd"j譛t&^_USWV\$$1n3 n3xo3 to3sVj=Px<$hjjh@&U|  o3H F H o3VP3uo3t;#=t%{ o3##=uthRg" %o3tttzut!tcuo3X o3^_[] o3zVhf"W Whg"4$hf"4$h"g"j%hlg"hg"D$L$011PjPjt$h@j$n3n3xo3to31PjPjt$hg"輄o3o3hg"j衙1hjPPt$hh"舄o3o3 tj 1PjPPt$hh"T,2tZj o3u$1PjPjt$h)h"xo3to3ËD$o3h:h"j1hjPPt$hPh"ރo3o3h\h"jØo3u$1PjPjt$hsh"褃n3n3ËD$n3hh"j1hjPPt$hh"fn3n31hjPPt$hh">n3n3fSWVo3t/ po3lo3 t5`o3)փ>8F u`o3n3do3 ho3 n3n3;n3 n3r*jZn3`o3n3 n3 ho3do3^_[áho3 do3 t n3n3hR&h$$jghR&h$$jVhP&h$$jEhP&h$$j4USWVt$|$64$b#SjSVW u=_3PMo3u,o3$o3o3h&Ahh"j赖o3h&1QQPe o3y 5o3\o3 \o3 =,2r|o3uhNi"롡n3u#n3n3i"o3h&1o3Ho3h& hQPsd n3yJ1o3H o3 hP5n3Q n3 n3y 5n3n3n3o3utS1V to3o3o39xo3r_ \o3t= o3 n3E n3t# \o3) to3I n3" \o3ujln3 `o3n3o3 o3t n3 n3t o3h`u;5n3 n3=o3 n35n3VP5n3W o31VhPo3hjghjX5n35n35n3n3h? -,2e=o3o3 o3 to3o3o3o39ss$`o3 to3tQj QjP o35to35`o35o3P$ xd5xo3-to31‰1 lo3 po3do3 ho3o3o3do3 ho3o3 o3xPh$$軎+|o3u6o3j5xo35to35o3P  t5o3h$$wo3 xo3to3 po3lo3do3 ho3o3do3 ho3o3Co3s po3lo3do3 ho3o3do3 ho3o3u@s)t8o35n35n3QPp@o3Do3 o3$o31 o3o3T$<$t$ Ho3-Lo3l$13L$ (o3,o3D$11 n3t,n3u#n35n3h i"/T$n3L$ AD$)ʋ$tЃ|1@|p9@|5o3 o3*n31 n3T$1 uK o3$o3I$T$ n3n3)ѣn3 n35n3-n39(o3,o3$ t n3)PQ5n3 n31n3n3 n3n3 t((o3 o35,o35$o3QPVR tjh%jnZ$^_[]5n3h/i"5n3hh"5n3hh"jJ5n3h$$jhUSWVt$(|$,\$$Uhn3jfZ C4WVs(P( 8jUjBZ 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hi"jЌV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h$$j2VPi9v VVPQ? t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVn3 n3t/jh"#jW n3 n3tjh"#jW 1t$PV FȺMb׋ Xo3-։+Po3D$H To3iى tL$ 1FD$|$ 5,o35(o35$o35 o35o35o35o35o3hi"jdW,WPWjV fo3Ɖ=o3u =M=o3ui $X0ެPh#h|f3 hn"'0赬Ph#h|f3 hn"N^_[0耬Ph#h|f3 h8&hN q3uáq3u tjwGjFUSWVjŁƋ|$11K< @u=$p3t?jj50p3 50p3^(p3,p3$p350p3UjWQ A)߉n(p3 ,p3N F5s3q0s3s3-(p3F ,p3n0/Ph#h|f3D h8&Mrh o"]1H,p3(p3,0Ph#h|f3 ho"'0ĪPh#h|f3 hn"LV贐1^_[]Vt$5s3q0Fs3s3^WVL$ q354p39})=s379}>p3829~vRO9G9~-82p3~Zp3΋Nu#82)Ou9~82RN982 4p3u q3uu82^_É1jDjDVT$p3t=p31p36p3t@9uхtp3uh%hK1^SWV1q3,s3j?h"腇.o"tWqt|8/uWh4o"Wh@o"h8p3; 8p3tLPi t$hgo"Pt0p31ۅu@Wp>58p3h$$jjo"jjMo"PJVP^_[V0p3tAPwxG0p38p3t!P 58p3J8p31$p3,p3(p3;58p3>0PVhs&h|f3ho"I^Vt$0p3t3Pؿ8p3t!P 58p3蹍8p3VEjhs3he3T| "x p3p3p31D uho"h$$$EGuȿ|w WjPp 1T L ш @u`q3hjV> P61Ftho"h$$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$T& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPs3 t uh@p"XC^_[]eC$ts38u@s35 s3Nj- s31;-s3M1WtÃ=,s3tj jwSVVVSt$(1Ʌ;L$uWwZ?E;-s3|1MVq315xq35|q35lq35pq35tq3肆5tq3 q3u q3uu ^j:jq;V5pq395lq3}tq3Iq3P5tq3莀tC5pq3tq3 q3u q3urufL$lq3r5lq3 1^0趟Ph#h|f3 h8&A q3u‹ q3u tj:j9USWV l$ D$fD$p 1P lq3|q319tq3@u 9u|q3Sks3 t$$PPh,  $ r3| t %e3ڃuh"#Q躸Uuhqp"Q蝸jD$P 4Ë $hq39}=dq3]q39|A‰T$R5dq3~NjD$hq3=dq3 q3uq32$@PSW| =s3?5ƅts3VPP,+ s38uK=dq3뜣|q3Gh"#5s3~t:jPDžZp"x Q:? ^_[]Í|$K0 Ph#h|f3! h8&> q3uq3utj8tp"j&7WV lq35|q319}'tq3FىDuw9@u1=|q3^_USWVD$L$9tVlq3r=tq3~=xq39 t9|1Cxq3Mu9|1Cxq3=tq3 9u^_[]fUSWVl$}!uEh3"#P UT1h3"#PzÅt*t$Sǀ}!u?S=0裛PUhs&h|f3hp"=eS芳x(=q3uWh(f"h|f3z 5s3+t$0v07PUhs&h|f3Khp"=^_[]USWV |$$Wơq3$,s3D$s31-q3-,s39-q3t\$=s3t$ gDž~w11q35q3Y6tss3PPjJ Å q3uq3t$ Dž|$$\$9t$utt p"<$u=q3t!p"9u ,s3 uh|f3PO9¡,s3Ƌ q3Ӏu1A9|$t $ q3 ,s3q3t )) q3u q3ut j4 ^_[]j3USWV1|$=q3t WrGHOHt uG `-q39}q3Vq39rFU5q3Gy-q3q3 q3u q30u ,s3F8Wڱ<1ۍF-q39~Nq3 q39wUQxt7-q3q3 q3uq3uhtkq30 F,0Ph#h|f3 h8&9 q3q3j2G @utLq30 Fq38谿0qPh#h|f3 hp"Y9-1q30=,s3=q3  )Ɖ^_[]js1USWV|$?!uGh"Pt$WI,VPsÅt2l$t$ US NjD$8!u?S =Ӿ0蔖PWhs&h|f3hp"{8mS{x-=q3uWh(f"h|f3k t D$ )@ʼn3b0#Pt$hs&h|f34h q"8^_[]USWVPl$Uƃ=q3t1ۅtf;l$ `1V$th~;-s3u=,s3t =q3u8 GWPt$ F x4EEs @6;l$ |=q3tt$$$^_[]USWV|$\$l$19t[=q33t UPrUPFy60Ph#h|f3  h#q"61^_[]USWVP\$5s3FEx @u}|~PVq6tjq39~lq3q39SPtgƉq3q3 q3u.q3_tO5s3;^_[]Ë5q3W5s3V蘏 . ,1xщǃ|$uEr3| /5q39$~Zq39V5q3tcÉ5q3q3 q3uq3t q3W5r3U ,$+HPS5q3D( |$tM1BDžhZp"40ݒPh#h|f3 h8&41 q3q35q39} q3|$Nq3q39͋|$|MVPrt05q3q3 q3u q3umua(/ ]0Ph#h|f33 h8&4 q3t1q3uj-j/,SWV11e3H e37he3 u8e3@%fe39ue3H e3ÍF=s39~Yq39wW5r3q=s3r3 q3u q3t r30u ,s3F r3C0ɐPh5q"h|f3 h@q"2%e31t r30r3s3^_[謸0mPh#h|f3 h8&U2 q3uq3u tj_+j*USWV\$ D$1tt$hRq"D$ l$1uHD5,f3J ,f3;s3 s3 s3s3 s3;t,uQs39;us3빋 s3| s3s3t9t s31Ƀ USWVPlm3s3DJ@t t@s3@DJ@t uHH s3~Ã=w$0&=r3!h;r"  !=s3" s3A1Qptntl  Ӊ s3A˃=s3FP”^ U s3@߈\$ ̀1ۈL$QuH s3H1KDB@,Aǡs3 s3  Pj  5s3j$1  ˣs3@̃=r3t=q3y=s36DB@jLǡs3@1Hptntl   ˣs3@̃=s3DB@8!h'r"=s31Hptntl  ˣs3@̋ s31PptntlN  ӣs3@̡s3HQPN"s3@1Hptntl%  ˣs3@̍H s3 s3 p1Pptntl   ӣs3@̡s3PPv s3A1Qptntl  Љ s3Aˡs3PPH- s3s3=s3=s3 9=s3 - s3s39 9w hlr" s3PP s3A1Qptntl  Љ s3Aˡs3PPl@ s3A1Qptntl  Љ s3ADB@;hq" 1ЍrЃ sO誧j hs35s3BB $s3w{8"% s3 s3:o t!gc ptrP  A s3< b=s3Ho1s3PP9  s3-s3 =s3=s3 9=s3 s3-s3s3@1Hptntl  ˣs3@̃=s3F1Hptntl  ˣs3@̃=s3hq" 1@ s3 s3AQP2 s3<ĥj hs35s3\@ @2葥8"hq"N@2 s3x w =s3s3ts30h#&莽 s3x A =r3u;.5s3O1@ s3 s3AQP@ s3jPP>s3x  1q1ۃ=q3Ƀ=r3 ˃h% s3x  =r3u-5s35 s3 5s3g s3x ? =r3uL-5s35 s3: s3@;s3?7s3-s3x =r3u , s3IQ Ts3x =r3u, s3 s39QPns3x QVP s3y F( s3y 1 s3y P5s35 s3g s3A1Qptnt lu  Љ s3Aω s3y  s3s3=@29|PRQ 1=s3u s3s3 ǡs3@1Hptntl  ˣs3@̉s3z !r3SPhAs3x  1@+q3q3uF%s3x $<u<2=r3t1r3s3x =s3hs3h#h|f3j s3x }*x1Hptntlu  ˣs3@Уs3x 'q3G1s3 s3s3@Hptnt lu  ˣs3Уs3x =q3q3u=%|$Wt"5s35 s3QP';s3r3s3x ==r3uJ)=q3q3u5s3Q5;s3)r3hWr"hr"hq"$s3h%$s31< *5 s3y qt(s3@P(s3@P=q3h]%+s3x )5s3j 6'(Y$i*tEEp $A8GMi s391s3)@أs3=r3t W6Ur31 q3u q3u u^_[]jjSWV=q3uj貽L$ɸ!q3s3Pjh"hr"Hy|h;#CtkP}=Yà P:tGWP跛|3/tf/VQ}ed.hDhup5s3jh"Vj=q3ujL$ɸ!q3jhr3USWVPl$5 s3'Ƌ=s3 s3-s39ʼn) u)E1u1$q3E@q3V}tzP蘹t_s3PPj DžtOr3q3Hq3u q3u[uE6Ms3@Pi1,$l& q3u q3ut j1^_[]jUSWV$q3 q3thr"ckjP~s3L$F$ =u3 u3 q3T$uq3ml9}C u31F9u,$y^=u39} u3_q39|W5 u341=u3 u3 q3tT$ q3T$M 0E+u3;u35u39} u3Jq3 u39|KVP0t)5u3 u3 q3u q3u^u`I#x0OPh#h|f3 h8& q3u q3uu؃^_[]jjfWVu3 u39|ld u3j Qhu3= tJPXOPh#h|f3m h8&@5u3>51u3u3ku3L$t$T$ =u3@Q葤 u3u3RDVuu35u3@LF5u3u3^_SWVu3u3r9 u3@<u|L19tWW49uu3s3H2s3L2^_[USWV=H2=L2=u3t r3s3$s3D$j荣q3u3 u3ÍS4R4nr@44v\1L1 [ u3\1l1sRt6,lmL)1 u3t)|?wt)LI1 u3t~l)}L1 u3,u44vL1Y u3l1}w4R4Ӆ HA9~Ru34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=r3t׫H2s3$H2L2s3D$L21 q3u) q3u&tj\h0s"$^_[]jlUSWVL\$d3h@s"=*Es"tNjt$`hPs"SV fttu=$<߃u _3r|$L$ D$1@&s"D$PcƋO9rPSt$ d tu;_Յuͅu t$hys"-|$dD$ Du$$1Fl$?uSt$ hUs"j_L$j QP  $;Fl$|1ƋD$8u&1zPUy!Uh$$j>D$ ths"jNjC=m@!sHQPW xs{QPW x4$Uhs" =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W\ y?60Phs"ӍL$fqQhmW. 3Uh:'#D$ukD$Ph"hmt" T$"ht"T$t"hu",f3H ,f3~$f3H $f3 PhPt"kh$f3j 譏t$8t$8t$8t$8t$4ht"\t$Ht$Ht$Ht$Ht$8ht";t$ht"*t$ ht"j?JoPh*u"h|f3蚋 j SWV֋|$t u"?t$u"VQP̈ JB8,f3H ,f3;轍$f3H $f3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hQu"$thcu"P`u u3hgu"$thcu"Pj`u hqu" jhcu"hgu"G }Peu hu"jr 0 D$ u hu"j t$,)݉\$D$$D$11D$$hu"SU c7~+Hr߃8tlH w&$Ȉ&$<$뼃4t6맃dtket/1@D$=$<umWt$7_Xhu"5$<KD$71@D$$+L$ _3 _3T$uA_3$T$uȋ$D$,jj@R/8l$L$ $tL$ $L$,1ۋD$P\CEu S)St$PʼnD$$u U\\l$$T$DtIL$ىL$$U$E L$)QPR! 4$\EuED$ushu"h% ^u]hu"bhu"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vh$u3t$ t$,QPREt$ )yjz=$u3y hu"|$$tQt$(jVjhSMy hv"jVjh5$u3My h"v"}hu"@]ǽt$(1CUVSwD$P]MUVSw5$u3IMt$,]1L$XAAA @D$HPQS = u3u'l$hD$h 8jU&i ul$uDžy hS"#1O~fVS5$u3$L VSt$VL |$h5$u3)l$0fE<u1iu@hWj uli8^i18tƉjjU tD$68Zti8tEVSt$' x )bh8#Thu%|$l$8fE= u3ul$0fE9EjD$LPj  |$@f9fGfG$u3G$jVU tQf|$<tٺtf|$4t?$u3L$0u+fD$<= u3ufD$4 h8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h4v"jt$8j.wh#y/fhxv"Ph9v"h|f3zjwPD$L$jQ5$u3 XUSWVA1K8uSt<։@ghU7 ~WUV: ~)u1g1ۃ8#ۉ؁^_[]ÐSWVP|$\$WS)Yƅu]jjtqƉx jPS^ ǀ;t$8u XWVt$|$ t8Phv"j= 4# ,u3A9tL ,u3^_SWV\t$lt8|$jYPW8 GY`&Ӄ(Ӄ,P6B60#4#8"WVd^_[USWV $8 $4 50u3VTPV 0W5P&1WWPփ (JWWSփ _ƍ Wh PX& WjjW\& TV`&h <Ƹ jPPV(d& hVU`7 V!E=a==hD$\jPST& 1Nxr$ SSǃW0t^SWPj tg0$8 hv"j];0hw"jF; 1N ^_[]þhv"j ;۾Shv"j; ¾h/w"V =bt =buk $}u+Zt$WSVL$ . FYD$t8Sh]w"#ShQw"WVPO. 1QQt[0( Lt54u3tQP!0,tt|@P%Ɖ4P 8tg04@tt| r>1A8Љ4DAtt;L5rShw"j&9 10huw"WV|$x$t,WDWHDWDW4Dx uW =jtw\wXO=29}5PBt852WVhw"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUu D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph{",hz"K$|$PQt$t$RhB{"j'C$t&8$\T$XT$H|$RQt$t$Vh{"j}'$L$l$8h |"h{"hhz"HUSWV u|$W 1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hw"j&NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP<l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSD$HPhX& |$0hSj,6SitND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhx"j$^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh/x" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ @u3@u3Hu3Hu3Xu35\u3D$D$TH Qq T$T$ t$t$QShR}"j 11KL$0t.DSPhy"jV5u3[Su34u3t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<9u38D$D$ tD$tD$4u3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP ~"PD$tD$t$t$8WSP ~"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhI~"D$8Phu3Vt$,V'~GD$D$8D$HD$L$PD$LPhu3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L Pu3Tu3tt94 S.84u3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Phw~""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh~"D$8Phu3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh}" Qh}"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh}" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhg}"je1gD$4$DŽ$߬$D$D$D$@$߬$ l&a111CƋD$|$8D$|$H|$LjD$LPhu3VL$HL$8t/u3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh~"b11ҋt$  t<=Xu3\u3$T$p$1߬$$$߬$@u3@u3Hu3Hu3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP~31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=u3$t1J8D$<D$ۋL$؋u3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh~"W $PhD$(X& yNL9L$ L$tL$L$8]:u*t$ tD$PhU"j0 ,uh"j uh6"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWFNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP蹹4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhH"jT$$BRt RPRPVWjt$$Vh"t$$k,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhX& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =(u3yh"j e11t$ t$$k,t$@D(D$L(L$(}tTt  t1L$(VWt$Q](d&[$t$ D$L$9Éʋ|$S=(u3tQPjWhF"j:]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh X& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$Qh>D$XD$TPh]X& |$t$t$kL$,9 $ ?t$ 0PVh#"jD$,]|$t$t$t$L$$QctXt$|9|$11k,D(t P3;|$}L$֋L$]t$Q t$D$,TD$, m4$yD$,`14tPP2hNA&j,u׋$e^_[]USWVu3tWjjPsj u39u u34t0jQ^x!=(u3h"jft$-u3xi8t`PWhЁ"QV`tPSh"Wj[.t8Vh"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21u3Iu顀2Pu3 2~ t1@u3@9uUSWVD$921A9|G2SƉ<$~ SjV 2D$~Q1ɡu3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5u35u3$2^_[]V$u3 u3D$D$ p&T$ t$ 25u3t$T$L$D$\$ $_"4$^Vt$FtN H N tNHNfr v >V5 u3^VD$`sH) u3u3 u3HtP4BPQ@@1ҋu3v9tu3u3rh"jtp4F@u3^USWVD$T$#25u3tC=u311-u39| n-u39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv sF V>u3 u3 29|[5u3tFNu u35u3t5FNHNFy F4VPVu3@u31@j@P莿U1@PF ~4D$F(^$F0^,n#2^8u3 u3t q4u3^G FtH 7~ F^_[]É u3=h "h"hh#"h"hh"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP u3Hu3N^,H u3u3u3H@u3P u3 u3Hu3H4Iu3H89t;tprpu340u3t4F u3H^hD"h="h4h"USWV}]uuu W@t u31@u31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gh&sd&G4$O,52w0VPww D$0^_[]USWVPt$ffh&sd&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j蒻8p u3HtƒQ u3@ u3^_WVt$ u3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv v^_|USWVPT$|$:%4u3\$ u3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=u3| t Pt3u31t 98t@^_[]Ã^_[]`V15u353hVhu3 5u3^ft$ t$ j#SWVt$frLN4F,=2~0WPvv 1h&t\fv4V1AN4F,=2~0WPvv 1d&1;NuN^_[hr"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS7$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h hz" USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP13T$3D$M u1^_[]USWV(t$F(F}F F F$9D$4tohjɮljPL$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h݈"JU$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthaW1$2L$1 QWPUSVhj-ÍD$(Pu S3 P EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVhjAËl$hu PJ $P E1PU\$tE|$8t h"R,$StUk ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"Rt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"B$  $ V)19tQRh" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj"h$f3D$(u KHKpStURQPt$DljT$t h"MPu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k 3VRhЅ"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$wL$tI9ȋt$ tPQ$$h"讋1t$襯\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt膌|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q H4$Q:D$ $D$5uO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW}ƋD$0T$UW}ƋD$0 u$$$UWK}ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP|ERP|$GW #RP|ERP|$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh".D$ H uIM QIM,U($jPsuE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"}D$ H uqqy uu A1҉Q$Q H4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVP[tPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQH4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW#xNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPwt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPwT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPev|$FV D$t RPHv|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPu t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP3t|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPs$ D$TBL$?ttXLT$BtJ J T$$T$ QP;sL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPrي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQCƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVpD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"9 D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"hz"tUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0xoL$(|$u)n$ )n8F<4$NdiA N1t-t$p ǀA L$H SjQ] ^_[]USWVL$T$ B3ulF1G&Uh֊#,$,f3H ,f3~$f3H $f3 h$f3j u q1^_[]V|f3PPh"V=VjjhԎ"諦"@&Ph2#h|f3&ujUSWV׉΋*h"U &tCt[PUjhh3s 53R3t233WVS53G^_[]Uh{c"jw53h$$jwUSWV$:$D$VuP_ 9$j uPB 1ɉ\$QSu Ƌ88"u11F9Ή$<$1ɉQSu \ ËD$8Չo8"u !t$$Vhyd53} tbVh"j^_[]jhȉ"7jh".uh""$h:"hT"$p hn"h"ju$053h:'#jvUSWV}E pho:%V^Fh"VHhh$V2SD$(P53藳Z#D$0= M$L$A1yyy D$Phwd533 D$tG\$ D$ L$|$j ljL$ NjL$IuɉNjD$ D$|$uhj茍D$v1111O w+Ow?u$L$A1AAA D$Phwd53I  \$tmt$ NL$,D$(3D$FD$FD$ FD$$~D$(P膫PWt$,t$t$t$hΊ" KuD$1D$|$Ynhxd 53袷R531111VQRP53h@"mhxd 53Z 3LQhq"=ww ww53h"w_G|$9w  jPQ53!¡3tNSVPh"Wt$ 53@ $9t\"Q h$f3SVPh"mكT$;r ZƉ[|$?e^_[]jjCr53h"lhI"h*"h"h|f3 j,Qh"WV$u>$jvW s'Wh{dЀ53赵 t^_jhˋ"jqq653h:'#jqVPPhtd@53h $t%t53h"A$2"u"53Q3$$w"w"s$b#QPhP" 3$$ w"s$b#QPh|" 3$$w"s$b#QPh" 3$$w"s$b#QPhȌ" 3$$s$b#VPh"f^53h"j_pWV$u^Vhzd@53* tH$D$PWVh6" $PwwwwVhD"^_%53h%"joUSWV}D$Phd@53蝳 tzD$Phd@53z u53hx"j3$|$\$ t$jVSWVRPSWt$h"+e^_[]f53hg"joSWVP|$uX|$_ha#S|ƅth"Shu+1Qhwd53赲 t ^_[753h:'#jnUSWV|$0t$,1@<_3$1ۉ؉D$h"WV&v qt\$te+$95_31|$7wWh|d53  D$ ;D$t-i9l$sUt$هƉD$l$묅hhPV臒3L$ $b#t4#RQPh"|$ t\ư1P`VvvvvQPh'"H G;|$ ru53h""$t1^_[]W53h"j m53hǍ"jljP|$u1Phd@53ư 3tQhN"XD$ 0Qh:'#jlSWVP|$t$^h#StDh3"#St@h"SпttT$da3 D$dD$ tTj/SWtF1;tٍT$d#3D$dD$,t>\$:t$1\$(XD&@&h(" u1\^_[]h"hY"z_3=3uj=3$333 3 3Yh1"5$<h "Ph"je3= 3u th"0"3 3t uh"t=2uh")ǃ|u D2j=03|$\G1PPL$lQPjWPt2t$dyst"1PPD$lPVjW$t52=03u4$P52@u#$=u03 3 3 $3 3=T3 ɡ2=03t&jQP2 2u[52h#jhhd3QPz2y"48hd3h"2d3=03u'L$dQPY52hE"h`3hrdAP 52h"^h`3hedA52 52h"hd3h2">^$$t(hQP52hO"$$ƒ 3>s1@![Vs ) ȣ3333? 3 333X33\35352=3=`3?w3 3=$3L[V$3? 3) 3>r$r$3 X3\3T3u 22]u1hQP|/ 2u25T3h$$\52102j52|VoX3u Vh+"8 11h\3t1A1A1ۉL$@1h\33 3h3=3u#<33@3 3D3$3 t$\F|$LSSWSjVt$LoT3n 1QQWPjVÖy5T3nT352j/V荤t@UUUU)ʹ3333!!сisL313t!tt3Z3cԋ"3 ,3031&3‰ 4383@31 <31AhQh(3SD i-(3=<3 / ,3ً03P+==w !r%1H$D$ ʀŸw1D$ $}ȹ"3yt3t  u<31I $L$9 (311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$3- 3=$303D$,3t T$$T$3=,3uu 2; <37=3l3_hW""ET381uh"aT3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRUPSt$@t$,t$4t$31K1Kޅ`1PPPPPP =28h;"138LFu=3uRh"%tajhݬ"1 "WjWWWP+h"t҉Z3u 3= 3u3u $31g= 3T3D$tD$|D$h"31N=t 蹵@ 1u"WhVVWP+9tigfff։f53<3L$ȃjPelD$ u h"jSh"y1HL$ Ajh"^1۾3D$^3tB?t=kWUhq"* b3L$ DD 3$ D$tD$D$ u3 <31(3|(.tq<(tk{PWhq" 03,3(3t (BD$,T(2D$ TL 3$3L$ щtT$ <3T$D$,F9u߃|$~O1l$GVWhħ"" T$ L D3$3L$ tT$FЉT$9uT$1۹է"VWSSSP)T$ ‰ $DD$R>q3=ue3$@D$ $#D$u D$ @&1$L$19;ta $Ȣ3=3u3u$3u  3=3t8\3~ h".3~lhא"]hװ"=3u1Ih3 ̬3t h "h"t\3o3e$jt1 3"3t 3t3$ D$ 3 u=<35(303,31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 3|$E9u KD 3D 3D$3DL /X3 \3WQD$lPZ D-L31ۉl$(-D$D$D 3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$03 ,35<3L3D$t$u~t:t  Iu 3 щ $ $3t&=u3օ4$u 3G3tiP3ȨuhF"hV%۰P3tj 3=u3Ѕ$tNL3=3u"Ph{"0hF"Ph"t P3 =P3uQt)$$ti%tyi%1P3ti3х $t4$P5L3h"M=3u5L3hX"1t"13=u 33^_[]VPD$ L$ $QPCh"蟯e3H e3~e3H e30he3MƉ t9tDe3H e3~e3H e3he3 ƒ1Y^h;"j4USWV1=43˃y CS t 35311 uY1ɉNVt11@5C C"t&"Ph"/ h"薾1He^_[]SWVP$2;2u+03u"QhmdPx y h#/11h\3<=P3u;5P3|- P31Puh"V=<3~e1(3111 ,303Pt,(38C;<3|h|".Sh".$2;2u+03u"QhmdPw y h#}.^_[USWVP։蕔1ɉQPU7/ 1O}t#Ë$8ul8"u r1^_[]USWVP։ϋl$=3T+(3 \3tú$b#t$76PSRh"T$=7St$h̢"$D$7UPS\$ Shݢ"7PUSh"77PUSh"7PUSh"詫7?PUSh'"莫77PUSh8"h7PUShI"P7?PUSh["5'1PPPUt$(SRh" ^_[]USWVˉ1u=(3h"T$$8$43|$͉ (31ɋD$u $u <1<)<!$<~|h$b#Whl" ~ L$$D$Pnt1$1=tkH8\t(3=(3"|"Ph$b#Wh"l0fPt$t$ h"GW=(3"|"Ph$b#Wh"ShϤ" (3$Uu*9s~h$b#Wh "Ҧ (3}K"|"Qh$b#Wh"蠦$Ph"芦=(31\$tS|@tj!l;Whq&jjSPVh+"h$b#Wh"(VK|$>)uh$b#Wh4" |$Z)uh$b#WhW" D$|$"3:!3 3 3l$M?>"3&3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$d"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"T $3 3D$HL$LVSQPxD$T$D$PVSUPxD$|$ D$@VSPWxljӸ1=2ƉT$ L$@PVt$QRUxPSW|$LWVUl$lt$,t$,t$(t$@h"股,he3jdh3ޱ |hr#h33\$ $t < uC{ - lm3DAu<-j D$$Ph3f D$$\$ h6v&S3K|$(@D$Ph?"S'7 $ϋT$ t։t=t$hx1&S6 t't$hB"S6 ct$ |$@D$1=2ы5H3jVWRvD$ՋD$D$D$D$D$$t$t$D$$  T$L3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Thr#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhl"M3Vwƀ3t$VhF" 5H3D$,$t$P։ω,^_[]h;"j$USWV΃ twttuƩ"^T$(|$$+L3уD$ ;,3"L$ 03|.|$,T$0 83|$9=43|=3u|$4u 1^_[]Ë-<3~} ʉ$9tw(3|(tk ,3t( T( (t1+L39\$ \$$}2;T$}#=3u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉ3tt  $tt ^"3 ,311 03t$ -<3t$|$$|$}(3] ʀ|(tP ,3t( ;L$T$|L( (9Ή} =3{|$(t ;(3KC 03,3:"1$t=t ,3 03S"=3|$(5@35(3=A1D3@3<3834303,3Ɔ3t$ |$(P39@3u85(3@1D3@3<3834303,3(31Ƀ|$(T$3\$1 5<3n (3|+D$Nu (3[\$j5L3,3)؋ (3P|$(t$ hhj79(3VfǀU@3L$ 03D$,3ƋD$$ȉ54383<311<3u(3=3h""u"}"=31|$(9 @3u85(3?1D3@3<3834303,3(3Ju UPQ$ <31|$(tD$,3D$03543=83^_[]h"j WV(3t^ tڋt֋|҉tΡ(34 <3 QPV\# <3ƀ^_USWV T$L$<3@hPh(3  <3(3~C03,3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR" (3;UjP{ fDŽ;UtZF , M ;M;MU;; ,3 L3T$)ʉUL$  L31 EE=$3 3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M<3 ^_[]h:"jWV1=(3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5lm3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$_!1Kl$ 22uhUPzQ5X3P2 ;2u[jVW52&_!1Kt?D$H5X3#$SUPO 52V52 ;2tÉ؃ ^_[]hׯ"jUSWV$0$,1@D$l$D$D$ $1h"WV," suM{j U5$<; á$<8=L$90{8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-_3)1<$L$jhQP40hl3hedAPd] =3 79l$| 7@f3UjDž\$ t|,f3H ,f3~$f3H $f3 h$f3j jhl3h$f3 ,f3H ,f3~$f3H $f3 h$f3j ט<$ D$tt$b#t]"Ph="pD$f3l3Waf3gdWPV5\ xnu)D$PhwdV\ h"hֵ"V+1^_[]Ph"25$<h"j4 h"h"Mj܈wPhj"h|f37 j轈USWV\T$3< $Su&D$9d$ՉjRPt$ V`[11 Sl$UV5 9 1U\$tL$j@PQK 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4H&h"耐T$l$ 31ɺ 31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 3ŅtMaQ4H&h´"iT$ t tuf f1113|$ 33T$ 3 3f3l$E<$g\$ttXaQ4H&h7"ێ ;B Q4H&he"辎 <$\$t4H&h"螎<$l$!F1D4 "V[ w,hP"VJ w0hc"V9 w8hx"V( w4h"V w"@D$Rt$UWQP赉$71w8$Ћo,1lj1l$DRWt$>"P@PUmaUD$PShG"$SN$#a0QShU"$S"<.Ǡ!w4`&hc"Phk"S  w$ԑ&5h"_<t$uM55h$b#RPQhr""555WRPQh"S}7h$b#h"Sh "55RPQh"SDM8tDƔF1Phķ"S F;E=3L$y"@l0DPWt$hϸ"jT 3{<|$\$W4$)Wh"h"S4$u hu"j, F j/P17t|4$4$)j{USWV\$ l$|$t$1E3ga&33h"WVw h~n3itVn3Ѓa~.btCd 3봃otBs3띃NuS$<331=33mjSh&5$< tHPEuA_3)ރu4t$$V41ut$(t^_[]hn"jhPh"h|f38 jy$Թ"=3uD$ D$@"3t $P=3u {%= 3u "=3u y$@P0+hԹ"hG&jWVPh3"#Qt1ƉPjPWC Wt jPKVBYP^_ÐWVt$|$ VWct$?/tWhc"Vh|"貑^_WhN"jofWVt$ |$7軤WVUSWV $$l$WVSU$ $ hU3WhXa"&uWVh4"jGD$@tF$j$hx&hVV$$$h="薀jwUSWV$$$$D$1 h)"SU $D$D$1G$D$ȃ 1$<&N|w5$<Ft|$`N|Z5$<Fx|$Cj$hh&5$<PS5$<UFp<$h)"SU>  V_3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hn"jWh$jGdPha"h|f3: j@uWVPt$jWV 9u9t x^_Vt$h"j5Vt$V t@^h#V^Vt$Vt@^h%V|^WVPt$jWVU 9t9u x^_Vh"jWVt$|$ VW_t$?/tWhc"Vh|"ڍ^_WhN"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$T$M⿪t׋E4D$T9\$E0D$Ds hƺ",1VWt$ t$yP@:1@PPVVu4u0uNËPhh&Pg7 }D@u hh& hh&SB7 }D@PE,CEhPc%VU\$thPc%Vhں", u]u"Er u$1U; D$ E Džu"Er\$]8},|3D$ t؅D$x~D$x|$ D$xt5Ph"@+%t9\$t h."'+\$xD$x\$D$D$9\$ ~\$ ~tSha"*\$ 9|1} t h"*hW5D3h"֊}4xME0;E4ru0h"*},u,D$D E4t h "舊D$T 1u D$D5 t$  D$($$L$$$E@$D$0D$,A$AD$|AD$4A $CD$$D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$"&(D$D$L$$1۾ËT$||$ |tL3L$$ 3tD D$ W'\$tt$1F9tWh^"'D$1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$ D$xtIt$ )Wh"|f3Py |$)Whμ"|f3Px D$$L$t$}D@tCW0&1@9tWh}"-&L$G$D$$|$tD$|D$P$\$hT$0T$T$WFD$(+D$L$,L$ ʃ{1QPWVth:"j1F\$D1VPSh@"ED$XWVPS(%|$$u1Ʌ|$t1ɉAw1@|$Phn"AED$tt$5<35035,3t$\t$dt$<583543Q5$35(352PWt$L@ƃ|$4tV<USWVӉ $t,|$j W\$ S Q Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ +8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"j6USWV|f31F/WVUhm"XWVjh"GWVj!h"6WVjh"% WVSh"WVj+h"WVj;h)"WVj$he"WVUh"WVjh"WVjh"h"WEWVj h"WVSh'"|V9fD$t1B9| 2I 21|3Iu顴2P3 2~ t1@3@9uUSWVD$921A9|G2SGƉ<$~ SjVr% 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5353$2^_[]V$d3 h3D$D$ p&T$ t$ 25l3t$T$L$D$\$ $_"@$^Vt$FtN H N tNHNfr v V `3^VD$`sH) p3t3 x3HtP4BPQ@@1ҋ3v9t33rh"jtp4F@3^USWVD$T$#253tC=`311-l39| n-l39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh" USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv 3F V>`3 x3 29|[53tFNu 353t5FNHNFy F4VPV`3@`31@j@PNU1@P?F ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H p3t3x3H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^hD"h="h4h"NUSWV}]uuu W@t d31@h31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jR8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdtFchjv vF^_<USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3 53^ft$ t$ wj/SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[hr"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRɮ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h hz"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$Fh|F|F )}F F$9D$4tohj艺ljPL$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$h݈" a$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthW1$2L$1 QWPUSVhjÍD$(Pu S P EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVhjËl$hu P  $P E1PU\$tE|$8t h"^,$S?tU+ ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"@^t$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh")B$  $ V19tQRh"|) 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj"^(h$f3D$(u KHKpStURQPt$DljT$t h" \u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRhЅ" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$L$tI9ȋt$ tPQ$$h"`1t$e\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttF|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ V,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q H4$Q:D$ $D$5uO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWbƋD$0T$UWFƋD$0 u$$$UW ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP螈ERP莈$GW #RPyERPi$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh".D$ H uIM QIM,U($jPsuE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"}D$ H uqqy uu A1҉Q$Q H4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVP[tPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQH4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPct$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP؂T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP%|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP萁 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPj$ D$TBL$?ttXLT$BtJ J T$$T$ QP~L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPe~ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQCƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVM|D$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"9 D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"hz"4USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0xoL$(|$u)n$ )n8F<4$NdiA N1t-t$p 臌A L$H SjQ ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP>1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jPωƉ t,U襉Ftf^81FFH1|$<΋t$  3uN 3NVfF fFLtt\$XtD$ 7Dt1T$R1RtRPt$tPQVhz"h}L$ultDH!!lt1t=RA X jQ脑t9Ftt1t ;T$h"h"jIT4U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ 33uPt7 \$t$`tL//Wa}1}ottP  t1h SVP܍ƻSWp + ^ hjS V\^_[]h"h"hh4"fUSWV l$4E}0I\$8u tȉFSt T$$|DF V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|ttO/ڋLt$t$\$L$ T$D$D$$蔏L$4tI(D$L$$ "\$8u;l$L$4A(I,WhT$L$$D$ / l$u L$4A(I,T$L$$D$  \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$ 蔔 @M A CtE4,$P:l$4E 3 tr\$<u tȉFSt T$$!BF(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$AF0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWOƅuWhu"jN$$<$4D$Phd@Ui tj1OLVhedAU豒 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h+%t$1 Sh"Um CPh8"Uo C Ph"Uo CPh"Uoo CPh"U]o CK,C,Qh/"UEo C0PhD"U3o $@D$t P1-Uhzd@$<W苑 t1 VhedAWp hjUG D$ P$4*D$, 9L$jL$9u0$S11:螮8tx$0h"XHb$11҉ $ƅ*ŰP0Vj PUTZ ^_[]$0h"jaLUSWV81ۍD$4ShPSu|c1NtAljSPSWuW6uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS蟩 h3"#Ut.Pb|$"V(t!Uhm"JUhS"1OUh"l$D$QUPh{%W]tPUh{%WFiD$$Ca2=ouV\$Rw&V{V$( ]hh0"WX ƃaT$,"V1u\$ىjW$( h5" VT$"V$$ h"]V褛輫 ^_[]1ىj=ߊ< t< uGjh#W萜 k2$( aj2WP{W EKu$( 8~y$( 1\$ىj(Sh$PH u$PUh"k "j2PWV E2$( ;(|V\$8"V$( @VT$"Vg$$ hc"h"uD$ $PUhw"S觇uU9<Shh" $( aPWh"Uh>"$( x?$( Z1ىjPySh$PG uSUh"  j2PWU E2$( ;h||$jt\h"@PUW| $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W9L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR Vq-8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh#V u<^Ft t u^F t tW貗PWV觘 tt$hU1 u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPh$$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh3"#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@P聃 t$$$ىh"rC< t< t< uSǕ=$<rLjShD"Sh`"N?Sh"h"t$<L$D$D$L$ oPRtXljo 1tX L@uH~vCtTjhhn"s V躔$^_[]V衔 )UjS D$ D$ CD$CD$C D$C$Cl$Uh&b#VuV u D$CV.)1$<;obD$D$PSh" =USWV$0xjW[ƅ~F$0h$1jUZ~4$hP C9uЋ$4h3"#SǍ$ىhR"$0Sut| uƄ$ $0ph"QU D$$0qh"QPىD$PUPUS u׋$0EED$1ɍ$D$ $PhSW D$PD$PD$PD$Ph{%SD$L$ T$ ыD$E L$ T$ D $A9L$D$uPh"h";}Sh"h" Sh"h2"; $02t$t$h"$@t$Ph"I |$W茑}~14z_G;}|Vk_1^_[]USWVD$(}~;$ ~VE pSrM $PjVWjSVD$11D$D$D$D$$D$ D$h<"u VuF H5$p&D$>j 5$<PL Cr3밋$<$PCrj ha#VH ىVvS 1PuE$ ~S4VH $Ph@ jSPt$VSuVht" ,Wh)"j:ÍD$LPSvxu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BVB} 8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQf $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPd $Ph"Phr"tM"PSh"路 .1$P;$h"Shrt$VW"9;$PVh"d|$$Vh"Kh"jhr t$j=3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQMb $PhV"Phr"~~;$1FȋLN&w &QPhX"襭 G`;$X|΋$\>9rh"n$`>ߋN8LN&w&PVhX"B `Ouet$$P\$ ZSh"h"$P\$;$PPhU" VhE"Sh*rt$  09rh"h"$\>$ThK[%t V苫h "^$X~:$\1j h5$V  "tQ'C`;$X|j 0~-h2"$`>V`Ouj $X1~$1:t @`9u9u$\Phs"衫1@\D$,\$H|$PS$hjVQ L$,9F Vh"VhrW h"1F0Ph"F0Pv,v(v$h"j h&"$Th"תPh"h"Fh?%V9gD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"i$PtPhύ%Ph"C$Tt*Mbi)QRh" j $$XqPSh" ]hJ"$X~n$1Wȃw,\"$H&L$7"!""LN& 8""PRhb"g F`;$X|ۋt$~G$`>G8tu #PLN&w &QWhb" `Kut$h"VhrP>U"tj"Pt$1 E$`$d $jj h:P$QPjV5yjhP$Va< V$`t$Vh"g$XMbi)QR$\VhD".$|$|$|$|$|$|Vh" $\uM4#1wh"L$!r "$PPV豧t$h"!11҉4hӀB9u$b#t4#QPt$h"X=3~S$h1h #91PQh" C uߍ_ j ) rt$h"Vh&r@t$S.#;$PtF""tM"RPt$h"諦t$ USWV`p׉͋$tph"S ,$tSMÃr t1C1|L$PVQIa Ou vu hu Z$1hoVW owt1$0 j2t W9 F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"W8 Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhj%S: tVjh"S: tBjhTB#S: t.jh"Sm: jha#SU: u$D$D$h"PhrWh"PhrW=3t?|$"t"PVh)"艣 |$u$4Х&VhD"j ^_[$oWV草ƿ|f3Ph"Wڥ Vh"W˥ VhW"W輥 Vhx"W譥 Vh"W螥 Vh"W菥 Vh"W耥 Vh"Wq Vh"Wb Vh."WS VhO"WD Vht"W5 Vh"W& Vh"W Vh"W Vh"W Vh"W Vh "Wۤ VhA"W̤ VhX"W轤 Vho"W认 Vh"W蟤 Vh"W萤 jVRhQ' t^Vh$$j'WVPΉ1WPhPPj PQF u^_Vh"Qj9'USWV։ωl$PU\$hjSJ E9C Sh"ShrW VhH"*ssss ha"ss3h"{""t"t$(Ph"ՠ t$4t$4t$4h"輠$t$Ht$Ht$Hh"蜠D$8PhN"艠$t"Vha"l$4Х&ht"N$h":Ę^_[]t$ t$ t$ j tt$h"j&USWVӉύD$(jPV71t$`FFF FFD$h$b#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP,#D$HD$PD$P |&5p&|$D$ fD$ l$ \$Tl$+D$Ty1d&Ph$$j($P芝T$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$Љ&ݜ$ܼ$D$pt$t$$߬$Љ&ݜ$݄$T$xL$|l$xЉ&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<"ShrQ3h["h"UhrVuh}"ʛt5|$d} r"<$c!r"P^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ s u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ |s u$8`D$1@$C`Mu΃<$t $`^_[]t$h"jx USWV$,h@s"8Es"tŋ$0h"7.o"t 3~?-|$h"VS' M~%Hwv$& 33ǃDt*Mh=%5$<蹜3u5$<MD33nNRt 3j W5$< 3L$9&-$<23332j W5$< 2L$9]`33}3nPo-tW"pPT-ujjFQPh7"jD$كL$l$ umt$=l$ 1  ut$)K3h"5$<h`"p5$<h"` $L$L$GȍQw[sV?P:oPl,-G A6PYGu$t L$-AGL$AL$$j=3u"hh"h"h"h"h"h"h"h|f3bP$W}dPh1$Wne bU*yŃ=3u#3MIрK=3u }8$V+ƹV])uV+W !$VVY+DžD$u h%"Xul$Vh֊#h|f3V Vhtl%h$ P;W(yl$`t$Xt$T1ҋ\$މT$̓=3u3MIрs6=3uA}t']h%Sdth2#SduWH(Ņu{D$TƄ ML$XE|&hP$ Ph>"h|f3[D$+hP$ S? ىV1 D$@W'$W,bPhE$Wc $'h|f3jjh"A>$WaPh"Wb j)$WaPh"Wb =3tVh|f3jjh"=3$WQaPh"WBb 6WKTh|f3jjh"j=33h|f3jjh$"I=3ꍬ$U$P`GV`)1;$v7$5<P{3$P`$$1Ehh|f3jjh"<l$WK(_D$h8jUP.3L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h%SO\t jhh#S{[ t ;/u f. Gf./WTZSIZ9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS}WtH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 3H $s-t$$tHfHxt P2)1^USWV=3th$f3jjh"-1jj9#tvƃ=3th$f3jjh"031GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=3tV$Ph"h$f3~ ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph"h$f3s} W_1l$$ttF9u t G9t$ &Qt$h3h"h|f3 }<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"h|f3||EuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3-Q3ǀ3|NAMǀ3EFNDt$h3h"h$f3{1N1@=31ۈ33|NIL33WPǀ3FNDǀ3|INOWP3ǀ3|NAMǀ3EFNDVdPt$h3h""h$f3){C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$h/"h|f3z1t$h3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=3$ WbPt$h3h""h$f3yUt$$t$$|$$WƀH1@=3ىV_bPWh3hU" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3h""h$f3x؃^_[]S133|NIL3t!h3Mǀ3APEǀ3|ONTt!h3Mǀ3FNDǀ3|INOt(h3Mǀ3|NAMǀ3EFNDƀ3t(h3cMǀ3|MODǀ3ECHGƀ3[SWV=3th$f3jjh"t)3=31VWftmxtg 3W sJX tCf{u7=3tSPh5"h$f3tw S\S [빃;=33k53tc~ tWuLfthS"W Z=3tWRPh5"h$f3v Wy\W9 륋v$^_[SWV=3th$f3jj hk"0(3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R3utDh$f3jj"h"',th$f3jjh"'53t$G!jj#^ơ83;3<33,׋-3WV]Ɖ׋ <3839sAWV2ÅuWVh"p\ SPh"h|f3iu c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"h|f3t:K39tPt$ ZU-383;3<33^_[]USWV=3th$f3jjhS"%f03jY9T jj\ʼnT$3 3PQ\D$5<3583J\Ɖt$U9\ʼn$St$p\Él$9$\$<3 839ˉs6f03j8DTk D$;83<3rM\$ -39sI<39583s9-3tS 3E9u<3 839\$ <3 839ΉsZWVÅu h"YSCPh"h|f3r cWV[Ɖס<3 83911 uU9t$D$ rIWV<Åu h"|YSPKAc9-3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5<3583fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3th$f3jjhl"G#FtVPXfvu݃=3th$f3jj h{"#3=31ҹ$RL$QtMƋhtDEt9VP|$ Wd1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3th$f3jjh"="3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"h|f3o 1^_[]fUSWV`=3th$f3jjh" !535353h."hh2`k3 t=3uFFF%)Fu9rV9=3tJh$f3jjh"F 3t(t$h$f3jjh"F 31V9vtRPh"h$f3i 3th$f3j vy$ 9̓>t9߁^_[]á 3tPjt$t$uù2WVIAfF=,3|C03)f8353jQh43u5,3F143PVQ =03F,3^_ù2Qh/"M8u"h"hr"53hS"h|f3hj]WVjh2 1t)h t 8@ Wк^_V83 <3t7#43=@u%o>83 <3t43!=@t^USWV$$$ $jhWV/,43tE1M1 tmjWVS$8jWVS$8t$Shtl%hV`cV<$ (3U Rh5(3DžtGh%P >tSh"h|f3g 5(3DžtGh2#P=tSh)"h|f3f 5(3[Nj5(31jPP6 .+^^$DOGrhPD$PhR"h|f3Zf:hPt$VE $(j7V@ (3u D5(3Nj5(3j1PP6x-+^^X^_[]SWV׉1jPP1F-+FF9tX\$)yWh"h|f3e %؉jQP6-~tF hP6׶ F^_[USWV|$_ OtGhS7詶 GO9}vDty)9|n4 ȉG.uFh%P;;-33rv=3tUh"h|f3d \GP1=3t:Ph"h|f3d %1=3th|f3jjho"1^_[]USWVD$$PWD$x/@th%Qj1ƀ81Mbi)43H1ًP1 t (3P RV85(3At\G9uGSVP9 t5(3Džu*h%D$Pjtƀ8MbE^_[]USWVt$!M1 tFjhRW@*,43t(E1M1 tm`ƋU R^_[]ËD$0LUSWVX=3th$f3jj&h" 3 c5 3jLjD$P] 3@ @h2hZ"h|f3jj ht":~ 4$5 34HD0d|f3Ph5"Vx_ h2h@"Ve_ Vjj)h "e^_[]h2h"|f31CWSjh"#h2hZ"|f31CWSjh"{WSjh"+USWV$ $$jhUV%43tC1K1 tWUVh7"{E1hhW+ $ (3S R(30Nj[~Xl$9|VUW藯 =3uVUt$7 Wu4$j1@=|f3Wh"V] VB0Ph"V] 1^_[]þ|f3535<3583ha"Vh]pB01Ph":|f3535<3583ha"V,]4B0Ph"V] jQSWVt$|$jhVW'$ 431tQ1Y1 t ȃ^_[V'=2#t12PPV V{=2#t12PPVƲ V{^USWV|$\$1 tI;33s9-33QPWSg#DtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;533rWVh"B 33QPWV" t߉^_[]USWV|$u h">W,3u`Ɖˋ- 3UDžuh"z>- 3)ً39w؉9vlj<3|$3WSJ^_[]USWV։ϋ\$ t;=33rVWh"= -33QPVW*{s LK$\=3t%[$tC1K 1 uh"S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W+333F$53^_[ËAP 9ttЋR9uIHËIH h"Qt8Vt$V*33^SWV|$t$Åuh"V,8;^ty^C Fs j/WFGS8*3 3W W*FV86P+1ɅF fN^_[USWVd=3th$f3jjh" =3td|$xh"WTƅu0j90+Ph5"h|f3@T Wh6";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6Tvuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wt[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ 3 $53T$|L$<q$Q Ai(3,3QA 33QA3A$t$ Vjj(QF @t370Phc"h|f3Q t$xho"8V&h^_[]USWV$=3th$f3jjh"e1PPU3 Džy060FPh6"h|f3[Q Uh"88D$,PWy0C60Ph"h|f3Q Uh"7$jS!ƅu h "7SVWH xD$j(PW4 y050 Ph"h|f3P UhH"{7W3RrD$l$,3=(3,$1Չ1 9$h|f3jjhj"jj5353S3jP.3u h"6PjPh%HĨ^_[]f03D$L$ ,3(3D$L$ 33=3u t$(6t$pPh"S6D$ L$$ 33L$T$ 3<)3؅~ڋhh7"Ph"h|f3fI1Fh|f3Vjh"V=V2to=3uf=3ubf$HD$=3t PjE:?Phm52O y"-0Ph"h|f3H ^1Fh|f3Vj)h",V3=USWV(΃=3|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$@ 83=3"t3|f3h|3Qh<3Ph2"W@h(3h01$W? =33 3L$$VPh"W? 3 3L$$=3 t V"Ph "W? 3 83=3"t3h|3Rh<3Qh1"PI?h(3hP"531? 53jjh\"3@ @ue^_]hy"jiWV3s"f03143<383=3Tt/33 t333 33 3 uѡ3Hw}$x&h"]%=3t|$3~$1(3t $3G9|33t333 33 3 u;Ph"$h|f3jjh"e3433@33D33H33L33 3 T3P33h33 3 \3X33l33 3 d3`33p33t33 3 x3|3383<3.3""3 3 <383 3"3~Ph!"h|f3< 3^_USWVΡ3$$D$f03=3u h"m#=3Tt h"T# 3ȅ @34$Åu53h"#$31~3 $r(1Aω~$$39} $O9sۃ<$u9t53h""3u:=3u1$3 $D$$P6\$ $L$E3 3 ‹T$t61 t@53h":"+h3@Su)333!3^_[]USWV}u13393u.=3!hp"!1ۃ=3D$$3T3@3L$L$ 39$$531֋=31 u"$35,3$3=(3 iL$QQ|f3Pht"V: h3Ph"V9 U=3t53h"h$f39 h|f3jjh!".3D$QPh8"h|f393=3|f3$3 1A $t=3tPWh="h$f31 =3 33hQVй 33^_[]t3 PUh="k s-3hh3U肹 h0)Ph"h|f3>1 j%USWVE3f03T3 P3D$ t$ 5@3LMhhh ~jWSu5@3q =3tRD3\$SShH3P ut.ǡD30WSPVh"h$f3O-u1C=3D$ D$t$tD$ P5@3'D$8P5@3=34$t$t$Vh;p"u $83<33D$h?hh =<3$t$=3t SKjSh83 1ۃ D$ D$tD$ PVhED$8PVZEt$t$V蹀 \$ SVˀ~jWt$Vj=34$St$t$hDi&)=3tSh"h$f3+ f03PPP 1CQ=3tSh"h$f3+ 5<3583S 1C=3 Ph"h$f3J+ M0PVh0"f03PPP D$ D$tD$ PVCD$8PVC=3t+d%|$` $t&Qt$t$t$PV4$V0sPShe"0[PSh"h|f3o*f03PPP[ 1ۉ؍e^_[]4$5@35@3|4$V~tf03PPP  D$ D$tD$ PSBD$8PSB=3D$t4$t$t$Ph0"S4$Sf03PPP WV339s0΅t53PVĻ3tlj53@=381=3=3535<3583h4"Vh"h|f3)^_USWV 1D$ 33$L$D$ 3D$=3u h"=3Tt h" 3ȅwEA 3 $ L$u |$~D$$D$D$E Ɖ=$3r11F؉Ét$(3D$tkHL$ D$ 2 9D$ tP$ PUD$ $L$=2~bD$ tP$ PUD$ ;$D$D$ u $T$P$ PӃD$;$L$|$L$D$ +D$ $T$P$ PӃD$|$ߋ$t$9ø$L$$L$=t$|$|J|$~CD$ tP$ PUD$ D$ L$$P$ PӃD$|$~=D$$D$D$] t$|$؉AF; $3^$3)|#=3t)Ph"h$f3& $39}))3tL$a$3FƉ9|׉޹3 uC$L$|4=3R=3t5353h"h$f3~%|$~53h"O =3u7f=3y-=$3~1t$ljG;=$3|칄3~#3h3=te^_[]á3fD$ <3L$ <3}Ph83vQPh8353h"h|f3$j,SWV|$t$38;3vhK"b 383WVP~ 3^_[53h"h|f3<$ jUSWV$$=3t$h"h$f3$ Z$ $(މ4$9{CKQPh"hl$U=3t CU342h"h$f3#tUCKQB+{))σ"WRL$ QP$(虻CKQB3{))σ4$"WRL$ QP$,3BCKQB;k))΃"Vt$RL$ QP$,Ϻt%=3$(tqUh!"h$f3w" \{$(u0jh1"D$ PT tFjhl"D$ P< tk=3th$f3jjh"9(jtzwC@D"P$6C@D"P$C@_"Pj$$!C@O"Pj$$ u_{C@_"Pj$$-!C@O"Pj$$ =3J=3t&$b#;$ t"Ph"h$f3  =3th$f3j H0^_[]SWV|$t$=3tD3WVhH3P =3uWV5@3hp t^_[Ë583=<33%0PSWVhe"h|f3j~SWVt$=3tD3Vt$hH3P =3ujjV5@30!ƒt^_[Ë583=<330\PSWVh"h|f3njV3tuf03VVVC ^PD$L$ $QPh|f3# Xu??\V=3t114Bu11Bu=Iu1@'535<3583Ph"h|f31^SWV\$j/StMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ=3uhVX~x=3t.u Ft#h#Wt9h_%Wt'\$j SWw $ 9uy6h#U$~h#Wxt@h_%Wft.\$j SW" D$ 9uyvh#j聎D$PhU54 u ^_[2h"#jwSWV |$t$ >h#Wt9h_%Wt'\$j SW $ 9uy6h#U$~h#Wt@h_%Wnt.\$j SW* D$ 9uyvh#j艍D$PhU54 u ^_[:h.#jUSWVhi$(1hWD$ P' |$ |$ D$~P1ۈD$$,,jUh" tjUh7# tG99ufD$u\$ tR$,4jVhd%t EjVh=#\ 4jVhB#D 5\$ D$7f@jh0uht$Vj P54D$^ރ9tD$j@hK#P ߉tD$PDaryDpriml$t?tD$PD andfD D$P~DgrowfDnt$V`D defDectsDuV=jh#Ph V54545454h#2Et2tR}jh#V H}j1h3#V >#}jIh#V辿 t6Wh"Sh$$UփOut$ h#b8^_[]1h#jUSWV}\$j S54O D$t"NuD$Hj@PjSPhy#j豉$j$Vjj54rF=tPh#D$D$ D$$fD$t$j VE 0_  9 1L$81qAQQ a A j QV54-D$t$ *jh#E p  D$ @L$jhtjPjQ54h#h$f3-D$t$H1D$`D$L'Ƅ$0VhQ`54m $j D$tPSS |$'y9D$(ȋL$;,&|"@D$Ph=#h$f3胻j GD$$<JD$ D$ L$jhtjPjQ54~e^_[]ÄtH<t<u'54h# 54h #h|f3% P54h#h|f3 hE#]h#jWE 0h#`USWV $ ~($ 1j4hT# ?C9u1CCJt$LUPV CJjh'UVjS54~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P54545454hX#M vL$D$$jh'hVjS54Ffȁw$VhU3 VhU" ƅtL$D$jh'h$PjS54]$f1Ɂw$PUhWh#[3Wh#MvL$D$jh'h$PjS54$f1Ɂwh#2t$ t$ 1؃;D$ D$4ƜF>|$Ń &hK&hPh% ~y)L$a΀-% plj\$ Cut$BT$ҋ $)|$4˱1ɉQD$PS  D$ D$ 938*蚱8\$ L$ D$D$W|$h"S"Dhv&S ;hU&S7hG#S3h#/#Sʢ'h(/#S财D$t$ |$@訰1ɉQD$PS D$D$ 9؋t$8s8|$U1ɉQD$PS L$ 99։D$"L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh,44t2h&2#v 1<==4 ڍt$81 D$ \$phjSh,4PVT$RT$1BD$L4JD4`L$p$QRSRPV4  4u1$PP$w &Qh,4h1#  41<=4 j=Vy9=4 j=VyT$81 D$ t$ hjVh,4PRWS\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP輂$h,4h 2#D$49t 8VhM2#S1JD$ $$Qh0#,=4D$t$= 4$D$D$,D$\$(VGC@D$p9Vh_2#軬0|Pt$h1#|$oQh1#=4D$WSt$h/#VD$ 81ҸD$ |$\$ Cj"$PoYÍD$pWVPSt$ $P\$ E $,4jt$tS7 $,4jWV# -覫0gPh,4h1# B4  4$Ph,4hs&D$ $u1@t$2|$ Qh/#(11G|$1\$ tpupthh#Q!]D$ t$D$t1@L$ ɉ%t.#PQ^Q|$t 芪8t1j t$ Vh4$`St$hM/#FQt$h/#7.l2m2L$ L$ ف$K{8P|$W.D$ t@j QS%V D$ ;$|$8tQtUL$4 T$hjRh,4QWt$O l2T$ gL$4D$ ,41ɍAD$4tT8`T$ Q$QRQPWt~c4  4T$JP$w&Pt$he1#t$L$ $d$ r $3 $tu¸G#t(/#PQh0#|$D$u |$u |$TF1@]%t.#Pt$h.#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/1#ܧ0Pt$hJ1#|$L$lj% L$St$hk/#{D$$L&o1ɉQD$PS L$ 9t 9St$h/#,D$ D$ D$D$0L$0RPQt$,t$$P+|tBD$tUtsD$ |$,4jVPM D$h|$t豦811FD$&|$,4VVP  D$'$D$8|$,4jVP D$p,4jVP UD$1=4D$44$Vt$h/# Ph.#=4he^_[]4$h0#ًt$D$t$$t$Sѕ@9s Vt$h60# S評@D$t$|l1ɉQD$PS& T$tD$pD$ 9t8u?8 St$hx0#Qh0#1ɉQD$PS ƋD$ 9t8t}St$h0#St$h//#D$t$։D$踤L$8`OGL$0d$ rxL$D$nT$oL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl.# jj-={Ph,4h.# h.#hx1#h1#h,4h&#SWVPD$t$|$L$ $QP67ҹ9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSw1Ht$L$ltT$d;WuT$h;W(u QO ŃtD$ppPUu D$DGXHr P`oXd^_[]USWV$l248,4t 4/4Sh,4WmtW,4މ)ˉESQ|$ W&u DW4VPVǑfǀ4/SUmu,4Uh4,^_[]USWVhT$D$A'#IJ&1Ch4eD$ CL$;rjt$V{ ufD$jD$Pjh4V.t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPVWt$h!'#|$$j@WVPVWt$h1'#j>WVPt$=h2Ph"WM 4t5$4Ph-#5h2*D$$PV5h2蓿 (4^_V΅tOHw;s1 4 4te0wPh,4h-#M Atʡ 4 4t"謟0mwPh,4hs& u =4t^jUSWV=4ˋ} 4 4 t u tth$f3jVuk}ti=4|}t j qMO؃thD$VuP#r t$UtuRh"{5p2RhPh%Ӷ bD$VuPq tMD$PVh-#蠶 D$VuPq t+t$ t$ Vh-#n]D$ s*P? D$L$ r!QPhG2$ rD$rIPh&b#QPhÊ$xt$h<$}u h-#j e^_[]Ph:&USWVP=4u(ˋl$ D$$|$5 4 4 t u^_[]Åtth$f3jt$Wi܅4| t j 腴$^_[]uCuWt$h"8 K4$~DN1ۅtPh #t#=4uPh.#9t4C뿃u,h-#ٴ't+ORh"迴rt51t ttt ttth[-#軣 9uЋkT ;$tl  1L$D$Sjh"q {t+1:LtPh-#K G,;{r܃TD$@TL$9uj CVH1A ^_[]h,4hq-#+USWV }=4t D$ toh-#WF|tcZ1ɉt$QVWz  T$$9t8u08,Wuh-# =4j肙11CL$ t$PSQVuu^tWt =41=4u?=4u6L$1J1ыT$1 u#MUPj h-#1ɅRaMUPjV tK=4u-=4u$1H3$3|$ uMUjj h-#MUjjP e^_[]ÉSWVtlm3q~FDx@uAFX@ut9vlm30Dr@tH^_[USWVPω11s6tUVh<-#SUh#Ss t9V6F4$Euuh$b#,Ɖ$t^_[]hH-#hC-#jq&hH-#hV-#USWV\։ύD$ jPj P, 1u0D$F|fD$Y|Uh-#j D$ P語$L$D$ L$/Ph #j D$ P肞[ $fL lm3/LA .sD$ L<u\$ SjPj S膃 E9[|$ t D$ PyVh-#kd^_[]WVth΋u\~8tU~4~`N4F8 I9rPD1F0F4F8FXHr PDFX^_fUSWV\$44h(3#sP\su 4ha"P3xu 4jKb4Jmx &蹶'?c.54芓ha"Pwu DM4=DM433#tM#l$PKrt Pu|Qߋ<-t<+u{uNh=%SPwtGSM16kh83#q4t8u)h?3#q4Pqt 4#hF3#}q4Pqt 4O3#1=4tjh^3#~FP7֛j觛N=4u0j_`ujjB=4t!=`M4u=4ujhu3# C1FVV7=L4uh#502uu\~jh3#B jM5L4f:0BuK@44!Ѓt4M44Bzu=hM4t0譚|hM4jS=M4u T4=R4~jh3#u j j 6GWVt$ y5454 4ut[<|=N4t= 4t|2'V1Wu=WSBV WV|$ Wr@jP9tWPԐ^_t$t$e9tjh3#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@9$4<(4U5[4]=X4u ,4X4UZ=v====,=XAf2 ,4i\4`4d4F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fĩ<D$\4D$L$d$ `4 d4D$D$fD$ D$5[4iPj5[4vU $4,^_[]VPhht@ja t1h3#ktPB$t$uչx%~h4h3#rkt(P# h4 h42 h4 h4u.h4#!kt P#Tƅ~5l4h3#jtP# l4 l4 l4 l4P^V[tP<=4t1H V趂^PL$$p41Qw$& 4#M(uMfp4 x4#44#+4#"4#4#4#!4#=YÉ$4#/ufp4'4#ufp4p4WV׉vu1=4u WV^_SWVPh*4#iPi1Ʌ 2hr%ui;=&t4Qh4t4=4#t4Vy )#4@4#4C4#4L-&4#4F4#|4a"y44444444~ 4N44_%4tƩ<湿#$b#$b#t 4T#gtlj=4I4#O4L4#>X4#t 4i4#!s4#t 4=dM4t8=4u/湄4#43B&4=4u 414$b#u 4$b#⹦$4t8u44$b#@A&q4=4tt8u44$b#b#:4t8u44$湇4# 4t 8t1@ 4$b#1 4$b#4#c%VWWh 4h 4q#e&V5 45 4h 4h 4HB#>%V5 45 4h 4h 4x1&>%V5 45 4h 4h 4#;tlj=$ 4#m( 4 &A#$b#$b#tơ48t,<$1QQP茀 PW肇<$W&i@$h4#, 4<%=2$b#u$b#u$b#48t2<$ h4IQjP PW<$Wh@$$#S>0 4# tÉ4 4y#$b#tƹs"=4u$b#t‰h$b#Ɖ58 4>u +4^_[É⹡$( 4z8{lV t<0 1=4u V5{^USWV׋t$$\$l$;Et*+u(>%$b#t D$ L$M^_[]USWVր9tMτtC1H 41U5h4Wxy H 41H 4U5h4V[y ;H 4|ut$4^_[]Ë 4h4USWVL $։ύl$ D$?h4#W)?SWUI D h VUx $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$IAxt$4h VW&x L^_[]Ë 4h4V=hM4t =4=M4uF 4h448t!48t=4u 0 41B 4=M4u 4h4b=M4t 4h4H< 4=TM4t!=h4|1Fj 2F;5h4|^Ë 4 41B^ 0 41B 4 41B=< 4ug=hM4t =4uN=M4t 4h4=M4u 4h4=M4u 4h4< 4Ã=4"< 4Ë , 41BY 8 4h4Ht$j54Y{ 1B)=LM4tË $ 49th4 =HM4jË 4h4 41BV=M44 4t0 41B5@ 4t-F=44t41BV^Ã=44t41B^_%@ 4t  41B>@ 4t 41B'@ 4t  41B@ 4t  41B@ 4WVD$ #=$2 lj Ƌ 4j"  4j  4j=M4ttV$  4j5@ 4^_WV|$ 1Ʌ<+u OL$ GWa-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%VatrL$PQV t4uRL$x4# $x2P 4#T$x 4#$x 4#w^1J4#^aD$# $2  @ 49uVD$ T$5$2! щ щ! ‰ 19^Ã=2th4#Ë ( 41BSWV@΃=2ttD 4tVsw`tx1Cj S*VGV^SP_GVh\v%P  D 4=D 4!Vh4#j@WWZ@^_[ËD$H 4WV92t#֍|$RQjWԄ1B$52^_Ãw@&ÉfUSWVPt$ P!уtRPtt jh4#jh4#l$$\$|$Q t^tY9uE}㽕3u u;Ճt(ˉ $19u tC ;$u~2KՃujh%5#t jh4#jh 5#D ^_[]1ۅs IQRP踒fVt$t=2tjh95#52^á2xy=L 4uE P 40@#4@u.L 4jhN5#?t [4t2P254)4V1N=P 4t9t/ P 4,@wB$@(@1҉,@Ɖ^USWV=2P 4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`5#1@$qQ52= 9D$}P 4럃^_[]USWV-P 41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5[4(P 4@9@S P 41JЅt8=T 4u/@u1u0@4@ &[WVP 41t[@t @4v P 44@0@{!уt RPF1G)t [4t^_USWVP 4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHP 49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë P 4t$@(@ ,@1HUSWV5P 41H(@$@9t#H1ًP1 u,@;Hs DN4%D$z9tG1؋O1 D$ ~9 $tG#G=M4t @t2x9 @}lh jjtH @1HGG7FGF8~FNOG Fx ~,@;GsN+M4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@H!ƒ5P 4@@2tOD2Q@u;G  )RQ@w u&P 40@4@&OD1@l$1tʼn$yjh5#1=4u 2x~OUQP 5P 4@@o<$t0@D$4@=T 4tU=N4u#L$ Qh$$ N4j2=T 4t=M4u q=[45P 49>tOOHOP 45P 4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh5# +41H^_[]USWVP 4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áP 4@u1I4@0@Ë9t1JQQ 9u@o P 44@0@1@@(@$@,@PPP@[E!ƒtjh5#81PPjt$1E!1WVP 40@4@!΃t@@9} 0@4@^_SV\$t$ 54({P 4h8@jP 4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV@D!ƒtP 4 P 4@P54vzP 4@u@^[SV5P 4@  ˀuH9tPQP P*dž @vv Hu5P 4@uE u@5P 4dž@tV1P 4P54y^[áP 4t@1fWV|$t$ t=X 4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV+tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$b#j4h:#lLh!4h!4h!4h!4\$ -uF :tjh:#]jNbt'.t5!4bt0:wtptcu+!4F&jSh!4 !4jSQ ,uF!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4ho:#J1tPh?:#J1F$2VhJ:#Wh\ 4P(hS:#dJVha:#Wh` 4P ^_[h{:#>JPJj3P21B th:#Jƅu&h:#Iƅuh:#Iƅt]h8#Vqu6h5#Vqu$h8#Vquh8#Vqqt1B5#w1 lm3TA ruƀd 4ƀd 4ƀd 4@=u=X 4D$d 4SVt$ !4M1ۅuD!4;1Cu12(u!=\M4u2 1ۅÉ^[D$d 4ËL$=r!=X 4tP5\ 4j hd!4r'd 4u d!4e!4ud!4ESCd!4Ãw@d 4uQhk:#VPt$ u !4ESCuw d 4u;Vt V5` 4B$!4xPV@,@d 4uPhk:#V5\ 4j h!4q!4^WVD$L$ =X 4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=X 4t'~3P19wKS>~-19s2C,9r9v)CK$SUBuF8AUV o ɋl$u9tSv At1|$jjSOF ~.EFE0uE^_[]V *4t";T2t1FVh!4P/ *4p^USWV\$,=X 4tV*4tgفuH*4J *4*419*Qh*4~-*45*41E4*4J*4*41E*4=*4u *4 *41҅; <2t҉օt1PS;H*$&= *4+"(*4Шu*%=tS *41*4]^_[]Ét$ *45 *4 2y)4!4)É 2n1|$ l9} SWh!4> uԉn$b#t)4!4VW[=)4=!45* )48u!e0 *4$*4tP $*4%MD$P-=-)4E˨ -)4E *4  *4? ǃ*4^_[] *4] v *4e *4)4=!4v!x ux ;|)4=!4w% *4)4< t )48 t *4 *4  *4)4B5)4a *4)48r  *4)4=!4wx u )4=!4\x tQ )4=!4.uD$ L$PjQ课 $T$e^_]Ë *41; *4|!4á *4t @@@ 11Z1PPUSWV=4׉΋$$L$ D$1AyōD$PU#D$=xh3"#UaU3W$ShUn 0jhA;#U  ShUn D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShUm S41PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=4o=82u=h2u =G4P1TAP4@PjVPRWf4|8QZtQL8h"W_É4$pu1ND$PV_ x#D$ =uhV=h4;#a0tPƅdո(2Ex uָX2Fx uhA;#h#Ss^ T$Z\VUhU;#S:S034$VW#WVĀ^_[]SWVhx;#/P/tt;^_[&h#V41ۅt+hV%V4tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%q;#+i;#Qh#PC] tWh;#v.] Y=82t"hi;#h#v] V(2=h2t%hq;#h#v\ VX2^_[^_[USWVPӋl$D$ $uSP1SS1tD$ t}t8^_[]StV믉h!4jPN SPuSqWV)48L$ Ƌ)4 l49}I9u)4xtWD$)4$)4V)48t,t$<$PD$)48uڃ^_SWV !4)4$ l4+ *4|51ۉ|$8tZO\$l4+*4$9|Ӏ8t-t$|$D$|$D$$8u$!4)ȣ)45)4^V^_[V5)4!4tR)4)Ɗ 0@u 25)4A=)4!4"*4=!4 1@^À=!4t8)4)4 25)4*41@á)48t AUSWVPQ3/$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh;#O+h;#@+Vh;#P@ Åt^_[]jh;#Wz@ t Vh;#Pe@ UD uh;#*Vh;#P:@ ÅuVh;#W%@ WV9G t'փtPh;#VX G?G uG^_Ð@*4i ËD$u5Ã<2Ph;#USWVD-4ÅE\$9uz$1ۀ|tisljDDs9u>rjjx D*4D*4$t,tV#hj:} =[4TeuYÃ=[4e4΃e@*4~o6/=X*4u #=*4 t t =^=X*4;*4Ct}.CЃ jS&ed~hh*4 T*4P*4=@*4t @*45=@*4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=@*4i@*4ih?r%jjS\Fc`$0&=4 ]%t#-l25@*4=ES[jUY  xS@*4H݃t =M4-H*4>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 5@*4 h<#9\49(49`4=X*4SX*4C1Ƀ *4|*4ῃ5X*45X*4@*4/U]VsWWr!2@*=4%I*4@*47N4@*4h#jj|*4*4n=4 5T2@*4 }h;#@*4 _gh%y1PPvN41; P*4H*4 T*4HT*4P*4/=4 @*4%h<#1PP9\49(49`4؉ك u. u.S莍i*45l2@*4%aih]%{jVy|*4*4 PZw H*4 *|*4уBЃ@*? !1҃ ƒ!D$Z=X*4,9\4t 9(4h 9`4W jh=#j#t$(VIOVrlp1BsRtM&=4=@*473H*4ЩuH*4Mj5<2ùe=[4Iv_*-t%+q1҃¹) |*4*4S\B D$t1< *4D$ D$ PD$PD$ P萪 X*4tjD$D$-<{|Q<`ʃ=*4tR D$HL$@븃@|*4|$ ^s 8eB@*4emh<#1PPL!ùe9\4e9(4e9`4e e 1?PS1FP@/|*4Ph$b#5*45X*4虤 1;5P*4T*4|T*4P*4n蔰VVA 1;P*4T*4  T*4P*4|4'M1PP54 =lM4 *4 t|7ػT 1;P*4T*4|T*4P*4蛻=M4P*4u' T*4|5d*45`*4PP*41QQm1;P*4T*4 T*4P*4|4|C=M4u5d*45`*4P1PP54A T*4P*41҉3P5M41;P*4 T*4|T*4P*4M4聺觮5T*45P*4DT5M4J@*4NVh<#h1PP5 ùe9\4e9(4e9`4e e /йSE*re|褹ʭl.4l*41l.4 \M4 p*4\M4 (N4 t*4(N4h^3#Cjjh+<#T*4݋5P*41ɸd9 jhO<#=4t>t5l*4l.4p*4\M4t*4(N4j)eD$t Pj{@eJr蘬 L$Qh$$1;P*4T*4|T*4P*4)O=M4P*4u' T*4|5d*45`*4zMP*4jjP1;P*4T*4|T*4P*4跷ݫjj蟷ūD$<2D$Ph;#=4jh;#VR T*4P*4M4 T*4P*4M4P*41ɉ T*4|T*4P*41@Pe(ejh<#e1;P*4T*4|YP*4T*4 諶Ѫ=M4u5d*45`*4Ljj- T*4P*4ʃEݣM4c T*4P*4M4x*4  x*41; P*4H*4 T*4|T*4P*4q j5<2?P*415x*4"5x*41;P*4 H*4T*4|T*4P*4 j5<2RCiP*41D5x*4=M4t5d*45`*4J1=W T*4iP*4me54V?P/V$P*41ɉ T*4|T*4P*41@PuGjhs<#P*41ɉ T*4|T*4P*41@Pk 2V_e!ֹe5M4RPyJ1A诳է T*4P*41҉AQPcMl.4Nnl.4@*4>X`h<#r1PP?ùe9\4e9(4e9`4e e S賁+̲1PP5M4n豲צ1PP5M4jP#'P*4T*4ؽy蟦=M4t5d*45`*4Gjj5P*4d:0ؔP*4T*4艽*Pjj5P*49; eS贔D$D$Ph =#{豱ӡP*41ɉ T*4|T*4P*41@P"etbt3tFu j11A; P*4T*48<#|$b#L$Qh@<#11%P*41ɉ T*4|T*4P*41@P'"e11A; P*4T*48<#|$b#L$Qh`<#je54<h#P541=tjh<#o5l2@*4nvh]%1SVUh蠻Ag54rSPx]M4 l4݉P*4 T*4l.49‰}P*45T*4)‰l.4+4eM4 l4P*4 T*4l.4+4i1T*4P*415M4QPHFjh<#H3D$Ph<#d ։u=h*4tP*4 T*4h*4e,5h*45P*4tI~V8Jjh;#bUSWVP趮ܢGVD$1Ƀɉlj щ t.4p.4T 4=[4uH9ljD$u21xUUjn6 9-[4u;=p.4t.4D$tT 4 [42t8teue^_[]USWVPӉơH*4uH*41 r4$0utV4$#H*4H*41ESWPO áH*4 H*4 x*4tu1Fx` sKu j]j%u0SW5H*4 áH*4 H*4 x*4ujh=#t 4$4$^_[]WV=2u=hM4t =4u袬׮t 44!ʃt]54QY+4u =2uP5TM4=T 4TM4T 4u _BLE5TM4=T 41jPPB ^_SWV|*4߾WX&t#@*4/ V+=*4u V@t h=#t u]%%P1+4PP^_[V蛫ơ@*4"~S.#V$^%=4*4VPujh?=#  tY>!t *4t P\ V!*4=4M*4.h3=#qF<+t< t 4t Q V菛4/7E=4V蜭h9=#Pt% =4V^XP*4^(N5P*4jF5P*4jQP軯^5|*4V5*45X*4X*473H*4H*4PV4h3=#h$b#r^SV H*4t s7@*4ZbH*4shE=#iH*4 shP=#QH*4 sh\=#9H*4thh=##H*4 shr=# H*4fyh}=#H*41Ct$‰sSh=#jV3VH*4CuϹ"t% s=#Q+4^[fD$=X 4t@WV|$ Wjeƅ~WhV ^_USWVt$0l$(|$$t U ,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD X 4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f *4 *4 *4 *4USWVi $AD$)< u?FP貛^tP 9~q>#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h=#htjPV jh=#h=#htjh=#h=#hjh=#h=#htjh>#h>#h^Vt$ t:j jr tL$HΉp *4*4jh>#荞^Vt$ t:j j- tL$HΉp *4*4jh4>#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVv 1H^_[]hY># t8tMjQP[ ƅuh;#t98t4jhi>#P/ ǍEjPW W iUUUSWVP1F=4jt$膃P#19jV n1PPPS !ƒJVWS <$S11 ?$:81xM'x+xG1O|E(|n|dȃ|$*4t*4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S贂1N^_[]4$ |t|uVP11xtɉSWVh*4t$b<ƅui\$h*4e5*4PSh*4I5*4P|*4t*4h*45*4p^_[ËT$ *4t$USWV։ύjOGT$9sP:8uu#,^_[ÃD$ Qh$$USWV\$01F9\49(49`4D$4$1t$ tÈ\, }D, *4D$Piurȃtu(vqle1A^_[] ƒddr$uAruuu.dt)D$t>P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=M4ÃB1ۃ=M4ÃCɍH9 h4~Pj#|k+4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=M4ÃB61ۃ=M4ÃC%|$mu9h4~HPj#j+4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPjD$X9vpG$11Ʌu2~>9sWt$V2 t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQ\t1=$N4ƃtEuG%t|Qh?#hh&AVh$$6 Eu ?=u Qh"@#$ u 覣!ƒtVHQh@#^Ã=$N4t$4tPP&t54ËD$t54PF$1PUSWVu1954O4t_jP%=4tJtWg%W"=4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =M4uID$xAPt4D$8\$Ph>#FًT$WVt$j 1@t=4jWd$54t$V$t$54g$54$h454#4t$ t$ ۨ8N4= N4111[4D$4PD$#V^t%V jP5T2 V6 =M4t~]t$ 1e^_[]h^3#SD$tjh>#S\$tXD$L$PQS\$ ىD$tL$L$|$t(h#S1Ʌ D$ \$h#S{t^h>#\$Set^h^3#SStaSOD$ te\$ Sh$$谎3# L$Y*4D$D$  D$D$ D$D$ jStD$xh1@D$ =M4Vs t$ D$ \$Ph>#ӏ߃Yqt$t,\$SL$ Qh$$D$ 00 h4tjP41UV=4jV訔#FtV54]hbZ54t854|54PVHj5414*4*4*4*4e^]ËD$t jPUSWV΋\$l$t׋L$2VWW UnV 9u jS^_[]WV.|$jWrOx&PVs=4u8PhC?#ƃ`At;DOtjh?#ՃatdtpouhW蛳2+j W r21jQQP!¡2ty'Pr28Ph?#肋^_USWV(t$<41$tjP4$|$ VWZD$ wD$t$D$ t U9Hŀ}mt9UD$PD$PD$D$t$1D$t W|9sLHǀt9s,$jUuWPhWе Uڃ,$C^_[]SVt$ h#V1Ct'h^3#Vth>#Vn1ۅÉ^[WV$ VtVWVtWt^_USWV 1=M4]=4Pj\h"<#1Ƌ|$ 11@L|uM@-u)Fh#W)1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$P7 W "S 1tXt^~u1O\$$D$jPW_b uQD$P4D$(0#^jh@#4|1 ^_[]ÉOVbD;t;VPD1|$rɅuŋD$(>#1O;PrSJ USWV=4t^_[]j荈h@#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh@#U{PljD$UVWS\$,8jUHrS\$SVUP| 4$b SY \WG VC V|V$Zo#N@ |^WV|$=M4taPWo1=M4#D$=W*jP`qWPhP2LPWnx#D$=@{WjPqWPh@2Vm WoƉ|^_V|$PVx D$XT$\1jPPVv|^UWV蒊lj54# QPmt1GL$ T$3*43 *41@ u,L$3 *4$3*4 u!tL$\9|$X}e^_]ø'A#Vt$V9vHx/uAΉ^fVn +41ы5+41 u^ã+4 +4=HM4t^6~^P~SWV1ۃ=T 4t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=+4t+4USWV-N4~ON}=N4~Q111SWuljӉ:}qF;5N4|؃=N4' =N41=N4|=h4111;5N4| V|ljՉ!<$=N4FD$1;N4ál4D$ 4D$l.4D$$l414l.4PPSUt$ ljՋD$ l4D$4D$l.49pt$j pF1Mh4H91Z{1@^_[]Vh 2F;5N4uj{ t j2^USWV\$,=+4t+4&|$$t$ l$h4t  $9~ |M4$x 9} H9$!tT=4N4t M4tC8+41҃=T 4TRQPWV脘WV Ɖ1ND$(D$<$=TM4t7h4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=TM4tzmz1@D$/1@D$=|2uu=2t hTA#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 4t)!u =TM4u=L4u+4=L4t Xm+49l$"h4HPj-|1Ot1E1=N4~1VV|{~ VVVD5 -T 4t <$tw y|2j@ ^_[]USWV=+4t+441=+4u!xM4y=TM4t h4'|$t$;D$||$$t D$9h4~ =N4É!tF=4N4t M4t08+4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=+4táxM4y=TM4t h4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åth4HPjytm=T 4tPay1u11FUvUVRPVjv!уu [4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V h4~&111RP!уtF h49| 1 h419^fVt$tsVGF954u#1=2tu1Ɂ2tщ 4AF=2tH +4v 9 v. ^% ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá+4USWV\$S@Nj522tv W6Wo |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@+4VEESËnU9Ë\$sU SKeFW謥 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t Pפ w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=l.4jjPWV^_USWV,T$Dl$@ظBӃ=4N4t  M4t08+4 @1)ʉ|ЉjSUQP虊كQP4v=pM4tK uu|| t u+| t u[4tt[4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t[4ǃ݃ tkwRPW v=M4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N l.4 CfN =l.4=M4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1hM4l$t$1E1!1M,^_[]Ã=M4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdA#c^_[uƉסh4HPLi11 u^_[8iWV!Ӌ h4It*QRP4 h4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhB#bKy1V[hVjRPUo=M4jusj'hD$ jhD$T$l$ !Ѓtd9}\h4H94$SW!уRPvlj9Љ $Ah4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$h41VVjt$t$PY95M4^_[]1K16-+4-+4h4H $)QUjSWP(1K[6=TM4tf"g15+4SW=gh4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9,+4QE#>$4,$tt=t|<9,+4|wC^w \$D$ShE#jW$4,$*E#f9,+4u+9,+4}9,+4t9,+4hu_G t t1"~#ut|\tt t tL@?3~|$j=WL9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuE#$b#6$4t$ t t_G칒E#$b#$40tUPtuE#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV $+4^_[]SWV׉Ή5(+45 +4h}E#hS=w )WVRQ$+4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^0+40+41+4JtGtO GO 0+41+4l2 t0+4u0+4^_[]ÍZ w6$&tEGЃTZ$&btPeu>f0+4랄tGOm>"#놃>$#w>K&h> &YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]0+41+4d   >0+4 0+4 1+42+46+4RhE#jh0+4xE#0+4_t>$b#vVhE#<-4P+t <-4Ƃ"hF#蹻@-4Pt @-4F#jVLD-4jVLH-458+4h-4h-41-4PҎ $u.4^1|$á.4 .4SL-41-4P-4 D-4H-4 P-4P-4@P-4;L-4|1ۉ.4.4.4.4 .4$.4(.4,.40.44.48.4<.4@.41H .4.4h-4#h-4-4P $u.4[USWV\$0l$,1=M4uSUƉסM4 N4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| @.4=M4tU t@.4-4Z-4T-4l-4M4 -49}Q-4ƁT-4 l-4ك=M4WV^! tt$j VRP)NV覼1 M4)~$-4r5-4ƂT-4 l-4Iu܅~+1ɊT 5-4~=-4T-4l-4A9uס-4H -4ƀT-4 l-4-4.4^_[]Ë M4t M4=M4t1M4@V5L-4P-49}9 H-4<u"D-40Ph-4 H-4P-4F9|Ӌ5L-45P-4-4.4^SWVt$\$u$D$0j?oPa/=X 4t&v!Ss1҅ SVqt1҃Pn1҅t$StP-4~- H-4Vt[uH-4 P-4LV3Zt P-4t> H-4VtV[t'i=X 4tVs1҅ƒK1JFVY# 4#4#54#4‰^_[QY# 4#4ʉ# 4#4áP-4D.4.4H.4áD.4P-4H.4.4ËL$1wQ5<-41SVt$ 1ۃw)V5<-4ʔuV5@-4跔1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1F#9u!B1@uDA;1A+u%uVt1@^ÃwV5<-4דu߸ع#L$1uj jE1ɉHH SWV=0.4 u|$t$\$t-1 |15T.45P.4tm1@Z ug0N4t \M4uU=(.4~+\.4 X.4\@`.4(.40.45P.4=T.410.4=X 4 (.4%=ua`.4P`.4d.419Rhd.4bmhd.4md.45\.45X.4\.4 X.4H `.4(.4u"`.4d.4x,1WV=X 4t `.41At^_[ÉШu-%=tS0l(.4=\.45X.4뢋\.4 X.4`.4(.4USWVӋl$,|$( .4=M4x.4uBu>%j jzC1҉PPx.48.4 .4 .4twQPl'UWS x.4xt<.4Ph-4蔅1x.4 .4u+(N4t\M4A\$l$͉=X 41؋5P-4D-4 .4Rk5P-4UWS% 65x.4c x.4-4PV軄.4@-4VP诅V荄 .4AVUUUЍ@@.4.4 l.49}oh-4藅ơ.4 l.4Y$gQVlu&D-4P-4PjVPm$.4$#5D-4-49|P-4l$ EVjUek L$ )v %uh-4蚃5x.4" x.4 P-4; L-4 5D-4|tq=H-40jf jH-49u"_l$\$u4Шx$_l$\$u$5D-4 _ ‰$ u*,N4t =\M4uKuG ڃ^_[]X 4m_uiud1UWj.4+-4 t28+491J$;<+4} qɉы4@+4)t _D-4\$ PjSi 1EL$D-4) P-4PjS`i ǡH-4 P-4tW4V).4~Z$.4t\ [5x2)Й)֋$F UWh?r% N1 .4E1- .4$_PdtUW ]X 4t6=M4t-QdtQd UWl $UWS t1@1^_[]SWV=`.4~4։1d.4Pd VW u C;`.4|1`.4)^_[Ã=(.4~\.4 X.4(.41WV=(.4~\.4 X.4m(.4|$t$ =0.4uu 15T.45P.4itb=M4tY.4l49.4|.4.4.4P-4Al4 .4H9.4}M4 j M4M4jf=N4.4tL@.4tBx .4 l49}; j,.4P .4 l49}@.4ы .4 l49|L=4tC4„u0=M4t't4|$t- 1j1j 1j5P-4958+4 uD-40H-4^_V=M4uajm5<-4ZtMȺj94#Fu=<.4u"Ⱥj>F#Fu^SWV։ˋ=P-4GP-49=8+4 uD-48H-44D$ .4; .4~~ .4P-4.4 .4^_[SWVL-4 P-49}1T$5H-4ׁtu Ӊ P-4@9|^_[ËD$L$ T-4l-4VD$ L$=,.4u=M4ttNI1҉ tK1G-49~l-4T-4+5L-4)΋ H-4 D-40 ~^,.4.4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8[4u/8+4H9| Qu@D-48GO1H^_[]cS D-49t D-4Mtۉ>?SUSWV-8+4\-jSr jSr DžtVtRU5D-4V賎 H-4UPW螎 Uy 5D-4y 5D-4=H-48+41t Wx 1Gt Vx ^_[]USWVL$D$ʃQPO1H…t$=8+4D-4D8OlV tn[4uc~D-4>-8+4u@D-4 (I=8+49rHŠIJD-49s=8+4)\8OVà uQL$ t D-4t=8+491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= VMw 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15l.41Kl.4|EtESSP tl.4@ԋ=P-49=8+4 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=M4u1@$5.4+5.4~1; l4^USWV։L$|$0\$,Ѓt$.4!t6tC؃T$RjQPWSQ=N4=8.41ۀ=4.4tw4$4.4 .4ىȺVUUUЍ@)I-4~4,I-41E 8Vt$0j* G;}|Cu4$SG @.4tf t.4p.4!Ƴttt$,9} 5p.4=t.44.41ۃtQD-4 P-4T$ 1ۅ~&L$ PjQ\ P-4~H-4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E.4;l.4uX.4# .4uD$,.4= .4=-4~01-4 8jG;=-4|h-4t.4;.4~<$~.4 P-4 .4$.4~1 ;j_G9u.41;l.4uD$Ph-4tP-4 L-49~~51ɋD-44*1 H-4444A; L-4|١P-4) $ .4P-4 .4; l.4~(M4 j.4H.4;l.4؉^_[]WV|$t$ =M4u1WVP PV WVt1@1^_Ð.4H ȁDG4r1DG4G4.4G4dG4G4 G4 G4G4G4G4G4G4G4USWVL$0D$,l$$G4$G4G4t-9Br }$r1z3|$( HG4u$$rG4t :=G4G4G4<$:rBJ jl$(jWG4tC:G4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?G4t_ )ϋ,$]}G4tG4tV+BJ NF=G4uW-G4MEu$9ˉ|-G4],$ϋ=G4t sKӋ$JHJ^_[]USWV1=M4tD|$(T$$!t3|0G4G4=G4t'9PH }=G4u11CŋE1ЋM 1 u ]u,G4G4G4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}[4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[[4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStG4 11؉^_[]Ã=G4xÃ=M4u +41M4Ph>F#4VG4xNH G4d|@G4* G45G49|jhVF#z5G4^USWV|$ l$1ɃG4G4tKC9⻌G4G41 G41 5G4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9[4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R[4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=h4~%GW8É!Ѓu O;=h4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhA#2.41111ۉu WVSU1PPWV+[4u Ɖ!Ѓu.4^_[]WVT$D$ = N4t 5N41)|щƉ^_fUSWV t$ >-uF(s7h]%+V+h"#+艣D$1S6]+S)S\^S?Sjy W"h~#À8t>tkV聪tmSʼnD$e$UY $ȃ$jP'袷t$PSh%t$Ut$g  Sa'Ņu>tVha"F'Ug(Ug j4WKW"1FVJ]V'D$$t*P*hoF#y*/j ))3+4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhF#.1N\$h"S4h]%Q)SH)h"#;)3(1S|&S[jj 71KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhF#1KtL tGf;t=ËFHN~ ;F~à tQu VSV1Vj L1GWZWg%e1=+4VZ^_[]fSWV1G41K4t 5u'#ar'G__ _Gt Pvd GF6u^_[ËL$ 1ɅV-$t:L4'W.t7^uM4L41L4L4L44 M4L41L4L4 L4L4t Pa L4Fu,~1S薺PW豺FvQa ^F~ ^v;4t PNu VSWh ^_[ËL$t@;4tjhF#x)1HËA QUSWVD$T$1ɾG4=49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9L4u L4L4uUSWV\$SκƋL4t@PPV7uL4L4 ` DžL4W ` u^_[]USWV=M4|$,t$0h#W l$L4L4!ʃtWj UQP"L4uL4 h#V腓tL4VUL4PhF#Wsu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=h49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P^  $FQF^_[]V=4tjhF#&dt$D$tt/uKV4;m?u7=2xCjh3G#뵃=2x%4QhZG#l&^jhG#jhNG#{Vơ4t P] VޣP4V] 54蛙 ^34VD$$L$ t tC8.@L$$VhcU&Q 2>jhhG#2xxPhG#j VV.||P|0tB D$0PhG#;D$$VhcU&P >t.jh~G#1M4L$QhG#$^ãM42V2x$ h41Vh@BVPRQ_M4^VD$$L$ t tC8.@L$$Vh#Q 2>jhG#2xxPhG#j VδV||P|0tB D$0Ph+H#;D$$Vh#P >t.jhG#1M4L$QhH##^ãM42V2x$ l41Vh@BVPRQ&M4^V|$u%t$jVt0PhOH#N#^V|$u%t$jV؇t0PhlH##^SWVD$L$tPL4p=4tjhH#"VP>PR Zt V踘)X!ЃtV谕5M4SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PY VӟP02VY 02QhH#!^V|$uJt$ =DM4tV4-L4h%_V_h@^^WVD$t t0t$R4l7=tDMtGhuXF 2PXM4R4Qh$$5!Emtwt su!FF2FR4FR4F$27vX V^_D$u5M46Ã|$"7VD$Hs^\jhH#7<2V)hʥ$&PhH#hH#V;2xu'hI#h=I#haI#hI#hI#hJ#h7<wVȃ=M4utjhJ#$FVPMy0PhJ#^_ÉPhkJ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;8+4~<+4A9s } uE9u9t},u E&| t28+4+4+4x2 ^_[]WVD$Pt t*$TV!PVLD$ps D$ stopD$Tab =t2|i1Gt$rVنfD,VɆ4<+4h&b#P5 G;=t2|V蝆D andD theDen t$Vx5x2hJ#P5 0Ph$$D^_à D$t t+uyL$tJQtQytWjhJ#Mà$2L$%2AAD$PhK#!%1%2$2$2%2 $2%2 V D$t t]D$t$jhZO$QVP46h#V&t5>t M4 $M48M4tP9M4#L$QhK#O ^ËD$Hsjh5K#/Åu 4Ã|$u=M4D$u =M4~GTM4ÃD$ u)=M4| PhFK#M4ÃD$ u)=M4| PhsK#M4D$u"=M4t=4t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7QhK#V D$,L$(t tC1ɉ N4 N48,uT@L$,t$Vh~$Ql >tejhK#Ot$5N45N4h?$jV0PhK##t$D$,Vh~$P >tjhK#9 ^ãN4N4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$&d~&s wR$&s wU$&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GN41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&L#1QZSN4^[ÍD$Ph L#҃=M4=N4=N4Ë M41 h4+N4t$4Ph}M#hL40 L4USWVl$,H M4t&AUjQD$}ol$,7F]$ &|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}M#hL4/ L4FVEŅ8D$EH$t&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=DM4nAL$,9 ItIT$uWoD$,7L4j+o2Ph}M#L4V- T$jV%D$,|$?+4t P L GP 4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WK |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhM4P M4IM4^_[]É|$|$ u D$PhcL# D$PhL#͉-M4ōD$8Ph9L#uA0h|M#j*hM4ݣËI1PhM#j*hM4£USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0PhM#=j UQ xt-u)%tt0PhM#1H^_[]SWV9toӉQ;|@jP ljtG\$=M4t <\u ~t F <$t)\tPS?Wt GFFuD$QhM#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$M4PhL#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h`#3rtP~21@USWV\$(|$$1E=1C4$$N4u V WSCu ^_[S=R4tR4 \$2=R4r 2H 2R4[V52N4t(N42VP52T 9t +4^Vt$52^Ã=R4tR4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVmي,`#O u݃|$0xG-Wt$8ތ ^_[]USWV\$8T$0t$,11|$GUSRV(mي,`#O u݃|$0xG-Wt$8o ^_[]SWV|$(L$$\$ 1Ѝt$F,`#NuxF-VQ"^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$PEj ƃ^_[]WV t$RVQ t|$P3GuVi^_9Hw @sÃtP=USWVPt$|$R4V<$=M4uԇTh=4 pF#Vt$ P]Eu 448JMp;5l4| +4^_[]VWj .^_[]ËL$T$$b#PPh=`# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuR4^_[]WVt$|$ zt!2Ph\`#PhV`#$b#PPh=`# ^_WV|$t$ t%WVra7ft=l4 +4 j Qu jF^_fUSWV\$l$=M4u<؉%t1UHg1GWP?[PW1WPPUVd[1 jj1=41Ƀ=[4HPVWEQ Åt!W4 |$t8jht`#'D$ tPXD$ 0Y4 D$ 89t VB4 ^_[]Vt$tPX64 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQt ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u QeD$E ʀ[} M4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øN&fL$tt"u$ h4h4HI h4IR4ʋTUSWVD$T$ h45R4|1Gll\G9uTD^_[]SWVD$L$5h4R4|F|\\|N B^_[áh4~Ph5R4ao USWV h4; R4R4th!t 1G31K;)1G1I4:tl!GtˉP0  h4jQJƣR4h4R4~PhVn !t\l^_[]USWVPL$\$As h411H$(uh41@$1R4<#|tZR44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$R41H; t$z|#=h4|O1;Ll |C9u^_[]USWV h4~.R411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5R4A1G1֋l9߻rB9u^_[]ËT$h4!х1A9Hha&*R4=DM4&t&P R4h&R4h&2h& 2hP&$2USWV \$4Z4R4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$L&=M4EQ-s4C$ىË $Fw$&#Fw}$&X!уj WRPBBtDt L=M4!154h#P`1sTu~-M$PuYQA tLу|=RP螽1 $1=Z4R47f1=l.4u ÊCCs|,v, l,uȡ4!ƒtظ:,u54资j W5l.4QTу h45N4n9|$ V5454蛅PtmƉV+ +1+5Q ic+Ɖ!уRPUVZ4=R4H8 Z4H=R4wA54kP豄 !уRPaٹ N4 h4VQRPZg 454,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/154Mj WP j W1P9;p"@|R4$b#9 Z4t R4$b# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5M4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5XM41=DM4tȉt 2R40A4^5$2'SWVQ|YNjZ4عZ49r ЍZ4WVS45 ;Z4;^_[VQ!уu$x h4H9}FV!уtt^^Ð1Z4Z4Z4Z4WV|$ =+4t5Z4tZ= 4ta=h4|<1W!уtRP虆Ws@Gh4H9|vuZ4覍5Z4^_USWV 22D$L$!ȃ2D$2D$ 1H2222= 4=+4t4$=h4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$h4H9|u $u^_[]Ã^_[]鍌^_[]TZ4K|$thZ4m=Z4t1=Z4Z4j jh`#"V΋At P$ FVC^hZ4SWVt$>t_w P$ WG$ ߅u1F FF1HZ4Z4Z4Z4^_[hZ4SWVQ1u(\$|$Z4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-Z4Vt;xH|p$x Hȅu^_SWV|$t$u;Z4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=M4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^Z4U1tHt$ !t Q9y}1I(t(t$=4N4tT$$1=Z4uȅt^_[]hZ4Z4=4N4tUWVjW7!t"j]jRPWV je^_]Ã=Z4u M4[4Z4d Z4Vj5<2t2Z4jVx 1F=4N4u=Z4u@11N^USWV(U ]1Nt$ t$tr:tm1Z4PSi( 4N41 M4t)1V5Z4hZ4 4N4M4ttxq @3Z4 4N4t =M4tj)4N4u=Z4tZ49Z4J\$tP1ػ&!Ѓ1ojh`#D$Pj@t$>SD$$PL$Qt$Tt$V>[4$u:Z4 Z4!ƒt&9L$L$|D$;Z4D$Z4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dZ4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5Z45Z42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=4N4u?hZ4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ l.4L$l.4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$l.4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8l.4+4t$ t$  }tEL$L$H1USWV8=Z4Z45Z4Z4D$$8u=[4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}Z4 Z4ȉT$!Ѓtsu!9t$ƄuYZ45Z4;t$T$$|@Ut$ 9D$ЉʋD$4$8+4@EhZ4hZ4}!8+4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># Z4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=Z4Z4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$Z4 Z4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ Z4D$Z4D$$Z4D$ Z4e^_[]1JЋ4$|$9ωL$}@D$ 8+4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=[4 USWVt$hZ4tH>tC\$1EjU1GGGUSxL[4G=[4-5[4t~'V u[4+4^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5Z4jjSt$DPV5Z45Z4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@c4Ph[4vfUSWV T$(\$$t$ 1`2PURS")ˉ<à uVh$$KKt$|$u u)u%u!1ɃtsQl2Ph"c# Kt Dhd#~^_[]SWV \$ hSh@b## uP-thc#~ ^_[*xEhSha#o# 4$衟t t$葟j Vhc#뙿 hBl W/52t$S jW.|$Woe[9uR1Vt$4$jJShc#}V@WV|$ 52j/Vwt@jWh'A#QVM^_1@c4PjV.ÊD$,f3J ,f3;j-Ɖ׉U]~*9u$h$f3QHEhc#Dv11f=2tj)RPhb# jh\d45a4Ԕ 1hha4VW WV&Wj&^_[]j58a4W 1Sj&SWy&VVhb#AS8USWV$,f3J ,f3;jMƉ׉U[~*9u$h$f3QFEhc#dt11f=2tj)RPhb# jh\d45a4 1hha4VW WV$Wj$^_[]1W58a4j58a4S/Wj$WS$VVhb#?W6USWVPh d#{s1GWjM$WjB$9tDƅtZWZ9uhd#,s1Vj#Vj# ^_[]h|f3Wjh#hb#Z1Sj#SV#-2j/U t@SQUB h|f3WVh#hb#WWVPjh`;$5a4K f=2t%52>t=a4V'PVW 1FVh"#5a4 |$VW5a41 ?nu52hb# > ^_VPjPVhc# t=a4u.5 2VyVh c#=hd#qP^Vt$j5a4&VtVhc#{=hd#nqEj4WV5,2t)>t$=8a4VPVW j͂j{VhVh+c# V2t$2jh:P$5a4褏 2u2$2%2t$2t$2f=2t52t$$52f=<2RF#tn"Pn2t$22d42t$2j2t$$2f=2RF#tn"P^WV,|$8V58a4 hn"W^t! $#ha4 $ ha4ha41GVW58a4^ hha4WjN8^_WV,t$8W58a4hn"V1Ʌ#G OWj58a48^_V1Vh{t 58a4 j觀Vhzt 58a4 ^S\$1ujP`[ESWV|$\$1FtCWPt1^_[fUSWVl$$1td4`d4$`4%PhP2hme#t$4Uu1I~1L$$D$=_48O>HЃ sX 4HЉ5$`4jhP2hme#t$4U ߃ufH1K$&$<td4뷃EF$<jh"Se jh"SM h#SD$QPuV$<h%Shi#Szh#S$_=_4$<(a41@D$<$XD$d4=`d4$<j/S`d4k<$$YxD$ P1PhPjPP5$< $`4L$ !P5$<he#QBS0a4d44a4=$<W*Shmw%h`d4zk 1@1H1HD$1@$D$~1HD$$_3)t5|$L$(4hI%Vt5(a40a4d44a4 VjVjVjVj_45$`4hif#j Vt5V4$jh$f3N#wT&P_ D$tu1=_4 1A111ɣ<2 222=d4t 2=0a4t5$`4 uW6uB=0a4u5$`4 u3^_[]xVh%f#Hh}f#Ahnf#:hf#j蜻5$`4hf#!he#he#hDf# he#he#jgh|f3jj@hf#j,h|f3jhhf#tjz,fUSWV,|$@h jW^1ۅ_4=0a4h_4Ou.j K1=4a4ȍPU8a4j8a4x3=_4u?jP 8a4teQ轉8a4Uh$$_4WŅ?1GVj'=_4t1O,^_[]ÉVQU=4a4uL$ @Vj58a4 1Vh t 58a4 Vj1@_4jh_4NfWVP=`4t 5`4t$uhni#oƅhi#Xt8/u22i# P腰 Vh2P %1&9uQPt$A `&uڃ=$`4u%h$`4hu)$t$蛽 u $`4%hd4h %t$v u d4=d4j:hi#t$訰 1Ʌuǡ`d4u'>/5`d4jV8`d4td45d40a4d4=$`4u $`4%d4Y1ɉ d4`d4t=td4utd4t =(a4lj:hM$t$ 1Ʌ d4=0a4u6td4t=d4tP5`d4> 10a45d4j:h4A&t$| t 2j:hHf&t$[ t 2j:hS.#t$: t 2j:hb#t$ t 2j:h%t$ t 2j:hn#t$׮ t 2j:h#t$趮 t 2j:hE#t$蕮 t 2j:h"%t$t t <2j:hV%t$S t <2j:hh"t$2 t |2j:hM$t$ t 2j:h#t$ t4a4j:h #t$ҭ t 2=d4u d42=d4u d42d4tPh",d4tPh2"d4tPh(f&d4tPha%hd4h.j#t$˹ u d4hd4hb#t$覹 u d4hd4ha #t$聹 u d4 5`d45`4`4t%j,VtA1ɉ5`d4 `4^_Vhi# Vhj#hsi#jUttu$Vhi#>hi#hi#>jk%fSWV t$ |$6Q `4!`4`4)`43h4j#Px`4VW8=4a41hu+t$c4t P Vyƣc42h#Votsc4hi#VStahB#V?tShU8%V-teh%Vt1|f3Vhk#W, Wc4$11ɺ20 ߈c4Bu^_[ñ1WV,|$8V58a4DWVډWV #NF=4a4t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj58a4X8^_hha4jjD SVPf=2tjmt$R 20utztD$=`4„u20u1f=22몈D$< t< u>jV58a4z f=2t|$ $#t$b#P[`u 2 <2tu 2tt A8u1f=2t lm3DAt `m3DAD$jV58a4 f=2D$PS&/hW)أd4NI$&Wh"#,d4@d4N Q1f~ @d4,f3H ,f3t;Whn#{+t%th:o#^|$ D l$ 1rh$ US |4ōPUSҽ < ߁WjP N1\$ PPh; tB=NýjPU  98t 8ux8u2N1 T$ PPS 9ǃu88u<\$Shmdv t*hz#K#Wv h9z#v h,z#FN1 T$ UUPB ljl$Shmdv~ 91EUSWV$F~ 1jUWSPsZ9u!D$=жxt9wwF̓uv hBw#i v hkz#ST$1uD1Gu<jUPSvY9tu&v h,z#hz#1^_[]hPv hz#h1r#h]z#h hv#h]z#hhv#h]z#hh5v#PUSWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ P D$VUPߺ s DD$st$s 8D$ s <D$tf4$l$4U&t_uhy#h_%h#$h|f3 &h"h|f3 uh|f3j j&D$l$4$sf@8tD4$t$xV!@SPSV)" \$$Vt$S*K1D$0D$,D$(D$$d$sD$4j@HPM st$st$hy#?t$hy#.t$hy#t$ hy# t$thy#L$9&t uQhy# &hy#|$4tD$4Phy#|$ gvVD$PU諸 16D$8uT$Bg)QPRa th:y# 1@^_[]USWVӉ͋t$VO 1Htkt$t$VSUEVtGUQt$t$VWURV9uVSW` t'Ww  Wa 1H^_[]WP USWV$$$|G8-t _3$D$ 1FD$hz#WS2 it 1$&29t9At&9IuJuiu3$tHPh{$ AtPqhz#=  늡$<A뀃Dtou&t$ mt$d$<$W$uQ 1t$hWV jSVI $FWPP uh&VhiPb u h#j^WxPT$$&2l$D$G_HrY7S'hjD$*P ft$fD$CL$fA37SGhjD$&P ft$fD$f\$ $T$0 T$T7hjRR S)Zft$fD$fD$PSUD $T$l$GD$x|$ hhjD$$P \$ $ sh#sh#s h#sh.#shO#shr#rs h#bs$h#Rs(hԀ#BsHh#2s,h#"s0h2#s4hR#s8hl#sXf|$rL$I}#fw <&L$T$ t$"VRQPh#h#h#j|D$f=212hjD$$P fD$|$<2fD$ $T$2h$$uH$&L$f|$u#tn#P9D$=ufD$L$IL$}1|$D$L$ tlm314/Drt#E9uT$ЃDPhg#~|$ujejPP' jt$t$ V蹨 VhiW u hK#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$Pg G$0hSWJ jl$UW wh΂#:h$f3譭Wh:it$V uO j.&h$f3yj9Wh:iVս u Cwn8)|$#q#P'$rkLPD$$PQ芮 $<1|$Vhۂ#Wt$kL4t4,&h #1h7#$48~1D=P)G9uh#&4 D$4!4"4#4$4%PSWRQt$hM#4(h{#444,40k<SWPRQPh#g4`h#Sh#F4\t h&#-t h+#h#&4d6|$1A t$t&u/7t$t nu Qh0#FL9Mt$ $t$qVFP$t$RVFh#Ph~#h|f3 jyUSWV։1hUS jWSϤ sUPP } t'Sh9iP tVFĔ^_[]h&h#jvUSWV׉1hVU jSUP }VPP| tAUh:iPw uGPhO#q1FSEĐ^_[]h&jHvVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phg#^WVhJ#f>r1D~PhsK&GH9|j]^_WVhJ#~f>r91D>Ph #c 9} j:lG9|h#2^_WV$fGjRW転 WhiV t Đ^_hX#jtfUSWVu }60h$b#j h#VWp| Hw$T&f4f4ԃBu|1PP5$<p f4불f4f4f4f4f4f4너f4f4sjh$f3_f4S3=_3=f4u.1L$A AAAQj jB =f4f4f4f4f4f4e31O=tf4$3tch#Vt^=f4ukjjVnA ƅD$ PVD$(!=<\$yB  e3u1PPVA Ɖx\$f42f3=tf45f4PL$Qp@ ƅ~E1f4VPS? i)u5f45f4t$0@ ƿy5f4h$$~mf4e31O=\$t$9ȉQ@L$5f4u ύD$ PS赯5f4r*V萀 f4Vh#f4f4f4f4f4V_@3h$$lf43V,@3hۄ#-ˋ$B65f49Ph#h|f3N 1@f4$;e3t=h#Wt1#=f4u3"#PWr;? \$e3\$=f4 1$ӋFHN~ HVƒ =f4u u u1G1=f4up=f4u< u7 =f4>h$b#hք#h$f33 0f3@t>$@$Phф#h$f3 ڃ 0f3@ t_  =f4,f3H ,f3;ىl$넉ىl$wىl$j$<$ىY1ɉPXuG _3$T:-u"j9uzuI _3 u _3)t u <$u|$uM1ۋD$Ã<$D$ tD$ @$4u9>W uTWhQ#D$u5t뢍D$PWFu!Whk#Mh#ji$1 |$ $jSV* u h2&PX41u*8V1CHHf wy$&|$uhU4Åu뼋ss 訢 PVh:'#a |$u.jSUI@ ss q PVh:'#* 1F $tCPpQ|$t KP;AmPsT$Z|$Osh$$d1F7h2&jhPPh|#h|f3jfUSWV$$61h$b#Uu -j4-j4-j4-j41Ch#VWo e'H wu$0&j4-j4-j4Ńo'filj4뙃prvj4oaj4j4j4%j4-j4-j47j4-j4-j4j4 j4j4j4j4j4j4j4u _3)ǃ=j4j4u-tX1Ƀ=j4=j4tL$H=j4=j4=j4=j4tʉT$4wk4jWxk4PIxt$lVUhH2s 9rUhp#\hH2蔷H2 @2QT$/u>t$|9A@2A @2I2vy/th#h,#jKet$ D2Dh j-=j4u$PhH2A$PhH2kBu@8uT\=j4u=j4t@j4 j4t3D$ P6A1#$=@txUhH2D$ P6Au6h$$jd#D$=@uj4 j41ۉ  t1ۀ|$/uhH2h#.t9U r|/u (IHr IH9/touɉt$P#k4USWVT$juQ% P.D$1t$CHfw?$\&ss PVt$ h:'# Psh#>|$(5D2C,H2)=|5TShH2h#\ t$V-1Ga{DuO|$u C(D$?Cj/D$ P襧t L$)@L$D$h2#Q@T$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2h׆#t$PVP^ L$@2@2=I2vx/u H@2=j4tD$PhH2X?D$PhH2>T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h# CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2h# 1Gt$#KPqt$1BD$ $&=j4L$ QP T$ j4 j4sHtbffM {4Q {4T$  k4t$/D$ !=@8fushR#jSt$ V7 1G)=j4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=j4t$tjQ\ {4H {4<k4tICPphH2!24shr#D$ PhH2S<1u=j4thH2sh" V)Åc1G18uFVx(e^_[]hЇ#hȇ#h6h#h#h?h#7h$$h2&j^GhH2fWVt$$D$(H0JH(x,z H4x8J z@6tjh4$(1hH2h$T4$hH2h$$T|$t$ D$L$PQ5y#EHQh$$mT1@D$|$t$ =j4t#Vt$UthH2h#2T4$'|$tV'1C؍e^_[]Ã=j4tVW1ۅÃ=j4t@1ۃ} t8G t2G;k4u'D$`PVNt_hH2h$$S1CVL'thH2h$$S1C=j4bWhH2`IGG;D$|uk4#G%PV)wUSWV\$|$OǴ OOtQPSj) uG1CQPhH2( t918thH2hp#R1F#GGtPS2)G1PhH2`(thH2hz#zR1Ft\=j4uSol苸t US( UhH2)u%`8-ulthH2h#R1FuWhH2t1F^_[]WV$ hWvA$ t,$t'hH2thH2hD#"vh7#hH2W&tWhO#vQ1@^_Ã=j4tjvP(1V|$ thH2t hH2hD#"t$vhH2e&thH2h[#P1@^Ã=j4t jV1V|$ thH2+t hH2hD#(t$v$v vhH2qithH2hf#P1@^Ã=j4t jVF1$PPh#h|f3sjUSWV|$j/S耙t@Ë$hDi&S$uGh$b#WVQ\ X_3)ƃHt4i%j1h=#WV\ e~!r8$&${5˃K~3LtgP{5믃st\vtcw {5듃FuX{5{5{5 {5m{5{5Z{5N({5B,{56uX_3)ފ ({54 --{5{5u={5u{5u{5 {5,ttu'MUj M%jP&t=${5u4PV00u$#D$=utYjPV|/uB#D$=@tM19t<1jA ŋ9uUVh$$jfR葲PPh#h|f3jfUSWV׉΀=({5tj}$hVS_ =w6S}_t)$ PQhs%WSj9h?A@!={5u!L$QVЃu#D$=@`%Vh$$L1C؍e^_[]Í\$SW.u#D$=@=${5u"SW-u#D$=@=({5 {5>/uD$PV-H#X$hSW^ W[t?$ VPhs%hW/D$PWO-a#t VQKD$PW-Å({5WVͣ/PVt@\$L$/PW֔t@L$ Q\$S{u)D$ )=|\$={5u={5h$f3Wh#h|f3  e3H e3~e3H e3he3.É؃t9 t4e3H e3~e3H e3he3ƒ߃Y={5u#D$=@uWbWu8=({5u WV{5 PWQVQtW#1ۀ=,{5$-{5VPWh#nh|f3jj h#s|9D$t$QVPB Ƅ fDŽ$.$$PQ*\$4$9|$ t#t$WP$ D$Ƅ fDŽ$.$PQ}*$3$$3$ $3$$3$  WVhm# fD$L$TTPQ迠ËD$L$TTPQ覠USWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQPD^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPޟ^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQPx^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP謞^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQPF^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQP^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP谝^_[]USWV |$87vh$b#jG j譇t7D$Phht@jՍ uD$tL28{5<{5@{5o[u D{5t$41۽ht#WVJQ HσG$&@{51H{518{5l{5p{5<{51H{5@{5L{5P{5`{5낃w{5{5^{5O{5@d{510{5"{5{5@18{5l{5p{5X{5\{5t{5d{5h{5 D{5=T{5t T{5L{5{5{51Vx{5G|{5{51C+L{51H{5@{5P{5<{5T{5H{51@{5L{51@{5L{51H{5@{5P{5<{5{5{58{51M{5{5r0{5c\{5X{5J18{5l{5p{54P{51H{5@{5L{5<{5_3D$=<{5u=P{5u =H{5th4#.^tP1 L2=T{5u T{5x{5 L{5L$$ ȉD${5 `{5{5 0{5L$D$ ыt{5 T$ L$u1 T$ ={5t ŋ$u|$u|$ t+uh|{5j,|{5 |{5={50{5tL$t*t,uw kL$t;t=u^B R K =\{5u==X{5D t/ ( ! =\{5u=X{5 tv {5)θ =@{5u/ =P{5u!c =L{5u=H{5 t~ {5t1AT2U44{5 ^_[]迤Ph#h|f3 j蕵USWV΋\$=h{5I t1PSR ~jP1ɉ=t{5tW  L݉t$=d{5D$WÉL$ CHHf$&ks $} PUh:'# 4{5{Dt{T.u =D{5tw={5uL={5u%shՊ#W1TSh#L|$|sh֊#+{5VWʼnى=d{5ut jSW6 W Å苤0Wc {0t8u ^_[]jh2&jBWVD$ qH1ftYT$zHftIf t$f tf9t=t{5uyDt,RQ{51f Duf u RQ^_fu1@fu1HUSWVL$dx{5D$ L{5u ={5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$Pz PSl$$h:'#ot$X 1@F F4{5Z|$dt~T.u-=D{5t"fu=t{5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=L{5t-T$$L$(={5t-sh:&j $W$D$\l$t$0Kjs>Džt={5tsh:&j $U襷jsvŅtщ|$W賐‹L$@D$9ʉT$@l$ U蒐ʼnD$<9L$<={5t/h#sl D$TPZT$ 9щL$ 1|$PpM  à t$Pf Ct$ PP={5t +Cl$TUP0U] ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p={5tD$|t$ |$ n|{5ʃQPRW$RPh|"jVµVD$|={5t$ |$ tHVUUUȉD$|$D$<$$SWhG2$VU^U腎$t$h:&VU;Ub$={5tDŽ$Mt$4t$ ,f3J ,f3;,f3J ,f3;,f3J ,f3;,f3J ,f3;#D$=@u.$VtP3 9r*th#j|%|WP貖 ty/t AƄ/@L$M$D$Sw|/uH9tx/@tj/Siޅt@VvL$rSh#81A $'@PVt$ ) ٍ$Ct1@$Mg4$PPh#h|f3>jĕ{5USWV։π={5ujVyt~VWt98uR\$@SVt{SW9Wh$$1ۀ={5VWh" VWh#l w={5u=jWuWh#H#D$H=@V7={5/jV虣D$@PVCjWpuD$1Pt$L{D$2x $b#t?r%D$1Pt$\4v1Pt$`wVPSt$D$BPhNj#h|f3蕟#D$H=u}1PPW# t$HhV \$D${5{5VfCVh#1C؍e^_[]ÉVh#h|f3 e3H e3~e3H e3he3tÃtH tC e3I e3~e3Pe3he3t e3 tuÃ߉1ۃYM@Vh$$'${5S0 {5t$|$SPt$ q Å11S5{5t$ 9x߉={5t{\$(t$,l$( p&$$L$$D$ l$ |$T$ fT$l$\$l$T${5RQPVSt$(t$(h#h|f3M$5{55{5t$  Å6|$W\$Sot$uVh#SD$hL$l$JD$pBD$tB D$xBD$|BRWtVh#t$\t$\W 蒁8tVh #R#D$HD$Ht$\$ \$D$t$Ph$$VqtVh#t$S1V5{5t$xt$ЋD$HPWDtVh #$WBt趀8-t$Vh-#o WtV|$W诺t Wh#H1ۀ={5DVt$SWVP׉'5jWP t$t-hH#hg#褨hH#h[#1@^_[%tPhH#h#l 4jWP t$th#h#%tPh#1돸P#={5uV#H#jWVh=%Pha"SSh$$!j}#jVh=%h#ha"W躛WUSWV8`2t P`21{5{5{5{5{5P53it$L$4&hjVR `2~Vh#0jG`2hhV  `2{5hjV `2#~Vh7#0jͳ{5u21`2{5d21t~|5ttja`2{5l21@5`2{5l21@D}Vh#0jE`2t|5tj`2 '6tQ`2h|5PYxC |5%= ts=`=@5{5hi#j許 |5{5hW#0j膲5`2?`2{51HPhm8@5`2^ 1ɅA {5-`|55\|5{5ˋ 3u\'6`'62v$H&=\'6=`'6>1jSS5`2o^!ƒu{8f{5-`|55\|5 a1H 33=l|5Gt =}r t~=`'6`'6q˃u#=\'6tPWUVx ~jWUV^ tw߿(=`'6u `'6~~=2|218^_[]111RSWV։ωS[/k2D$t,t\$W3.4$t$ctjt$.'A#1@jt$.#1PWt.4$t$}jSVVx^_[h•# hѕ#h#j(VP=`2x=(6 (6t}={5ut=(6tD(6HQP~'Q &P51{5{5$Pj ݗ5(6h#5(64 5(6K={5uKh|55`2zUu4# |5=u"`|5 \|5u5{5{5=3w=(6t2~ jP5`2.2~jQPg (6 (6t4={5u+5(6hM#(65(6&J`2={5u {5tP1{5{5x(6t2 (6 (6t'=(6tG(6HQP~Q P5Pj P(6x(6tZ5(6hʍ#iuC5(6 |'6x'6 u l'6h'6jhQPkfRPhύ#VS1V5(6I5P5^USWV=3$f3t|f3D$WO+|5 |5 u1@1ɉ$L$=x(63\$5|'65x'6h#hS蝍<$t$W5|'65x'6e$hw#RPWh#hV_$VSh#hWC}W`fPW}tf=5t]t$5555h#hV$Vh5h#hW׌WePWj 3u_5P5<$t$WjVd$h$RPWh#hS}$S]Vh#hP^x(6D$=2OP5D$ #D$5|'65x'6VSP$5l'65h'6VSPl'6 h'6 x'6|'64$t$VPQc$hw#RPVh#hS谋$S]$QL$Qt$Wt$$hɔ#hP|$t$VdPVj "$PW5(6h:'#t$8e^_[]V~={5u(=|2~h~V5`2q |2~^V|51={5uE1jVV5`2IVxRP5`2a ysh܍#0jd 1N^Ã={5uh#jI&1={5u5(65`'6h.#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU/ ~)t^_[]WV5|2={5t$t$5`2, ƃu*~3{5;5`'6tc5`'6tU{5L~ {5?5|2x52h#j, 1cr52hl#0j^_USWVP5|2|$l$1ۡ`2$WUt$7 ƅ~)tދD$9u|5{5!|2{5Hs-q8 uc1h#Vh5|2:~\%tS1jPP5`2Sx})RP5`2_ yPbPq8tDFq8t:x(6Ht)t hf#52h#jL 1%h0#jzp52h #0j^_[]USWV1N=|5=|2 3uh#j٤{5<u{5-{5sg{5l|51jWW5`2KRxXͽuWURP)jWU5`2 RyQu t#{5@{5=|2:hǏ#Ff@Phm5`2Q x|2h#j1^_[]USWV \$$|$ l$(1uu5|2{51jVV5`21Qx\D$ljT$Ӄ={5D$`|5\|59L$ujRP5`2Px+D$T$EU,={5u#Pnh+#0j |21N ^_[]USWV~=|2$(~$$~{5t)h[#j蔢I1u)1ɍ|$h~W5`2 0|$fGWhm5`2O fD$D$Whm5`2O \$h~S5`2 $h~S5`2t GfD$D$Whm5`27O |2t1<$uzfD$D$Whm5`2N f $ `'611F$$~jQURы$ʉD$ ʋ$$~) h#b1F|?1jPP5`2Nxg)y11=2|!h#11Fs1okh#RjRP5`2EN1yKkhܐ#.kh#"kh#khB# khl#0jB 1N5|2~^_[]fD$D$ D$Shm5`2M yBkt$h-#2kt$h#0j٠SWV Vh(6j yjhR#0j袠 jVjW yjhl#0jv 1N=|5|5=|5=D)6u5(6h#趟={5hl2WC\hd2W-\o {5aX#t# 2#t&#QWPA S8 3P#t"#P5(6hu#h#hÒ#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5{55{5h;#sWh#T5(6hu#Ah#4hÒ#'h#<=D)6th{#j{52h#5(6h#ҝhߓ#ŝ|$h Wf|$.|$t+D$5..L$f tW\X= r@h,# h#h #Y5(6h#Fhߓ#9sWy\Whe#|5|25(6h#(6 ^_[hY#М|5t P[% WA |5t {51|5|2hK#j|53mtt$11Hfhh|5cth|5 W51fh#0j臜 1Ht$fh2#0jX 1HVt$V ufVhF#0j*^\SWV|$$Wƃu[?f1~tHNtt 9 tu/fPW+t#D$=@t e1N|^_[USWV1Fx(6PH{x(6P kjƉ+L5Hw> x(6SPh5Q@ 85$ <5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PTPh55P h$f3WVh5M<0f3@ub85@5 <5 D5QP.t x(6P(jh(6j xsZ1e^_[]*dh[#0jՙ USWV (2x&,2kL29|׋yM1II1T51PQÅy19}WDu=3h#j.hhT5OÅy1ۉ9|(2x(,2kLShT52y݅u=3teh#j迗T51E$sVhU5T5P )؍T51Eh#ji1IkFL2x(6ShT5#1ɉ^_[]USWV D$x(6xGD$S5$1F1T5SQ291Cx(6hT5h5P$ x(6Qu*D$PUhT5Q8 T5tu=3h#j耖t$hU5hT5 $W1CttUtB:x9u=3tFhC#j,WhT5Q19uh#j1H ^_[]h #th5Q<t P51hi#USWV1Cx(6PHx(6P yjƉ׃='6t/53t`hl#0j4 e=(6t Rrx7t$t4x(6P(jh(6j lzbV1ۉ؍e^_[]Ít$\$D$L5Hw5 x(6VPh5Q@ 85D$ <5L$ h5kWeh5duy=(6tSh5,t^(6 (6tSh5 h5Ujh5Xt@h5Em85@5 <5 D5QP=5/u+?<u"5PNPh55P (6 (6tSh5H (6tp(6|NPWt$h5)6Q=(6(6D$L;5D$P5Ph58(65t@t=(6u Pl=3t1L5Hr@tZ tUh5l'9D$X;5D$\5?uD$Ph5$Ã|$=(6ut$h5Åx(6VSh5P@ =(6uSh5/!؃=(6\$C=(66D$(6HQPQ (6=(6D$L;5D$P585@5 <5 D5QPDy h5j=(6\$^=(6Q(6HQPQ D$L;5D$P5D$X;5D$\5OPj dz(6D$u85D$ <5L$ QPp5x535(6M-85@5 <5 D5QPh5ji\$=D$L;5D$P5Pj y(6USWVj/h5>1Uh5Ut>55h|5UK /tOGh|5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=x(601F x(6t9t71ho#jێmQHbx(6P R=(6t i<x(6x t `m#(6 (6t#5(6h#5(6t (6ujh5^t(85@5 <5 D5QPu1=(6th5hxuth5lyx(6P(ljgSW, xa(6 (6t&=(6t5(6hM#2(61G*ƃuejh(6j3 ^_[USWV $x(6xu d?*1Fx(6P,x(6@0D$ jAD$T$=(6jSh59]jh5Q$=(6th5~gh5+th52dL5 w's1PP55 $jh5Pƀ=5/u+4u"5PJGPh55P& =(6t4$h5Z' (6t:(6|Pt$t$h5s.Ph50(6P5h5T$t8=(6=(6(6HQP~dQ cx(6L$Qt$5SPD ƉPS?&=(6tc=(6tZ(6HQP~3Q 2Pj rt(6Ph5%dPj Kt(6D$L$ʃ|QP  <585ʃ|QPxnh5*1C@TPh5Z%>U55hR#0jh58ch5)t x(6P4 jh(6jf =(6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=(6t cxIxx(6PHx11@USWV $$h 5(6Sa = u$ /,4ŏ4/t EƄ4/FED$P5(6#D$=@`1Gxv%xmlxd=(6t exRh5!(ttjh(6j Gm'15(6hʖ#j 1GĐ ^_[]-S5(6h#0j҈5(6h#뻸 )D$ )D$$h5 X(6 (6tV1=5/5t$PU ;D$vh5h1#jN _D$PS!E5WT&W^jh5Kt'h5K`h5&'VSh5NR xơ(6 (6tD$Ph5I=(6t5(6h5+(6P5=(6tEh5C=(6(6D$D;5D$H5h5{L5Ht 1PP55輽 $jh5#Pt$h5 Wh5D$P;5D$T57wD$ Ph5;(6tk=(6tbD$D;5D$H5Nh5h5^^D$D;5D$H5D$P;5D$T5O55hR#0j蕅P5WWWh5!Ph5=(6e=(6X(6HQP~ Q Pj m(6 D$D;5D$H5UfX'6X5\'6u x(6@\'6=~| h~Ph #thPh>#j蜃1Hã`'625{5y x1l'6h'6 X'6\'6ʉp'6 t'6X'6X5=3u=\'6t4=~| h~Pho#thPh#j1H5{5 y xX'6`'6p'6t'61|'6x'6X'6X5~2`'6USWV=(6th˙#j艂1I^_[]Ã=\'6`'62u\'61IxՋ=p'6+=t'6|$\$52UVSWj)9|11UV$)݃X'6|Jt'6 2p'6~H5`'6Pt'6t'6;p'6r֋ X'6 2p'6t'61)ȉQPx[X'6Ɖ5t'6 2ȣp'6)=x'6|'6 `'61l'6h'631h#jWV1N=2=3uh.#jy1|'6x'6525X'6Z12~9} G{u'Phc#j~ xI1=|'6=x'6525X'6~ X'6 t'6x'6|'6 p'61^_ËD$L$t'6)ʉt'6QPR USWVu ]1D$ D$ D$p'6 t'6)ȉ9؉| t'6)։ `'6QPVS$h)ЍT$RPQ 1ID$L$ )x'6 |'6|~ p'6t'6)ЅqxUtX p'6t'6D$9ؿ|‰t'6)ظ|D$L$ 1H1@D$D$e^_[]V1='6525X'6~# X'6 t'6x'6 p'6|'6V1xC=x(6t/x&5|'65x'6525X'6~'61 (61H^Vt'6;X'6v*5p'6)QjP{E 5t'652^USWVt$'6 '6ƒ|]; h'6l'6}O1h#W}=l'6=h'6$-X'62 ( p'69)1 -X'61ۡ21PUK;2tS1l'6h'6SX'6 2p'69)QP륉h'6 l'6Nj-X'6S5p'6Uf +t'62)USh'6l'6X'6 )VQS* t'6x(6Htt(61O1^_[]É-t'6USWVP\$1~cl$p'6$5t'6<$)"523x3ǡp'6$5t'69|WUV 5t'6)11H^_[]USWVPD$~Z\$ p'6 $5t'6ŋ<$)Dž~9p'6$5t'69|WVS 5t'6)D$^_[]ËD$)USWV\$ l$؃|~p'6D$=t'6t$)#524x\ơp'6D$=t'619|VQWD$ _B =t'6)Éظ|$1H$$^_[]USWV$  $x$|$D$|=(6t7P$!y#E$ hW#0j.{$|r t'61Np'6)ȅ52  t'69غ|PQ$v ~|)à t'6 t'6ظ| uXP$:!$3D$8$3L$4 $ h#jUy hx$ h#j5y LnD$ h#0j z'ID$ hW#0jy111o^_[]USWV$$x$|$$D$x-D$PQ2 t"C4$h#0jny L$|L$1$p0L$1p'6 t'6)ȅ\$^ t'69|4$ST$ RT$RPQ$P~R|$ =(6 t'6tP;CJ t'6)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=(6t% u!$9$t4$h#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=(6$4t1PWy#AhW#0jQw1HD$sD$$P$<4$tkAVh#0jw $l$ l$\$ 525X'6W脭 lj\$11ËD$ 9D$D$D$X'6}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525X'6$< ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Wh#<$Wh^#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]?$0h#0j8u1K<$o?<$W$4h9#0j uUSWV|$7t6|>/u/1N='6MWh#js '6.|$tjh W莫 V; $='6'6_Sh]#VPU$xƅE<$8$S x<Sh]#P$MU$xywC>0=(6t5(6$hg#Vjs15'6$ $=QhF#0js1N^_[ÉX:USWV|$?/tGj/P ƳUW+u/Fj/VƅuhW=(6t$$W jW[y3UW轸u%D$ PW)jUPWV/Fj/VU1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pyu~`<Whx#0j r$tDPnvy2<$h#0jq$ 1$'6^_USWVD$Et$$^߅tPRy;Whx#0jpq=(6t<$8$W 1 (6tt)$($u7='6uj'6P'6'6!UW3 3t%1PPL$H$X$T$W$tJSW˩y!:SWh#0jpWt$ 1$'6^_[]WV|N1uA|$ t$t$W t(5(6B j:Wh#0jp1N^_Vt$#D$ PV۩t%5(6 !:Vh:#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=3t =3D$PVMt9Vh՝#0jKo_=3u&D$DL$HL$$Mbl$L‰T$=3u'D$PL$TL$D$ Mbl$X‰T$WVt698Nu} u&WVu8Vh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVhÜ#jm 1HjW |^_[USWV׉L$]D$PS賳t6St$bth70wwS tՃ} tL1@_1=(6uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h##Vj6m1He^_[]ø#D$=@u%h%S4)tS0Sdq} D7Sh#0jl댋D$$u1@Ë $jPUWV}wPV]1@xN=(6t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $\&5(6h#'uu=(6tlD$PU_uZD$ !=uHhWUڡ ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$n 4$U#4L$ t uu$UFD$y)Q8=(6us<$8$U xZL$ A$4t$Uh!#0j3j1H=(6t2<$8$U Uhg#Wji1ɡ(6tt1Ƀ$ !($t($t$$5(6hʍ#%jU$RxN1=(6=3=3Uh|#UhJ#j7h 1OD$PUx=1$ ?#D$ PU1@=(6u;L$ ($/3t$h#0jh$ PU1@Pt$6UK31 3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=(6t މ|^_[]ø#D$=@u5h%W$1EtXWoyĉ#$t W?ly5(6#1WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5X)6T)6 P)6L)6L$T$tI AQPn DUVP 9t_L$ xZjPUQdҋT$0y@oEP< Džt<$\$MQVP D$8+$T$0)+|$$>hg#jJe*0t$8hu#s0t$8hW#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh'6S@ y%u##\$0SV0je^_[Vt$ xFP]=(6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(躛 ~H111Ã1T |A9uV$P$(腛 ǀ$1111틴$(3x$3|$ uUP$(? xLX$3D$8T$3L$4 uF1VVV$(xE$($\h#.hW#.h#j%c #^.$(hڞ#0jc1N|(^_[]V=(6t'6=(6t'6=(6t@'6='6uh @ '6t01x&=(6tDyh=#jhb1N^WV'6tPp1'6'61N'6t '6tqA'6uj1e3H e3~e3H e3he3YtN;42u1tB '69G= |+'6xx'6 PW1t-'68j5'6h'6T '6&1^_SWV|$tR?tMj tSƋ\$WH~ </u>ۉ^F='6t%'6p!hl#j`1Hh#5'65'61^_[á'6t@=(6t'6=(6u0=(6t'D$$u'6tjP5'6M WV=(6tB5'6t;11G~u)uh#jA`6h#h|f3`F vu^_USWV ='6u%'61N'6u'6}$ $ $L$P'6t#HHf w=$x&ph1##"ph۟#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p} -* '6qhE#0 ph#p j_e=(6t\@PL$QL$ Qpp p09Bx8'6jjt$t$t$t$ph#p j[_ '61N1 $&LJ$Ƅ  LJ$LJ$=(6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G '6 VqP  '6VqP 5(6hʍ#V1u'6@e^_[]fUSWVT\$tl$h=(6P($覣T$L$X$1V8$]V<$$b#$b#t4$tVjQjRD$Ph_#SB $u2@$%  RPhq#Uh#^|$x$h|#SLBEPD$Ph%S5B$Hs Uh#u# Uh"SA SX^_[]Sj QUSWV@L$E\$CD$PS{3j9٠#|Ϡ#L$QPj@t$V^ue^_[]SWVT|$dT$t$X$hS($ȡWVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPS|VSpGu܃^_[Ã^_[TUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V(6~1F1u(6h#j9W^ÐSWVL$D$t$|$$<'6t'6tt\^_[駼}\1KZ'6teSPti:tdx:_39}j $<@_3sPVW hV'6:-u/'6È'6n'6'6`S6h#_3=S6h#h|f3h<?^_[f1Ã='6u1áx(60h#jV '6t"H '6p0hТ#h|f3 <5(6h#u_sUSWVd|$|j/7(6t@l$x(6h#P.5(6#1C|(6D)6D$ D$1D$$jh2h#WUHЃJw$(';t$$@$&$<|5묡3t 3(63r3t c3P=3ܤ#\$(6! $<k\'6 \'6|5I#|5%2(65$<R3t 33\$(6t{53e|(6(6L{53=(6.(6 Pt$ * NL$ $< '6$LF{53{53{53{53'6$<'6|5p$(6q5$<[Z 3@K 38$<8-u x{5D$ =`(6u (6(633|5f#(63'65$<WO (6D)6s )6d3U(6`(6?{51@D$ )3 L$ ƒ ʺ|f3t$f3 _3(6ƒu 9u , l$D$kL2x(6'6 (6a"1$jh82hڢ#WUk/~HЃJS$l'42ƍHw$T' )6뫅!$<|53D)6||5p$m(6@X(6ˀC(61|5f#"(6 $<@Ƀl~mtKotRpd(6SatDeJ1A (6 (6 3 3 3"3(6 3@{pe$<{5SH(63 $< '6'61ɉ5$<"](6(6$<L$ha jLjh2Q%*x(6bl 5$<Vh#C V~24(6 (6@5$< i@(6|5(6|5%(65$<9i $<E \'6N(64(6 $! $< }(6(65$< =(6@(6 2%=3(6$f3 0akG1A11|$<$t(6D$tGNutNj]]h3#S1t[hX#SuE'6'6j5'6S^ 1AL$y#$]1'6<$D$h#SBl$\$th3"#S1Džu e31 ðt5hX#Su3'6S I 1urL$tP؅uAJjh[#S uP'6D$t t P CPoىQs ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#S t W=d(6<$l$S|$;'6,31ɺ G1Fmفt#u41A 03<1A 03!531ɺ.1!# $ 4u x(62=rnFr0s9-_3D(6PM_39}j4NxP_3@_32_39 1VV4b x_3@_39| Qh##j?H 1FPhʣ#V(H V"5$<h #h(#jHj"5$<hj#hh#5$<h9#jG |f3VhO#莠g%52WV- 52WV- Vh$[5$<h #0h#jjG!j"mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8Uh3#W1D$h.D$1$h#Uth3"#U(-Džu Je3tkðtAhX#Swtjh[#S tj1ujSðuh#Ut W=d(6Uh_#l$}$l$hX#W]tjWB\$rt D$W2|$ td^_[]á{5t8uh@s"{5t8u{5Es"Uh6#j E USWV|$%UWXUV)NJ00ht$跩tAtZ/UVXUW488ht$vut$h#0jxE1H1^_[]á'6t H '6h|f3h#jWV|f31FWVhhv#WVhh##WVhh#WVhh#VUSWVPˉjPQ փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Qٱ$1>tj,VZÅtj=VFtmj $ tdAE0H@'6='6t \(6s\(6uh#j6B1O^_[]h(#hQ#h(#j B4$% ɋD$L$01WV5(6hh#h|f3( t(ο#Ph}$h|f3' !uءf3H f3~|f3H |f3 h|f3j 1+^_SWVPωPQKt4Ƌ$| tC$Sݹ t'ǍCPVW DG d(6 d(61^_[USWV$t%t_݊M\tS8uEEhB#j@EjE UEƃjSVM t3l$hUVPWUh#j\@Sw $EE<\t:uCCU* $AStRC1fGt,PtStgtstp1B ы$J@u $A=h(6tZl(6HVV4$ Wh[#ji? 1H^_[]VVk hy# h(6 l(61V4$= Whө#USWV\$tK;tFj蓷 tLNjl$1pS;G woD$G95p(6t%t(6x!h#j>1Nh #=p(6=t(6^_[]WV5p(6t;11GFu)uh:#j^>6h#h|f3}$ vu^_USWVp(61 l$$=(6Kt(=(6t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=(6tGtlD$@1G8D$@1D$\1GEt$ h #j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh##j59tNjE|$tDD$@t:$t$PVh\#h|f3 VhF#h|f3 $t+Et$h PV  1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7:(6|f3WVVj6uD$L$ L$$VjدVj uD$L$ L$$Vj误VjuD$L$ L$$Vj膯Vj軠uD$L$ L$$Vj]hج#0(61)6)6)6P (6t$,NFF FFe |$WVj y|$ujWj WVj y|$ujWj WVjn y|$ujWjV WVjB y|$ujWj* TWVj y|$ujWj (D$,WVj   WVj 0=3t3i=)‹1@?9 tR=)6t3<$/>3i=)‹1@9 tR )61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=)6ujh=< )6#t\u#uGW6 tjxGj jW3 Ť />3i=)Ë )6,t 98t#@u $j t!8h $1(Wht#j9- h#hA#j!-^_[]USWVP|$1N=)6ujh=? )6#t\u#uGW tjxGj jW6 O />3i=)Ë )6,t 98t#@u $j t!8h $1(Wh#j<, h#h#j$,^_[]USWVt$totij/V`1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh6#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjKS CS>tKt^?tYڃCKt6C;C C})VWh#j*S贳 hr#C=)6t$)6X VhN#jW* 4Vh#)6)61Whخ#j** SE h#}VQh#j*USWVPϊۉ$tslm311JDhu.e[YAuۉ4$iÅt>V ,FN4A1R)113W1J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACS4V!1҃ډЃ^_[]fV1= )6u*jh 觪  )6uhN#j1(1N^USWV )61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EPv $$$KCs{ D$C $C1^_[]Ët$ h 3P}  1$$CHC1FwCE3 S S hy#j&1NwUSWV )6t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j& tx@ LHDh{#jY 1^_[]USWV,)6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u ,)6-4)60)60)6-4)6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@0)6=4)6l$T$s}ډD$0! umщjt[4)6=0)6 tIj t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,PhX#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=8)6u*jh= 8)6uhɱ#j1N^WV8)6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(| t^t$܋tAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W蝥 h#jj ^_[]USWV 8)61Kt$/>3i=)‹tjh#W t1H^_jhe#W u(=D)6u\)6u\)6hm#jjUSWVl$hUh1N\$1h$WSQ K$ǃ4$Yt"Yh PQ  Ǎ A/G<rH )UhP)6hL)6o   PhX)6hT)6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP yEtQQP  ƅ(8$VPyElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxug&-u~t6h3"#VDžu'R0 PVh3#jHe31FUWD t5Ë$rt$VhF#j$_Ft1N1e3t W踻^_[]fVjh%"[8xKh"Ph)6t)h3"#Vl)61u;5h)6UV8=(6th%"h#j 1H1^WVPD$$|$t (6t$(6 (6t"=(6th|f3j (6|f35(6h"W 4$VWB Wj w ^_Ph)6t$L$T$ $RQP 5h)6fXSWV|$1N|5l)6t,\$OPWS, t;j Sɕ1t^_[SWVPD$ $|$t (6|$t$(6 (6t"=(6th$f3j (6|f35(6h"S 4$WSA ~V茡 Phg$h|f3 h|f3j R ^_[fUSWV} u7<h$b#j \$1h$WVvo LtPt߃95_3D$h #?ƀ8/h#Vnushf#V\ua$PVCtKD$Ph%Ct4$3D$ $3L$ u$3D$$3L$ t1PP{ƅu j02Vh$f3&0f3@ujhi"jfPh"#h|f3 jUSWV$$6h$b#j芜 11Ch3#VUm e~%q~3كrtރvt_x)6ŃV.PtrكRtwftAit)6x)6뒃Wt6duqp)6z)6lt)6x)6W)6I|)6;u_39|=t)6u 1Ĉ^_[] D$h j$D$,$S I9v9/u؃@]9v8/@tj/S谩t@À;.uCt<.u{t0\$u h÷#C\$)6EHu]j$8u )6Pj$)6a$8tӋD$t$ VWA )6tRtD$W4=t)6u8ts8?ti8t_Wh$$Y_HtjC PWh:'# +D$@uDp)6u;Wh#)6;;=)6uWdڀ=t)6utV/tD$%=@t/==|)6u uWWv t)6 x)6х ˉ4=)6u Ő=)6t@jPt$# u h=#7P]-u18V,NjGHHf wO$P'=t)6WOwP"{jWVc9 GG \=t)6uWOwP:GHftIfgft9G =t)6u P& PW}G  Gwut)6#8=t)6uG ?tow 觚 PUh:'#` c=|)6uO1zuSwt)t)6t 8t18?t'8ut/wh$$;\)6V{+Dž6=)6u =)6t)6wuwX0h2&jg`ww ę PVh:'#j`vPh#h|f3 jL)6USWV΀=x)6uLVhM#h|f3 h|f3fe3H e3e3H e301C=)6l$$#E=jR(8D$Pu<=|)6uvVh[#1Zhe3Ɖt9 t4e3H e3~e3H e3he3ڱƒ1ۃYÉ؃^_[]ÍD$x $b#t?r%1Puѱ1Pu1VPWSD$Ph#h|f36USWVAӉ΅:#K1jhV, $ǍD$PWG.D$3CL$3 D$(3CL$$3K #D$ =D$W,1PPPW D$$h PQ蕻 KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW** D$L$D$)T$T$ 9D$t;$SV{:)6Vh$$X)贾)6Vh$$lXW,1@e^_[]`)Wz+u1PPPWؠ uh h$P芺 KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW#) D$L$D$)T$T$ 9D$t1(W*1PPPW. h j$P߹ KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWr( D$L$D$)T$ T$9D$t (W#*j1PPPW} Th j$P. CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW( ;D$t$$P$!PY8 L$)L$L$L$ |$D$ h'W5)|1PPPW菞 fCXK\D$L$ȃ|oRr \$9ËD$| S$PW& 9D$)؋L$D$ظL$|h&W)1USWV\$l$UEtMƊAuA)k')l*6j赸UGG SѸG)6<)6 l*6t^_[]Ã=p*6t^_[]USWV\$tKƊAuA)k')Ƌ,)61Gt?uSOtmt&uS6u4)6jVJ1^_[]ËD$t @ъ@uA)k'))6WVt$ >tVG t|$u G?l*6ww ww Ww  l*6u=p*6t^_WVt$ l*61<)6t)6VPs8uG'u l*6t^_Ã=p*6t^_:USWV|$tWBuA)k'))61t(l$sWȪtu tC uމ^_[]jt$ }t@1ËD$L$ pqvSWVl*6ƍ1P腶1 )6tQ:t @ C'u9 l*6u=p*6t)h jVWO{~R1ۋph#)p43HQPP@%3Q C9uW荶^_[h #WV11 )6t))6Q:ujPuFȋ G'uƉ^_USWVj268H 26(11C}t$Ej=P蕂t)AQUkh&#537(TjUt_Uh#p(w23HQPP$3Q 26H 26(S Uh;#53' u1^_[]Vh=%tauj426t$1Pc ơ26H 26@u1^fWVP5@*6lm3DBuFB'ut t- 8*6]$x'NF밉jWV4 L*6H*6 B'j8*6P*61D>GB'uGPVH*6WVP蔈 H*68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5@*6^_ÊVF|uܹո ѹ Ǹ É)B$:@BB'uVPQhP# fUSWV|$,t$(S脲=8*6jLV~t:xIuxNt@jLPj V~1tE@j P~)=8*65<*65@*6"1,=D*6uƉS;^_[]ùŸ#V=D*6)u ^5<*6Qhx#*WV$b#|$ |$wL3 P3 26>t'F 26Q26RN@>vuڋ7 26Q26t& @뭅+L3@P1576VrƉRPh$# 1 ^_USWV8׉ˋ H*6L*6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh|"jV#jVt$ % USWV Ջ\$$St$$tƉ׃=D*6%up1҉  ډD$$=D*6&uU1ۉ D$H*6 L*6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWVi99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVpƉ׉^_[߹6#G#*#wSWVP=76P*676Q5)Ɖ=76=3ttxt>ug&1ۉSPV蓑 Ɖ9u$8t*֮8u+$t@B' t$@u^_[ùT#%USWVPՋ\$St$gƉ׃=D*6uKh$H*6 L*6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաD*6HwSjP ljաD*6uND$H*6 L*6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THH*6 L*6N"ىWP1Eكra$"ى=D*6#ÉD*6݅~hD*6 H*62É׃'1HH*6 L*6NLىWP1 1H*6 L*6NىWPÉD*6LH*6 L*6NىWPe$É׍EكwD*6|$4t;~l-D*6b1A1Ǎt$WSh|"jVojV5H*60't1I1@1l$QPh|"jU9jU6  ؉^_[]ù#T#J#@USWV֋] $t$ơH*6 L*6L$ D$T$uPV֋=D*6Ww,T'8\'}uPW ֋=D*6ȃ}tً$VPt$ ֍Gw\';E Qȉe^_[]fUSWVb3$D$ h#t=etuD$ j260hT*6GVS8?SՙUʙ@P谧áT*6)QPS| T*6)١26pQܷV胙PS#$jh;##ƅ<.u 1~.D0t/ua$Ph%_tGPVNt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"u268Ltj268j*5T*6uj=T*653[3f`5T*633HQPP3Q 53 3@u1[h$#[0y PhY#Ah8#7SWVWϟWP豞u2\$Vm蘡8"u6W蝟WPtVLT*6V1^_[ÅuT0y Ph#jT*6tjPh # hd#ÐUSWVD$ 3fa1Ƀ|$‰tpыLh $S譒$thd'#S蘒u 1t$.4NJ]taM\uNEU\rw$8'\0u!11ЃwxAunjt$>3HQPPe 3Q t$.PN    ȉš3HQPP 3Q<$t*3HQPP 3Q 53W 3Hu 1^_[]ÁfHh#jfd*6u覛L$ h*6jPTV=l*6t p*6K15p*60ppp VPjM  9506t =3ujVܛV^jpPT$=*6u *6D$ $1APVp*6l*6t1It$aVPL$T$ D$$PD$*6jWVP|$t$D$$4$ WWV׉ΡX3t L39ty u hL3 =*6*6u1Ph"h`3 =*6t5*6h"h`3 t*t$ Wh`3 x4hg%h`3xVt Ph$$h`3] 3HQPPj 3Q h`3 ^_SWV|$t$\$ќSWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$k4$w^WVt$ |$KWY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQh6&j ht*6 t*6@^1*6*6*6*6WV|$ |t|$wL3 P3 26>t'F 26Q26FN@>vuڋ7 26Q26t  @*615+L3@Pơ*6PV *6^_USWV\$0t$,|$W̙576jVi j=83thƉ؃$1t7=3u.D$0t Nf $uQVi=*6u"W这j螵=83u11EPiWcu *6D$0u^_[]jUSWVL$,|$(306̓VԘ$'Uw1ۀ=3_=*6Mjw1ۀ=31=*6$=*6jwH1ۀ=3=*6=*6uQ=46tTjw1ۀ=3=*6=*6t  u8V31tu *61l=46tUW_j\$0SWh a=46tWD$,E=46tt$,WK_=46tst$,WE\$,SW=46t@UW=46t)UWyPh#e hL3k=46twww. *6@jw1=*6*6 jwa=*6t *61V谖VuL$,=`56t l=r3t *6tu u^_[]PNjUSWV@|$T5d*6D$$w=*3tttn 66576P$Ph"#Gtj P53[ KȅuhZ#53Rl$jUCth5d*65h*6jm<$t&4$hha#[53|$*6\$Xl*6-d*6j wD$ l*6u=p*6tSwl*65d*6j l*6u=p*6t]<$t&4$hk#538@^_[]j5d*6pUSWV\$;s3=*3{ 66576PP'h"#stj V53 vh6#u hE#3HQPP3Q 53Vl$l*6ttQu {tF1ۃjU_|Sl$SP~ tuQV{*6Ju l*6u=p*6tjsUsV言*6 l*6u=p*6ttJ=*3tA{t; 66576PHPhI#539^_[]SWV|$*6jw1=3t *65*6^_[Ë\$1*6u/? *6ut΅tSw5*6*6t"u8*6H *6K*6jw=3tru+*6H *6*61 1@65*6+USWV1=3t5*6|$0D$Pm[thUS- =*6tiD$*6,$\$4>G76=*3 66PQPh2"w 3HQPP3Q=u3HQPP3Q 53juw  Sw5*6=3uZ*6t"u**6H *69*6m"u*6H *6 *6 *65*6D$P襏 ^_[]USWV|$0t$VR@O 76jPw+ _1=*61{t'G76$pW Wuuޡ*6[tZtT1=*6uI=3u@l$41; u{C76Us t=*6u =3tʋ-*6-*6V譎 ^_[]USWV\$K1t@ l*6PSwƋk1OuD$}t 1{PuVy uR l*6u=p*6t~ jW|$x4$Ajt$jux W<$t$ mE{t V[v1 Vh{*6 l*6u=p*6tA^_[]Åx W+0e Phs#USWV$$D$1t$ 56D$$56D$D56D$Ht$05*6$P辌5*6E76L$XIEtH1F\$XljtwuG76hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG76w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=3t=*6u|$ ~ $@D$@D$ )$=*3 66576PDPl$41dz=u)3HQPP3Q9}j=WpWƉt>u#3HQPP03QFPU 1Ո`1t$XtOË$t)3HQPP3Qv É΅u$u t(PV53 مt ȋN΅uء3HQPPS3Q 53|$ +t$4~jh'W{ u|$$ƅuf|$" L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$" f=46t*fsD$=H t= u ft$}u$D$@f%Lu D$l*6jU[qD$,ED$D$tD$L$` =z3u f|$t$Ut$4r t@*6|$D$D$`t$d D$,F L$l*6=p*6tYD$t;=*6ul*6=p*6t.t$`jt$hL$D$Hs*|$" toD$ t$,t*6.u D$ 1@t$,ol*6=p*6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]66D$(66*6;<NjD$ d*6? D$(66=*6*6Y1PPW 1ɅȉD$PPV26\$pf26D$ H26$26126l*6 66L$( *6L$L66D$D$hP l*6u=p*6t$jV 0d*6D$ 5d*6|$t&D$1f|$tH 5656$*6h t$8*6H *6=t$L$QPy *6l*6t$D$(66D$D56D$H56D$L*6h2626t$pD$ d*6|$Pt jK l*6u=p*6t=*6u 1*6*6D$@z$jW跶d*6D$ =d*6h!t$85*6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x33t3|3@L$D$*6D$pySD$ld*6D$ 1D$T$PW豵t+h*6D$|$D$*6=d*6D$$ 569t;D$=) t=7 u)66D$(166D$TL$$PQt$u |$ uD$0ufD$D$4*61f|$ˆQP$*6$26261@<_3D$*63f`4$t$T$$L$t*6D$ d*63L33`3T|$TtD$(66*6D$tD$p*6D$D$tFD$t D$f|$t$lQl*6=p*6t|$" t jD$u3F t3)N3|$@tht$DhWX&m $P薀^_[]h#5*6t$1=*6ȍPu =*6u"D$4thB pȅu5*6t$ t$,Pt$=h*6uS葕'h#h26x26t$p|$Pt jt$h)D$(66D$D56D$H56D$L*6D$ d*6jP荲80 l*6u=p*6tVW Ph#xh*6u*6j~*6t*61~WVt$tr|$w$'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF 56QjRp ^SWVQ3t1OS jjP t6T>F1"jjP tv)^^_[USWV|$41GGG =3l$0\$S]}l*6AjUfjUPCh uAl*6=p*6t 4$1CSt$SU\$t$_$w l*6u=p*6tS|^_[]h#VP*6u1PPVPjh3R tF$P{*6t.1QQVPjh3sR t*6@=PATH5*6 ; *6 3 3^á*6SVh$b#Z268uj21^[1ۈ335*6thB v|6526 56SSQPV*6á*6ËD$ *6*6PËD$@*6 *61*6*6Vt$ |$|vXPhʼ#1@ *69~1Ҁ8cB*6 *61^WV15*6VD2690t\Wz260PjPfH5*65*6*6@*6jw5*6JWz*6^_USWV$56$j/WFt@D$PWcD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVuD$ %=`uVyjWS ƅuWh%Whܼ# Wh#L$*6x *6V|$|D$ p膇*6*65*6uu~9} ~ *6*6^11@1USWV4h$b#c|$$WαT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#53(14^_[]UWV׉΋ *6uj' k< *611D$ T$l$ &D$ $,$<$\$ D$#D$?6u0uFjh`$W2% %Wi|80uHx.t x0@te^_]fUSWV|$7j/V$Du#$jVP uaK$$WV4kx Pus 1@Ɖ$m=*6ud$$UVuGw8t8w8t.w8 uPVt wV{vju$P OfSƒrtt~ *67PSCPVh:'#jSWVt$|$t$VWi !wt w^_[Ã|$u0jWC6t26*6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$f,89-P3}@v,; L3t,WSQL$ IL$ |9/u 1xAA/D$PL$Q规*6E9u,;E-*6L$Et <:tEL$<:t1ED$(Q f $+ L3AQs^_[]USWV$1C1D$ 1D$D$D$\$h#Hw5$'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ 269A2693t$$1CjWtV@wM$p'|$t&|$ t4t=03x'@ |$u26H 268u56PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ*6/tPEȃw?$'|$u/|$ u&u |$tf<u t$Um묃@+6r533$@th#1@$$$$^_[]SWVt$l*6*6t5Hftfu9503| P1 9p}Ëu̓@+6r l*6t^_[Ã=p*6t^_[USWV$G$$'o56EjWS PqqM䃼$$twhJ#Vht#FGPh$$l*6w>PQ^ l*6u=p*6t h~#D$Ph#/thb#hk#GPh$$Q t*3HQPP3Q*3HQPP3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!*63tFWPbtc6|$tTl*6W`PSnƉf@@ WP l*6u=p*6t u1@+6^_[l*6@+6Q3.  l*6u =p*66USWV$$$j/$|;turfEE^569tth#V?t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$Kao8So8Eo$ u=03x $u  \u =03y& u $MƋ$1Mtfyu03YL$$j$P 1OD$V`mG*6tAPh#m{t$t-'5*6h#>{t>/u19}-9j$$PM ƅvvD$ PV$x3D$(!D$ =u8=*6$Nu$m8tm8t mD$}o$E$\$|$$t$t'53jS\P$hs&VfEo$T$pƋ$$l*6|$ÍD$ uj$HfxT$ ufBuω7 l*6u=p*6t ׅt"G GfEG EG fEGE fEEĜ^_[]l*6T$ Éuj$fxE$ufBj l*6tbiVH\C+L3P%jV$ij$t3fxu*SVm$=p*6V$h#SWVP'1t8|$'L$8u%tWP_]L$ t us^_[SWVP'1t3|$'L$8uWP]L$ t us^_[V't%'jPf@NHu^V*6 03trft fuxB =@+6r^USWVP\$=561N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡03y x5031Ʌx $y $Q503^_[]SWVl*6*6>t+fuwW' ߉?u׃@+6r l*6t^_[Ã=p*6t^_[WV|$D$ l*6jP+@ft*fu vfFGF GF GF l*6t^_Ã=p*6t^_WV t$D$L$ l*6fO 3fOPtGWVU l*6t ^_Ã=p*6t ^_jt$itfxupE%1USWV t$811G$1D$hɽ#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP26:KB26*#$1\$ D$4$߅u U= 't,] ' '8uUPYujUNƃ<$t0vh#4$26H 26(t|h:#-j v2tuhH#vh#2684$t3HQPPJ3Q l4$t%Uh#SPhX#+h%#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$'D$j/U1jUl~e0= Ph.#:uhh¾#Yuhz#Bu h#7t.Uh#3+56 t$|$tJHh#_t$26H 26(ouh~$돡56D$ FjUD$PK PcN<$u$b#|$te#Ph^#~Sh#pt$ct$1 ^_[]h߽##ct$b#RVh#Vhͽ#1PPt$  5L3@PubUSWV|$D$\$=3tD+6H H+6 L3 L+6 P3 261ɉ P+6 `+6H 76Sp26tH 26~L+6L+6dH L+6L+6+L3Pah+6d+6u%Vjap h+6h+6sd+6UVWh+6-h+65d+6x=tEd+60va5h+6΅u!cL+6262V'h+6d+6t Oh+6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t56t D$3 56D$L+6+L3D$?~uЃtRWT$4$ D$1@D$ wy< 26H 26fL+6e$!PVVST$0/>u!y@u=D$ D$D+6$26H 26RL+6Q=D+6unL+6+ L3;L$~[xuUHL+6Q26H 26L+626H 26L+6$ |$D$5ЉD$$ 26H 26L+6`T$,H L+6>~=u|$ D$ RV"T$4| u7626H 26~#L+6%J`T$,H L+6 X.`T$,H L+6$9Ut$ *T$4L+6+L3jPHPuT$8 _T$,H L+6>26H 26~L+6 _T$,H L+68 76w_T$,H L+676V_T$,H L+6$^4_T$,H L+6D$$ 4|$tu^_[]USWVt$,\$(=`+6t56t$D$ 3&j[XNF56D$ P+61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=h+6l*6l+6u(QK9P7Yl+6NQP5l+6X l+6 l*6u=p*6tPh+69t31Ʌt AuQP!u=h+67vA h+66^_Vt$t"h+60v5h+6΅u^V5P+6t1l*66P 5P+6 l*6uۃ=p*6t莻1`+6P+6^USWVt$(PnYL+6+L3PmXL3Gtr}t  KvC#:t /tQ t7=3tAL$,u8 26Q26ZO@랃tPY^_[]Ã=26u Z26L38t!P tx PXu$h;#ljPXGËD$,tÊ>'$< t< s4< w*26H 26~L+6ZH L+626H 26~L+6YH L+6Gw/u}/uEP USWV,D$DD$L$@9A|$$D$t1B'‰T$D$D%D$ j=L$Q#D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ 066T$)11GL+6+L3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ uD+6L+6+L3=3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =26t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$26H 26~ L+6ՍQL+6VL+6MPL+6EK1ۋl$$]|$ D$EÊ>'$< u.26H 26~L+6 tVT$H L+626H 26~L+6 FVT$H L+6]EuKl$ u% L+6L3)L+6 26\$\$L$ D$E< w.26H 26~L+6 UT$H L+626H 26~L+6 UT$H L+6]Eu1L$ }D$n $Ip$'|$t26H 26~TL+6R1G>L$u0L$ QV1>t5L+6UL+6ۋ\$uhT\$H L+6=L+6+=L3t$ t$(St$ WV-uL+6=L3L+6)=26Sg1GL+6+L3t$PS <$t[1@Ftuրut܋ H+6 H+6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#dO)Ѓ576h #F׊t!#u(HL$IQWP576h%#D$ƃHQWP576hH#USWV5L+6+L3D$l*6P+6D$ T+6D$$X+6D$(\+6D$,=`+6H+6l$0U+Q+L3P-PD$ P$jU3QD$,\+6D$(X+6D$ L$$ T+6P+6=`+6H+6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 l*6u=p*6tfhWt$軽 yOQ8tl*6HD$EEt< uD$C낉$L$}1A926} RL$ƅ~N$ 26 FK1:26H 26Q FK1Ƀ=26 Q1ɉƋ$|$t>'$< t$< s< w 26F$ 26Fl*6D$ x PҽD$t P" D$tP5=*6$u+L3jPt$$ 5L+6 l*6u=p*6t^_[]USWV D$4L$@-L+65L3l$)hP?D$26H 26~L+6qPH L+6=L3UEWD$ P[NL+6+L3PZM576W蝛ljӍD$ P]NL3 L+6L+6) 26 26 PL+6SWh|"jPL+6xt$GF9Iu|$"tjVU0 L+6A L+626)26D$ ^_[]SWVt$|$\$`+6t#9Xu 9p ux2jK `+6P+6`+6`+6Xxp ^_[WV=`+6t$ 95X+6~?=P+6l*6?P =P+6 l*6u׃=p*6tѮP+6`+6t?9p|l*68P `+68 l*6u=p*6t芮 `+6u9q~)q$95T+6~ `+6`+6P+65X+6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) '$< u*26H 26~L+6CH L+626H 26~$H $ L+6QL+6 CL+6 $Q$ PL+6$j<"L$u.<*26H 26~L+66CH L+626H 26~$H $ L+6QL+6 BL+6 $Q$ PL+6$gT26H 26~L+6BH L+626H 26~L+6BH L+6>t`26H 26~L+6TBH L+6563*65L+61L+6^_[ÃЃ wAj PV @8ű$<=tuw~;52626b56D$526ØD$D$‰؃AD$$Z|$ T$L$T$|$,>'$< u*26H 26~L+6AH L+626H 26~$H $ L+6QL+6 @L+6 $Q$ PL+6$eØt2'$< uO26H 26~,L+6*|$u^8tW26H 26~WL+6U?H L+626H 26~L+6?H L+6L$$S`?H L+6۸26$Ø/'>'$< u*26H 26~L+6?H L+626H 26~$H $ L+6QL+6 >L+6 $Q$ PL+6$eØt2H L+626H 26~$H $ L+6QL+6 .>L+6 $Q$ PL+6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-G26P26~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rl+69tH9u %8/t F%QD$;5l+6tF/}tEEGXـxs@<$uokt$~tdǀx .u.uN jWt$G t8tG@u@/UPWVH5l+6=p*6tt$誱tWE/Q l+6߀xruX@8tB@9tD$P5l+6葵x5l+6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W)@P7WPHj7p h+6h+6^_USWV\$D$|nOʼnmIWP)|$SUÉps*x 7u߅u҉3D$^_[]SWVt$(\$$W7C H+6L3L+6P326`+6js226H 26~L+6h9H L+6L+6+L3Px6jVP W7^_[USWVt$FPh&b#ĩ3HQPPu3|$Q1ۃ|11E4(E9uSh#j3HQPP3Q|=1C4膤3HQPPޤ3QC9u1^_[]Ðhm#辘hm#贘+6H +6~+6H +6#=~u+6H +6USWVP83H +6t+u y+6H +6~xhL3蛤h`3莤 +6183~PX+6hSp転 {eG68t_83xL.68#>WjW< !Pjj  h"#683p+683@1ҋ+6  +6@@P t 1++6+683{tXAˋ-+6M +6~ @لt+6أ+6=3t$5+6D$p53D$+6H +60~^_[]ø+6+61+6+6h#,USWV=83w l*6^t)kU$~D(< t< u 83Hc F+6F+6F +6G $9t V4  l*6t^_[]Ã=p*6t^_[]-V +61~^Ë83r t ~6u1@1z+6 +6SWV\$t$|$l*6 83y tja1 83I  83A$A +6H +6H +6H XtK =+65+6 l*6t^_[Ã=p*6t^_[RWV$l*6jWٟƍD$PVuT#D$ =uD1PPPVo u2jPVM u <$ELF1PPPV= uZV9t:$Ph l*6u=p*6t菓Ā^_Wh#Vh#ؓVWhٿ#ēVҟWh#谓Vt$l*6hm VjjVA |$ t83H~Q83pxuh/ 83A1+6+643 l*6t^Ã=p*6t^馒83tL$T$9PuHuá+6 83A +6A+6A43Aj8. 83@1ɉH H$H83WVt$|$ l*6|$t=+6W2!+6+6543 l*6t^_Ã=p*6t^_V583l*6Fx PϊFtP ~ u83V~ 83H +6H +6H +6@43 l*6t^Ã=p*6t^U83Vt$ 839tp+6tPu^h #莑=83p+6t-Ã|$t=83p+6ux+6~P83@fWV|$ 9=/6=06@3t P袉jh%".@3MPȈ@3hr P=5@3Ʀ/6B9t jj1Vj莕Vj胕Vjx |069tQju1|06P5@3.0 h莞 /69tQj/6P5@3菥5@3m@31Vj躔Vj诔Vj褔=/6@1V8 tV軞@3Fuh?#J3^_-0 hPh#:-0 h-0t hPhm#@3;D$u D$@3h$b#D26SWV=/6jQEƋPh$$Ǟ|-1GPh;$蠞G;|ۡ3HQPPB3Q O5@3ǣtJl*6V[V l*6u=p*6t{^_[h#ۍh#э`,0! hPh#貍Vt$ h$b#C^USWVh$b#vC=/6261FjPlj+/6i5rO@QPh#Q |,Ph;$+E;|ۡ3HQPP͘3Q ڛW268tH 26@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 /6M5/6At#~i9:0#I {/6#4$D$D$=/6C1tQ~H$8?uEt$Pd>uUt$6t #tl#K\$ueZ*t%tS-tU+E#D3x+;/6}#5/6it #\$1|$ t5^_[]áD3t /6i #뚽 #SU~USWV/6)i5rO=D39u=D3)/6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D3^_[]SWVt$l*6~X1tttG9uމjQu'19}q~5@tu ƆH l*6t^_[Ã=p*6t^_[^+5/6i5rO@Ph#賈+5/6i5rO@Ph3#蘈P Ph#脈WV11FhU#_>kt!Zu忀ރlt puԉпɁu26tg8tbPh$$bm=3u =3u@26tA53jPvW:26H 26@uj)bW53 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh#&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] /6)i5rOC-D3+9tti-;)t RPh#jl$ Ue\$D$P$t+,D$0h#jS0S\$ŋCt:tBuM ,%Ph#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Sl$ ō,@)QPh#w0 hi%jQR ݍ,PWD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁Ph;$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =3$tCt>5@3f,9t%5@3PV$=/6~y\$t$1=/6tEt*t t.<$u u/S0=/6u WE;-/6| $^_[]4!0 hjPh#膂USWVD$4\$,tl$0|$WUS ƃu 8=`56tl*6/6/6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o/6D$ /6$iD$ 9T$tcu tQ=06t 1=3uL$,uP9tPtu 3P l*6u=p*6t^_[]Vt$l*69tP džƆ1z l*6t^Ã=p*6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hY#5t$ntpu26D$D$D$t 268D$t(1PPSȑ EjS==/6u|$1/6-26~6@ /6D$u}t!AH Et{1jPƅt9u ED$u :u G Eu26t Dt111D$uD$/6L$L$t$D$\$l$|$ /6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$/6C$jU9 L$tc|$tNuJD$1rȋi4h&b#jD$(P1l$D$D$L$D$u U D$\$l$t0~Ot)D$/6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =3u V 4Ń퀉0^_[]h]#{Shz#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( 26t yjPƅt,1t/6)i5rO@Ph#H$t#tH~1i0 tPh#&轊11G^_[]Ã~1i4hf#腊3HQP~G ;| Z %PG ;| 3Z;|lh#yh#yV1=/6ujt$ St1+^V1=/6t. /6~$A/61F:uI}^V=3tO=06tFD$t+ /6i5rOA1ɋ3u0VQh)#R^USWV=/6u65/6~%=/6Ft WN/6l$/6~"5/6HI}l*6tfiPƋ-/6=/6iPUVn ~ ;uKuU l$hnƋ=/65/6i 1҉AJw)׉=/6 l*6u=p*6tmwl*6fdž=31/61B|iP l*6u=p*6tv^_[]SWV\$|$轰ƅtt.VSt$W\$<$D$ #^_[0` Ph3#vUSWV|$ 06tWdW~*1506d*6D06V>V}5/6l$t$t%t =3ttttk0hWj~Wj~t uu`mul1VLVhV%^tOhV%h#vVjuV5@3薋tTWjzWjzt*=3t!WjzWjzWjzu/6^_[]%0 hPh#wuUSWVt$ l$|$1ۃ=06t/t*=3t!ttSVDu5<3tEL$ji4DDt QP ^_[]WVD$t$ N /6=3u=32t=/6jP=/6~/6>f@..@.^_WVt$ Ђl*6NJujVj 瀾tW5@3ʉ<u%+/6i5rO9D3t mjVt=tu  ρπtt=ttu ju VK l*6u=p*6tr^_0 hPh#DsSVD$L$ =3t1ۅ SPj~\ ^[Ët$1҅tހu1=/6u2/6u) /6~/6:tzt IuhD#~/61@SWVt$$1@=/6|$(1@D$r"$P'Wh#bjvu h4F#h?r%tjjvjv 1~ hF#21@^tjs%;thi#h˥$jvh%1Wvh\#1Wvha#Wvhm#jvu h4F#xhJ#kjvm~ t+u h4F#Ghq#:jv <u h4F#hx#|#Rjvu h4F#h#7h2"v h;b#jvh#jvu h4F#hX%;h#kFp]h;b#P~tF1SwJh?#.Sw 1> #t#P uh#hP$vh#v#'14#1###1#N9tQh&b#jWWSxuF x%Ph&b#jVRVjv S h#51^_[hf#hf#jvUSWV fD$ /6 /6l$ 1D$U$u1!" $']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻q&!$}D$##} u#$%)4$<$zT$tvӃux<'t ur>u<'_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<':'$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I /6/6 ^_[]WVt$ tG|$t jV~t'h?r%h?r%jVvu^_USWV$t /6 =/6D$P 56t 5656 $=/6z1jh'St `P>;Hx@u8/UD$PV#x D$pL$t 1D$tD$p1ɋ/69/6*6tH1 8t:tGt89=P3Z 9=P3~*65L3WPV >?#<=26l Vz: fiDle cDhangD ged߉V~v3HQPPvv3Q D$pL$t /6/6E;-/61-/6D$PĔ^_[]GfUSWV<1UjD$hhh UPjt 蜸襸N9u 9È806j Upu <06j脘@06h$b#U h,#43,$UhD069t$T|$Pd*6D06|0606@fD$PVWVW~=806 Àu {=3n$h<#h*6ttQu *6 *6<$B=35=06(ȃu6=|060626$h*6u7=h*6u73HQPPt3Q h`3tD$Pl*6=p*6tcg$$=806u>h;#J't1PhI#QPP[V$=3u3 806t N=806uEt$(VhS#t8t$PTPV$76=3t =26tj<'kuD$P26u/jM=3tFh"#|rh`3s*1ɀ=3ˆQPj=3u=26t43765*6+p$$#uSWVD$8t^l*6jPDqƅx jVO l*6u=p*6tvex"1=3t=*3t*31G ^_[11=3t 31j蜉V3V芉=3tt*3u3^_[USWV|$(V11C=`56tn1=3u4t0j53ujh`3q3P=83t.te=3u\1Ƀ=/6 /6jPPi1;tW1R=3uIu=3t7=3t.hW#hpEVuu$u蔆V#^_[]Vt$l*6jVsox1jP l*6u=p*6tcj^Vh#ct1Ã|$|D$pPmmft$赯 tht#ct$t$肺 tht#cWV|$ W:@Pn tWPp^_ht#ZcSWV|$P39~b9l*6؃P tr H3 L3P3H3 l*6u=p*6t wbP3l*65L3>L3)P3 l*6u=p*6t?b^_[ht#bD$t L3) P3L3j h#j)l D$ H3 L3H P3H 26H 26H26ËD$l*6H 26P l*6u =p*6aVt$l*6H3;t H3PX FL3FP3F 26 l*6t^Ã=p*6t^=aUSWVP3<kl*6-L35H306t|F9uuH3PVD  H3H3+ P3 26L3=P326tG90uC H3 L3H+HH x@WSUP 5L3=P3 l*6t^_[]Ã=p*6t^_[]S`ht#`D$l*6L3)P3 l*6u =p*6`V5P3P3265L3^V5P3+526P3)265L3^ËD$ L3) P3 P3L3+D$ȣ26USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]h2626=2652626^_[]SWVP\$t$t2uhxU%Vz1C$"h#^Zg%(,3u*23b#03RQPh#^y#uȡ3HQPPtZ3Q (,3t"23RF#tn"QPh#h^ u.$(,3tPVtub#VPh#M<$u#13t(813uƁ23u숟23h#1 [3t$Y3t(813uƆ23u Z3@uă^_[V(D$ T$039tub#RPh#Lt#13t(813uƆ23u숁23^WVt$ ~t)~tP uvި ^_USWV jA 26t_y 8-uUD$$26126P  26y8-@P1F Pơ26)l*626=26~-26Ft7 261N࡜261ɋu26 l*6=p*6J1F526P)ƅ2699Sl*6 2626lj4$މt$\$)1*C/5269rL$ 9v!\$ۋ4$ P; 26w4$ 9vQ9w26 l*6u=p*6tIW1 ^_[]h#2Jh#(Jh#Jh#JSWVT$ 26tstm8u'1z:trrD8uAÀ~:u"9u 26Q26 tf 261ɉ 26D526>1t6?-u1t+O^26-uta5261^_[Phi#:IPh|#/I|$u1PjPPgel*6jw268t PI l*6u=p*6tjH1ËD$Ѓ w#j jP u2626ËL$~ND$tH  26=26u 262626h26h26Qpph #CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$b#h0#Y J|$:uUD$8@?jPh0#Y ^jUh0#Y 1|$D$0)@<Ph7#h`3V jh0#f1?\$D$01@11T$4*l$Ph&b#j UVhUhb#Y D$EEjUt$0X u0^_[]À|$:uD$8@:PhK#K1L$0L$4@UjEfVD$ 831qqA1Ʌ /60PQ83p ]t u 1%8383@j* 83 u^qqhX#EPD$/6/$aQXUSWV'ơ83@tu'tƃ 83 x,$@D$t.$xm$18uWP{tG 'uD$tKjD$p4*t6NjpVWPVl E$ht83@^_[]USWV83@|$u 83A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq83@@|$Fu6|$uD83@ 83Ap8 u|$u83@^_[]jjX 83ASWVƻt u j pxʡ83@^_[USWV83kE1͋ 83x t*/6,PqN83@ C1Ƀ8Qs s j@83HOH O oKy K9t?U1CSpt ^Sh<'P= 83HO@ G 蝯83!^_[]WV@t$P 83A uyWm wWhZ#4\ 'h#j"Q Whr#j"PQW-uL$Lx4\ 'h#Vh#jPQWUSWV83@1u 1=3tMtݡ83@xuUj @jtÉGpj`aC+t83@tj,(pƉ^_[]h#83t$p0h#O@USWV83@$ u83@$EŃCߡ83@$'$ 83APUj já831Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt83xJjG B u083x,u%@B't@/@B'uh#jÀ=3tjjj 83H0+H8O U 83p0j^@ 83QPI H pGu583~ h8%vm|$F83xujD$ 83Hu 83H L$ qx0j@83HKH K {@;u.83x }83x|$ T@0GjG 83@t(HS u 83@83x\$\$j 83HK @0Cku83x ux,uh8%p0jP@<31ɉH H 83Q0PCAHrAAtejC9t jW\G @:83@ u83@$EŃ!ߡ83@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$83X0j2x@ 83QPI H X t\$|$D$C 83APsVL 83jj 5jj,jj#jj jjh8%jjjjWV83x$G Hs83jpW$ uq83p(x,u~ 83At8 u @A8 @tHA~րxru\tuՀh#83p0+p8j@ 83QPI H pG .Pt83@F 83t1^_jjVt$&9u^jVVL$1B'tA1B1t AB'u^uVt$j@ 83QPI H p^USWV |$$tD$ D$$D$l$E1$83xc 83x0$t $j\ƃF 83QVI N ~ut. 83IB'tAt=t AB'u1c83H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc43 83A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(83 $+H8N~L$NL$$N @0FEPrj/vAuG43 83+A8FF83@4 ^_[]jjjjh#L$1B'tAt=t AB'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;@06}X;<06~P<06I;-u{tBuG83x0+x8j@ 83QPI H xF^_[F h#lUSWV|$43D$=u ?vl$$5L3P326G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4383HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uN26H 263\F u%26H 26  F43#á26H 26ƈF t詚=v43菚=t h ' u4383HH 26H 26r=L3)FV,83x43+D$^_[]USWV$$1҉T$ T$$D$(54383r0=<'t1$|$ fw|$1/fFn D$j8fNL3 P3 26=@'u ƒ=26‹nD>  $d '=:'u f|>z 2643Bס83=:'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=>'fu 26Bn׍MN|$=@01fD T.fTT.fTT.fTD>'fD1AL$!(ljƒ(M 26FD 26BvNO|$s@81ɃfD T7fTD@'DfDfD> 0 = 26\G_T$ t$>Hff 26T$ Bf|>D>u6t$ˋ nMn 26}f|>  26BFfL D$$D$f|>tD>t 26Bf|>u D>v 26BW 26B*Ã{t B' 26}E+=L3 26E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $z nMnD.=:'u 26 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD<'fD 26T$ B1AL$ I) NjFfL 26B) 4383@8xt /6 /6$8W Nf|F\=`4" $"}f|  26T$ BFu6$ Ft$HFuЖD$$D$ Poſ1۹$ 'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD<'fDu6t $譇 FHF 26B赕= t]H\t 'u 4 t =u 43831Ƀxɉ /6$6 26T$ 'uF|:' 26F$ >'$< u 26T$ BT$ 26 cʔ,t$@  4383xD/6?B'L$ lm3DAD$D$E|$}~>'f|t 26 26B\>' u 26BNf|t 26B1@D$ 26 26B݉ý {"XŃ', D$0$R nt$T$ Mn 26B1@D$t$C/6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M 26vNO|$@81BfD T7fTT7fTT7fTD>'fDőL$ uk%=I =26 D$ wF 26P?ˀ 26@ww 26 x?ɀtw 26@ 26W?ˀul 26GXT$ W 26x ?ʀtw 26E 26O?ʀ 26Gw7 26x?ʀtw 26E 26O ?ʀtw 26G 26A?ʀtw 26A 26H?ˀa*2626D$D$$26B1zB't.26H 26LjGq B'u\KЃ w426H 26LjG; ÃЃ D$ u t 26׃Z 26H 26]=Gt/ up}tk26J 26/#@ǽh#tE%t@Ń:bD$D$$/ '諕¸U1#,W9uڍ1|$Nf|uf|t Ms@ L39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|:'fq fq ƋT$ +6H +6~+6H +6 ډËFD\$D$$/ 'NQ1/ ')G 26x?ʀtw 26E 26O?ʀtw 26G 26A ?ʀtw 26A 26H?ʀtw 26@ 26A?ˀa2 26AD$ ??26H 26~2G:26H 26~$_1c:B ˆB1=:'nD=@'G=:'tf|cf|.326H 26莿5L3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B83L$H,L$H $վ83pM tΉ${ Nu83xĨ^_[]1HE;@06} ;<06~<06>uxkjy1$&tu>tyu6EBE9E0E"EEEA }83h$ Ή$z Nu=tuS$#$&#43 83A0$N#u$3#b$|#V$a#J$2#>$I#2V 83xt@@ ^Ãx t#/6$@)83@ @8 43H0+6H +6~+6H +60諄ƃ~0:=F $ '> t=u럃F~t\u^ 43@43 83A0yt/6 K/6$S(*;|u0d|83@=t*ʆ4$D$D$:'Kuۡ83@1v u4383HH @1@Q&83@-83@83@&tQ;ub83@ 83@؅83@83@ 觅83@u:\u?0 u64383@81Ƀxɉ /6P&Bjjh^q"A ځVȋ 83y8~0 26Q26@ 83Q8rq8^USWV\ӉΡ83@D$ 1,$d*6D$^+L3D$$UPl*6$~S"ʼn$S5L3P͋ l$|$tD$$d*6 l*6u=p*6t?w43D$-L3P32683x t*/6PL%83@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4383HH s`un=ub\tX`tS43 83QQ NDt""u$26H 26~E\E \@ŋ 26A26@26H 26ٷEL3@|$t~Pt$jP荅 D$pŋȅut$ j轴E83xtH@1D$43D$jNǡ43D$Kt5 83At$ D$AExK83@t$ Ex P39ًl$踵 P39~=L326t1SUW6 )26l*6Us $ l*6t\$=p*6\$t 83T$ Qd*6Nf|u%Du 26Q266@Vt$+t$ 26Q26@~.F26B26ȅAJ։ȃՃ\^_[]á83L$H0h#W~<$t 4$r /83@D$d*6jPjj#jjVtQYr N^V 83$b#ytA5/6t7t u(56H66543P5/6#^USWVt$,|$0l$U5P31BW;L3u(VG269w&26WVS Uڲ^_[]Áw: t9v$P526k tã26$26랾#뤾#USWVT$L$ -d*6҂Ɗ*3*6D$1|$083D$|$ljWtJD$83*3V艂-d*6D$*6h*6$b#jU\$t$l$=d*61F5*6D$083$V\$S7 !{Vh<'P 83A |$t|$t=3u #@݅u:T$1rIJ$JB *3VVRM -L3=83D$*3t$臁D$d*6D$*6؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 361t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 26tu(Mxju PQ.Ex PtUn uF^_[]USWVl$ t$\$|$t|h@VSd VSeDžt9u 9t S 9u95D3}5D3^_[]Åyh0) PVSh0#WWVShJ#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ 36$36M|$];@06};<06~<06Eu9] u36tX9X536t-pt 9^t6SLF9t S 361tF9Yt? 36tHt 9Y jjS PkD$($@t 9XjS1xl*636  b36 <069|AQjS ǃt;=D3~=D3x jjWg jݫ$JBXxp l*6|$u=p*6tu26t$(WUN mC߭1O ntuK536jS DžD袭8t 蘭8ujjS Džw08 PShx#\$t 3t3|$t 3t3^_[]j PShu#0 361tT$9Qt uÉVt$536j V u 36|Qj V u8FPj V u$j j V ujj V t;D3~D3^h# WV|$ t;G;36|.GPSƋG9tVPWww^_WV H3 A H31F |71FPWW y w;D3~D3PTgfff  36^_USWV$$$~l*6 8k$8 'n  36t9i V 36tQt 9j b Y<(O8=3tNnjUvƍD$PV#D$ =nhh]n$SUoƅtjV{!SjVk $/nhh nhh U ƅV;5D3~5D3|'u" 39uu-jjW 9t1jPWV l*6uQ=p*6tH A1jPWUy v 胩0D PWVPW l*6t Ā^_[]Ã=p*6tĀ^_[]< hh j PWUh# 0ր PWh#k 芥1F5*6V0 PUh3#A Ш8VH8*6诨j0 PUh# USWVPH]xa|$\$;D3~D3oU肘= VUS 1jSSQ t!t$$^_[]h# 4$1EUj0Uj%UUUjSj Vwt$ g SlVD$536l*6PV]36Vue  l*6t^Ã=p*6t^t1=26SWV536t4|$t^tCx PjV6u^_[SWV|$ D39|ȋt$|9}9| D39tVojjVW 9u^_[ϦWGS~ PVhf#WV36 |;@06| p36t$ Pj V y2x8t n8u>36 jjVp ;D3~=D39t V^_Vj 迣tL$ T$536036PH^á36tT$369Pt uWPc EUSWV$|$<\$81D$ $D$1F5<5_3h#WSK !1tbhz$Wh#W؏uo1<36tEl*6436[ 36t jV l*6u=p*6tF@u46>hm $WPthvm"W>t D$1p@|MD$K}h=%Wt8D$D$h# j531CKD$D$u}h&# v11 t=t8<36u.u h#v VaPhg%  GF@uh"#A F@uu=46tk1uu莩ND$E11P@É|$t<36tW436h#Ah#<36t436 h#{SfPhp# Eluh#53 Cu|$tE1F-l*6D$t P1<36D$t436X D$36t jS< l*6u=p*6tEt h"#11<36t:368u.u h#aVLPhg%   GF@uh"#/F@ut h"#1<36t?368t3h#436VPhp#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=46t61B=06tbu^1Ƀ~7t@tuH1=34 36t1Ҁ9ƒ (u1=3B1ɉσu1B461t)9t`tbփub1^։PjS $u=3d1@ָ PS處t^u46u jSf1D$ D$D$$K?r ' 1@ jPj ^_[À=3u=26u =3=31@Vl*636>t8t6U 46r46 l*6t^Ã=p*6t^eSWVt$u 461ۃÿ36t6368t+l*6SP l*6u=p*6t36=46ru^_[,^_[V1=46u#361A:t2>u 46r^WV|$ 論046u"t$=l*6tg=\46u^p*6WuS = 36tӃ<36t>368t2t-`46`56=3tu=l*6u"!0^_WV|$t$ 46uWVj46<rjVuƆ46^_áh36=46t1Åt8uUSWV\461G`56<`46u@@uu`46=46u΋436tãd56S-*6V.jPaVS t<$tS-*6m \46^_[]ù@rA<\46tøWVt$ 95h56t)1Wj;Wj0Wj%5h56^_ËD$l56p56USWVhD$=l56up56)=\46td56t D$D$*6p56*6=`56tt$,jV4u 5d*6et$,jVu45d*6=46u%=36t?t,136PWl*6jVu5d*6Bjc|$wfs 5p56C1ۍD$X XXPjDSW螐\$\$ \$\$O?r P1@ DD$jPj b7VPuf53t$WVt$|$ ?t*FHN V>Qu953u V^_53t$WVt$ Nfut56FNtF t0fu^~l*6 ?NQPF N)Nl*6vՏF FF l*6u=p*6t V N^_Vt$F t-)t'VfxQPR yNFN F^53t$USWVP|$t$j'V ]t~th#Vu<<k>t!h 'V1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=3uUWMGHO W]H"WVGHO W3H"^_[]WVh 'QLj'V[t)19<>^_hL3oh`3bUSWVD$~@|$l$1SWU^ t 08tF r)~1H^_[]ËD$)D$l*6X3tPL 1X3P3 l*6u =p*6PD$L$ T$$RQP XVPt$t$V6 tt$ P4$YL ^h#PD$L$ $QP53 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+76+56Pqq hP#jh66襤66SWVP56h 'C PVw u,$$wD1CGσCGCuhL66Vhq#8 u*$ @66@66D66H66^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv t61^_[]ËD$t8SV RƋD66`uH66$9J D66|#tu#$#t%0H66㟉D66t$D$$J# ^[WV<5d*61$|$PWt $D$PL$LT$H=d*6PQR 5d*6$<^_USWVL$T$tHtA|$9t91B'Írjt/9t+1B'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U'{V藈Ƌ $A$~ C@ $Q$f=t @UP-WVp ^_[]SVh#WV<5d*6*6$|$jW}u"D$LL$H=d*6*6PQ5d*6$*6<^_USWVD$ èu|$=Z3uÍD$PQW Ƌ@l*6Nt$݁ uF @SPуF`u vG F~tuF1Ɏ! s%t É^~56t56u56t j~ l*6uk=p*6tb[r2j賆XxL$H @ $  $#`uWF `u WF fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=26u0@=26tc@=*6tf@=3ti@=3tl@=806tp@=3ts@jPh#,WVt$|$ l*6twхVP? l*6t^_Ã=p*6t^_WVt$ t|$Wv 6u^_USWVP\$l*6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SfRS迄UPu< ؉G@543S543hT3PY ~ F1gjt$,66uQG L$<=u556H562UjS $81F FF56,66~66566 l*6u=p*6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ *6t8Q12<08uF=u =ut j=RPF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVT661tr:1҃Љu66r׍P辂ƻT66Nj+t7Mȃu%EttUЃuEmŃ66r^_[]SWVT66>tLGu% uwB Gu#WA @tw݁Gg;u66r^_[2SWV|$tfh#W.Ws9uWh$$V't*tUj'W Ot8)WPh# h# Gh#Whp%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhlI$tUhlI$>=uD3HQP~ j( P 3j)n~=uGuthaL#EU3HQPP3Q ^_[]USWVP66u66 h66T$ t$\$T661<$?tIOt !T$ ttуt݋ 669|QPT$(66%66)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPVI1>?f u%PV+1u%#L$1PV1t1Ʌȃ|^_1@Ow$ '1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$; t$M19{USWVӉϋu76fx@$d '$PW 1ۅD$PVr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW<1ۅD$PV$$L$$t$<|$@11$;D$D9t$ aZ$PW1ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVW!i1ۅTVWi1ۅfVWiVWh1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]rQ9-u1tQyt8ytBÄth#Qg't1h) jjh'Qh) jjh 'h) jj hP'R_ËD$L$  )VL$D$ 2)u AJ)^USWVPuj PV* ljnu8t"duځ8"u 11E9s:$9t( lm3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉Ոt 9Fup  ^^-I9uM1PPKI~ōP@rPU$I~ LH;NuS[2 #~^_[]ÐUSWVt$(h$b#jH D$,^H $x?-Ok-u)sstdluu~xwGWÅu"lm3DHt'1Ʌ SBكh#Ehlm3DH\ƃ~ƀtVŭtVVh#jQރ $hg&Sd1Ʌt:Su+$891V53V|-$K$8ʉT$h=%Wid1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.&|" $4Ph% 1@D$l$t jWqj D$PUdT ljӋD$9t-ف8ur1u q8tQ#x$b#UPh[#3 1@D$\$ $4h6#1@D$F \$ t$Ph#j*6PPPPh#532jWVPΉj WQ}S 9u=у|=}^_VhE#jQhr#dj53j`WV@h+6+6+65=>t)j=W;thW>uPh&b#j@V jVhj# Vh3h~" "$VWhb# 踃#t%VQhJ# j,ho#hw#q VWh#bL^_=h*6t 1+6+6T?83261262626936tj=36u3L33`33tP, 3Vjz15*6 ><35/695T3t\3@8@u jRl*6jD\46uƀ\46@u l*6u=p*6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$4'$T'Vw vVw d_ t"Vst Vw?w]N@F1Vw q#w ]N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u4'E$'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t") Ã|$) USWVPu }76 763f`|j%vh6m O1@ 0$76D$,(76|$@t$(q%v>%L$ h#V9<*u C he#S1N .u{*u{ 1HD$Che#S1HD$  t$CD$'C`L$&~QF0 $'. D$׋L$ jj D$tfL$tjWt$QPh@76TFu$l'$76l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph@76Ti$76L$ Q0]|$$76H $76T$ l$= 76uM|$L$ jL D$tbL$l$tf|$ L$D$$@76bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$@76L$\$L$$X8G$760$76E ƋL$ cjl |$D$VPt$w$76$76$76$761  $76 $76Wt$*|$$@76 \$$76<76t P% VRWP <76҉D$xF\$wZ$'a=&t1"u@"*\\t#'u0'btnv fre\qFuZlm3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~V76,76T$t P# T$,76076t P# T$150765476Љ\$H\tF5476X])P0tXM\$u/^t-u#F5476벸^tic\$>T$ j5476F5476{ lm31:DYt 7GuF5476\$DF5476ȋ\$+1L$ jlD$t1L$t5WQg76L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h@76 PRQt$QP  76FPv 076 VjxP=` 7s076T$t t$L$ t PVRQh,76گMT$L$ t1PRQh,76軯.VWh@761PQ*t$P PQh,76苯 t,76876T$z \trB<]*<0tu$0' ?$'."'#Eu uSh-#76 4$lm3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#76\),ҋ4$u|$ uWh#76 ^_[]WVP$760tp$76^1ɉQPV Nj lm3#DQt$c#r& $76+ (76VQP4 761^_SVˡ876H 876 u:3Prp~r0 P{3Q 밅u876)3HQPPD3Q^[SWVP$760t"$76<'t<"u1B^_[11f]1ɉQPV#@ lj+t:<-t6 lm3DAu)$76+(76VPhZ# 76 $ڃ^_[SWVӉQ8MǃArVhK#76GPVh@76 D$=76>76Ƈ?76^_[USWVP׉1PPP. ,>UL@PUQ x$tG9tC$76+(76VPhn#.$76+(76VPhc#п 76$^_[]WV9t"΀:t9$76+(769t\VPhn#Z$76+(76Ph#賿D[8"uD=$76+=(76j"3 PVWhK#~RPh(#m 76^_USWV\$$8l$}hJE j jh'Ukƅu!hJE j jh'UkƅH h]#D$w؃tD#D$uK#؃L$u R#D$uZ#@D$ub#a D$uk#B D$u t#"D$u#D$u#D$u#D$u#D$u# D$u #i]=76tj f7676# D$u# w %u#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u #D$u#]=76tj d76؃76#wu ##jw؃u*#LD$u1#-w؃u8#D$u@#G#u=76tj d7676O#w %u V# ' ]#u D$u e#Uw %@um#4fD$ut# D$u |#D$u#D$u#D$u#76tj b7676#'tX'|$FTPSh#jdWa,^ u΃=76tj Ob7676tj (b7676'1' tN$L :Ntl P#PSQLa#uFj PVc =A8u$8u؃^_[Vh$$jzWVh]#j<USWV f]676j ]6ƒ ]676 ]6€ш ]676 ]67676hn#t h#t8ƿ!'#PV12tG uVh#jc $$1ɉh#SU. P6$,'76kj j5$<(b ƃu?8"57676v $<f76Wj j5$<a ƃ _%76j j5$<a ƃu,?8"G5767676761A5$<[5$<hS.#V0tch$#Vu0K7676B7676/76#J>8"tD576  9u76rCjht#5$<hY##Vh#5$<h@# 5$<h'#j*u h# 76t 1ҁ‰76]6փ9576u<976u2]6976u#]69 3t 37676=76u\1ɅQLh# _3=76t)ͅt=76ut 1jhh76P4E $yh76h$$j=76u1D$(Pt$u#D$0=u 76761N1$' $$h"@.o"t$h#Qhs%hVRV76t49t0$#$#9tS.#9tS.#QPh#^ 576|]6]6^_SWV~#4#'#'VSh#h|f3P+#ujAEVPjj"PM th#,^1Q1T'$ =uh| jj"t$ 1$4諁F"u4$+ 1@^WVκނ u1H3 r1P^_V΀=76u6=76t񺋁 t41t)Ph;60h;6hedAV xk^Ã=76u񺋁 Jt=76t776t.h;6hedAVp th;6hrdAVY t=t=6ujCh#jh+#jZUSWVPύAPjh#h$f3NGw40#'h #Ph#h$f3N $f3w(h#VN w,h&#VN w0h-#VN w8h4#VN w4h;#VzN W4O<W8#9tQh#hB#h$f3ON$b#OHtQPhK#h$f3*N$b#OJtQPhU#h$f3N$b#OLtQPh_#h$f3M$b#ONtQPhi#h$f3M$b#OPtQPhs#h$f3M$b#OTtQPh|#h$f3M<$f$1۽a$f3Pjjh#wVh#$f3P(MwVh#$f3PMGtmÈJ9|6{u;[tVPWh #fXD$(ffL$(D$ 1ۉa)D$u!)tPt$hM# XL$4 <)ǘ΋I<9vt$hz#W$N<.”T$9vt$h#W$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#WW D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( l<6p<6t$(L$QhVW  D$ 1h#VgtG<$hr#Vv4(1>tYj:WnD$AL$\$hr#Svv,1tD$hL&Wtkhd=$Wh:#Wn\D$Ph\#W  D$q;76efj<6ujh;=&l$!U_ l$0#'1tUP QF#'r܉1hD$ Pj <$Wh#_UD$ D$t$ <$}trÉD$h&"Ub t:h1"UP t/h6"U> t$UWh$#T F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhD#sTD$ D$<<6FʼnD$uf5;6l$u D$l$l$h%$WlhH%WVh#W@h#W*h#W h#Whݭ"WTh#Wh#Wh#WUhT"Wkh#Wzh#Wdh#WNh#W8<w ~W|$Wh-#R T1<$8<6jD$<$rt$Wh#R D$f;6@<$Whk#lR76fj<6jUh;6jUh;6 <$t$ht$0VWR J21jD$ Pj< D$<6뜉1jD$ Pj D$ <6q1jD$ Pj uuD$<6J1jD$ Pj uND$<6#1jD$ Pj u'D$<61jD$ Pj^ tt$W|$Wh# QD$<61hD$ Pj uD$f(<61hD$ Pj uD$f*<6a1hD$ Pj ^D$f,<611hD$ Pj .D$f.<61jD$ Pjc D$0<61jD$ Pj8 D$4<6; 76sr"jW|$Whh#W|$WhH#΍L$$ t$t<6|$]6L$$ L$x<6t$]6rhr#Vlol$}}T'1ۋ>t.WLt t uPUWo Á'r D$lm3MDHu D$"91hD$ Pj t4$h#ND$ \$"r)Ut$h#N h#}ND$1ۋD$<6ND$<6W4(t$|t%hr#VHn L$1Ҁ<tʉT$D$< w'<$$('L$ L$|<6<$tL$$L$ L$|<6|$]6cL$$t D$|$]6L$|<616FL$<$C fF|$]6L$! L$|<6|$]6t8L$$ D$|$]6tL$|<611A<$D$ h;61D$ ȁ(^_[]4$h#LD$ WVPθWEV;6d<6fh<6h;6 fh<6=76u=76u#$}h;6hgdV 1h;6hfdV y#8t #8uv$=76u(PhmdVn xX53he} 71=76u$h;6hgdV2 y #1G^_ù#h#] 뙃=3tt$ t$ t$ 6 "1HVD$ t$=;6thPh;6 ^D$L$01wV"t,uVh#-t"uVhX#Vh$$%Vh#Vh#J^h]6hmd53& USWV8 $RPh hx=6Q蛓x]6 76v|Pt$hp#aJ lj D$T$1D$ XƉ 11 ‹l$ ?6 x]6x=69x=6hWD$P $;D$$b#=t=6t =}t=}uЉD$$#=76tȋ 76=WEVuT$tf976rD$Pftt=76%4$t$Uh#/I D$t=VEW=76$t=VEW4$t$UVh#H=76|4$t$UVh #H=t=6$D$PSt$Ut$Vh5#E8=76u $h76S$f3V 576SVI SGSt$VhVW t=6D$ L$D$11t4$hI#,8^_[]USWV T$ $11F1Ń=76|Uh#G QPWD$Pt$蛐9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=76tUPh #F Ɖ ^_[]Ã=76tUh#=76tUh#FċL$T$tPh;611@PhU#t"j QP"@ u8"t1H761Yhe#jPh#t"j QP? u|8"t1H761Yh#j轻SWV։ϋ\$+76tItEu761tGtBx=6 ?6x]69w1x=6 1tth;6QA1@^_[Vh-#jL$1=76T$ PG1ɅɉWVx]6~( WRPhx=6Q x]69u ^_h^#uQVh#j診PQVh#jiUSWVPӉ΋l$|$uj WVi> Eu"9"t:M";L$ w,O>t" t9tlm3DJ@t1^_[]WV1t>΀9t7hr#V<t#ƍFhr#P#d1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#C1۹]6؃^_[]ËL$9/up<6D$\$A/jPU u$D$ <6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#B]6!Wh#B]61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#fD$$Th#Sut]"D$'W PWS  '> uۀ$U-$T14(%'D$XPO tpC"uD$TPh#0$T$끹#(%'j" $eFMu SQЃ {Sh#\0h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h#/$PQh/#R~$ )뾋$G8w4h.#S t*Vh:&S9 tShC#(뾋$G4w"Ph#Q? ~5$w$#']6]6 hw#rZVh#P~I$ $u ~ˍ|$@WV9t"b&J~PH k$#'1OJH w@$$' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=]6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#!"h#"~USWV|$t$t$h"V$ Gw4%'hD"Ph"Vk$ GPSh "VS$GPSh"V@$VjjhA&GXtVjj h%"GXtVjjh0"|GXtVjjh5"cVj 3w(h>"V# w,hP"V# w0hc"V# w8hx"V# w4h"V# w"@D$Rt$UWQP!$71w8$Ћo,1lj1l$DRWt$>"P@PUaUD$PShG"$S!$#a0QShU"$S!<.Ǡ!w4@&'hc"Phk"S`!  w$%'5h"_<t$uM55h$b#RPQhr""555WRPQh"S 7h$b#h"S  "55RPQh"S M8tDƔF1Phķ"S  F;Eu 1<1A71Au01<  $jj@PD$PWD$ Ph$$C9u<$u4,f3H ,f3~$f3H $f3 h$f3j 1^_[]h#jžfUSWV $ $ D$-@1]6]6]6]6]6]6$]6]6]6t$ h#US c~!P$&' ]6˃PtdT]=$<?1AJ5$<d]6뒹 .$<]6h$b#n ]6b ]6D$]6T$:@=]6l$<D$ Tnt uBxou D$ 1Ɉ ]6h%V t]6h$b#`ء$<$j:W/C-]6tWu{tm繨]6S c$ \W]6t]6t ]6_39$ 1ɉL$tVh$P tj/Uu Uh#"hPh%h$ UV苊DžuV謉Dž7h$P蛛 ƋohD#W]t(hh"WKth#W9pV 1QQ$ 4PU7L$9C9$ $ 9tUlj?,$u1QhD$PQVs h]6hzd@P tq$ PhedAW W j|$ WD8$9",''uWix^6,$h h 5]6P Ġ ^_[]hs#j"$Ph$$j>Vh#jhk"hj"ʍD$ Ph# D$ Ph#jD$ Ph#롍D$ Ph#땍L$ Q48''h#USWV։ϋl$jh Vݟ Uҟ CCCOK G^_[]hP('Ph7#h|f3j USWVP׉΋tASW4$4(VSk Wh[$Vt$ P W8 É^_[]USWV|$1_hD#Sgt$hh"SUth#SCu\]6toU3't[u=]6t .=]6t%]6toU3t [u^_[]USWV$D$|$]6$b#tW3t CÅush4$t$ uD$b%D$ ]6t L$ mt L$ ^$D$ D$hS $$ t$h.^%hV"$0|$D$4$L$h%Q1G@΍K9|,SPj Ŋt><-u(GD$tj=V&t>FD$ GDp#th%D$P0u|$1F1B,$֋$$$,$D]6tP$b#t"P$h#d xF1Ë$4hg%HC9uj W迬t2ƅ|$t t$衵 4$薵 tA710h #n|$t t$l 4$a ^_[]ÍD$jPV0B x!L$ȃtuuh_#묁tlP PUh:'# 끉 ]6utD$P$^uW$P$uPVhe#  jPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj jUSWVu^6$Ph%o$|hWV` t Ƅ|D$PVn1ۋD$ !=`= بtLVH0h$Pa Džu6h^6h$$1 Vh$P DžD$PW7nVh#Wh#ue^_[]Ë$3D$($3L$$ u^6Vhh^6蚪 t9Ǎ$PWmx#$= uVh#{Vh#pWh#eUEM JRtHPQh # t$t$h#hhb6b6]á(c6tjЃj WV01Gj0h('W\ =,c6jj0^_SWV01GWOWSjSv0^_[USWV10c64c60c68c6"#ty#Pv vvh#h|f36x$SWV։ϋY Wss ss҃ Dc6t~j HWss ssԅuA Dc6^_[ÐWV1t$|$ ɉ @4uzȉXȉX\ȉ\ȉYz9zz PQ40y40<8y<8D@yD@LHyLHTPeyTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40x40<8x<8D@xD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7xVw wwV FwwwVFwwwVF^_USWV\$l$EffEffCEffCEffCu uwS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuvSCuuvSCu$u vS$C EDȉCDu,u(uvS,C(E@ȉC@u4u0YvS4C0EHȉCHudh#VŋFNd6tbSQP d6x 8e6~,=e6tffOfGG@ Չn,~$N()ǃ~$N(=8e69<$D$hP-8e6>N,ș)N,)n$F(teh#V$FNd6tbSQP d6HT$<L=e6tAf=e6t4f.<$ ^_[]c68e6F,)F$N($fOt@ c6븋D$L$t$ QPQPUSWV$$$ $$$(hlI$SV\1j wD$SVWUhPD؃r_4e6950e6rPSV Pt7=e6tf%"=@t4^#WQhk%d WhY#T^_[]USWVP|$\$s s@=e6tf9uRe6t=c6t=d6tj:D$1PPPs sQs s6OLc63C Hc63K u 3&=e6tf%"=@t4^#Qhh#胣s s/)SUhv# c6u =d6t:yj h#c6th #y$=c6uh#u=d6e6t7t;f5c6D$e6jhb#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=e6tf=e6tGf"@t4^#Ph#/SVz.=c6t)1=d6L L h #O#h#$p$l tRQf@ Lc6Hc6 1VW 3L$@D$DD$ t$|$ d6pt95e6tʋ d65e6T$Htt tɉL$LL$QPh#=c6uh#5153PPPjLc6Hc6  53RPjjt:d6=c6h#!D$L$ Lc6Hc65Lc6=Hc6 tYjj=d6He6tt,fI=e6tftfI=e6tfIfHVW51Lc6Hc69c6t-j R Lc6Hc6 djjQP Lc6Hc6 AQP=e6tf%=@5Lc65Hc68,$t$R=4e60e6 t# Fjj WSfp9ݹÉrFND$P9|$P$d닔$hjj RS$p )ˀ0^N9wh #訞h'#Ntf5Lc6Hc6153WWWjLc6Hc6 CRP53jj_h#h2#1c61P^_[]Ë$d#Hc6 Lc6$tҍt$PtV$lSUQP4$SUfH1G@u5Lc65Hc6h2#SUu.$l#$pth2#5Lc65Hc6SUq5Lc65Hc6H=d6e6fA=e6fh#c6hS#h"#\jj5Lc65Hc6D$DD$'L t$\$ VS@@PD$PQVSf@5Lc65Hc6tfA=e6tfA$l$p!fHG5Lc65Hc6qf@5Lc65Hc6SU5SUh{# t$p$ph#S =c6j \USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡd6@4 1WjPQWWRS 9=e6f3 8e6ff3=e6twf3 8e6ff3=e6tjf33f3=d6t3ȃ=e6t]D$ Yf3 8e6f3f3 8e6f3f33f3=d6t37D$ G UV=d6l$$tApQt=e6tRP_A(=e6t1ҋ d6I4-d6teQRP d6xtt$V/11jWpr =8e6=e6tf=8e6f3d6;x4})}jh3Wq =8e6E d6A49rE =e6t<$fGj \$l$u6_=e6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=e6tfUVfXW|$$Wf@t$$W=d6He6tt,fA=e6tftfA=e6tfAfH ^_[]UUSWV$$1Q 4e60e69;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=d6pt$ =e6t ɋ=d6e6L$xtt tɋ=d65e61L$|1ɅDT t$t RP(\58e6UVRP tE{[|$t}SW[ljUVSW)SW[lj_{[ |$t]SW[ljUVSW{)SW[lj?UVSWQ)Ӌ$xX#UVSW,)Ӌ$xX D$4PS $$W$VWVhPWV d61ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =e6t SWZ d6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =d6<$\$T$|$(t$,DpLtL|Dx=e6RSYTtDpd6D$0X0vvYRP}YVFvviY RSXYVFt|tx|$8>YD$T$Rl$$D(D,=e6tFB\pTtd6B0FN FNDxD$L|׉L$L$؉D(MU =e6t]RQX d6I0VPXU EMhɡd6@0 ȃ=e6t3ȃ=e6EhD,t($d6@0MU EhEhD,=d6L$ tL$D$D$=d6,$\$ 1QOP\$  t19}#8@#pLp0l$$ d6ɋD$taVt$P= d6x4ƍ$58e6pS譚 d6@0fPt$t$ d6x58e6Spm 8e6=e6tf؋8e6f3d6B09}+^jh3Si 8e6d6B0N9rF =d6tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL d6taPt$t$$ d6x=d6t$,|$(DxL|DpLt1҉TxT|FN=d6<$09e6QPV)RP VVF^vvU )RPUL$(D,D(D,EM =e6\$QPU d6I0)RPUU EEhhȋ5d6N0 )ȃ=e6t^ȋ5d6T)FN^FV )S\$L$4$*5d6V0)EM Ehh )ЋL$Ev8QS c61Ą^_[]Éjh3pg $Ph#k=c6th/#h#߻F & d6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fk ^nFD$hF$D$pFD$lFd6pt =e6tɡd6=e6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQw

t~1F=e6tf)9F=e6\$tAf)=e6t4f=e6t'fL$=e6fVT$Rt)f~T$JR>>fD>=d6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=c6=e6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=c6t Vt$t$Ut$h#1Ƀȃ^_[]1A=c6t1=e6<$\$ HfUSWV $8$4}tE1ɉM4M019 d6‹DT 9 e6tRPIOM$U(E$f M$E$U( u ^_[]%=uLId6(9‰|ǃ=c6t<|u=d6tFNFh1 td6tD$hVP趑 |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =e6t RPKN d6I0VQRPZ։D$D$ ЉT$t d6=d6Q8k=d6L$$tL$D$ =e6t QPM d6#8t@DQL!!IT u‹$8U t#DT tE=e6t!RPfMD t(=e6t1҉EU}@U=}@|$c6EM QPQPh$3WWh;#聇h_#'uQ{u u d6y0ƃ=d6e6t:tMPWL?UUlCD$T$NQt PW[L~V ~V h3#Be6d6@ 뛋5d6F8E -d6T$$tT$D$ =e6t RPKv0 I)؉$ʉT$t*DT tZ=e6t RPK$8D t6=e6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wc6E$8I QPQPh$3UUh;#薅h_#<$<t7d6Ht)$|$-d6Cq qƃ=d6t0FV=e6|$$tJRPqJ)RPcJ4FV =e6|$$t&RPAJ)RP3J)FV )FV h3#e6d6@ USWV|$ \$t4e690e6aTc6 Pc6 ‹-d6t9ˉrux9ˉ\$؉jL$QWPVUց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סd6t`v0WUL d6d6pxjV|$(WS蔚)Љ Pc6Tc6=d6jVPSl d6A^_[]WSh #d6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$d6p0vv_ $G d6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPNS19rÃ=e6$t$ \$ti=d6t,ۉ~A1_t4GT\$F9uۉ~1O ɋW @9uG W5e6萲t$ D$x , d6;Xt|$#=d6t JًL B tmt$v vh#hW#WVt=d6t$$B1ɉL c6t$ $$Bt$ B Cd6;Xt`R5e6踱T$\$1ۃ=d6t%JًT tN=e6t#RPEBt/=e6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbc6L$AI QPQPh$7W]Wh;#h_#|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=d6t+FV=e6tGRPD+D$RPD1FV =e6t*RPD+D$RPsD+D$ډFV +D$ډFV h3#Ze6d6@ 1@$5USWV\$41F~3|$0l$,|!$e6 e69|)S9у} ȃ^_[]Éދd6K89}=c6tOI.A!1‰9)=c6l$,|$0t!t$4PWUhm#d6PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=c6!$l$|$ T|$0tN# $ND$T$RPWUh#n d6<$\Ttq!qIVPt$ Sh#$@l$19=c6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#d6t$Sh#1Al$,|$0USWVD$,\$( dc6`c6փσ5`c6=dc611 J lc69hc66 tc6pc6Xc69xc6@D$ xc6=d6\$jD$ PL$QT$RLց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =|c6c6tc68c6T$tc6‹D$ȉpc6tc6c6WUS5c65d6贬= e6l$$-pc6+l$(=d6|$`5c61VV=e6tf%=tjvdv`T?VdF`vlvh@?VlFht4&?TCut4?TCuG9a=c6t< d6(1c6SS=e6tf%=u1=d6u(x$CS =e6t RPm>9Ƹs& ɉ @u ɉ @uG9wt$t$t$5c65e6襬c61Ƀ=d6 Xc6^_[]PSh+#awUSWVl$|$d6jVUW蟏 1ƒ hc6lc6Tc6Pc6=`c6-dc6=pc6-tc6xc69c68#{H1ۃ=d6(=c6-c61|c6c6ډc6t@|c6 -c6=c6Wh腆 c6t^_[]UWhN#Tvhs#Jvc6t PPj c6USWV l$ =d61ɅDT =e6t RPq< d6Y0މD$ʃQSRV wÉD$4t,P=d6RMT$=e6HRPK'9L$0ơd6@0 T$D$=d6D$0T$T$4=e6t$$t RP&Mt$t$$=e6tȋMD(d6@0T$,‹t$(΃=d6e6t+tMVR&uVFt$t$ k&7KVRU&MQ AD$:MQqD$T$AQ!EL$DT=e6t1ҋ d6q0RP耐 ƋL$ jWSQ蟄Ӄ=d6D$ t7~SPt$t$${NjT=e6t RP%|$)~SPt$t$$D=e6tȋ|$1҉\$$ t/f d6q0RPݏ xËD$L$ L$0|ád6@0 T$ʋL$ȃ=d6L$0T$D$t!D$4=e6t)PQ$D$ T$8=e6t@ɉL$ D$ =c6t h#X=d6t h#Xh#X/=c6u h@#WX=c6u h^#W3=c6u h#W6=c6u h#W<=d6t=c6u h#WT d6|$Y8֋T$  SP5De65@e65Le65He6h#Wd,$kdыd6@DWSQPzD$T$iщډWSURzjj RPRPt$t$t$t$t$VD$Ph#Σ$=c6 d6+0e6 4e6He6 Le6He6 Le6 tQPh6#q =c6-d6KC)s, @e6-De6Ջs4HS8\$ ډD$$+ e6$T$$e6 $ $ډ Љ @e6De6tRQhJ#蹢 =d6t8h_#裢5d6tvvh#膢 6j 蘡=d6t8h#b5d6tvvh#E 6j W15d65d65d695d6tmj# d6405d6h QV, 5d6Vʍ=e6td6PPҞ5d6zd6=e6t c6j d6y,t+d61TtRF d6 d6F;q,rd6PF d6=e6t =e6th#Sk61=d6=c6u h#S=e6t h#SGRtgD$Ph%u1D$t)L$ jQPh%hb%:t-=c6u h8#S  ^_[]1USWVd6D$45d6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B (e6l$9؉|5d6|$0G;~,$LHN4H~KT$މ)1@ (e69׋T$9|5d61҉t$L1F , De6@e6Le6He69S,SދD$4HxL$HD$81ۋjV d6ׁ\Tډ\$tQ!QЃQ SPh@d6Ed65\d6|$D$Xt1NPSWUskʼnFظ|߃\$ <$w4Fd6<$t LX FuWFsT$ He6Le6$@=e6tfL$fAf|$l$$j /) hX d6d6T$ =c6t| $=e6t RP RPh#l=c6gq$ʋT=e6t RPw WURPVht#u($DX=e6tPh#Pc6h#Eh#frT$ '|$@@u' T$t$SUt$A Pe6t$D$, F=d6=d6$@=e6tffu$@=e6tfft}SU{$@=e6t?f=e6t/ȃ=e6 $ApfAAt$f=e6t $ApfAA $AtfA1ɉ f6 f6 f6 f6l$T\$Xd6pt4$9 e6t ʡd6 e6$tt4$tʡd6 e61ɉ$dtX$t $D$LPt$衹=d6=d6t=c6u,$$@\=e6tȅSUh#C h#,p~SUؾ19 e6t1ɉH\H`HdHhHl$f!B=d6,$(E\=e6tȅƄ$E\=e6tȋ d6I0H111҉,$L$ D$t ߋ d6Y8Om\=e6t͋ d6#8߉@DYL!!ÊIT u,$\$lD`Td t<=e6t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9d6H4 D$|$׉D$|$=d6t݋AQ=e6t-RP !Eh=e6tȋt$|$1҉11 ˉl$$WVRPSUh-#uA=c6th#h$m|$t;SU蕼ƃ=d6D$|t1$=e6t RP_FVc6=e6tȉFhܽ$|$jj$$$$SU z $A`Id=e6tEQP $plph1$D=e6tWUPVhN#  $AhQl D\$C5d6;^,T$$L$ f6f6׃ƃ=f65f6 d69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-d6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H, ƋD$9\$(s+l$ Uh#>j;SWUt$@h>#h#m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wf6 f6ʃǃf6=f6|$ |:w whk#= =c6h#qjG $D$|$tjVU¾ (e6<)1CVUh$D$,p p*f6 f6ʃǃf6=f6 j w hp d6tHd6 d69tDy1Y1 t 9u,@e6De6$|$ ,d6d6Q1I1 ы|$ td6$G0W4L$Aڃ]D$ p ph#J< =c6t)hy#莽1C+c6h#;h#h1Ct ؃ ^_[]c6jpjffUSWVP$T$1B@B0 d6f6d6x,11=Te6t>Q:d6x,$kd1PWSQh#h|f3ZTe6d61ۃVU聶tzljl$ t$d6pt=e6tʡd6 e61ɉT$HtttȉD$LVUz8tD$PWbu(Cd6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$f6ŅtTM1ًU1 u3VSh$w wf6HPUMpXf6 d69tmu1 d6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $@)'h#F9h'#eh#ejj聴=d6e6f@=e6fh#8h)#eeU1hPVPVҜ1Bh#8h'#'et21VWhVWVW莜1 tah#+7c6h#du<tf@=e6tf @f=d6tjjxfhP: j5d65d60T$1B@Bc: -d6d6  $Te6$Wt>E6+5d6=d6kdPWVQh9#h|f3ITe6uF$h\#vv 躑 8e6A1ڍF$h#cvv 6ǃ=d6F$ e6&jP1 8e6I F NQPQPhSt=d6F$ 8e6t%QjPSh$hp#>6#c6QjPSh$hp#36=c6th #w=c61F$8e6 I1)щN$uh#b-vv *ǃ=d6F$ e6$Wt jP1҉GW1҉GW }hjD$\Pf =d6e6D$tt7fD$T@jv$-fD$T@jv$yfD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=d6$tD$\=e6tL$Lu$D$PD$PD$XPyTe6;,$/c6$W=e6ve65d6;4$]|$T{$AhjWd -d6=e6tt0fD$T@js$z&tPfD$T@js$`FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=d6$|$TtD$\=e6tD$L$|$TtD$\D$PD$PW٧;4$=d6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#(^t~s sqf@fNCKK CQPh2#ss oOCK =c6th#ss QPCKh2#QPss fN c6;<$=d6d64~^1ۋ/uu q]]8u9rۋ=d6/CK tS  StQP HKX9rjj轄`^_[]c6j&ejtPh#/L$D$@, +A,USWV $0 n8$=d6ui=d6t`E=e6tȅtNE=e6t$;0e64e6s&E=e6tjPo@E$F0N4 utEh%PkV)$0 F=e6tȍL$A=d6AAhh%Qp d6 e6tD$D$L$L$D$h#v v薉 E=e6tfM9v%}EPh$.;$h$4[4/E=e6f)=e6f=e6fEtf=e6t΋$0 AI 1 h#QP辈 h#Z$0 F=e6tȉE$$PpZEL$fAWQU $)fEPUV =e6tfD$fXWPU $0 G0W4w wmfH$Xc6$0 =d6t>}t8h#v v贇 h#Yu EBc6F0N411G9 v vGD$@=e6tȍL$A=d6AAhh2#Q  e6 d6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=e6t2f)=e6t%ffD$=e6ffe6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=e6tfPjU\ D$fEutEh2#PQRl$L$Aq $0 JR ωtljhd$RQUW݅l$EMك9v%}EPh$*$hq$qWD$$0 T$ 3F0V4=c6h$ڃD$=e6t΋D$p@ =d6X}$0 ~hL$v vڄ Eh#VJc6Bq$$0 1GPVtXD$T$ F0V4=c6h$ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUVk D$fXSPUX E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQU $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh# U4$F0V4=e6tȋ 4e690e6s5h$juv v݂h$T4$=d6E=e6tȃu}uE=e6tȃtb}u\FN U=e6tʋ4$h$jRQPX=e6t}Eh#T1 e6EtjPgC$0 A4y0$$0 t=c6 $=d6JR u=e6tPjVRQ菁h$cSƋE=e6tjP1Ƀ=e6t fe61ہ@€@t f e6fGc64$Crv $0 A4y0AI U=e6tʋ4$h#jRQP褀h$xRc6zE=e6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=e6l$\$tȋM=e6t1퍜$UQUPhScSh+$$"Ph!$ %9-c6th~$Rl$\$ h$zQƃl$\$$0 A4y0| AI KC=d6taEO9tU$0 AI U=e6thS$jRQP%GEh#Pu $ c6fO4$E  ^_[]ËM PShb$"ȃ=e6tUSWVT d6d6,=Te6t>)"=d6kdPWVQh$h|f3sTe6}ww cO W $T$ WGO ƀÄ:1=c6t4=e6t+=d6t"uGO 1F9ƺw1 tbQPc8uS=Pe6xJ1v6KNj@ $GD$wOG tQPb8u E;-Pe6|E;-Pe6=4$h$b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ X D$TD$Dd6pt =e6t ɡd6-e6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ 3 v6ΜL$QPt4t$t$af@jw wt$t$~t Lc6Hc61JQPFafpd69)T^_[]fUSWVT1ۍT$1B'L d6x,@=Te6t;d6p,kd1PVSQh $h|f3pTe6d6 d6<\$11ۃVU衛VUm`$t$l$ d6pt<=e6tϋ d6e61҉|$Ltt<8tϋ d6e61҉|$PdtX 8Džtɋ$L$HQ$X)'xtCVU誓tV=c6VUh1$^1=d6L L tOjh$sd6tuQ1y1 t6 u_VUYdtl=c6tHVUh[$Xl7jh$$PxyQ d6P jhb#D$P Cd6L$;JWD$ PB끿\TL$tˋO!OڋO SPh@d6sNd65\d6\$S=& e6e6ttut5d6S5\d6Gm {U |$4tU tt$h$y1ۋG $L$T$D$jUVg f=(e6)1B\$&|$ d6L$ tL$ y1Y1  u"T$L$$tGd6QPUVo{U L$uK`ى9@e6De6|$4@t,d6@4 ؉1RRQPwHwDw w{` O d6;H8tmۋ|$tKC$ LL$D '|$ GWQAd6W |$$L$Aa |$tyttD$4@ 5d6;F8ubCLL$DQPD$d6d6tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5d6d6d6h$h$ udd6ǀh P5d6 5d65d6,=e6td6PP>5d6d6d6@ d6HHщ8<=c6th$in=c6uh#u_h 5d65d6 5d65d6&=e6td6PP75d6'd6d6d6ǀ,04ǀ(<HHPLщ8<҉@Dh P5d6 5d65d6"=e6td6PP45d6d6 <:$L 1@ Whj#6 h$f3e3H e3~e3H e30he3 t e3I e3~e3Pe3he3 e3 t e3 t^mNt"YAyt n+j  yWh5$Ce61^_USWV 1d6d6d6$X0Shl\d6`d61N5Ld65Hd6Xd6hh\-d6d65pd65ld6|d6c6c6c611ƃj$耳ShÅ…t|txt$FD$c61_Gc6yG 1HG GG9l$td$X0j$ShÅEtu5c6rPVQ^ D>/|)Ot$L$6m62m6$!D$h8Jm6$ D$tB?JL$h)PRQSWVD$t$ 4e6950e6r==d6 d6jSPVԐ)޹394v t^_[PVh$CWV|$ wu$)'1XD$@uPw w Ph$$*=c6th$n@h$t ^_Ph$趽Te6USWV$\TM@$ 5uh`h`VP艖 =c6t h$?= e61ۃL뀃=e6t\,L$UPQ DPPz$\, e6L$L$UPQP |$u $PP@1LDffLD@9u=e6t8PP\e6L$UQP t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h$(USWV\$t$=d6!ߋ,t9Xt6@u|$t&j肞t1ɉH HHXh1^_[]h)$VD$ L$5d6#p9tыR9u @^USWVt$|$VW/d6!t7^Fu+11 33 1u{ d6tqt$0|$,\$(l$$T$m6t9PtjRQ m6(Xxp L$ m6t9HtjQ5d6 m6(Xxp ^_[]WV d61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$,'$1Aȋ$sY9U\*'<8*'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$)'4  <Qh$h$脹D$P`wZL$ D$$*'1B(ɀ!1Rh $h$SD$H`wPD$T$ $*'1C%   [Qh0$h$衸SD$H`wND$T$ $(*'1C%  [Qh=$h$6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW}ƅuWhu"j׈$$<$4D$Phd@U茣 tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h+%t$ 1 Sh"U CPh8"U菩 C Ph"U} CPh"Uk CPh"UY CK,C,Qh/"UA C0PhD"U/ $@D$t P> 1-Uhzd@$<W t1 VhedAWl hjUC D$ P$4dD$, 9L$Ǥ L$9u0$S11:8tx$0h"Tb$11҉ $ƅ*ŰP, j PUP ^_[]$0h"j]USWV81ۍD$4ShPSux 1NtAljSPSWuW2U uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSb$1NHD$ D$(%=@= j/S3xr)ك$0PSQhJ$hRD$jPhǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PSya1@$D$hh SR ƅ%D$ PVxD$3D$ 3|$$  D$uH$0PSh$8$P$TRPVy V(S D$4@D$1$Vh`$jSfVjS R ƅxc1GD$ PhFV  >8u;VR Wh`$jSjjSQ Gy D$t PѢ<$t t$1Ox VNR e^_[]D$(%= tn=@u$0ShR$hPzSƉ\$1@$D$:\$ D$ PSp_B$D$jSP }tStN$PhF|@VJ x4D$t PơU$$JhF V$USWVP1hUU= ƉRP)9-e6t1@fCM+PUUSF d6;A0u $ytWVC^_[]Ë\$-d65e6SUqRPX$@ `d6ؔؐh P5d6 5d65d6 =e6td6PP5d6d6[USWVt$(~Ohole6tUQrՉ 1=d6L$$t| tWVwrƉt$$H$ád6@05e6QPWVsUC cMhml=e6tUQrՋt$( }d6@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=e6tȋ|$d61ɉSh$=c6th#<*h#lt$" d6QP#T$1RQQD$P1Aád6;X0t$~~1Ƀ=d6T$DT =e6|$t RPmL$ pL$QSRPRyǍPnm6$|$1D$D$t1)ÉعF@jPܓD`r9w<$r$l$T1C @<$9uG<$;|$}d6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡd6@0)ȃ`T$1ۡm6ـ#h$b=c6th$'h# ع`֋,$L$t1ɉȉD$ օt$ tH d6i0T$,RQUt$> d6;A0l$,} $L$l$l$,d6@0D$Mt$ |1TT1PD$T$ ʃ=e6t RPjL$(ωQM D$H 9tet$C9\$t$$h$ c64$F4$;t$SD$`1c60^_[]ËL$ ʋ d6f9u Shp$褤D$`,t$$h$lj d6Ph$CUSWVT$L$D$0(D$ X=e6tSUviʼnӉ OD$$d6@09ʼn} t$t$5D$PSUt$< d6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5e6t9RPt$ƉT$ ht$1ӋT$1 t<$G RQhD11 u5\$$9t ;D$t`GPD$ GPWTt RPRh$<$G L$;L$t9ta щʼn$;D$t`1ht$辢^_[]USWV d6$d6x0UWt$0t$0sƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRas m6T$4$1B srl$,$ ȈU1wX=e6t d6!9GX=e6tȋL$,1Ph$蚡 m6L$ $  h$y=c6th$"h#t$D$OPWTP1GTGP^_[]c61USWV|$,a$tf$d61@$d6sll$d6td6 L$  ƍD$1PQQVK9 d6;A0-T$zu D$`1]l$z$Ń1EGpD$hV D$ Pt$ u&xMt(T$hV D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh$џ=c6th$!h'$Et3s ss3st$Vn[E;,$uc6%t#Ph$0jUSWV0\$T|$HOX=e6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGe6҉L$D$td$PQdÉ׋n11 D$Hp{ډø4$uRWPS Dž1F $ LBAWNjG ;C wjTj蠄M HMH MHX,O(HW,щT$PW@ODL$HT$0POLL$4H$OHL$H O $H(_q1Ƌy 1 t $B8HB8tQPQQbC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h$G'h$h $h h$YPh$O4$V0Vh$hp$h hf$hU$hWVt$ F,t@m6th$F,P;1~,>d9~8uv0^_h$h$h h$D$x,u@Pt P߄h$h$h h$eWV΋I01t*N8~2IN8tPQP P蔄N0G;~4vɃ~8u^_h$h$h, h$h$h$h2 USWVEH1Bx,T$1hsM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS譃e^_[]h$h$hF h$&USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h1$hr$hK h$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h$h$h` h-$h$ha h$}USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h$hC$hq h-$hC$hs h$裼USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h1$h$h~ h$fUSWV\$$|$ l$t$m6t5e6SWUh$USWV5e6 1^_[]USWV\$$|$ l$t$m6t5d6SWUh$LUSWV5d61^_[]V=c6th$Œ2j5m6HtahQ$腌h#+tSm6xL~61 m6 s"@Pt4hq$ m6m6F;pL|^5m6vjm6t'x,tPm6Pm6ám6t x,tt$t$t$t$P1WVt$|$ VW=d6dtX=e6ts,d6`uau33 u1@1^_WV c6t1 m6 d61!`u/aʀs2hlpx1Ph$ԊPh$h#gJh$蹊d6 ǀdƀah P5d6b 5d65d6=e6td6PP5d6Ѱd6d6!1111QWRPjhm6hh$h#艶lh$ۉd6 ǀdh P5d6a 5d65d6=e6td6PP5d6d6 d6dPs+aʀu Ph$Ph*$h#蟵h$d6ǀdƀah P5d6` 5d65d6=e6td6PP 5d6d6^_jUSWV1L$ AL$HAL$@AL$<L$ <'L$A <'A<'A<']u }h$SV,c ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh,'jƉe^_[]Ãu95_3ujh<'D$PQ8 u1PPD$Pje95_3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQVRPt$8t$@t$8t$@W1u2h$R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Ph&b#hV^D$@w ww7VPhe$S 1h$+h@$WfUSWV1L$(AL$$t$@L$ D$ }] h$WS^ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9_3u~]#D1غ$Phzd@聚 tN|$$tOh,'j[t$ ut$@u1Oe^_[]h,'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$S]SjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q m H @AQ@A$Q @QHALh!$SXh!$h!$USWVP\$|$tus$" $&"$jPtQ1@PVSjPt$8t$8W E1u>4$h$$W V|WSh#$W4$h#$W 1H^_[]UWV} uOʃ$<|RQPh!$VJPRCx& $T$W1ٹ|$5$<h "$ 5$<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh<'V~ 1OujV5$<>uW?,VQ>~Ih"$Q1$VQ7 t1Ph,"$Qx 1O^_SWVP|$1N?u;j S5$<= 8u1u5$<h"t$ ^_[WV|$1N?t5$<l;1t^_h#$t$USWV 1O1;B։ˍD$ j P5$< уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5$<Ax(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,njh<'t$c$ tjVt$I$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0whE"$VIz1t^_[]1;BB  Fjh<'Ps 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hU"$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph_"$Q 1HUSWVt$|$ t)l$\$$jWUS走 tWUSh"$1h"$V*l$(\$$jWUS肰 tWUSh"$V1H^_[]Ã|jWUS(/11USWV\$1s3h%5$< t^1Wl1'蒄tuWh #$t$ 1Nt1'p1' Ch%j Džu^_[]WV|$ x1'l1'Wh%#$萪u^_USWV t$@\$ p1't1'!Љ! tK$\$L$49$b#ty#\$8SPQ> Sl1't$<> Ջ\$!$!u Ћ|$4t?t$RSh3#$jVu?$b#ty#\$8SPWW> SVWL> ^_[]USWV \$ |$$tl$4|$0L$,D$( uh:#$S1N ^_[]S 1Nt@PL$$9sPQhI#$S_ɍQD$@ XT$ډL$Y jh<'S  ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(P K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW t$$h#$W 1t$$hh#$t$(d WV|$jh<'W  1Nu.W5$<6t5$<h#$t$ 1^_USWVl$$\$ |$t$jj h$b#USjVU yD$USWh#$蜧|$tVhg$臧j 蝦 ^_[]ÐWV_3;$$,(h%$^ $h%$*j$,(}RPh%$ hx&$jV p FQPh&$Ħ v,v(h"&$ v4v0h6&$ F8Ph&b#hWU3WhI&$wvPh[&$g1$hl1'jIĈh&$B1HĀ^_fUSWVD$ $t|$$L$|$t$,t$4RQ躎L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh-$P%1D$Bh-$ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh-$u1fUSWVPM(,|$8O] D$1h%.$uS7 sujsWVVuutqD$9_31t$}$f~ jj h$b#RPj|$7W诵 xWh$$|"$f~ RPhf"| ,f3H ,f3~$f3H $f3 h$f3j Ղ|$G8jm$Sj$P蟴Sh1${|h;1$n|G0O4 tQPh$PPhz2$;}qh$f3j WFHsF 8-uJF $1҉QQ$$Ph&b#hSSh0${vG1J0$ha% V{ h4$ V{ h2$yWpD$W0$D$tD$P0$1ot$w7] V2{w w V{,f3H ,f3; t hp1$ewhA$Xw 1A AAt$Qh&b#hVVhz1$h1$h1$vĔh1$v|$uhusuqVh1$ohU$vuuulh1$1$t$b#PRhV`%zvĜ;8jmWj$VzVh&b#hWWh{1$@vĐ^_[]USWV΋\$$|$ ʉl$͍L$jj h$b#UPjQ蔮 yD$SWVhC2$u|$tUhg$uj t ^_[]USWVDt$`l$\\$XT$1 󫡘<'A <'A<'A<'B02$` h2$VU) k)Hw]r$uStJPSu7HsutPD$PS uh9'jD^_[]1Hu߅tjh<'D$Pr t9-_3uPh[CD$PS벃luhK&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh/3$SW  a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uh9'jռe^_[]ÃluhK&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=_3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H Hn6H Dn6@@n6 > GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$'U Ǿ0?'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT3qL1ATAPAXkiA\:$A`i Ad;$Ah!i Al;$ApfeQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph#Vo |$V V ܉(C 1Љً(L$I$1 sD$P֎D$D$ t2t$ ^ {uWvY+u{u C $\$uohN=$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ g E0t!t+M4S9rQSPA 0t,hj=$ MHtU4uL9rRQP t$|$t%u@uhV tI/81tSul|$tDEM9rQWP u@u`V u@yu@u`V teEptUt$8ЃtEu8uXVc t, ^_[]h=$h;$Ah=$hC:$5h=$h=$)u\u\h=$udSh.=$j wlh$$j fUSWVt$_F 1tvt$G t[S tCPQ Vt$J tPUW/K uW袃 S 1S W#F ^_[]USWVu]Ph&=$S t$f1j?1Nt}ǍD$ Phm$S td\$ t\hjD$P) jS\$Sm ShiW t$E L$Uf jQh&=$PZ je^_[]PPhm$t$ u1$YVPt$ t$t$V tPhm$V\ u1$^USWVt$t$xG t Nj\$ Peb 9v,? ,1N*Ƌl$Web VPU )SjU( ^_[]USWVt$t$F t?Nj\$ Pa 9s9Ƌl$W b VPU )SjU^( , ,?1N^_[]UPh&u t$+1H]USWV@uPh=$V ] h=$V*F tPMa |$ P\$$ShiV\@ |$ jS_ Ph=$u H V腀 ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP:_ t!Ph=$SG V* 1He^_[]ha%h=$hh=$$WV|$$h=$W*E t;P` u1V=` jPV VhiWQ? t^_h=$h=$jVh=$#h>$j Vtn6h3V V |n6huV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhG>$hV>tVh}>$AVFߋD$t$j7QPhG>$hVl>tVh>$yAV@F߁^UVuPhE$V t3$L$ AQhiV= u hE$1e^]ha%hE$hh@$"UVuPhE$V t3$L$ AQhiVe= u hE$"1e^]ha%hE$hh@$!UWV}W#ƉPhɍ$W tZt4$P<tW@PV$\ tGPhdE$u D t>V1e^_]ha%hE$hh@$ !hME$hE$hE$ hE$hF$j hE$t$A tPhdE$t$%D Hh"3&h_E$hh@$ WVPt$|$D$PVW tKD$tUh=$WA tPh=$VC H^_h"3&hlE$hh@$: hlE$h=$j h4=$j SWV$hiA$S"A t]P\ GAsdWt^WPhiA$StNpxPhiS3; u?V1&1HĐ^_[hUF$hjF$hF$j hA$j@ USWV 1CCj7Shxi P uhD$?,$PuhD$#Ɖl$D$Shxi W u hE$j $L$9~D$~*1t j <Sh$$~=G;|$|j <Vj4USWVHI'D$@I'D$ H^_h"3&h{E$hh@$h{E$h=$jh SWV\$,hC$S; t`PV GW8t\WPhC$STtL@xpPhiS5 t5Vt1 1H^_[h'F$h u WhA$j袼 P-D$L$AËD$L$AËD$L$AËD$L$AËD$ 3 31ËD$ 3 31ËD$ 3 31ËD$ 3 31ËD$H@ 3 31SV\$ Sh 3uCЃ r"CrCr ?01H^[h 3M H?r  ؈ 31ыL$t s61ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 3xs6t8u^s6ǁs6s6s6s6s6s6s6s6s6s6s6s6s6@wh 3R&uhOD$0h 39&uhrD$ht 3 &u hD$j $5 3tvh3%61t6t6t63tt 3$h 3$Uy ƃV B~>CNt6F v/FwD$@' t6Au"h?$C$t@'t6xu>Wu4D$P1VhVVj V5$< t69t$:*ƀs6l `C Lvms 33u$3t6t6rt6 t6D$P1VhVVj V5$< t69t$taYt6>t6O t6CatTl5$3+wtz39t 3 3$ÿ3؉$3_3 t6$u = t6uB=s6=t6=t6u|t = t6u =s6uftu^ t6uS$ttH)ŋ$L$ T$ RQL$QWPU%up. u&hqz"h?$,5$<h %j薶 t$PD$P & u h?$D$t,DtVPyDžuhqz"h?$JW WtS)uhqz"h;$Wuhqz"hC:$ 3t H9t@hqz"h@$$@ t%VWЃ$Wj&hq@$hqz"h*h@$USWV- uhF$h?$j臵 Ƹ 3jmP$b#$b#tHG$jL 3PetNG$USWhF$h|f31 3t VSm#HG$u$b#WWWWWQWhTG$h|f31$Vk j%V 31tT$q9t Iu^WVΉhjW D$PhE$V tZh$V0 tQPK L$PyRPQO WhiV* u hE$螯Ĕ^_h"3&hE$hh@$)WV hB$Q70 t;P(K  u1WJK j PW Whui V^* t ^_hD$hD$hih@$hD$j芳 h|A$pa1ÃD$ 1ɉJJJ JJ BRhiP) t1hA$j1 $1ɉJJRhiP) u 1ĐhA$j Qh 3USWV΅t R(, >* 7* 0($D$Pji!\$D$1t$$tsVsD$tVPVhm$W trC=t6D$uCt\=t6uCuM= t6uCt>= t6uLhj$V VhiWn( t!$uۋt$$4u=t6t ~ j *h$f3s譠Wt& 3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhB$h$VVUhB$* jl$U$V/ Vhit$ t$,$t!PhB$l*VhB$ܫ,$jt$Vڵ Vh~it$8 t$tPhB$*j 0)ꍄ$P$$ j:QPhB$h$P蝹$t'$UhYC$)UeE}uj:$$hB$h$PB$t'$UhkC$C)U E}u- 34$tVWUmuj|$W$V茴 $$ DŽ$@Vhit$V u$ hxC$(1@Pl$U%jWl$0U' 1@D$81D$ hL$Fh#h;$:h#hB$.h#hB$"hC$hC$=t67I$tC$Pj USWV Ӊ΋|$4hB$Q@& tPcA 1EUhvi Vv j U? PhB$S0( V` H ^_[]VD$tL$b#t$jj QPRjV\ V 4#uz$b#PVh5D$3#-у $b#t4#Qh=#PRhy#h)D$# ^WVΉhjW WhiV tD$Ĕ^_ÐSWV$h %V$ u6hI$V$ u$hH$V$ uhJ$V$ tDt6 t6=t6!lj=t6hjS {Sh7iV t Đ^_[hI$j Vt$VPh$$!tVttPhI$!t$V赠t%L$ PQhPh%! V蕠%uߋD$=rPhI$p!^USWV$WW1ɃtQÉ1 jVU蛬 Uh8i(S D$ sjP觿QƉD$$Uh8i(S :t$ZPhdI$ h?r%t$D$;D$t(hʥ$t h?r%t$ ej)yj o\$#|$hJ$, 1AK'9xu H uh;=&t$(hjV Vhi$ St$<\$8hJ$H$ J'Qt8u 9A uVhJ$s VhCI$/1#X4h$b#hPh%D j Zjmtz D$ ~[11ۋ!9uIuU谜PhpI$hI$hI$4j D$ 1AC9|M rV:ļ^_[]PRhG:$$h&I$h;$hu"hWI$ h&I$h3I$jq Vjmu t6hșVV2^hI$j8 h|f3jjHhJ$5UVuU OPh!J$V t!#t6 $ t61e^]ha%hJ$hhI$USWV(ӉQtoh+J$U tt6H1 Rh8i(U u 8uIjh+J$S t)D$t6t(^_[]hG:$VheJ$j hRJ$h5J$hWI$j SWVt$T$;h %V+ t\Ƌt6PF: V : PW衧t+Ɖ߁PWt2 Ét611H^_[h;%hwJ$hhI$hJ$WV֋|$ QVWPhJ$j WVPt$T$thI$Vd tkP9 VJ9 PWt>ƉPV5t6訜 ǣt6VY1u t6$h#Z1H^_h;%hJ$hhI$WVPt$T$hH$V tbP8 V8 PW8tIƉPV5t6 ǣt6V1u! t6$h#1H^_USWVt$T$1hJ$V! thƋ-t6P<8 V8 PW藥t6ƉPWt>V ݉-t611H^_[]h;%hJ$h2hI$yh_V#fSWV|$ t1H>t$|$\$j@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V5 tE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP7 Ɖ׃с11E9r u8"t$8tc1H^_[];sC| C 9s} 9"WV: t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP7T tEC tP7> u/D$ Ph&7薽 u$D$1$n1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$Vܢt|$,$h%W D$g&tD$1{tj/t$tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$WDD$4D$4D$ PD$8Pt$ t$ CÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxrD1X \$TfD$t7|$0j WPǗ t9t1ۉD$=r"11HD$$P辺|$1OL$L$D$L$T$PQRh$K$V" 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PZNjD$fVSP; sD$ t P4$W 0 W萹<4$uM S]s {te|$t^t$Vt$t_@PW/ W tNVsE0  ߉VuzP ۉt3EF ^C F1Vt$hKK$h,K$hKK$hE$ hKK$hF$j- WVt$tVr1H^_V t3t$L$|$ Pwt΋D$F ~G F1_ USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'/<$t@1@>.1-t PaN 1GG GG1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUst>Vst)u 1H^_[]Ís s(CtP7k uCtP7U t1@뿋C$1$0L'4v6 !6 PK6  v6 tMtk $t$ 4$UQ$t^hoR$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhP$j @1Hx^_[]hSR$h@R$jK WV0t$<|$jWhM$V萴t8Wr t7HfJBRhiV t!10^_hQ$hQ$WhQ$j~ hM$j~ SWV\t6h 3VSdt6h 3W@VgW^lt6hV3tt6hW|t6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW Whi$ U $!hR$$HQPۍ\$4|$fGWhiU t$R$f|$*uR$=t6t P2fD$(WhiU t$R$f|$*uR$=t6t P|$fG WhiU t2D$*=) PhR$=t6t hS$fD$(IWhiU> t2D$*=) Ph S$n=t6t hS$V1Shi8U |$DhS$1tPDL@uShi8U t$HuM1|TuD@uD$L|Clm3L$P9Dzty:t|$jQh^R$ uVh"S$11t j,DLxPtT h^R$Rv<u h$4j J$PhiU tDh&S$$t$h2S$ hRF#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR PhLS$c$=tPhVS$Fj \$=tPhBS$^_[]PhR$jy h|f3jhh_S$ ÃD$1ɉJJ JJ fBRhiPm t1hM$jy 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hP$j_y USWV,$@$PhiV tr$A jjj"  xgljj2 xi$-hSWF xB$/uE$0uf$Ciu.hN$'t1H hZN$thtN$tWG 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hN$hb%hN$hN$hP$hN$h O$QL$4QhN$(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q t6t t6Et6tIAtcAtCAtPA tSA@tBAyAAT$ht6UWt$PVt$D$VPRRhN$?,l$ }"E!Ê<)\<$M'=t6`Cs|$[VPWl$Ph O$hUO$#<*<0<2=t6<$O$<tO$sQh$$4#1L;$b#y:P$QRPhC,#JG%9u<]K%C=PhAO$h$$=t6S<$CPhyO$KPh~O$K s k t?L$D$FO$PWhPh% N%܋L$D$(Mu} L$D$D$FO$PtPtPuO$O$ O$"QPhPh% N%D$ŋL$D$(ȉ</=t6%<C<$M'^P$=t6CPh O$=t6CKSRQPh-O$h^O$YC~@sFNuQPhrO$! IRQPhhO$ Muj>l$ L=t6?CPh6O$(shPO$h$$=t6<$CPhyO$KPh~O$~Ck tAt$D$xO$\PVhPh%J O%܋D$t$)E}twt$D$pO$ttuO$O$ O$"QPhPh% N%D$<t$)ƃl$ rPhO$j><$€l$ ?^_[]ø w\$SVj  l$ UVW dƅZD 31OjUj t:9uB$=h@U$jVo6  8uh D 39tttn1VSj_ VD$$PjO D 3vhT$@jjj 1VSj VU6hU$1=D 3u$=|$ u'1VSj VWj `^_[]Ét҃t̓ u1Ht$8F FFV3 PhZU$u1IT$WVtVT$D$8x xx8WPV3 a"{jhcT$hٹ#} Q %SWd WhT$j%VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[át6H t6t$Vt$VVPh8T$ijJ%VD 3VPD$$Ht5t$ I?r&$ !P$Ѕuσ^PD$L$ $QPj ߞXWV1N=t6tED$@ L$1҉RRQWjPět4$ hU$^_VQ55 jhlR'&3 jV2 tP[t^VhU$>jVhU$)jPD$L$ $QPj, XPD$L$ $QPj  ޝj#XÐUSWV$$D$D$D$,1H$11D$hlV$WSk f~/P w`1A$xR'5$<) D$u[FtR=5$<D$,D$낃g$<8#u(@j L$ QP_ $D$8L$<Pj@$)$<8#u)@j L$ QPM_ D$D$8$<L$QP跸 j D$ P5$<_ D$D$8c1Fj D$ P5$<^ $D$85$<hV$8_3<=t6u-t6~q5t61ۋtVP蓵uJVh$$FtPhFX$FtPhZX$j -t6C 9|?,u)É\$(k <D$js D$Ps Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0b1ɉQD$ P4 D4D$8u ;8tz`Xt$7t6u t6-t6CPVҳt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP jq |$tt$ VUWs  UW20 8C|$$8D$@PW<tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUW$s #|$$tS9u$UW/ RW_1 $D$utSPW1 uWh!W$Y1ļ^_[]Ë lm3DQu^_WhN"j@ fWVt$ |$7G WVUSWV $$l$WVSU$ $ hU3WhgY%T uWVh4"j|@ D$@tY$$QPhZ'hV`WV$$$$$h0]$j5USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$h]$WSbG L~)Hw;$hY'5$<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5$<L$1@D$kjuhY'5$<<P<=N|45$<1@D$5$<Fp1@D$5$<L$ 1@D$_3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W?9Wr@$N|dže^_[]hn"jc= t$h$胝Phl]$h|f3ӹ jYWVPt$jWVv9 9u9t x^_Vt$h"j< Vt$VDt@^h#V^Vt$VIt@^h%V|^WVPt$jWV8 9t9u x^_Vh"jH< WVt$|$ VWG t$?/tWhc"Vh|"r^_WhN"j/< fWVt$ |$7{ WV1^_USWVp|$o$o\$WVUS$$jHSuWh$O uIV8KD$  = v6%D$ Vt$S jHSt$D$@D$ $p QPh^'hVURD$tS\$O$oj j ShWt$ PZtPMPh^$/t$ SWh^$ڴt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h^$蜴81p^_[]WVh4"j: j觫SWV\$D$@u+t$?t;SP t7VY1 u6Cu6C^_[h\&j": j;USWVPL$$T$ l$\$1$1 3֍zh]$USA @~7M$L['OӃ23=v6 v6먀'룋 $<DF@N@늋 $<IF(NnOe $<R3KF ? 30O' $<aF8N v6O $<g\PjD$ p4t$ N @OPt$(h,\'5$<h6Ƌ$t v6t'tOt@tO t=v6 v6 s= v6v6g@tOy  3sg st1A T$ J sh#V.4$v6$fyh%V4L$ A$I$sh]$V3L$ A I$sh^$V3L$ A$I$sh ^$V3L$ Ahc$ G=v6<$=$<h\!%WUluw6G=$<1#PPjPPd31@D$$$<1"PPjPPjv6m$<1i$PPhPh<w6P9$<1Od$PPhPjw6 =$<=v6j:WDAj/WD.?yv6$<Hf$l$0UU݋\$UW|$Pv w6w6slm3DH,W!D$h$WjhWH&Wjv6W v6N1j$PPhPj l3,v6 lm3DHWD$<$v6hd$_3=d3_=v6tVhe$z5$<hd$j5$<h d$Zhd$Phn"j6 Whd$9Whl$.D$ =v6u1=v6@v6$1󫍄$Bv6Al$$+D$ -v6t1$ 1D$$$MljL$$ PW!Q?t$h~e$w6l$Ul$RQPc $׉ȉ w6=w61| h4f$$t/$$T$9‰sQt$t$WPhYf$tFtA w6WPUa u5w65w6t$hf$|$(F=$PUl uRt$hf$v  A#$=`h w6he$1=w6 $Vh0Mu Vhf$al$VjD$Pmo w6-w6-w6݃=v6~VUWt$hf$;|>9|Pt$t$ )̓ }4$y0\$l$ v6v6ɋ|$  v6=v6 w65w6σ|,@σ|1ҿ9  w69|щ v6|$ D=w6Ejjh w6p .h w6he$v6=v6tv6v6t&hQhdž,<tx(=v6dž dž,dž(Ɔ l3p3u(jhm$=v6-5,{6u"jh5m$=v6,5,{6 v6N0v6F4Qt$Qhhm$=v6w,5,{6F4Ht$Phm$=v6S,5,{6F4 w69}"QPhm$] =v6+,5,{6F0=)hPhm$- =v6+5,{6F0=|)hPhn$~ =v6+5,{6F0N49}QPhAn$~ =v6+v6,{6;v6|QUUUU)ʹ3333!!сis{09\~\{0\\5v6sXș9}%CX=v6~Qh|n$~,{6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hn$2}=v6**,{6{4$=w611F9tA uPhp$j $Kd=w65w6 u։<8=d3[ WVhn$| =v6),{6<$C4$8=w6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPQNjs8ƒPVRW")lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVh o$Az=v6'w6tm ,{6yxH1҉$q1ҋ8$$)$<$$1C$I8$ w6=,{6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$WO1C1 t׉Ë$$QPV$$V9s($$$V[OÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ8$9wȃr$9‹$֋$r‰$$$$$B1WRQPLË$Ë$ʃQPRSz)ÍC4$$W$$P$QW@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ.Kj$P$$F@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh4o$s =v6 ,{6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d3$_|HL!ʉG41SSjhjPS<{6N ,{6I4QSP}U ,{6H @{6 <{6 D{6P44Q5H{6щ L{6`@#HL 9| Hh h3H< v6HX w6H\ v6PTXH fǀ$贖%=,{6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d35O _(HLJ$v6$$$t!LJ^F=v6$$߬$$ڌ$t&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$Ro$=n ,{6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$o$m=,{6O0 9| IУP{6T{6=v6u\Tu))УT{61VVjhjPVX{6uP{69T{6T{65T{6jP1Q =w6Gw6 w61ظ|(RQho$ m =v6w6 w65X{65w6~ ș)dہ|4c'GuȹC=v6tL1$PP$$5v6V1=w6VhZN w61u;1$VhjVu  =X{65,{6h`VW& =v6tWV5,{6x\X{6hhPO 1@$=v6h!q$n=v6|o5,{6N,I\Tt~!NȃN׊Nd1 t1WPhG2$RRi$2f39u1H$Whht@P4 PPftu!ѡv6t $ Q$=w6u$|&,{6H,$$DŽ$%$ ,{6I,$1$ DŽ$1h$f3#,{6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hkq$ڜ=v6Y ,{6j50{6L 50{6FU $F +$^,{6$~J`^p=d3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=v6uFh$ NlK`ڍOȃ$ډFd;v&hMq$=v6,{650{6F $11ہ~U uv`щSA,{6$~!ـ1@ 0{6Il ,{650{6F=d3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\50{6N uҋ,{6B8H!tk)D4,{6B8)Nj50{6$9sE)ȉـ1B~U uv`50{6F$CHu͋,{6B8$؋N9ȉ$J`~U uv`щS,{6$~!ـ1@ 0{6Il ,{650{6F=d3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD450{6;Vs2р1@~U uv`50{6F$Bɋ,{6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$D{6H D{6V$P V PV~x; H{6up=v6tL{6s4PP ,{6@{6@@{6Kd15L{6s4L{6D{6 ,{6q4jP@E ,{650{6{0 9 X{6PVQ* =v6tX{65,{6P50{6g ,{6y0X{6$ryxtG$\%TuCl$AP$ ,{6Ou$ց\TtQ!QЃyId t15X{65P{63 5,{6\TG~8^xN`1?9'T{6+$~0lj$Ɖ$)ى$=X{6$譅%GlX{6T{69wߋ$9w$,{6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=v6} $H$$$~A=w62$=|j.]扄$$b#t?r% ,{6ׁ\TtQ!QЃYId t1RP$Vho$]$$;$$|W=v69,{6H,t =w6 $$ DŽ$j \DŽ$C,{6;X,/$~ j Y\=w6 $hjPA d3 v6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$Ar$5_3)=l{6u l{6$1|$(hjW  ttt=t{6u t{61;{6 {69p{6u  hPV蛐 ueVhke${ohmr$ 5$<h d$j 1Phh{6PVYxō$PUu1h{6he$ō$PUu?Vh~e$j =p{6jjh{6 h{6he$ljt$1=p{6 |$u ={6{6)j5t{65{65{6ף{6{61҉|`$$P$T u$$j5t{6QP $׉ȉ {6={61| h4f$$t.$$$9‰sQt$t$ WPhYf$qt$Vjn$u Vhf$ t{6{6%{6ʼn߃=l{6~VWUt$hf$W8|>9|Pt$t$ )σ}4$ d{6-`{6uU-d{6uY5{6={6t{6@19lj| 19ǃ| d{6u `{6͋5{6={6t{6ˉjURP=|{6l$ x{6uA@19lj$ $t$u h{6hf$jPVW v|$wext23$2fs3$ WhG"h{6hfd'Vh{6he$} 19ǃ} h.g$ |{6t$VUt$  U蒋 t 9t V耋 jv-USWVӉ $|$j W\$ S~B Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"j觺 WV|f3Phr$VO7 1GVWjh"Vhd'ͩW+USWVu} D$8jP=6565d{6%UUUU)3333!!щ%i`{6Bt{69933T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r={6{6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1|{6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ|{65663t$ƺQ=6D$6D$ 66D$661 656D$8666S666N56666[6Z,f6 f66 3f6\$H$SW 93rWh6 5h{6|$t"V3YjVh6* 166\6X66D$6 6+ 6 1҃r1I156~σRVPW足56H19w+56|$OL$)9r΅u 6f5^65d{656V6YVjPL GD$AD$ 11L$\$66tn6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@6t ^6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ 6|$11t$66=l{6~i d{6 i{5`{6Q5{65{6PRuht$- 6 d{656PQWht$-6@6ą61QQjhjPQ讷ȅ6I 5ą6jP. =p{6uk{6 {61! V5t{6 1N1Ƀ *&Fu  1@D$$=l{6|>hx$`=l{6|(L$ 6 61PQhG2$PP +D$$2f39u1H|$LWhht@PV PPftu!ыt$l{6tL$QT$=p{6uL$L$D$ 1D$L$ 11T$h$f3R=6t$tX6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f56616 5ȅ6D$ hh6P@ 566P56Vt$ =6=6 615t{6ǡą6)؉1t$ P =6Wjh̅6 6H9|$u_656 6)ʍZ9s1Gр̅6B9r)̅6VhPD t$ 1Ƀr!11ƃ̅6Cω 9rωp 9ǿs"ˀ̅6CI 9rޡ6L$  61Ҹ̅6Pt$ 56Vj̅6P  ̅6 6L$)QhPo  u1̅6@ u6L$ D 61Ҿ̅6Vt$# 56jV  =6tb1=6t 13 O06F;56r6L$ D 61h̅656 G;=6r=l{6t$|\tX=6te6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=p{6|$T$T$|ʉj.%'t$몸$b#|$|$t?r% 6 6jQt$,Pho$'T$;D$_=l{6* 6t=p{6u&D$ D$D$j &1h2#S'~ j c&=p{6d=616$hjV  fF쀁"fFD$8FFF fF56 ׉؉t$ ֍$fBt 6$,F܉VDF81 L$ F4D$4z 61CL$ =6WGD$(\W2D$S56tPjt$0  ^6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ 6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP L$ D$1t$V 61CL$ \$^6 6=6t$,9sD$()QjPP t$L$ D$41ҋt$(VW'V$Yj=6t6t 333@1=6à r t$hhjV fFA>fF6ÉFD$8FFF 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h̅65656f53|$D$1ۉt$ 3x1ɉt$)rͅ6RQP Wh3̅6V 3̅6D$ fЅ6 61Vt$ \9\$t563D$ CiL$T 1VhVD$pP 956t6t333fD$TAfD$V3ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h̅656iL$Tj f61ۃ=6 5ȅ6<hh6WC 566P56V% 56 615t{6ơą6)؉1WP5ą65ȅ6ƒe^_[]h v$hv$ au$hZu$P ho$Ph v$hv$Vhr$Rhr$PRh s$hVh7s$hVhas$RVhs$Whs$VPhx$hw$vjVWt$ht$gh0t$`h`t$Yhq$RhHt$KRQht$B1u$1u$'h v$hv$"h v$h?v$h v$hov$ h v$hu$j腥 USWV6=6tr6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ6t ^6 6Ѓ^_[]SWV=p{6u0׉΋ t{6\$QPSt$ 56w 9u^_[WVhw$hw$jΤ USWV=p{6΁ ̅7u=61 6 ̅7t{611;{6-{6ǡd{669v@1Shg'8!;HtH#P;Pt USWVӉL$-6USt$(D$ lj\$  156 6f|A 61WUEG G6@ 61W566fL 6<$66Ël$9ʼn-6D$1PSVUBщʉl$)Ћ6SRPQʼnӋD$l8\8( 6 t1$P56X=36QPVt$ Nj|$ ǃ=6t6Pt$VW %=t((?Gdڋ4$V56[V^_[]hPw$h,w$-VUhPw$hw$Pjj hPw$hUw$jj hPw$h~w$j fUSWV$8tWm ƅuWhu"jǞ $$<$4D$Phd@U| tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h+%t$ 1 Sh"U CPh8"U C Ph"Um CPh"U[ CPh"UI CK,C,Qh/"U1 C0PhD"U $@D$t PT 1-Uhzd@$<Ww t1 VhedAW\ hjU3 D$ P$4yD$, 9L$跺L$9u0$S11:8tx$0h"Db$11҉ $ƅ*ŰPj PU@ ^_[]$0h"jM USWV81ۍD$4ShPSuh1NtAljSPSWuW"k uMU D$t$$$Q1e^_[]fUSWV1@D$D$Pjj蛡 Ѕ7xjjj脡 ԅ7y h5x$j| jPk u hJx$Җ P uhcx$‹} ]78 1HD$D$ 1D$؉hjx$WSʢ H41B$Xg'؍|$W5$<78؉&} r؍|$W5$<7} 8!M ؍|$jW5$<螖 9D$=} ؍|$jW5$< D$} 8e؉|$L؀ ؅7 $<1y$PPh7؀ ؅7؍|$jW5$< 9 ܅77؀ 7k؍|$jW5$<裕 9=D$؀ م7؀ ؅7؀ م7ء؅7@ ؅7؀ م7؀ م7؀ م7$<13#PPh74 ء؅7@؅7$<7|؀ م7@q؍|$jW5$<詔 97} ؀ ؅7-؀ ؅7"ء_3HD$ ؀ 7 ؀ ؅7hy$ 7؅7uz&t7t_ T7v C =7~ - 7|$D$ fD$"l$"|$0l$L$0T$48 8T$,L$(l$( &|$D$ fD$ l$ \$$l$D$$8 hz$ 5$<hx$t\$D$x$$s 5$<h#y$Lh?y$C5$<hXy$45$<hx$'5$<hjy$5$<hx$ 5$<hy$j hy$؅7Щu h,z$T ܅7t7 ܅7D$ Ku9_3t-hy$hy$9}$b#hh07h 7P $7%؅7=u ؅7L$ u(,77(77$7 7 77f07478tω=@7u ~ 1ۃ| ‰T$ ؅7T$ D75H7VL7u VhUz$WD$ @ux=9}b7C9uU7zh$f357h݂$G9}%8i-@=B'7C9u壔8c4P87t.D$jPjh5Ѕ7 u hmz$藏7t.D$jPjh5Ѕ7 u hz$`7t.D$jPjh5ԅ7K u hmz$)7t.D$jPjh5ԅ7 u hz$ ؅7 t+fT8V8$7W8|8[8|8t'ƀT8'(U8ƀV8|8((x7) 87)PhT8Q D$jPjj5Ѕ7_ y hz$K8 |8@L$H ؅7@fP\$1ҀڈP@ 7P  7P ; jh7j j5Ѕ7 h{$lm31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh$P HơD7 @79}1Ҋ\<7B9|1@9u؅7hH$V ~"1D77Ph #5 G9uj F s*D$<jPj j5Ѕ7 y hz${t'D$jPj j5Ѕ7d y hz$Pم7t'jh7j j5Ѕ74 y hz$ 5$7 5@7Ph07h?{$o jh3hh5Ѕ7 y"3 3=h\{$jh3hh5Ѕ7 h_j1585858585858588D$<8@ppp pVPjL Wjq<957~h8j CF;57|/USWV։ϋ\$l$1EE EEfEUR6t tMم7u6jjU? u##V4@t)xu:H Mt0t$VS輜 ^_[]5(<9 PVhT$Whm$j萎 Ph$h|f3;  j=ԇ8u-=8t$hit$Qć89܅7~܅7j1jh8jo[ thÂ$j: USWVX7ć8ff7838 83 8 7P8f7f717Ѓuȉf 71t$<jVjP5ԅ7 4jh07jjh75ԅ7Z y؅7t h$ˆD$<jVjj5ԅ7 h8j. 7P8f7؅7 r&sK878787+ 8ɸMb-8ʉ 77 @7yf7|$qD117C9ut P7‰f78T$1A xVWh07h$( h$Yh|f3Lć81B h8ԇ8@ć8888888̇8 ȇ8 uCء8x88t8 8 p8̇8 ȇ8Ї8 ؉+88D$HT$Ll$HЇ8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ ȇ8̇8&wh7 88 ȇ8̇88Ї8ʚ; ȇ8̇86eĉЇ811ۋ88D$T$ ؋88D$8D$8D$5Ї8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v ȇ8̇85Ї8=8|$(t$(|$D$ fD$ l$ \$,l$|$,=Ї8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5ȇ8 ̇8=Ї8؅7t 1A؅7y7D7 @79}(8i-@=B'7@9u8e^_[]hd$hz$j@ USWVh8j5 7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$Dć8;܅7D$Ḋ8 ȇ8 t]+ 88$$߬$Ї8+8D$\D$\5&&s=ԇ8uZ؅7tQ̇8 ȇ8 t5+ 88L$xD$|l$xЇ8+8D$XD$X5&wD$DD$D؇87 &w١8 8 t>+ 88$$߬$8+8D$`D$`5&D$Dw\$8Ѕ7$fDŽ$jh8jR D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PS SD$lD$lPD$,Pj5H75L75Ѕ7R <h8j" L7D$8<BC97)؉D$D$8 T$,h'\$A9P8I؉L$A ć8Iff9uԇ88@88<8888H8 L8u8P88L88H88؅7 1D$18 8l1A h{$0h|f3A؅7<1A t$, PVh{$r ΍T$(jt$>Ph$<D$ ؅7t$؉T$΍T$(jt$F$h'h~$΍T$(jt$Jh$΍T$(jt$bF$xh'h$΍T$(jt$$Fft$NfQPhq$  ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h1$΍T$(jt$؉t$h;$΍T$(jt$d؉t$hK$΍T$(jt$9؉t$h]%T΍T$(jt$X؉t$h_$)΍T$(jt$-؉t$ht$+hӀ$Ph$L$lL$AQ D$iPhE$h$ h$h#$Nh|8h\$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ|$L$dT$C; 8u#Ph8QD$X\L$$ D$L 8PQh8ѳ T$Ҹ|$u1G|$T$PL$r |$ rI,f3H ,f3~$f3H $f3 h$f3j z(  }T$A{^N2D$ˀ) h|$uPt$,X L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh|$qh|$[9 |$ sS,f3H ,f3~$f3H $f3 h$f3j 5  }KF߉Ήs(T$h|$L$T$؅t%,f3H ,f3~$f3H $f3 1I h$f3j h$f3ݯء8;܅7*؅tء؅7!^L$AQ T$Q=<8 88 t+)|$L$p|$tl$p@8)ЉD$PD$P5&X8X8`8`83v3؇8v؇8\$CfK%h8f!th8 8T$ .KfKfh8D$ 8@1ۺ9T$t$,x L$IfɋT$8RD$4\$T$T$$T$ $L$J8@)t2(uK l8؅7t1 l8h{$ l8 ؅7 PVh|$8 Ph$h:~$hW~$hx~$AfPh~$h~$h~$h~$h~$h$h/$hF$hV$hg$wh$mh$c l8h{$n1BD$D$pf3@)f~\؅7tSωL$!ȹT$V!RPt$ hC|$T$ D$,؅7t1RT$D$fxf53؅7ruTt$,E L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B@7C9D$=؅7 ؉T$5D7|$77)RQPU GD$9L$~D$8:7uG9u߅uQt$,s L$IfɋT$8RD$4\$T$T$$T$ $L$E5D7)7t$>RQPhx|${D7;@7}0u h$[Ph\$ICы\$1B\$D$\$D$T$jh{$jw 1Ah4v"WV88~b88 ,f3Q,f3; L> QPh$l؅7tkD>L> QPh́$F|>uGD>؅7ufPh$"L> ffPQh$ ^_[WVم7u8jjVr  t'86 PWh$hh|8 "6 Ph$$hh|8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h,$$t$t$ t$SPh$ UPh7$ t$t$t$ hC$t$ PhU$pt$ PhkI$Vr0G9s'GPh #0| KG9r߃$^_[]fUSWVHƀ8-uFh##Vu 8h##Vg1u 8T$,11CD$D$hj$Rt$0eu Hw؉$h'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 _31;L$(uj|1L$ 1ɉT$Љ $P褾L$Au $AP{D$t2ڋL$ PWH WWf uމ$DuY|$ujHP Džu ~ PyP$t8=8uIj Vh##辥 Whs$T1FVrPh$$Vk SU< h##=8Mj Vh##h Wh$Va \$$b#z"$VWS jjVWS\$u7 1GWWBWj7Wj,Wj!WVWj VW9 u h$jk jj9 uÄ$8j~* ub7 jk* j jO9 t)qtOQD* j j(9 u9ل$8t1Aj jh## ukWh$jh$t$U: $Qe0WW8 $t$b#V腣PShPh%Wi SWh$j解AVf&=8u$b#VPh6$h|f3]jfD$tPh$hk'Ph $h|f3 jUSWVPu } hk'WVq cR~5StET ԑ8͍Hw4$i'đ8벃L8̑8둃ftTdL 8tȑ8eؑ8VБ8Gܑ888) _3`n8=ؑ8tjjhV%6 8ND$ jjj"5n 8jL$$Qh@hP覬 u h%c8i )ލ<S H $(i'=8t1Aj D$<1CPSeD$D$ PSND$D$$PS7D$D$(PS D$ D$,PS D$D$0PSD$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F 8D$8gtj586 rD$ D$$b#D$D$$b#_;-8S$-t.H$1ۃ=ȑ8uWh$hp$hX%T >hg&S蔹g =ȑ8uh[$hC$hX% 1C8FLCSS H3 VT$W$Pi' \$@1ɍP$ j'81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128#8L$L$# 1AD$ PD$@PD$ D$<+8R D$ Pj$838383 88׋t$#D$ Pj8d$zT$ ED$ L$TL$@JL$C8"3-L$#d$d$d$L$׋t$ 8:88@.@8"(808 H8\$ X888 t 8t 81SSPr L$Y\=8j$)/jD$D$ D$$b#D$$b#8L$9a|$u q8 8ta|$  ‰4 D$=8T$tD$1@D$ ,1ۉD$0hxSh`8J atgcuL$c8 h8b88@8t88l888 X8 8tJt$(~A|t18t|$ ObT8ؒ8tPt$ tH@WVhؒ8,e ؒ8=ܑ8t=Б8uw$8tMD$tH@Vt$ Wd =ܑ8t=Б8uL$$8tDD$(tIAVPWd =ܑ8t=Б8uL$(${8tDD$,tIAVPW&hH%V>t# 8T$v1FD$)1C؃D^_[]ET$LW t$ȉt$V3CىD^_[]/t$VW t<$ul=8tcW ŃuhWWth uTWD$$L$ D$$HT$JHp 1VsR '.Us 1ۃ<$ T$t$e1C~ ~~~g&Wh$h $|Wh)$jL USWVP։Qý 8t 89t;~11 F@Ft 1JʋFP\كF@FF1҉PPP P|FWhPL$ CL$ tND919^_[]Wh$PhQ$jK VD$ 8tw:114w "w w7ɉJ@ΉpfP ɀ:u r9‰w@^Áw뛁w렁vw닁wHfW1ցlSVYtt:uOq蔫 PVhˌ$1D$hPQjPVh$Qq PVhٌ$ Q>PSVh$h$f3~^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV&+D$  PCY1PPWSjV|$dt$ \$h$ D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy93tE3P{y$L$t hc$h$QQh%PPhM$4 C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPh$ ,f3H ,f3~$f3H $f3 h$f3j T$h9t$g h$' L^_[]hՈ$ jh5$jH D$t'T$tt hc$h$QQh%PPhM$ ËD$t%u$%tur$Ph$i$|$PhՊ#jUSWV|$<\$8D$4t$0~u/jUb u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhRn"Ph$$PWhk# ^_[]USWV|$4t$0=8uM8hh8Mt 8'j.h8rst@hPh8T t"^tCt0Wv`rhhxU%h8S ^_[]1w)ȉPjQ蹣 SVUz fEu jU` WUu&Vh8Sh$hh88^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh8ShӍ$hh8褽8[SWV$L$4D$1Gm't$"tZ@:t9rD$Ph$跾,^_[SWV|$t^D$uFD$jjPp t1Nj0j.Vqt@h8Pu7ut$ߤ xU%hVh8R 8^_[VD$L$ 1Ҁ0QRRhh8VPH thhP%h8q 8^Au yuyt$Qtu ȃPG Q? APh$hh8"8SWVD$8Q4ݍ$R84ݍ$R8ƄR8.r|I1AFL$ tWWVWh(o' u;D$ D$ PWEWWVD$Ph(o' tt$UĨ ^_[]h?r%t$  tԉ1|$l$Vh$PVS0MHt$t$Wh|dD$Py \$tN1D$;D$ 2i9t$sVt$Ot!ʼnD$t$Wh|dt$jy ul$$WhedAPOy f$a$>ukSt$h#"hD%h$W裭Ƅ$t$85$ Ə$t $QPW輮 $Kà9Éu|$$P 1h?r%j Å~A1ۉh"PujVh#"hPh%h$WͬƄ$|$t$8\$ Ə$t2$QPW C;\$ mUZS|$l$|$$PUSWV z uj迤D$$D$<$sh$VthZ%V3hU2 Ƅ$hZ%s諆ut s hZ%Vtt s h$Vt P= $8D$ h$VͨtHá(8th#P (j,S_tZ S7,PD$PU#xD$!=`ÉUh$$- S7Dž?tG<$tSWUh$h%h$V}V$ tEUh$Zh$?Uh/$h%h$P+15(8tVD$Pj A Ë} 9tVSh$蕹 tNt$ t.u[D$.m"D$$>$ch$ D$8m"D$$E$:D$@Bm"D$$L$t$ }2D$%$D$$$b#}D$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S\$ =08uD$y$D$ P$PH 8\$t$Ph$ 08PU uUh$$n 1@$~#Qh$ 1@$\$$$Ĕ ^_[]$Ph$$j$ DŽPhȓ$h|f3 j蝕USWV L$48$T$t-88*jh48> 88š48$T$1i E$48t!u6$t$PnwT$ uF$t$PRwT$ tEM<ǃ he$1 ^_[]ËD$ t 048$4$݋D$ t 048$$ؾ<8Phh<8" uh<8h$$j># fVD$t.})zhzQ9h$5l8褟 TI9T讴?r%%Ho'PQhPh%5l8oi#u5l8he<$TI9^ËD$ H^WVθ%Ho'PVvt)uVh$5l8 TI9SGt8tPwh'$x wh2$fuj whzQ9/ GQ9Q9^_WVD$ t;5Q9D$=8 |8u 8Ho';pt8@uVh $j! @u=R9thR9Ph'$À Ph2$賀u5Q9=8^_Ã|$t :$TI9Ã|$t %TI9Ã|$t A$rTI9Ã|$uhQ9hG$5l8{ 菲TI9Ã|$uhQ9hh$5l8J ^TI9Ã|$uhQ9h$5l8 -TI9SWV$$DŽ$HH$pƋ$ ƒtS!=@I9Ҕ$t͔$Ȕ$atσ=LI9 =PI9 PSj $;rtr1Auu($$h$PQ: te$P$$h$PQ t8$(1;BQPVWEV>ǰTI9^_[USWVx֋$$t{tp11@=lm3D_t1z\t r9΅t<΄t45lm3AҀ|Vy5dm3TVP5lm3@u΋$ $t`1HhjI9trʄt<$1ۊXI9t8tCu 9siI9B+$=FFu4$D$|$ 1 zI9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ zM9<$؉D$zM9$to\[$uvz$\$-lm3BDEJ<0HB,t ]tVрy$t[lm3BDC$G)=~"B $tG)=BJB5Alm3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5l8h$ <$?uhVWY( x^_[]USWV0$Du%$H$Dhה$PQ y1E-hZ9h'jUh@8购 t$H4$=8I1VV$P8 Í|$0;=8=hZ9$H5PI95LI95HI9s =@I9Ҕ$t͔$9ƒ=8RPSQUy=hZ9uE=h8t<88$HcthZ98 hZ9VV$P? Å 4$jshZ9iTI90^_[]Ã$D|Ã=8t=8;1 T$󫋄$HRjh4 |$D$=8ʉǃ=hZ9$H[L$05PI95LI9j =@I9Ҕ$t͔$9Ã=8VPRQw=hZ9u9=h8t0588$H1thZ958G=8-=hZ9$H$HL$05PI95LI9j ƃ=@I9Ҕ$t͔$$H9=8PVRQv=hZ9u_=h8tV=88$H1thZ9=8$$H4h$蚠D$P E;$Dnj=h8t#l8@=u1Hjh"#P jh@8 WV=hZ9t@=h8t758= 98 9158= 9u hZ9^_USWV1@=8S= 9Fϻݞ$ͅtUSh$5l85l8Ht$PhVhe3zxddm3L$DH?uOq#t58RPhɖ$Q裆8#5l8jj6h$881TI9^_h$h8t$t$ TI9h$h 8t$t$TI9WVD$ tZ}UuZt$~hn"W?tOhRF#W?tBWpy7vh$5l8υ 1H_1=|81@1|8 x81ҾRF#tn" щ x8PVh+$5l8p1=|8TI9^_ËD$uD$L$hE$PQK tvD$ph$gu<=TI9u0=8t5l8hV$ D$ph$tgu+4R9`V9`Z9ǙTI9VD$ L$TI9t u]H 8HQtsP t8=`R9l8t5h`R9h$P3 TI9(^<Vh$Pjj$h$5V&^ËD$tIDuD$L$h$PQ t$D$phח$Ufu4R9蹘TI9SWVD$-uD$L$h7$PQ  1G=hZ9h'j\Wh@8H t D$1VVt$ ǀ?tx=hZ9tyD$thWhח$eu 4R9=hZ9uB=h8t9=88D$bthZ9=8 hZ9VVt$A DžaSjwhZ9mTI9^_[ËD$uD$L$hߗ$PQ< tmD$_D$L$h$PQ tI|$BD$ph${du8D$ph$bdu4R9ÃtTI9USWVt$ |$.E1ۈ$$DtÀ8ua"SUōpW#V<|@EUSP ,$#9tVƅtyD$=ti1PPh"t$VUǂtFVF# >5l8jj,h$1% u v1.=TI9^_[]TI9USWV D$ #D$$L$ h7$PQ L$ ȃ#D$$L$ h$PQ D$ L$$|<$Dh#t$iVt3$8|t+4$$H$D$ 3D$$hZ$0VD$1E-hZ9h'j'Uh@8 t D$$\t$=hZ91D$ H9=8"t=%9$9t$t$T$$VVP4t$QhZ9u?=h8t688D$$" hZ9tA hZ98E_t$jFhZ9$9t4$!*TI9 ^_[]SWV$tKjjtK~S胖 9uWjȯ1uhq$贒1HTI9^_[þV Fujj{h~# Q %tj/VtE t@hQWj =|8t85l8V l8HQP~ Q Pj y|j5I9h'A#WVm~  jWV_~ Vh^$TI9j-qSWVPD$D$t&D$t$h$PV蓽 rTI9^_[ËD$ph$^u|$h$ tD$x|$Wh$^WQPjW3] uP|$h$ t D$x |$WhƘ$I^WPPjW\ 1ۃuM|$ Àu*D$p VhƘ$^VPPjV\ 8{5l8hΘ$ D$TI9(=`Z9t =`V9u=`V9t#h`V9h$5l8z TI95l8jj%hݘ$3,ËD$TI9=`R9u4=`R9t#h`R9h$5l8lz TI95l8jj$h$+ËD$uD$L$h.$PQ8 teD$phh$\u<=TI9u0=8t5l8h=$s D$phg$a\u4R9ŎTI9ËD$uD$L$h.$PQ莺 teD$ph$[u<=TI9u0=8t5l8ho$ D$ph$[u4R9TI9ËD$t8uD$L$h$PQ tD$L$QPh$b# ˍTI9USWVh$V $|F$$h1Gh4VU 9}hh?r%V> G9$uVh$$Zu jLT4R9^_[]ËD$t8uD$L$h$PQ tD$L$QPhЙ$ ֌TI9ËD$thuD$L$h_V#PQ謸 tHD$:D$L$h$PQ舸 t$|$D$pph֙$Y ÃtVTI9VD$t$588u h$Y%TI9D$ ph$Y58^VD$HrߋTI9>588uh$8YD$ ph $"Y58^VD$t$588u h$X%aTI9D$ ph$X58^Ã|$u|$t&TI9Ã=8t 1PP)j=8t 1PP jRj|$u|$t͊TI9Ã=8th$$3X'V1VVcVjVPD$ D$t}uD$p*lTI9fh$hHI9t$t$TI9h$h8t$t$TI9WVt$ t3}.u:LI95l8h$T LI9TI9W辇TI9F|$LI9@LI9TI9jwhXI9 u iI9jwhiI9 ^_VD$u,PI95l8h$ PI9TI9D$ L$hš$PQ |$1@PI9TI9j 5I9@"ƃ=8t~ vt5I9j V"h5I9hzI9 ~ vthVhzM9 zmTI9^VD$t.uf1=888n"tRF#D$ phn"V*t.hRF#V*tA< u# 8;4xZ9~F9u e3I e3~e3Pe3he3@ e3 tu:Qe3~e3H e3he3@e3у u5l8h$ 1HTI9^_NA 84|Z915l8hʜ$WVD$ tkfuD$L$ h$PQ tFD$jp蜸lj!ЃtD$VWph$5l8i1~1HTI9^_USWVE{uE Mh$PQo t]E jp@T$$!ЃtI5l8E xS!P9PWh!$Vh1;C ~1H1TI9e^_[]ËD$tu}TI9h'$MKËD$ph,$8KVt$ h"jVt$tvvh4$5l8_h^USWVD$uD$L$h$PQH D$pfh>$[tǀ8ua"W=V=,UPUWP Uh?r%S UVS SG TI9Su Vl |TI9^_[]USWVPD$uD$L$h$PQO h>${tǀ8ua"W1<ÃP||@CSWP! =8I9(I9$-,I98188I9(I9,I9L$Pjh$qVh2$h=8I9-,I9$(I98Vb {TI9^_[]SWV|$uvt$>he$W t+hݗ%W t hl$Wu: 1Cv}tu&6ht$5l8e z1HTI9^_[t8u88P58h$5l8e1VD$ L$TI9ʃuCuD<"3tKD"3V$b#tQPj h$5l89eu^Czjpp TI9^WV|$ W߉tQƋ|$@tPFWTF=8t3|$t,P6hڝ$5l8dWhĝ$5l8d ^_WV|$D$ TI9uIwOtAƋ@tPHF6h$5l8;d TI9^_Cywhĝ$5l8d ^_V|$t.=h$P(t$Dh$$t$l $t|$@t$t$@ЃD$; 8t|$tt$D$L$d).$`.$Y.$tM.|$Htt$HED$H|$Ptt$P*D$P$t$ DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD= 8t;P-D$HL$H+ 8tD$Ej/t$L t@Pt$Dh$t$HD$t$ѡ 8L$D|$D$81,I9(I9$I9 I9$$9$8t1$Pt$u$\$` ,I9(I9|$py4I9$h3"#t$L趸D$|$t$e$QPu5$8$<$$$\$` $I9 I9(I9 ,I9t+t$j5,I95(I9PY=8tPt$Hh?$5l8U ,I9(I9 tQPhJ$5l8U5l8h"#T 1O$=8K8 1O$*|$pu D$TQhޡ$b8ht$hWu =TR9|$Lu:|$LD$puuh$t$Hh$*uh$S~D$L4I9`$|$LD$L8|$dD$t$h $~8P$$W)$<h%V'[1A$<$ǀ?tvj:Wl t=@j $QP}[ ~޻t?$9u3;$u*W")9$<r$)PWR t/h%VZDžm1Ft$Hh$$1$t P}$$u |$p$$(I9 ,I9t$Lt Vhj$t$d脯t|$dj%Wt Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1h%W)tVh#$+`$(2WbDŽ$t$Dۜ$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB X8JBB D$(PRW$8 , t ]60vRtD$(Z$$PN-j j WhSvv t%h"PS| j "PWk =8t+D$(xt!~U$ti$WSP5l8Pv jvG Åx`=8u~PvvSfx)$P$P$Ph$b#蓈ykS 1KW$Ph{$K Nȉޅɍ$P) PW$4h<$]h1N=8tJ$t$uP~$$t$uPY$8~RlZ9Wh$&tNu1h@h$h8 u\8059ދ$tPQDŽ$$t4Wq$PjW0 $tPDŽ$$t4W2$PjWF0 $tPDŽ$D$(t P( |$D$$hij谀$8<tQ_h$$记D$$\t$ fj*8tV=8tWh$5l8N t$$tI=8D$tPt$hhɥ$hͥ$5l8M1@t$ht$hh$f |$dwh$V #h$Vѭh $Víp8tph k#V觭 ȅu(I9 ,I95l8hɥ$ۿ 5,I95(I9h$Va5,I95(I9h4$5l8M1F&1t$lh٥$V' $`#=8t"D$$n$t[$QP|$h$ tPh$WȬ h$h$h$W讬D$$0$|$Pt1$tɥ$ty#tD=8$tPh$5l8L FWh$$8W= $$0t-=8tPhϦ$5l8K FSh$W t=8t5l8h#< h#t$ ˫t$d1VP}\$D$Lt$P5"3ږƉ$$ىD$ډ׋$$|$8‹$4$8$ 48ˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$P$+$$$$+$ΉЃ||$`t$@$Dt$=$|$`tCt$5858w h#58M|$`=$@$Dt$h,z#費|h#t$D$8|jj n$D$@h"Pk D$@|$@DŽ$PH,I9 (I9 m!ڃt9}M#$H5$I9 I9$$!;$$=8t5l8jj hȢ$RD$T}D$@$f3=8I9=8,8 (8ƒ089}%l8HQP ;HQ#l8HQP<Q 8tB$ڋ$!t  I95$I91ϋ$H1 D$h=%P h"t$B;D$@|$@tDŽ$ t$D$@Ph^$hK$Vhm$O"8)PSh$Oh$%Pt$Hh֢$j2lh$h٣$Gbh'$GL$D$ D$8t$4D$ D$0D$D$,T$1@މPj =t$Ûth$赸jct$@$= $#$1V$WN$$$$$$t$@Ѓt$@Wt$ u.5l8$PPBPh$V9 ,8=(8| jZk$I9x& (I9 (8,I9,8; I9u1,8(8D1\$  (I9 ,I9PL$T$ T$8t$4\$0r\$ 81tt$hr$5l848 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$dED$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#;7tt$h$5l8k7 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$DD$L$ L$8t$4\$0h$DD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h#$$C$D$8$D$4$D$0t$,$$1@މjh$CD$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h;$h1$hh$USWVD1D$ D$D$D$fD$D$0D$8D$4jhb$Q t}D$VtƉD$j@Pbt%L$L$4t8@P@ƉD$j:V.@PD$ t$D$0|$$jPW4 D$4t 8D$t{8tvD$ t8tj;PX th$Ph $Wh$WVWhH$qA VhA$aA1C)1C>l$,|$ $tc?tTj/W L$9uut$@jh%V @L$ǃuC=8taD$t$uI$t>thh$V1Ʌ $t}thh$U1ɉL$<=t8=8t 1PPӼ=t8'|$DhPW |$L$D$L$D$ tD$ D$$=88L$QPq=88t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPho$W? "D$Pj詓<$l$,|$u'j/VtG1|$t>tFhh@A&l$LU~ l$t$1l$ -4R9D$Pj«9-4R9*x1l$,1Kd}Z<$t3$DSVW Sh%W SUW <$hhE%t$LV t$l$D$ D$<4uT588=$8X$tD$hP|$LW |$D$Pj58 8uj/UA t@ʼnD$ D$$=$8tAD$Pj?>uP=TI9uDh|f3jhh$;)1D$PjV8TI91ۃcÍL$%L$0d؁D^_[]1Eh$<Ph$h$jx USWV օ\$ |$$jhR$Q l$t=jhb$U t;jhZ$U t9T$(.C fCPC fC C 1}Gt$j/U$t9lj)CSyS\$$UP肿 { uG<$WxC Uxj@V|$$tZ{ u t8w@PmxƋ_j:S\t@PLxG_Ot[uUnj]U$tYÊ@t<:uL)SUV蜵 V蹉,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PUl4 }t $9ut=s fCt$t$UhƤ$t:CC tWt_uk8KUVhq$K: t$t$Vh$3:\$ n1HJ38(u$b#UvC{u{ %t%PvC1 ^_[]hJ$j[ WV։2vvvGvtvGF G FfG^_USWVȀ%t u7Qt*5lm3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=h8t<Ph$jdV&~ l8Iu1IPVQ{ jh8(B Vd8j\=h8t|jj ;MD$~h3"#WI D$|$n8D$ PD$e38u Njhx81 t$jLD$=88xPm 8|$tt$TD$jTI9,8=(8jLh3"#VD$|$t~D$ D$fxtD$xD$(PWRux.#D$0=u$$ $I9 I9u h$5l8 Wh^$Vh$_TI9D$tt$jrKD$tt$j [K8xPk 8|$ t|$t D$ t$Ѓ|$t t$D$$81,I9(I9,8(8e^_[]Ë=,I9 (I9" t^L$ hҔ$VthȔ$V"u3Q9HD$fxL$ D$@щυtSVh% Vh$$4R9WD$|$Y8;p8v+ t8tQغ8p8P]ct8jAD$ujj ID$=8I9tD08=8t $I9!ȉ'D$ !jWPt$G[1Q9HspL$1HfytL$IT$fztD$PV5<85p85t8IE aPhBw#ŕNED$HQPD$~ Q Pà tWti,8 (8;L$D$|Tl8HQP;H~0Q#5l8008L$D$L$Pj#͋D$@ @D$HQP;H~bQ (8,8D$HQP;H~(˃ tًz8(8,8PS7Pj *1HjWQPЅx,5,I95(I9h$ $u h$$&tc,8 (8;L$D$}%l8HQP ;HQ#l8HQP~ Q Pj jD$@ @tu hBw#蠓D$@ @t$8 t h$1H,8(8jq>|$ tD$ t$ЃD$t$P1t$V,8=(8 Pj#%h߫$hӫ$h+h$SWV |$$D$h2$Wt D$2$=DI9Ҕ$t͔$D$Q9ƅu=XR9=\R9 4F95Q9t jVth#$jw$=895Q9t jVthp8h8$t$ jh48** jhx8* hjE08h2$W 8|t1@v5l8h$C M5l8h $+ j#TI9!h?jwD$ ,I9(I9 tQPh$ \$$SWh% jU j#D$ ,I9(I9 tQPh$ Vt$h%j 081WW"W4$jCj"=08SVh@$5l8j4$joCj`" ^_[Åu1t PF"=8t j  |$1=8P"=8t j  |$1=8P!=8tV o91j $,y hV$y=8t TI9jYVV=8t jf!j\!=8t TI94$jABVt$h% t)Vt$h% u=8 j =8{j\lWVd81VA5hZ95,84I9rt suY$w$dWPV谠 Wh$Va l8Iu1IPVQq_ jhx8& Ph$je USWVD$=8p888jjPD 8x8tL$jQjhP 8<<=D8w=L8j=8=|8u 8h$Ɖ=8~&t =8u!hk9h#5l80 =8tCTI9=$ 5l8h$薀 hϬ$Č1A =H8=P8=8=|8u 8h$>Ɖ=8~&t =8u%hk9h#5l8j  =8yTI9=tT$ wJ5l8h$ ?$tgL8h#$=8 #$3$t2P8h($~=8($PASV3Q LPSV3Q QEPSV3I1  $TI9=t$$ <$$T$$$VRQPWhn$hp8 y$$:$:$:$88D$ff8k=858=^ 88=8188u f88t P] 8jjP覔 8=8u(QT$ RQhP 8 8Qh8P" x8tjD$ Pjh58 D$1888Ĥ8Ȥ8̤8Ф8D$Ph8588 OD$8j58iy h$-=8" 8$t#/=D8=L8=H8=P81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR@ =8=|8u 8$P$Pt$h$Ɖ=8~&t =8u.hk9h#5l8  =8+L8 8tPV8 8858=88SWVRQPh.$H8$8$¤8D$|ä8D$xĤ8D$tŤ8D$pƤ8D$lǤ8D$hȤ8D$dɤ8D$`ʤ8D$\-ˤ8̤8=ͤ85Τ8Ϥ8 88PQjRVWSUt$|$$$$$$$$$$jjhE$/X=8[=8N81ۉhϬ$#1A#h$hЮ$u 81ɀ=8D$jD$ Pjj58 1Ƀ5l8h-$ey 1E=8TI9=$ w5l8hq$h$\58X 81AJ8;TI9=t+$ w!5l8h$W5l8Qx 뗠8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph9$hp8Q , |$ |$|$1-8-Ф8-̤8-Ȥ8-Ĥ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ fD$ L$$T$(t$\$VWRQPShB$hp8 1-8-Ф8-̤8-Ȥ8-Ĥ8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ f8f 8;88jPh858`1ɀ=8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$hp8 \|$ |$|$18Ф8̤8Ȥ8Ĥ888f8L8@uD$ $ ff 8jh8h8c 5l8hέ$5l8hD$5l8h$5l8hT$5l8hέ$=8USWVX=88tuPjjPT ƃPj58dT t$8D$fD$D$jPؖ8<D$T$ |$ Mbt$1PW訖T$L$+T$ +L$(x@Biy1PjV.a u8t8#th$uh$8t$4\$8VS58S ǃu+=8t 38#uoVS58S t׉58S =8t$jWS ut:|$9uD$0jPjjW V58Ehͯ$58'S 81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ ,I9(I9 )$fz$R|$0|$,I9 (I91PPPt$ :K,I9=(I9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P t u\$,ى;=(I9,I9|1jPPt$ ::\$0D$HQPD$~ Q Pd " t ]Pj ti,8 (8;L$D$|Tl8HQP;H~0Q#5l8莬08L$D$L$Pj#̓(8,8D$HQPD$~ Q9 Pǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 (8,8gPQ;ۋ] ,8 (8;L$D$}%l8HQP ;HzQ#l8HQPQ 1JjQPR读x~L$1HfytL$I$fzt$PW5485858e8 t h1$r1H,8(8vu h$$}rE @Ph^$4Pj D$@ @t$|8 t h1$=r1H,8(8$@ @tu h,z#rj|$ tD$ 4$Ѓ$t$1t$V-9t$t*t$hF$5l8 5l8hz$he ,8 (8|$| j%= 8yD$ = jjSvBT$DD$@!уJ։1\$HPSs{ 1CSu 5l8} D$@P蒪P5DPWh$VPj#yh;$h%$h3h$XUSWV\$j/S t"%9tjP /%t%jPDžxx8hSh8蛂 ƀ8.ue8G1dMt[G09tÉ؉jh8x.0uO.u1GOtSh$o1^_[]5l8h$qc SWVd|$t1F58j"jdhױ$S l8Iu1IPSQ@ W9Vhx8 SWVo9 f$D$@=u1H$jjSPyt hװ$nhh$5o9 5o9Ѧ o9j Dž,y hװ$n=8t TI9j9t+t&1ONthSP@ ju=TI9(u jj'h$ =8t TI9j8^_[V&08j ,80^USWVP,8htj |$ 8te$Ԥ8\81@K$\8Ԥ8188E8 TR9CthQP ETR9 <88<88󥡬o9<<o9o9@@o9Q9DDQ9Q9HHQ98LL8@I9PP@I9DI9TTDI9HI9XXHI9LI9\\LI9`;XI9VQPp~ VWXI9P^~ q;iI9VQPF~ VWiI9P4~ PI9PI9;zI9VQP~ VWzI9P} zM9VPS} VUzM9P} 4$Vj=,8t,8jփ^_[]8j%=h8t#l8@=u1Hjh"#PD< 81hZ9,8jh48S WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR0K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5l8h$] TI9Q o911j1xt5VH o91Vhs$iTI9jQ4^5l8h$r] fUSWV(1h$b#S`$@0o 88E%8E%8h$袅 $t 81@88888 88888 8$8,8(850848588<85@8D8H8L8P8T8X8Y8h$ tVPhY8z 9 I\8h"谄 .o"t `8h/$蒄 h$P.tFhʗ%VtJh$V t$D| hʳ$p| Գ$tWQhrR#| hڳ$I| مtWQh${ h$%| tWSh${ UȃW66VjVjVjVjhDj9$<|$|$ $@j:0ڐt$@0<jh8> hj+hj $@0j@VttxGp5 <hS$ <?u D$PPPh6$h$f31Ph?$F 8P*81\$(ht$Sp t$~$@@FF =8t 1t88$<@VP=8 8tȃujUS 8ȉ8t=u98Ph$5l8 58! =8d8|$|$ t&WWWv$@$@Hjh8i hj^hj O5$<h$Y5$<hղ$L5$<h$?Phi$75$<j?͚PVh:'#5$<h)$j?譚PWh$ja ރ uR0艚Jt$$D$Ds ƃ=8tjWWVP PVh$WV =h8t>5l8h8O K=8th8hlI$5l8 5l8jh@h8he3'tEt W=9k\80t&ƅu'G$Q$5l8P)O /2$~ ts$=8t 9j 6Wm \88\8059V = 9t'~t!l8HQP;H~Q~  Pj|hj hj ^_Ã=h8tl8HQP~Q fPj $fV58u<<"3t!@"3hrR#PLtFuh$j^ 58Գ$tPhh83 8^SWV|$1t*<"3t!<"3WPt Cuމ^_[V58u<<"3t!@"3h$P衔tFuh/$j] 58$b#tPhh8P3 8^V 98 I9 91I9 \8A95P5\8O:t9^USWV1|$-3t}D$3111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hF$D$PRt uu ^_[]d;9ơl8=8Y#t$Qhq$P 3t73 8ttPl#PV8 8uV-jVN D$E3Vxtǃu&Vt$h$ Vt$hĴ$5l8nE|$tw7j h$5l8K"j 7t$Vxi t$D$PjW Mr^_[]USWVP  9 I9$t!uLI9t.u=I9A 99!"3"3I9 I9A t tu I9I9tu$I91BI9 I9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5 I9  9;$ I9  91tu I9I9I9^_[]WVt$ t8<"3tD"3VPdtuVh$jY G^_h޴$f="3u 6+ "3l8@=u1HP2 1;"3USWV}uCjho9jo9o9o9o9o9o9(I9 ,I9 o9o9|$(jWj(I9(8 ,I9 ,8w+o95o9G1;o9)ʉT$t$o99o9s?D$0o9D$(L$, o9o9o9=o9D$8D$"8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSW~k ;{{{ {{|$$PS\$j蒸U$1ۉ___ __$PWjb 1@G ____SW|$ S\$j =8fDŽ$ 0I9t$Ph$$hQ1F$I9 I9ƒ\$x|$|l$xЉ&ݜ$݄$ p&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh*$QP7I99|ӡ0I9tPL$ 8L$ )΅~DQ4))h$b#Shp'Rh1$QPƋ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4q'QPh;$SW?L$(+ o9T$,o9\$0+o9x@BD$ډL$hT$ll$h|$@,8 (81G؃D$@5&vqL$`\$dl$`Љ&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4q'RSt$DhH$QP $I9 I9ȃ,8(8D$u݄$|9s0;T$ D$r$|$\$|?؍<)hj$؍<)h]$QP+ N+(I9 ,I9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8{ VD$ B J1rrJVRVd $^Ã0D$4L$8T$ 1ɉJJJ JJQRPб x$1H0V跲0j覲0^USWVh=8u=8u }t$XjV+b+o9~=o9N+ o9y@BD$HT$Ll$HL$$D$$5&,8 (8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$b#t4#|$d54I9PRQh$hWy|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$b#r4#+|$QRh$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ o9HQP~ Q PΘʍHr̃t"1o9HQP~ Q P腘\t"u5o9HQP~ QPFo9Gduo91G o9HQP~ Q P[~#\uEo9HQP~%Q'H wr? t:,u3P讗t%o9Gdzh$ 1No9=o9ixU%q'ho9Ptu :v2USWVՉho9QztDj.VRq1ۅt6UPzu&)Who9VkT u1ۀo91C^_[]SWVD$=8t5TR9h5$5l8^ nD$t$h$PV` uA 88t8t$~Vt. d89PQ TI9^_[Pvt=8t"=8t5d8h}$5l8西 1G=8 Sh%hzQ9P =Q9=Q9Sh$hQ9P =Q9Sha&hQ9P = R9Sh;p"hQ9sP =Q9Sh*&hR9ZP 0R9=81PPv h`$j B WVPh8ơl8?snt$h$P貾 Ɔ8 8?)PRQhe35 x?t$|$ 91; \8 ^_Ph$0 ^h$t$hc$5l8' =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=t8tDt W`h$.$t V`h$PD$D$ L$PQRSm:4$uu|$l$ 8l8tQShH$P7ShW$P& D$WjPUhe3tU58sƉ$t=8t`VS<WFWt$PM Wh~Y$VN WSVN $t Pt_4$Vh$uD$uqh$6" t66hs"#t$hc$5l8+TI9kt$VD$V2PjVF D$Ph$膞Ƌ|$WPjW u{D$ u?h$! tt$VD$ V轐PjVќ D$ 8PhƘ$Ƌ|$ W臐PjW蛜 1ۃD$  ˀuPhƘ$ĝu_4$dZ91F=8uR8,=8lZ9Sh$Ouht$Q 1$tP]$|$t.W跏PjW˛ D$tP[]D$|$ t&W聏PjW蕛 D$ t P%]d^_[]h@h$h8SK \8059UWhh`R9 u`R9`V9`Z9V58=|8u 8hO$At>h$hk9I r1ɀk9.)hk9Ph$5l8Tjhй$hk9M tfjhX$hk9L tN=8XR9t\R9j hչ$hk9 uh5l8h$x+ S=8XR9t\R9Q9j h:$hzQ9I thzQ9h$5l8胸 1HPR9LR9HR9DR9@R9t hw$j8 h$j8 USWVt$ \$l$|$WSU tUX| u;HDO 1 tD$ t6$fO gK9uX e3I e3~e3Pe3he3 e3 tuÅtV$g t^_[]Vt$VFt^Vh$j7 hh`R9W t`R9USWV=hZ98t`=8tW$twDt9PhhDp9 j hDp9WdDp9tJDt91P薈Dt9Ht9tNjwtHt9Ht9t$h5`8VD |0/thh%V3E hh$V E Vw5$$P  8L$88I9$-818I98$ t1=8PGt*"1SSQPVh9$=%u8TI9d$$r tk9$ t1=8POD$8$8I9-8h3"#V苲Dt9VMDt9t2$75Dt9ֆDt9Vh$0 h$] 1^_[]USWV,=8t8l$@11 SjhUJ tUh$ ",^_[]<$tދD$0S[ ,^_[]WVP58=|8u 8|$=LR9tft$h)$虓uqj hk9ca@j WP茺  =lm3LO@1 5l8jj(h$bru=TI9u=LR9u LR91HtJ=|8uA5l8hk9" l8HQP~ Q Pj 蟳1H‰58^_USWV458=|8u 8\$L=TI9=@R9!t$HhZ$X+j hk9`t|$j.hk9`thk9蠄k94$uYk9519 k91f u>hk9hf$5l80 fk920hk9h$5l8 k9t$1 U"Vh$UZJ D$(Vao!у $ 85l8jj(h1$`u=TI9u=@R9u @R9tj=|8ua5l8hk9 l8HQP~ Q 0Pj 襱# |8tUh»$5l8 4$|$58=TI91Hƒ4^_[]t$hڻ$j2hLt9ZtLt9h$j0 USWV\$l$jW=ghY#W-gUh"$SH Džu&Uh<$SH DžuUhV$SH Vjf^_[]SWV`Z958=|8u 8=TI9h #虏`V9u_j hk9^]tL8tGx"uAHt.1Ҁ"ux"u"@`V9ZHt@r1Ӎ`V958=TI9^_[SWV$h$V= V: h%P-1Fta\$SWx t?|$/uH$V=PVS0 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhg&P} ƅu 4$E} 1$^USWVHuI\$ $Cj j ShWuu l t "hVWC4 j VS74 8]t/M I9Nt vuvvS` jjS ƃPjS \$fD$=8~%|$@jW978O$Cuu S VjP] 1D$ PWhpa" D$ PWhhQ$h$ 81\$@jPPhSvvk thh"S2 †8Shm$ -D$ PWh$蘆8$\$=8~N1PD$P06T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,8t8#tj}ud8AuZku<FD$ t:D$L$ PQhhuh t\$ ۋEu Y 蕅D$ PWh$S 1He^_[] t$aY WV|$h"$W.wt.hg&Wwt!t$?tt$ h$1F1^_h th-$jW# Vt$ Vt$ ȡ t^VhV$j1# USWVHE ML$8t$QPVN DUt$F|$X$$PA Vh$D$Vh$!t$$t Se9NvB11BW%jV $=t9$uXh$VhPh%PW9r DŽ$.gz=t9uhh W ) $D$D$P D$ T$4$7 =t9u@D$ #D$Vh`"$Vh`" t$ u h"$RVwD$ !=t D$D$pD$5t9hVW<& W#j|<ǍWh$ktI=t9uCt9u:Vh$H$Wh$he3|ijD$P|$W t $Vh$b1PPPW[=t9$uL=t9uLhh W ƒu 1@P D$ 1@P| T$=t9u:4$T$WjVVh$F$P5 t$ $T$ V1PPPGD$T$4$ t h $uD$ tP t h"$RL$#L$t9tGujjW tV$PQL$qTtNWhs$4$:u WVh8$aWh`"jWhN$ $l$pT$ 3T$ϋD$1 u Vı4$ $Qt$Pt$h$4$ $Whu" $1B1P 5t9衆hvr'h#h|f3 j胆V|f3hvr'h#Vݑ uuPh$Vɑ jOUWVD$PjSx2=t9t0#D$1=uT$l1h$jKhI"<|$VWj tt)u1)tu4h!$6e^_]ÍD$t$1B1h$PjVh2$PD$L$ $QP[=t9u t9XUSWV׉ˀ=t9u h"$ t$t9jjjS X!ƒt7jPS tuhR$ql$hR$11PUVWhl$薍؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph{$jV衋L0L0D0.Vh$h$f3聏 Whp#ӌ^_[]PD$L$ $QP踞 =t9u t9XUSWVpT$hL$lh!}h~!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RjT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$r'1@ɽ9jD$0P{Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $r'Cىt KDP@uD$ lm3|$1 ,,C t ^DH@ujGt-Ê lm3DA@CCu 1OD$" 8lm3L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$~9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êtlm3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =j31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$~9L$ QhP ~911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P$6 $(4$hUt$P6 L$l$ ȉD$<9 ɽ|$Xlm3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't lm3DQ@tVFu$$  Qσ s[aj $( PSӃ ya8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A lm3CDP@t Cu;|kwlm3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VE =9 hh V EKCDH@uٺ$yG=9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@uH%ƋD$pW\O@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,|9t!9}uEpVO*mj |9xt$p@ |9>GWVt$F1Ejhht9f Å1|$څ,5959hr$|$t5959hU$t9 t911<|9t6 uGp5959h$M W߅uFu49t@Py89\9P``9(^_[]R5959h$jx 5959h$5959h$VQR5959h$$P5959hH$$P5959hw$jjUj 5959h$lV5959h$UP5959h$>5959h]$(5959h$Q5959h$5959h&$5959h $jju 5959h$5959hU$5959h$5959h$n5959hI$X5959h$B5959h$,$P5959h$Sh$$95959h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u49_NSFJ1<|9tJ9ouwvSgKt?G $pSH|$698^_[]Ë$@S5959h$j[ SWV׉HЃ s%j SVL{ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC9\9s\9؃^_[]Ë59=9SP PWVh$jl USWVP׉΋$1m~ w]$r' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x "3"3>u)jH1҉P5"3 "35ojnH@"38 "3>u j5t9h$f3Au 9P`hi"j} OPPh$h|f3kj}`USWV\$|$t$ 91EtB5Ć9WVy 995Ć9@199Ht8h3"#pkĆ9 9I 9KphE#jh̆9#grf9"9 ...9̆99@Ȇ9 9 =9uȆ98#uxnu 9  Ȇ9W1 t,E-Ȇ9@J}99R)ʉ1ɉ99‹\$k91m1 9Q9u>#u~nu 9tĆ91B C1ɾ8f 9@Ȇ91ɋ\$u9\$t1A ^_[]É6KQh$$j USWV|9uN 919u:=9u9e3e39$ 9$f39i"91NHQPPA?9=e3P==9tC9SS59! th959芼 o9=9tM 9t=$f3tPY=V 959h94 99=9t99 9@99=9QPrf|$󡨆98t0W599V W59V =<W59$V W59$U V U6 PWVh$Wh9+c9h9V 9޻t=$f3t P;h"h9Tg 9rH9tt$t$P 9H9tȋL$!QP 99=9u99 9$f39i"h3"#Pf959h$$ 99$@1Q59P 59h9h9 ƅttb9|0 uNt$@ $@ $QV59P91@|^_[]59h$$j 59hp#h$h$59h$jg h$h$ =9uh$ h91jwYh{$벡9@ u:HQP~ QP:t59P҆ 1=9t 9t SWV9X1t^h3"#3dt&Nj@HOW:uW"9[뾋HWPI W91F^_[Vt$Vgt^Vh$jS Vt$ D$tVP)uVh$j+ V^WV|$t$ WVt^_WVh$j SWVP\$|$9t P]D$jPSWk PL9VPSWO 9^_[USWV9jh991FD$ 9t9<9JBtOz T$R uW|$+;A 99d9ыR L$y th|$ 9)щ;HT$7D$t{T$A 99+d9. 9;H@ 99|$tod9u1ۉ91;A91;AT$t1~T$ d9=`91ۉ__ WjWSQPZE|$t4JT$B8 9;H`<9T$d95`91~>~ VjVWQPD1FT$1d9=`91ۉ__ WjWSQPDT$t tCsBtt$u 9;Hr<9xt$t91BtȉÅQJA7$tu'= 959$=9FPj WE @) 9QPW t9Ҿ5=X9 X9R҉Y = 59h(f"5 9_ u 1Pjh"#9S1P5D95@9)1Pjh"#@9S1P5959S%1Pjh"#9S1PS = 9 T$9=9GPj S ƅ $9D$4)أ9$9 509499a89j5D95@9h9j5959h@9 4 5 9rU  T$99D$<= 9$f3="311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5"3r5 9jjhGp%w5 9j$l 5 9j l 1-RL$ tKQD$ ;"3r5 9jjhGp%15 9WjS t$ tsQ5tejPhTv' tQF;"3r5 9jjhGp% 1Tv')$Ph$5 9\ Z;"3r5 9jjhGp%[ 1t$ D$13Ph$5 9[ F9ut$ t$L$)4"3F9r5 9jjhGp% 5 9j$k 5 9j k  9@ @9  ֡9  9u55 959j59 =$9t5 9j j n jh9Y  95 = 9( 5 959j59 =$9t5 9j Ej 볋50949989+9T$JQd9T$ut Q;P 9T$Id9D= 9yBu%hh r螫 F 5959P ;9 jh"#r٩  _ T$=@9ujjh$b#h@9  9D$09D$,9D$($9(9,99@9$9L$(t$, @95D9L$0 H9L9T9P9= 9_ 9QZ=j399 @ 9 99r 89֍49@PQ89509 F@+6vFt Pr uF6^_ËFp vh$$j& USWV ՉL$l9h9щT$Љ$ lm3`9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B |99r7 |9P5x9x9h9l9$`90D$SPt$V it}ŋ4$L$]\4$L$t&uE\|99r+|9P5x9ƣx9h95l9F1C4$l9l9\$D$ |99ȋ$r+ |9Q5x9;x9h9l9 ^_[]USWV`}$111D$h$u W uu5$<>ut0Gtg$<;u$<$8u _3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%SQ t+8ttDGh$j" 1E L$3Z th%舠 u3h$$j tD$PW uh&$ۃ|$ tt$$ uh0$뼅tt$h uhcx$렋Cu/h~#h Q %tjh7$VV VeSPyK QVh:$ -Ph_$h|f3I jg>UVQt@t $e^]VhL$j WVP։.1ɉQPWk V?t$8tq.1H^_].8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvP>v F vvF^USWVP1k<j03~4j03$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<j03j03$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph|f3jjCh$j:V1=9LPV t* jjj VVG5X< 95X<9j5X<@9jP9t#1ɺX03A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$.ZtE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? lm3DAh|f3jP Wa@$v'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$v'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLT"=m$ 5T<w5T<臠1QQPSt$V5T<5X<b1U)19}1ۋ$p$)ŊEt9}1< ˊEE5X<h$1VV5X<3UVj5X<!Vj5X<P 5X<5X<2= dm3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h|f3jM bxu+=9 9σqt$VQaVȽV?u5X<Ih|f3j M ,$,$fUuE 9|)BfUh|f3jL ,$T$4xut EfEuGza|1x(| E9}ED ufMh|f3jeL !}Eu)uE t uPXu譼f;}]D; jttQD; tt$4UЃF4; ~ttt$4WZuE tuP軸u sE uussE9,Et)uE t uP[u谻EtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃurEE tPrE ^_[]Pt$59t$t$h$h|f3:ZO$@ t$St$t$ t$UPh$'O $A It$U59t$SQPh"$h|f3V:$j.USWVT$qЉD$ qQGud$ T$T$ $P$ǽ)j P\)1Ƀ QWl$ U|$ WD$p~tS;tNt$Cj S)؃ QSVWD$p~t G}uo $ $l$Atl$|$qfKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth$VSwn}|$Gu1PPw%|$ GL$G)VQwt  w) ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQM =9ۉ9t @tFj-9Elm3\Jك@to@uwt uDZ@t< ty< =̏9u =ȏ9tI59(ttj 59=̏9uj 5999ȏ9̏9?=̏9u"59stj 59\j 59L1̏9ȏ999̏9 ȏ9f)91ۈD$u9C59;st$L$4 59s9Ƌt$|259sVUUU9}j 59|$uCj 59~KVW59xZ E߃ @ Ȣ99=̏9uW59vrt7j 59%5959Uȏ9̏99959 ^_[]t$Ph$$VPt$D$ L$ $PVP1A4$^h$b#t$t$t$t$USWVP|$ \$$l$(t$5999D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j59 1ɉV,$E|$@t[D$@8tRD$u:hI%59,Tt$@59Th#59TWt$Dt$ hg%59S4$59&pD$ 594p59p‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59S59 pth%US59T/)PS59B 5959Ã~0L$ZD$  F#і L$X1)<(x1 lm3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP{ QtRD$(υ~] $9I\$)RPQ& KOuLuH|$@tAt$t$D|$W Wh|f3jv D$z19Dzf tN;L$$} lm3DXuh|f3j/  $9A)RPQu $8GED$t+)j Pt$59DL$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P 4$踮0^_[]h$b#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59l59l$tKۋ|$,;S_|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P迺tC@j P詺uL$$)݃} 9WUQS59Gƅ|$ 葒V}ƅtV5T<蔆4$59PW599JPW_F1PPW W D$E|$ GWUPS59规Pŋ=9V]PWc=9VIPWE59,99#WUt$ ShH%59b1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV詼4$tWVHV@W薈UP@W?^_[]h$b#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$b#t$t$t$t$USWVP|$ \$$l$(t$59蹻99D$,$VAUPA14$SWt$(^_[]h$b#t$VPt$D$ L$ $PVP1ɉ4$ ^V59g59g^fUSWV $$$ `9159599gY%59W9WVP w'Ft(=9tvvP蛗 vh9&B>vuɸ(99999hr%< D$|$ hEI%SU e~o~1pKrtCGD9붃fg5$<h3"#VPhWH \$hr#W3 D jPh# t \$Sh|$W u4 ^J%w'W:PWVe t }u몋}tE$thr#S|2 <=u͍4@hr#Pb2 FhaM%V衔 04$VWЕ Hd9h9h9hPI%5$< bSA$$$ Fm$<D$/J1WhfM%6du#D$=uD$h|$d}:h|M%h t61W覑 t@ < uFrW*` 1W` jh"$h$ AR5X<dǃ5X<d1FVVPWz 9$t65959W5 9hJ Vj*Vjh˻j5X<&:hh9cD$D$@VljD$ VD$1Åj2P3L$t|$ o u*t$ %n ut$ K%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVh:#u ![`9j9j"9`$u誸t`=d9t jǡ jjGȜ/Џ91 ^_[]Ét$ hT1GQWP Ph#h|f3Y VAW =h|f3jj,hI%诱j Źh|f3VjhVI%莱V V1Fh|f3VhEhK%lVs UWVV~ h;# PJ 6|[=9t>V萙Ph!M%W 59V59X9=9t>VHPh3M%W< 59599=Џ9uh|f3jjhJM%we^_]Ã=9tá9tt$P jU jN h;# tP7 t h%& Zjh.w hjUSWVB L$Qdb  P Ń j hK%U_ ~ uF t$|$ W^ WfD/UWt] Wjŋ>7Ptn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P!4$UV S ŅSY ^_[]ËD$L$I41@fUSWV1t$d9j%Vt$t$ t$t$4$jjVP;=d9P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15d9Я[{,9VPX~Bjhy,9jPWyjhx=9V/Vbu%,9ǀ$jhxup#z,9Ph$$jX jtO,9)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5d9jV#jr4PVf8 ,9$*tKuKt!Pуt,9$P,9L$$Q3 tXD$t$VSVx)VOuM%uM%t*VB^_[À)ujhbsu Vt5T<w1WW5X< 5X< 5X<kwSj X9;xhj_jZjC]jVkJM%M%!}E'USWVο$WQS肈 WhM%S3 WSUf Whjs%U S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQVԇ ShM%V腈 SVW踇 Shjs%Wi Wit VW^_[WV1t$t$t$ t$t$4$5d9jxVtkjo4PV[5xG,9*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ Q.D$l$1@$4V9D$pPt$V Z$DaD$|$ $%t umlm3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5lm3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8ulm3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWq 59t@WPh!M%V 59轨599sh=%hM%! 9t*W蚋PhM%V 59`.5 90AtPhQG#hPh%j[1e^_]PhM%h|f34 j UWVV'p =9t>V1Ph3M%V݄ 59Ƨ5959wh"hcN%. 9t81hsN%W莄V虊Ph~N%Wv 59_$0FPhN%hPh%j[1e^_]V1hhPhPjjPj jjhE3hи4xjP訪V輹^h|f3jjhM%m9tPjjhM%RjX SWVD$x1|$9t9Ps1; P]PVh:'#W^_[USWV$$$L$$QPhV $h3"#V $D$Wj1K4$ 1G9r6|$  WUŋ$(\5F4$踇 ÃugD$ PVNuH|$dh3"#V $t:|$G=9tVh,N%hN%P% 1KS1D5$$t 4$! 4$u9tVh,N%h4N%P 1ۉ؁Ĉ^_[]U袐$$$1K9Q USWVu ED$l|$(PVW  ED$8D$1ۉΊ<'t  j Fj'V觝u VJljt$ t$PSW D$ t$ )VPh"L$Q hN%VB t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W薴 tWP É@/ WqP É|$PD$TSy ND$+D$D$ .t Vt$W tSy Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ hN%P 뒋D$L$T$;t RPSG |$\$$h?r%S G|$\$1\$L$<t$0Vhht@Wi fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=X<jP|$ Wr 5X<$j:5X<褞j5X<[5X<iX<D$D$(D$$1WS轫D$ L$VWSPQ31N|$p$ 9h9hptt$$: =E3\$hE3hbtt$( us=E3ujjh &j9 hE3hf@t$$߰ =E3t0E3hE3hbtt$(趰 N%\$E39t P 9t Ph£91t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@59L$@EL$D$D$9}\=D$hPa(=Fd|$u9Mx{;5X<tVgEjPɹ|$ۋ|$t h"#'hP'ce3H e3~e3#he3L9Nj|$t}cj& ;5X<t V|$ t E%u15X<5X<sj5X<Tct$(胆twPquW_D$td$8u-e^_[]D$t$ hN%jf VhGN%P 1S5 1FV5 SjhV%4 VSk| #t$z5 $ D$pL$|PSt$( t$ T]9t*t$h O%P 59{99t*t$h#Pf 59H9h@A&D$ 0+u.hO%D$ put$vm t$e s h9REtt8tjP7 u%t$V63 6h1O%` jj3L$1PhO%t` USWV։5X<謕1@P5X<R5X<`h 1PSU& 9hP$5:hPS1CS% 9Wh$$蚂:h$$FPU:B`5X<gA@)VUPRQ5X<[tcjP t05X<裫PV詪5X< !PV11PPV$ V_^_[]h|f3Sj+hN%蟑S fUSWV-1@=ԏ9$hT%Pjq h:rD$1D$ $ $?$Vδ9+%VWo PWt$ W VWjo G|$T%z'lm3D$WwPWt$ g uD$L$DAu >uD$ |$O 4$ ))ht$Pp FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfF7Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p ԏ9 )) hPh؏9n 14(z'jVh؏9贳 t1GuD$(VhU%j@$SN 1PPD$0PD$XPSA t|$Lub4,z'h؏9hPh%h-jSj"D$L1QD$PPQQS@ ShU%s1=؏9su=ُ9lulm3 ڏ9DH$D$$Ph% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TVB j!W|$0W2 iW&]hhV%QCh09PPji=09 h09PPhh=%hXW% PhV%j+o hV%WohUV%WohV%WohV%Wnh09hV%Wn =09t!h09hV%Wn $9hV%WnhW%WnhW%WnW芯hLR%jtnh؏9hW%h DŽ$h39VVj~j hQ%V;; 39defa1ȋ 79ult1 j hW%h39: 39manu1ȋ 69ual1 391 39none1 79 tlf=39 tb=39t`h39h؏9hW%jtCh؏9hW%Sj~$$'|39ؐ9hhqW%HOh"Ifh؏9hqW%h~W%hL [ 8 ؐ9hsO%D$ Pj3 ~ht$ hܐ9i t$n{j hܐ9thO%D$ Pj ~ht$ hN9yi t${j hN9螈t=N9t ؐ9hnP%D$ Pj ~ht$ hۑ9i t$z=ۑ9u:hP%D$ Pj@ ~ht$ hۑ9h t${zj hۑ9t=ۑ9t ؐ9hhڒ9bau=ڒ9t ؐ9D$1@$" h/9S$WPh Vڒ9PPjxVۑ9PPjw SWȭt%ؐ9|$$|$ t |$ujٓ9PPjye|$t j9PPjz^hٓ9 =9u=rQ%=r!ƒ}Q%t่Q%=ujQh9ng j9PPj{hܐ9PPj}ؐ9u4D$D$Pj|$uhN9PPj|=N9M$M$tN9=39Q%t39=ٓ9tٓ9|$ti=9M$M$t9=9M$t9=ܐ9tܐ9SVWQRh؏9Phڒ9hۑ9h"h,$L=9M$M$t9=ܐ9tܐ9WVQRh؏9Phڒ9hۑ9h"h(jjj ^ xPC' 29Q%Ph$$hb ha}<h؏9h)W%hSb S"jrjQ$H1WWV$PhU%7 t( ;$P$Tsh-U%jPbt^DŽ$ 1WWV$PhLU%7 ? ;$0$4&h`U%jPh`uq59 1H t$t$6v1t$t$vhQ%j<$t$jԏ91@$F=N9h"hQ%> hQ%jft$(VQ VlPhR%hQ%Wtf=ۑ9thۑ9h2R%WXf =N9thN9h=R%WJhPh39_ WKt;ƸI$39SPU` SVU` WJƸ%uցļ^_[]VPh؏9hU%Pj"#Vt$. Vj. tfjhV%VD u;hV%V u&h"V%Vm ujh-V%V  u"h"#j&. ƅu4$p^Ét t t@hVh29^ SWVt$hV{WuT|$tMƄ$j.V}t#GSVhڒ9o^ SWhۑ9 hVhڒ9S^ ^_[SWVڒ9S(hۑ9hSh/9^ =ۑ9tO)~!ْ9.uڒ9Phۑ9茆t(/9Vh%W^ Vhۑ9W|^ ^_[ËD$w8z'ø$b#USWV$VhE%,u $1퍌$Uh1S%W :HUUW f@$|$$jh8S%P 9tx/uG/$N~/vt$jh8S%Pa $b#w8z'1҅‰)ˍL$$QSRPh@S%hU; ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<9H1ɀ=9/9QPhs%hh9R 1^ËL$1Bh 9WVt$=ԏ9u jG7Wj 螄u1@l9 59o1ɀ=9/9s%QPVWh9 =1ɀ=9/9QPVWh9 1^_Vt$V dЉh9$^WV D$Ph9 u:$nfsu-Vh9h9bZ Vh9h9OZ tWj 蔃1F?t[h9h 9hMS%jPu>9S%h9VWh9 h9VWh9 1 ^_SWV=ԏ9hUؐ9u(h%Q\u9h/9hS%U=N9t hQ%˵=09t hXW%赵|$h؏9hS%hW h"WƅVWPhS%j[h $V[=39th39hS%Vy[ hLR%jj[ؐ9uGWPhS%jK[=39tDh39h9hٓ9hS%V%[=ؐ9tCh%T%Th؏9h1T%h9hٓ9hS%VZhLR%jZh=%hS%XPhS%jZ V%SWZhUV%WZSWZ=ۑ9thۑ9hpV%WcZ hٓ9hV%WPZ =ۑ9tPh/9hlI$W/Z hڒ9h#WZ WhLR%jZhT%Zuhܐ9hT%nS=09thHT%XSh؏9h\T%FSt V賚j|^_[USWV։ϸjPPN tCËl$hjW˦ ojh؏9WV WVS轌 S 1H^_[]USWV$΋$PhE% u tW$b#V ^l$PSU 9<$u9PVUWh>V%hC1Ʌȁ^_[]ÿ:V%fT$L$t$a"u/Átuuc$Ãt6u8h6h/u uhP%!wz'hhV D$L$FFhDV~ ȃ ^SWVP1ۉSSWSjh0{' ~t{4$6V1ۅtjSSWPjh0{'}tEh?r%V# t&|$\$PS׃th?r%j# uVXf VKf1ۉ؃^_[USWVX%({'\$|$jSP5 ƅt Eu$wS7MT wh=%7T G^_[]WV{'|$u${'t%|$ jWQ5 t u1^_ËL$E34USWV1td։σS誗PSW蝘 t u6P1PhPPj D$PU?. D$t΀8uɃ<$uð1^_[]ËL$E3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E%X%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ輡 $V1VP訡 95d9D$40$X@h!P@tt$45X<?he3W 5X<J!9r d9ɉt$ =1MD$Ni8D$$11t=i8,49tǍXUStN݉|$|$l$$9,9ƀyH1ۉLPTXVUQhP ,9" .hQPNP VUhh9?P ,,9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP,9$()1HD,048Ƃ(1 d9<596W9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً d9ɋD$L$ӾV W$b#QSPSl$GU ,9$H@ VW$b#RPQSD$BP 9t% ,9QUHDRhX%P腼 =,9$0@ơ,9$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-d9L$QP5,9 u<5,9h_R$Pdž$l$,9()8 9 9VM9VjP螜 L$ D$@D$9 d9yuƇy$u4P4 44S*$똋D$,9$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$7D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ47El$L$),$|4xfDŽ4DŽ47T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ7D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ7D4B1hPPPPjPPjjR$Pjz4$1K|$$8h$$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2F3I ,9F31@멃=d9yud9d9s19dL$w BsÁt1USWVD$$,9*t1G.$ )$PhX%hV b%jt(hfMVhX%h% j$ i%W踢,9$Phmw%hVl WVhX%蜥 ]h%Vjj\Q1PP3AhW jl1q\^$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$Dz'hY%D$P Y%D$Y%X3|$0tPhX%hW走 WhX%D$P b%D$X%zh[Y%D$P gY%D$mY%i3|$0tPhY%hW4 D3t#PhY%j\$S S\$W D3t#PhY%j\$S S\$W L3{"t"$\!%tWRhY%D$ P D3@X%t/Y%D$b%D3|$0tL3tQh1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$b#$Z%\$t7ȉL$7 T$wXgY%D$ b%D$$`z'$b#$uht$$P> Z%Pt$hZ%t=uD7L7qQPhZ%uP$$#d%D#t $D$ Pc% $T$h%RFT$ D$L$ 1@D$h#[%RT$Y%D$L$ h%RuD7#t$$D7$b#@tR[%$b#yW[%$b#t_[%T$($b#tf[%T$ |$$$b#to[%L$,$b#tv[%$b#t[% $b#t[%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h*[%t$D?@غRPhZ%t$>ClE;F{Pp\$CPWl SMt$0|$4hh褕L$0QjP7. P8WMtVhZ%t$y> SvM=9u#D$@9@@hDPih[%\$ S0>h[%S">h[%S>=9th9h[%S= $ 1|$@VVPWh^% ;w$b#r#t#Qh\%S= h-\%ٕh3\%̕h9\%迕=9t hB\%評hI\%蜕1hLR%WL=SJ~W1`e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ L{'hR\%Uq- UeuhY%hR\%UJ- U>FjVD1Ktljt$#"ha\%|1G$Gb%G w#"Ghs\%J1G ${$b%C(s4C8L{'h\% 1C<{@b%CDsP$sTL{'ShR\%U, UstlSh\%Uc, #"U0F$F^ FSh\%U/, FL{'U0F $F$^(F48ihY%hR\%U+ UtlY%Wh\%U+ #"U*0F$F~ ^Wh\%U+ FL{'U/F $F$~(^48+4$iƷm۶|$9U91KhY%賙tzh<#臙tiD$h<#Pj記 XWl$UVt$t$]I6NIOu4$=I,9Ph$$h 1PP}#,9)t5Phmw%hU 鋔$ 1$ 91APuDFl9Ɖr:,9Ph$$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbh]%h]%hh\%mL$T$jt$oËL$T$jt$XWV׉κb%jujWZh$b#Vh2"#蘔 ^_V091ɾ 9r^^VD$09tU@8xtlIuAH1FVVjjhh090QRx tjh09j9 t09^À=09tjh09j9 09USWV 1WWj9 &iP 6SPj W9 t$ xálm3D$1/dev4$D$iƋ1N/ u1FSt$$P!/dev uDL$DAt|tER|$$t.jVj8 t lm3L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFh%P=yt.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T8]%wE]%Ph\"hs%V ^_[]Vt$D$QPbLt(D$t%t!hhPQID$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$59.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh7 h jjAPjQQhE3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h!PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwUvt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ -D$$@$;E tL$ A;L$tI1۸hSSh.ShjU>~`^_[]USWVϋ@PD$ P-hFPt$V x1|$T$RtPQL =`91PWt$$t$$oD$T$1PWt$,t$,o t$t$RPqhz^%|$dWI D$,tjPpW, t$ Wt$ , |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:'#S<^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhR]%h:1^_[USWVu X%{'jVPV uh8j}wy jVw) E3OE3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPhv]%hSV ZY|8^K|8PG@$QP"B'$HffsWBD$Bjh]%1ۃt$D$謑襑h]%h]%WC Vh]%SC Sh]%Wu S$Ph}Dt$VWQ6W}Vۻ$Ph]%$8 1ۄ$h]%$襕h]%P菕L$LQhL&P4B t$,04t$jj h$b#RPjV |$LWjlm3r \DZ@uWQVt$h]%ht$ B 1C}$.1ۿ09PSW^v t$L^^^F~ FFVhQt$ ? t |$dJSjVv $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$b#RPjV VSh$ht$ }G8@É؍e^_[]09=}t'fy"f9 g9NuEt FuXt1€1ɾi9( Ӏu A'w'h9 ' Àu A&r  uȃsƄ\$,04t$jj h$b#RPjV $PVSh^%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$b#RPjSM W$mPSVh ^%ht$ , -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hX[%q譊 Y|$h%u hDžtohL{'6gtkDŽ$v/rDŽ$/dev,$$VuP" D$/devf@/VuP" Q踃낋E\tu xt@@AED$59$ttt$PуuN,9덬$WPU! t$/devfF/,9WPV! [Sd\asa9aO$CQPU! {PWV,9$t(tt$Pуt Nj5,9,$1D$0$h@h!P5tt$G,9PUetTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS $WD$pV+ l$ Uh%VV ǰD$hh"Wdh#WdtyhD#W}dtgh$WkdtUhZ%WYdtCh"WGdt1%D$td^%tD$VPS- VWS" Uh%jU DžED$4$v PS} t"vh$$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=`9SWt$t$0`$1PWt$t$`|$u1@G92s9s%VPWSh9 wsVPWSh9ۃ 1^_[USWV |$ faa@D$D$1C$b#=9tha%j9VrPWhPh%h:vD$PUAD$h6959hd%j訙x9rW!9u9QWh9Vt$D$PWh1d%SR$'D$D$ =mdt2Vh9h9 Vh9h9 1$hVSf t$t$t$D$ 9jVV ~;Ƹ PV;!D$i jQP e9]D$|$hj[Ww'o ~#u4h9h9+x 21jio9ލ$9Hf@7tJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Ph9w u`~*=9t!ha%jU19Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hnd%h\d%h'hc%bUSWV|1ۀ=9t}h9hd%jŕ ue9+d%s%9h9VWSU h9VWSh9 VU*#N@1 É؃|^_[]ËD$L$I1@Ã=9tha%j(9Vt$ D$t PmVj=m5 9^USWVPWj<1F?tihh9h9h]_%j讔uL99+d%~_%h9VWSUh9} h9VWSUh9} 1^_[]SWVPVj`<>u1@;9_%h9VWSh9} h9VWSh9} 1^_[ù1@t U9It1ùtA?9t 1ùD$?9Au49ËD$49SWVhflhy1$hWV.b 㹔G3WSChWWh:Wj65|9WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW49tI1r rr2d^0u&1q1ur1ۃ0݃侯^r @뜃|$tB B_BBp_^_[]USWV|$D$L$BJ 0uQ=x91۾;=&-p9B0t#1urF49tux99u'Cϸp99t049l9th90 5t9|$Q-jVPh^%W!^_[]WV|$t$ Nt tuh_%Ck_%_%2t%jjPWV^_USWV|$=9t h9j;WWG9u9l$}QWVhMV%hUz 1PP` ơ9t3Ѓ<PUuu#D$=ueߋ$$$t\9P{jۉt{uh_%jz$t]PUh_%h[Z$t`9hhSjP2 jP W V jUh_%h V  Ve tP$td9Uh$$hi jj7ah5 91@|^_[]Ã=9t=9tUh `%ju C491$th9Vt$h.%VStV9t 99^t$-9u9USWVt$,VQD$j$t$V,to1\$l$t$GSVhVVj UP7 L$Vtu(;D$0s"L$44EQL$|$)L$OGj$Wv,DžuD$@PPDžj$t$0J,|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$V3 1D$44Un D$44vP$D$D$ j$S+Ņm<$t$ >tV\$Sn V/P$|$);\$u ^_[]hc%hc%h hc%SYSV5G31/t.T$ G39u9t 49t q/u^[V1ɍt$QQPVh`%3 y1t1^USWV|$(1$PPWVh`% $D$(1PPWVh`% Z$LF1d$Pj%J4$>$T{'h}d$Ueh~.hhd%ehhUdW5 9D$h載jU5 9N {'PPqhVjU5 9h&VNt PVW 訉WD$ PSt$5 9N 5 9*5 9>Sjhe%> j D$ PU Uh%c D$(SSWVh`% $j h%fMuQ1AtCjVZ{ u4Vhd%"1ɉtjV6{ uVhe%j) D$(SSWVh`%i u$~h%`%jTȁĐ^_[]1USWVhh+d%9tPjjh@`%(1l9h9d9`9\9X9G3/u D$8G3ڃ9t49u@X9Q/uD$/u.h9X919haj莹 G31@|$>Z49M \9L$ d9L$j5T<5X<5X<=9tha%j聈9l9h96P5X9hT`%jaa9Wj b0D$ttRN1ҋ0t1t /u oBrg49uƃ49l9149uAuVD$u,D$ \9D$d91@49l9^/ d9FX9h9QR5\95l95`9Ph[`%h` jj\/_5 9O]1C9tvhh`%hu>h,_t$FVj.~th`%j軆h`%j謆ha%j蝆1G@9@9th a%jfh%_L$QPu{h9a%_$QPuYD$3$L$3$ t?h>a%h]a%Mft!hga%jޅh]a%ha%a迪1=9tha%j訅9]$1L$VVPQh`% }t|$ th%`%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h=%ha%{at@Ƌ|$]1Phb%S9 4$WV V*GhLR%S^_[USWV-I3ta1FI3t&U7Jd1tUh$$h] 111Fo u1tjh1@1^_[]Vh8b%]t$hPV hhȧ9V x(ȧ9ƀȧ9hKb%Qj j/P!@Gb%t9^SWVhTb%&]Ǩ9hPVM V4Fȩ9K5t9 ̩9Щ9PVhPh%hWl jWh%$#/ hfKVRj<[ 1hhib%WWh}KjHj j j jVWW$94ƣlJ3WP*lJ3V9W jjrRt$5̩9hb%WVl h8b% \$WPS5 S,SVRj jj R1@^_[UWVj WW( W |$ hPW j WtZt9 ̩9tV("RWQPh%hhe^_]1PPj< USWV=ܲ9uj5O3 ǣܲ959uO3P>ƣ9^V=ز9~GtOز9Ǩ9W WC;ȩ9t19h-Y ܲ9A 8dز9$Ǩ9$V y))L$H 9Jx .@ SPt$ D$PhǨ9=ز9-O39|uP5ܲ9 ܲ9QjPN P59 9 QjPN -O3D$%=@t=ut-ܲ9D ~c1ܲ9D8 bdt$h%t$ =ز9-ܲ9ȩ9Ǩ9P  9D G=ز9V V $$ܲ9B ز9fJhdjQPĄ^_[]VPt$D$ L$ $tt$VPp 9t 4$VPp ^PD$L$ T$$RQP XUSWV$01D$$ha%WL$Ph$$Q hb%WL$Ph$$Q軜 hb%WPh$$Q蕜 4$ŠPh$t$ k D$ t$舊h"P<D$\$t$ hSx tt1hr#S腘 4$0P?P$4V@ u <.=tSh$$t$t t$ hSGx ut$ U?t$I?4$t$ 2t3h0Ut$FVj$~t$t$t$t$ν1Ʌ2jQ#D$t P D$t P Wh$$h3CU jj$T5 9 1N^_[]t$ A>t$ 6>Vͻ11N4$lt$`t$ t$ 4$ VD$FVjw#F^SWVPD$$h=%hb%Wt@Ƌ|$4T1Phc%S 4$WV6 Vr=hLR%S]^_[h$c%ha%SKc%)1ۅtHa"t]a" 1ۅÉ[USWVhٹ#= P D$1Ʌ$l$h#Un ti\$WPS 9s?hh%S =w%hVS =wjSj t@h#U0n u4$R 1jVj 1Ʌȁ^_[]4$$ 1AVt$VP<1|TsrLc1f ^Vt$h.%V=tV9t 9 9^WVt$ D$wǃr9t\,tSPQjb1 V5X<0V5 90V5X<0V5 9!5X<5 95X<5 9^_WVt$ V u.>vJ0"PVWhTc%h|f3e {c%^_WVt$ 0PprPGt$>FFVj F^_SWV=G3/t/t$G3GtPV9<t /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$VTƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUtMƅtPt$V S3OVUP tP׃S.V%^_[]VPT$ D$t$4$IVPv ^À=Ъ9uaЪ9ga"P9c%|9 d%T94$x97$p9&a"9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWU4 uD5<w |5L Ku1PPD$P/ )ƍD$Phd@V% |$D$|PhedAV% V踰f$1 GaD$P$,hd%t$V, 1PPV_ $C]su PUhhت9t$'t.٪9CD001 ݪ91 u=ت9tZF9|4$ɯja$,h n%$0uz EPPzP jOh9D$4P  D${O1ɳ$$uƒrL+1Ht$,D04$1t$$,h n%u EVPh$P EtE @E w-G$9@  VЮ؁^_[]1D$L$I@P49wʀu?9Au49 491USWV$$1$hWV= E jShWWh:Wh5|9Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur49A1ËD$1ɋ0t1ur49A1USWV ։D$ $E1$  D$$ ,$D$d% $Ee%u0e%D$$ e%#e%uXe%F\$$x9M \$\$$&HD$\$$)|$=h9=9=x9$ <$D$D$|e%(<$pq|$4$D$ x9D$s% |$D$ h9D$9D$e%=ԏ9u$ByD$1Ƀ O3\$pJ3C|$D$$$$D\$$({|$!<$D$x9D$pJ3{=O3$b#|$l$ D$D$ce%$kljl$4$L K=ԏ9u $fxD$|$D$$.$$C\$$'|$u1= 9=9=x9$ <$D$D$|e%Z<$t|$4$D$ x9D$s%2 |$D$ 9D$ 9D$e%$juLl$ t$<$D$ h%i$ \$<$D$[h%i$ l$4$J > ^_[]Á=mM3ftp]:V%=M3PFSWV|$ty̩9GO4VS-tRV t{S5̩9Щ9VhǨ95ȩ9hN%hSR jSh%$# fGlJ3~"PptV*zV1^_[ËD$ ȩ9ƁǨ9 9fH 9fH1SWVt$ȩ9Ǩ9V~)S4:QA F9F9F1^_[ËD$L$01,fSWV1ۉShPS$ WtD$$P t V :8Vo:81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWjt/S$SPW3V%y 981ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=`91SWt$ t$L$ T$'D$T$SWt$ t$'D$ ׋9t$ t$(2f%L$\PSWt$t$,t$RPPQN $`91WSt$t$&D$T$WSVt$&É֋=9t$Ht$H迍$PWVSt$t$f%PPPQAN $VD$`Pjhq1@USWV u C(D$|$8hjWE3 wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿ{'|$D$u$|'B |'B|'B|'QP׾ |'B@ tu Ǿ`|'pЋ$+L$L$8L$9Ǿ|'HQQQQRPRPjD$ tjlm31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDh:&WSVE 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ayotd( GF9 T$BH`LNfx'f9}"ɋV t AfN9|^_[]USWVTt$p|$l\$h-90h09P;9~9h09P;9~9h~09P;9~9hV09P;9~9h.09Pz;9~9jG 09PU;9~9jH/9P0;9~9jI/9P ;9~9jJ/9P;9~9hr/9P;9~9hJ/ 9P;9~9h"/9Pn-99~9ŋx$t;11ۋ@(48.P6-99~9C ;X$rɃ-9\$h|$lCD u9kwi${'N4F8hv~4l{9F FN$Nj5`9QP T pp,ppqq*q5f|59Uhf%swFH@Hthg%s]FH@Hth g%sCFH@Hthg%s)FH@Hthg%sFH@Hth)g%sFH@H th1g%sFH@H@th9g%sFH@Hh>g%s\;T o8>o,jr nh$b#Uhf%sTd{91F( {9FH@LP`,PSUhf%W{9j5`9vv{9j5`9v$v L59RPSUhf%WpT{9FH1@LQwFHpX59PQE|FHp\5 9Uhf%FH@`L$Ph:&jQ< hw+VjP P5959hf%sV^b:p+~V|$jPWRUvPQd@( m4*WP59hf%sT1hh*P5959hf%sch^_[]Ës=9h*PWUhf%VҋFHP59UUSWVP $1jlv D$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F59me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|Z94$ukGllPwYGX FPv3t~C $i)ىQRP 1D7D77qfD7 D7 Z4$~Efn'  V)RQP{ fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A ohOu\$ 9fA |$tAqfAAZ 1AA tAfAAs A ՁAufAA?) 91jEVVh%hKhrjJVjVQPh@94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*Ch%PuuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]h8f%h#f%hlhe%USWVt$ kFllPvuNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ oh{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV,9t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$F!t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0G9GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Whf%QW t$$|t%L$ PSƋ|$ Whf%QfW t$St-$L$ PRVƋ|$Whf%Q5W t$ "L$ PƋ|$Whf%QW t$PSVW`9D$D$] ٹ}$L$ |D$ L$L$<1jPWS~RPhG2$j$P]! t">tt$ Vhf%D$DP]V D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P |$YtZVo MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV% )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ`9}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP豋 $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋`91щT$1)΋EM M1WRQP3ljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hG2$jVa C `L$rL$DPhf%uL$DPhf%jQ$ D$D---D$D$s9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhf%PP SVhf%PP VjWaSX`9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hG2$j$P t"?tt$ Whf%D$LPO D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PWU{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD 2$uR1jPPPhhPj jjj%VjMF4x!t$PW0Va1@^_[]hf%hf%hhe%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ |'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; }'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS; t$]EɣfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBh%j"tVE (95(91^_[]á(9t8t9t$b#QhUh%jz" u5(9(9USWV=(9tt$oVUt?t]oVUu19t$b#UQheh%j!u%(9;=(9t؉WI1^_[]USWVt$|$=(9tAj4jTá$9CUWPM CUVP? $9^_[]É^_[]SWV׍$jhPjQux8ƉhjS jWS Sh{dЀV Va^_[V=49u|495(9tT(99t$b#FPQheh%j V뽋$9NV,V5$9u49^SWVt$|$\$T9t$b#SQoPh$$WVK^_[SWV|$t$9t$b#VQ3WP轃1ۅVhwh%jU ^_[t$h@t$ht$h}t$hk1Ʌt$h@P1Ʌt$h51Ʌ1=(9fVhd1ɍT$QQPRhh%|p t4BIOS3L$T$1 tUEFI3T$t$ u ȅ89h^ÁP% jUSWV41D$D$D$ ,9()$tv $D$@9D$ L$,1$ 1D$kT,0 Ut$G|$ T;|$,D$u1VjVQyClǡ,9HVjHDVVQ?,9$wOʃD$$&;DHDH1PPL$8QPjhP3#xt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=<9t@u.1}hGju tEx i%rti%toi%M u@=Uu,>t'D$ L$,9;\M`|ˀuK(Ѓt tu tPjbjWSƍD$(PVU$1 $$QPV S $V4T9$ul$`=u]tP$PSʹ $5fǃU'VSWh$$hi% uQe^_[]SWV0\$@1҉1 F FFF =89tjP4D$VjRRS0<^_[USWV,9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hi%jkt1e^]USWV8=89EM 0~klP1 ËE E8؃lklQSP談 ߾}',9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =|9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS{ F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hn%hpn%heh%n%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$:u o:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$4~'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQPox T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(:u m:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$D~'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQyv |$ƄE C ^_[]WVt$ hjP? ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9utn%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVs >uD$ D$iousD$fictO4uQG4 t51ҋ5lm3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDj l$(Pho%U f h"U [Ɖ$Uho%jYu D$Pho%VFu wXw\w`hp%V/uPwdh.p%VuwTh?p%Vu f1ۍ{aE4`'WuWuWhJp%Vt E< t<uEMPWQWhbp%Vt$<IGp%9|"#PVwtC9z1hLR%WTtVR D$PD$Pt$\$4Shp%hqp%WSq 1(^_[]hKo%h3o%hBhco%h3o%h1h|o%h3o%h ho%h3o%hho%h3o%hh%n%MUSWVhj{{1O1ۍD$ShPS$4!z9+ōF,PhedAU赦 l$$4$0$($<$8у|1҉$$g F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Q]o D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$=0$$hp%jP r=t31>t9>u 9>t0uk9uV.V&OVU/1@19$,|;ЃVt$t/؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d|~'ud FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hKo%hp%jg6hco%hp%jh(h|o%hp%jiho%hp%jj ho%hp%jkh%n%"D$T$ L$DrRQPk ËD$Djt$ Ph USWVl$j/Ur 1NtbNj\$)CDWPUU uHD/t(t+t!u GF "u^_[USWVPӉ΃=|9ui"sv|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=:u N[:~V19|(1@@89|~@w1A^_[USWVP=:|$(L$111=|~'"\$uӀt0t u@tӋ;$'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h|~'t$(t$(t$(PPt$0$' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh|~'h 9誊  9k911KjdƃwD0'DtGCuޅtH=:PGd:t)1ɀ<t ,'AuVt^_[1V :t(:1t ҡ: :F9r:PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hPh%jQQWRjjhp%(,1^_[]USWVhu}WWPHD$T$,9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv,9@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $b#1ۺL$#PWVSh0RQs t$kPW$b#PShPVM ,9VL$'Qt$t$t$ t$PPh`g$h$Ǻ,9$0Ͷ$,9$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC$ffC C 2CfCC@=:rC fC*C,NG1ۍD$(huSSSSSSSjjWPh貓48P胓@,Xqt$VWrW膔FuQ1K59mt Pmt$A59mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]hq%hq%hyhp%薠USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$b#PWVSjh\1U5`9|$ ww萕f%t$R59RPSQVg U5`9w$w Zl$459RPSPU6 G\$skhSjPD P迹Vc9j!h r%VUy V h裫%L$59PRUQ譼 hv$59P%PUS肼 hKPSD$Ph*r%hh9W 1҃9Q9A \߉$4PWhK0$j$W hWh9Q Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,Ŕ9$EBL$ ;QU9Vh D$PW1u!h0s%VPWh$s%j跿1EWh:s%jA hW hs%W赘$hPS;> D$PS u"hDs%WPSh$s%jA1EhMs%还hPW= Whh%j 0l$ShMs%hWs%jt D$ s%PV$SPW= hcs%Vٗ$s%1PWQU虾hs%V踗SPWI= hos%V蟗PW$s%PUa s%PVPhs%UC ahY%VZPhs%j ;hs%薗hPW< hs%VPWh$s%jڽh s%ShPW< h s%VՖ1BP$hs%V趖Phs%jy hs%hPW< hs%Vtƻ$Q3Whs%hU訦 1tVUh$s%juŃ|$tjh+'$Ą ^_[]USWV ։Qz 1Ht L$ L$$W7 $f} r= jhs%U u&UShs%D$P uhg#( W7 Ņu>L$4t&t u$Ut$ t$ hs%jt$_LW $ ^_[]USWVՉfD$/D$jh%D$5謔t&裔8t虔SPhs%hU VSU': 991j/Uq t5ÍD$9tK9vH8/t@P2B CߍD$ PW9 D$%= h$PW FƄ$/u&踓$QPhPh%hU /h$PU69 hh%U9 e=@uWYA x*|$VW$P8 9r>讌?裌0|$W W膌01Ĉ^_[]hUj t}/u }$$tcD$UQ|WF|Ɓ`|$tVh%U8 9=VWU8 9%|$W x(WA7贋>1F1S蚋0jh*#j SWVύD$ PQ1xVD$)tOjWx@ljj PW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@j$m \$hjS jhs%HD$ƍD$ PhW@Vl t$1hUS誆 ,$̀'tWP0|u-9D$C E,$ !u1L$PPPPh jPPjjj!Qhm4t$t%j=t$VWf_Wzn6VH ^_[]VD$@t(L$ 4@Ā'VhW1k F 91@^ËD$ 9fH 9tPPQQQhs%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺gk$L$~D$<P t3$b#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$b#t$DRQPh6v%jV D$ T$Bj5`9QPu$b#t%t$DQRPh6v%jV謝 D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o59t$hPh%jt$hVD$XP1WWjjj0賕,`9|$4D$0,9L$QW<W,D$DPV[~ljӍD$DPVw|$߉څu D$$H؋Pٸ"D$<h_%t$w|$,] {t+[1h%Swt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hPh%jt$hVD$XP1PPjjj0?,j D$DPV D$׋D$@tlm3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSWQ )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5`9PQ|$ RPhG2$jW胙 ;9CVDSjP jPPh9. V8@(^_[WVt$ 5X<_Q5X<~$uFjP59F$1O~(1h9QQhr hGhRjFj WjPv$h9{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$} C{$t%K0 u G TfG lJud'fG G5G,G G,-G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVhX%jPQЖ 'u tEj,j+荅L$jPPQ+ h"#7j*fL$QjPT6 h$j-?t$R59Ph$jFVN j.hd'PVh=v%hh9& İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5`9RQmL$RPhw$jQ譕 G<(\(|(Pu#]j#]L$>PSWhf%j&Q%j5`9SWlmL$t$>QRPh6v%j&VI $F|(,u)|$hgPh\v%j(W <$1e<(Ou*?D(Ltۍt$h趃PWhYv%t$t(Tt(PPWh$j(V豔 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhhv%v:t 4$@;|$|$upd^_[]1؍L$>PWhRv%j&Q  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWhYv%j(V蘓 4$h^VjP lj|$D(dph-PVhav%j(WE *USWV,9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá,9H1WjHDWWQZơ,9$1$ ,9@u <@TX uDHXT=d9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$b#WRPPQZ1ҍD$*W Q$b#QRhQP-D$$W Q$b#Q1Qh0QP&)ߋ,90D$pL$$QL$.QL$QPt$SPW/ ,90uNjpfL$$QL$.QL$QPWSSj'B0 h$0+|$pG$DŽ$$T$0<$tT$@BfBB0ffJ B 0BfJB0B fJ*B,+0=:r~(uB0fB:B<90@1L$0huWWWWWWWjjPQh\4t8P[@,Xq$PSMS\$X(؃u ,9TXK$P'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u h%PgT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV5,9R t@D$4D$8GD$ D$,fXC]~1K؃^_[]1USWVH,9L$1$QD$`x_jS(Ņ~ F!IuD=T$ ׋D$`B01huVVhr VjjAVjjSUhT4G(WPFw(UU.9w0$CPPs$J)NjT$\C$BCHfJkllPs)ʼnCD$DklL$s)Ɖ)$ى@RQP T$*lklQt$P~ 1DDD $1D50 D58j D5dtIL$ HL$T$PD=hD$PJSL$`D=4(D$P6D=hD$PL$`1|$DT$\fBA.1NH^_[]ËD$@1ËD$@1ËD$@1ËD$@1ËD$@1USWVxˋuyD$1 |$$B9T$Ju UD$})Ɖߋ] ˉt$w\$_ }}} ދ\$CKT$,9‰|$}+D$,L$D$L$CK CjlP%CtH{hh'PA =rID$$t?x,u xPtlIu&59t1IHH Pt$$VW5,9, >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Oh%D$ P^t5h_%t$ ^u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0X9)ދ\9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$g L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$( L$)։t$ t$A59 1Fhv%hv%h]hwv%[L$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S tt<1^_[USWVGD$59l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX7AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}`9k<4LE1UЍe^_[]USWV1:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=T9t*=( :11M<t9\@u 9DDMHEr=P9tO :D$PP1ipt$1t9 :ut$P9t:,@uލEpr=x9 :J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@( :D WVu)y8u.q$t"y8uqxu Hu^h #h:x%hm hw%BD$x8u@h #h:x%hm hw%mBV 9; ,9tD9t99t‹9u€92t 9^WV΋$tRttyu)99tЋ9u90u1H|$59,1C1҉T TTCD 'k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D '$k 5 :.$b#t2"#PS5 >tiD$Pt>Sh{%hfT$\$  :$DL$4L$0 :0|]t$VEPhs%WS :( ( PQVh{%WSt$\$ CCa5 :.> >,>(>$> D$)Pt>Sh{%hTS$$(t$,t$(r 9t P `91`9tWWh y%CUWhpy%h|f3e@ 9t8Whpy%PM@ 91Ntjh"y%P1@ ^_[]1N =9tt$hw%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ ,9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$褾$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx`90^_[]h #h:x%hm hw%USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tIhP1h :PtPhhuha(Qh :ttjh^h.h^_[USWVL$\$ t$$tNKk.^_[]USWV$t$8$Q3u*11IhuPPPPjj PQQjhQ3P4Q3N wT$<,$T'l91Nl9RP/׉Vj 1G$h*jL~-"./ 0 |$4h&b#PW0 1PWWVVjjU( W~ xL$<1$^_[]USWV4T$H1z$X11D:tL\$St:PQL t2L$ D$; $…u $;Չډ $ڃ,ut B$Hrt)u.$CM$։$B(r,Jֺ]4$h :^~x14^_[]ËD$1A1҉PPP PP@ HH $hLRP{ USWV l$8fD$-5p9u61ۿ'P 9މuڃ5p9J\$<|$4$|'h4 SPVh h%Woh5aǸsu8j5`9 [L$RPhG2$jQ=. 5p9h6oh71PPWVh h%U{4du31PL$Ph$$jQ- 5p9h8t)u D$ h&b#jPo- 5p9h9t)u D$$h&b#jP.- 5p9h:zt)u D$(h&b#jP, 5p9h;<t)u D$,h&b#jP, 5p9h<pL$QPVh h%W ^_[]USWV$@1K $ $'_ 1hSSVVjjh=p$  /t$l$ WSUU UhS%WS, S,|/D1l1_,9, 1>WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&b#US* 1USSVVjjt$" Sx xL$1^_[]WV|$ 1uOG Pkt/1; }OX"h :x 71^_WVt$ F1hWP# dž dž dž$dž(dž,P40^_USWV$h^2t$hPV艾 $$$ȅ'D$@{tUh?r%V USV 8Ouڋ$xhLuhMSPh|x%V}C(~Ph&b#hV( }hNHC,~Ph&b#hV( }hO#C0~Phx%hV]( }hP#VPh|x%W^_[]USWV$R3u*11IhuPPPPjj PQQjhQ3P4R3Nw'$R($܅'WP\1N1jWWVVjjhQ lS, T0D$4h&b#QPf' 1PD$PPVVjjU D$P|u x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP  蹜Qkd)Qhx%V赮 ^_USWV$h^|$hPWQ $$$'{hV VPh|x%{hWvvPhx%W?[hXp1~,t[hYS1~0W[hZ6ǃ4V uh^V0FT~PhN#hW% sh[[h^1~`{h\vXPhx%WF\~Phx%hW$ sh]mFd~Ph&b#hW$ sh_HFh~Ph&b#hWp$ sh`#Fl~PhN#hWK$ shaWPh|x%V/[hb1~pPPWh|x%S^_[]USWV$@1N R$fT$(' 1jWWVVjjhc|Gl=Ol,9,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&b#QP" 1PD$PPVVjjU D$Pp x1pGp1^_[]1wwVt$F~|F Px t1@1FF^SWVT$1ۉZBr 1Bl@ZpPQkd)Qhx%VL ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hl|%hU|%hh{% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FĈ'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$9uh9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWG 6Pw$$$'@21^_[Ã!t*Wp1@<QKWPV說 rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph}%Qr D$D$uPh}%j[t1ۉ؁^_[]E@USWVt$ $=p9$Wh0%jP 1t t^_[]Ë 9! ÍD$XWhB%Pj1~jDjjtD$$"#Vt$\kVjzkD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1hr#W ƀ8tt1tCuVL$ D$ j jVSp É$qj jV?p t#D$Zj jV(p D$T$C\$ \$D$|$u\$uthh?r%S讛 hVS蟛 \$E61ۉSt$,j SVo É$ tbD$ ʉ $tQD$ D$tGjh1$t$}V@j tOjh1$V,j tdjh1$Vj te|$ush"#j^iD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Ui hj蠤$tJ@j`PQT$苙 T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;hx%ho%hh{% D$ph%j iSWV=t95|9t^s3ߥt#$t$j(PV 4$蝣_u9hsj|$0VPh$jxW~ WVV &t Ĩ^_hL &h>|%hh{% USWVσ=t9u hɷ 1t0?t+t9t!-|9E WP tt/|$thh%S轌 !hvS訌 u4$$$$$St$h~%j ^_[]SWVD$Qt$Rh~%Pj h"#t$Z$jh'PL uWh"#jfZ$tAt$hr#W 8tjt$2h"#j%Z$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh~%St h~%S^ h~%SH h~%S2 h~%S h~%S h~%S \$hy#S ǀ?t($؈'WP uE F@j`WV虉 -j(W̨ tj)P軨 t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&b#WU WUUjU= H>wѻPD$x0h&b#SU SUUjiU< H=wˉ,9DD$H1Ƀ|1M1҉$PVRUS 1Q\$ SRPA 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á9tq.9Vt$ 9u W. 919vFt=N| :wu1w< : ::^ËD$Hs-s '.h #h%hhB% Vt$ =9u-(t;u2L$ rȃs̎'$tu0:1 ::L:^WVP|$t$=9uI-j PV =v1t-h;t @ :t4< :^_Ë $9u։^_-=8&:t4&:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh^-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh1@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F VhC,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$Ph(H,1\$}UM;t;Gs} Shmw%q} ~Shz%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWW L$D$ T$VQPRt$Vh|%h$P $L1QhPjVRx`WhydP D$V?|$t;jWS} \$;MU}h%h%h hB% 1e^_[]RSQi} ShX%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSV )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H< :)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU辦 @$\Cǃ1:k0hWVͳ D$4WhPW$XmD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$((tÉ|$UFd#D$0jPUQt$(e(1 Ⱦu#\$,hPt$ Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PlX P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x PZ tn{ C K$;}sL$4QjSPL t_D$HtW< :)1ɉAw Puu2S"j@jP蔮 fdžUS#p1ۉ؁4^_[]h%h%hhB%藫 USWV4D$L D$PhjiƋl$X\$T|$H'WU F|11Kn^؃N$F Fdž?džjh>USu @džPWtwt%D$ D$D$D$F114^_[]h%hD%hhB%脪 USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPWN D$vP6N 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h,%h%hxhB%^ USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D715DQ:5@Q:5HQ:D$D$ D$1D$h\%WU> pu $<HQ:e~ft$lt*zD$ƒbtCeubD$벡$<D$ ChjVV5$<hg%!DQ:@Q:zVhVV5$<hs{$^!D$Vu=_39}4D$$D$l$ t%1PPU D$yUh$$IL$ tHt$(Uhr%V h3"#6uRh}%fD$0Pt$s #D$8=$$ DQ:@Q:jÍt$0ShV u UPVy UjD$0y DQ:@Q:Sy h%t$(T1|$P}Ky h%1 y hʃ%vuWjt$J1St$J4$t$%Sh#PP2t1h؃%t$t$J4$t$5TQ:5PQ:XQ:$f3|$t|f3\Q:2f3tf3=l$u1HL$(Qhht@Px PtL$* `Q:t$Buh%lʼnPEJyhF%TR0 D$ yh%@$uBL$$4jPI4$t$V6荱6h%j|3Ph? j 7 j|$WUt$K x>tq1.SPt$  yĔ 19u2PQ:TQ:)u衔 8t1FVh$%1FVSh2%V2t$D$D$L$D$ L$ D$|$tvD$ PƋT$ уƉǃtωÁtt؉D$ u 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj UQL$ɋD$tP V P褃 h$b#PVhR%h|f3[ j V jV胐 jR7 VP^Ð= R3u  R3\Q:@=u1HPx 1; R3USWV}uCjhxQ:B xQ:Q:|Q:Q:Q:Q:hQ: lQ: tQ:pQ:|$(jWSB 5hQ:5PQ:lQ:TQ:?X+=Q:Q:@1;Q:)ω|$$\$ tQ:95pQ:T$s;D$0Q:D$(L$, Q:Q:pQ:D$tQ:D$$D$ =XQ:EtQ1$w ww7wwVWVzC 7www ww$PWj薐 M$1~~~ ~~$PVjf 1@F ~~~~WVWC =XQ:B5fDŽ$ HQ:t$Ph$$hQ 1FDQ: @Q:ƒ\$\$xT$T$|l$xЉ&ݜ$݄$ p&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh*$QP= `Q:9|ӡHQ:tPL$> L$)΅~DQ4))h$b#Sh'Rh1$QP Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPh;$SWG L$(+ xQ:T$,|Q:NjD$0+Q:x@B‰L$hT$ll$h\$@TQ: PQ:1F؃D$@5&|$vqL$`\$dl$`Љ&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4'RSt$DhH$QPɤ  DQ:@Q:ȃ||=TQ:PQ:݄$|=s4;T$D$r(|$$\$ ؍4)hj$؍4)h]$QP5 ƃ}u 4)h"#QP ơ\Q:@=u1H$VQP e^_[]+hQ: lQ:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h%T躆 8t谆 8#u$SjV)Z tGtV $1E48FB$)Ex t$7@[h%h%,6 h%h% 7h%h҄%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuh%h%{RÉhPKt4VhjPMEuh%h%-R1H^_[USWVp $$$!19L$PVW1Hl$Ut ƃU豾 VD$PW] tb$U]tM$dt$ $dPU t$jWX tu)$-j4'WU) 1Hp^_[]Ë$j-UP 0 D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9PlDdž- t^[V V 1uɂ 19^SWVlT$|$$VPC1Nt/ǍD$Pr PSW t Wl^_[USWVӉjh0jQ ǃt{jjjVi~ L$ F[9#t$b#<9#tŃ8%$b#$b#t 0%؉$b#t%|$u$b#SQRPh@%jhV諘 ^_[]USWV$=~蔁 71Ha~B11ۋ$4Vq <(Gs@ ,PVQT C$9u1$WQK ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u) jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$PS ^GNON1wOWhPw {@v>V=1H^_[SWV$uSh]%h%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6n 8 ` 89h{%hq%LNF G8~ ~u3FVhjv S?uh{%h%3Lt6hWv < t%uh%LPWVu  s V^_[WVp׉$ftPh %h%K jL$PQW jjPd PjWL tnjjW: t\PjW& tHD$|PWV t2Phjp >u6h %h%J"h %JW# h %Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW'0jW05^_WVPt$4%@5@u^t8tW%V$%8Vh{%j?#45@u`V,2<jP, u hՅ%G,-dž,sh%|Gj?3 t1t3u5$0$ $1Ph%F $ $1PWh%F^_WVt$ h#pG8r4@84^_8t8t uhnj%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@Ruh%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SPl% SUh %F SUh%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Pf w_ǍCWt$P'J ;)QjPr hό%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhM%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYhx%Q肣~PtVAt(t NLt m#t6%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQPB WtHAt[ƃx t Ph%p;%KFNtTHNUh%;n 1Oun 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh2%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph%6:11BUnj%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhO t$hU%hF%9$1Phi%91F\$ MbihS$( EuVh%?9ul 87t l 8 uF띃tVh%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=5uFGGtIO9tA t3@UUD" O5WQjj.>jV(t0<t$VtSB< t<=VS= hU%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/i 7 Vh%h:'#!7T$1|$`F(f9t(~ tωӍV QPRhԇ%6ڋL$tf~(^>8u(F*4$QPωj ~ tcF D$F*|$ <UWSPωT$ P\$Sh%6 <PUt$WPSh!%5T$ V>t*4$QVN< H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h>%hq%5 j-^_Ã~+ajjj% ̓kh%hw%hO%5 1m9h%h%hO%4 <6Rh%5@hf%ho%hO%4 111dh%h%hO%w4 @+X1BWDPU hf%h_%hO%14 11G1=Q:Q:6u P9W+Q:zh%h%hO%3 t0S vPh%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VW tE9u݋D$ 9t9 u~<$h%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;h%W&V .h%WV !h%WU D$$D$h%%WU |$t$<t$S ǃt1Fl$<4S GF9uW$t$<l$US WUD$P E t=1FߋD$@D$PWS Wt$UW EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]_ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tW5Q tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xhB%WO h%WN \$,hVS@Y jǃ0[%$R31O$$0@4jV9u11@PP$u1Ajjm uD$l$(D$ D$D$$dm%tl%Uhؒ'P$VO?u$duiM)4tQ6uD$ 럍Hv H w?$,'$<$\w$'D$%D$[D$ PxGD$r%D$2 $d 1@D$D$D$$h5$< $hD$z%D$D$%1@D$x ˀD$D$FD$9_3t$bS{($h($$p$l_3)$艄$\$,Su1VVVS6$U$PjSA\$h% D$9_3$4$|$0W ?_31VV4Wo6&$$Pjl$|$t\U胾HrBPt$h%# t$\$ SgV 8$UА $`$d$`$d_3T$ QR$4 $$`hqz"h%l$,<$茄D$ t<t,<ulh%L D@Ug uDh%& LHUL h% TPUCs D$1DU Vh""4$hqz"h%"D$1Cl$,$bu Uuhqz"h%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PD $ }$nUqq$VU# U+A$;$R3t P%$dP@1uh% !$dt3$Xt'L$jQP uhqz"hq%#!$j"$hh$f3% $$d ؁^_[]Ë$r,u'_3Qj$4 $u*$`1PQQw $$c@u h>%$VUI ha%$`5 $d$`$dUh(Zjj$=t'UhLZj$($}hqz"hz%hqz"hi%D$L$Ph#%U$"h#(R 8thqz"h%3$`Q L$aQ 8 S$`$d$dl$,hh% u!pQ 8th%hqz"hĊ% hhҊ% u!8Q 8thҊ%hqz"hĊ%^ UtUhqz"h%Uh%1k$`r;$d@ щ$`$dU薹tePhqz"hl%KD$ Pjh0j,Y hS"#yUPh% U$`$d҃ ց uK$`$dr>1r_3$L$ QPUM W$`$d%r _3$$b#$b#t% t%VQRh`&WU{\$,1D$WhPiu h%ShVj$$nuhqz"h%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x u%ً%$4PF$$9|t$t׃z Ru$dh%P_S[$bh6%Jh&yD$ L$$$XPCUhUj$d$ uhqz"h%X $dh?% $dD$ L$$$XQ譺UhUj$d$W uhqz"h%7S$D$xhqz"hz%`_h%hqz"h%9hqz"h4%*hqz"hɋ%hqz"h% $O PhJ%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h]%PJD$,PB't#%@tD$,Ph{%Qj$dWD$0P"0$01~ tVhO/jj$$vS*I WVjhV% t*VPuVhˍ%MW轷hV%h#0^_Vt$V許t$pApdr$PhӍ%NjjtVh}Ujdj ^WVPt$D$uPh3%h% jP, tuIh3%h8uM, ,ʶdž,>wt=D$|$ffN(ffOfuj8 ȉG_1_F*N>QPSp F>)^_[USWV$lt pvh%PWj t=wM$lDA 8th%h$$h$u)h@%h%hh&% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U1 =wfD @PUhh%W=udh@%h%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF PhI%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQPM F>4)mC Phl% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#F? 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h%h%hGh&%h%hHhՓ%48 D$tFL$tt 9Jt >  > 1HBH@M1@h%hC%hhՓ%7 USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v= 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h%h%hh%h%hhՓ%5 L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hV%h|hՓ%4 D$t L$HH@Lh%hm%hhՓ%4 D$t@Lh%hx%hhՓ%4 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hhՓ%N4 USWV(l$<\$߾'1|$ |$|$<$E4t.1FM0 I?r}: E4  G9rՉt$@Pjե 1Nt91D$ D$D$D$9E4t$1E0jS4#9 t G;}4r1(^_[]h%h%hYhՓ%n3 Q:tD$ Q:QQ:Q:WVjPj1tMƃPj- t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PuNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =Q:t'Q:H Q:Q:N8tv|x| @t,'\$$|f3SVU{S Uj ^ (V3 s SVW  ^_[]PL$T$ D$$PXUSWV։3 $VhUWJ SV PUh:'#Wv3 ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,V3ËD$,V3r SWVhS$ 賞 1OtFƃ ||t 52 +D$HP0V3Ph$$Q] 0V3^_[á(V3ËD$(V3@P )V3 SVt$ hjh(R3h|f3(V3 s1fà 0 jSP  tt1 V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhj. t!jhj 1ۃۉ^[ Vt$t'PdžtPݝdž^靄D$t$t$t$ SWV$hjWL, C jPW- Whi7 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv C/ 7 6/ V1H11Ʌtsm $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV  1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0r VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV ) Fjŋ$@Vȁ $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4B t GP9|PX~11\jT$4R4 t FX9|XD$ 9D$H$~11LjT$4R4貸 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PV@ CG$C D$ jt$ VU C yQPD$|P. D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4賶 F;`|ӰD$|$0WQe~t$\yWh(%e$_w ɺ@r <t5<(<$L$ 1@ut$h(%$1@fG(FG>O*VTPRQ $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVW w_ jVS r& 1N^_[]j:S t/@1UQhQQj QP& G8mtD& (G8GjSPX O t lm3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS! F jPS WSh~i tD$Đ^_[USWVPj!D Q: Q: Q:Q:h[%FQ: Q: $<  O+VQP 9v1 LJ\$ I;<j,jU@t ǃD h3%Vj,j&Ht ǃL h3%'j,jPt ǃT h3%t$$WhP'V D$9rh3%h?%[H$|$ 7D$PWD$t$hr#D$PA ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h3%h:'# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$hr#D$P? ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h{$U h%U hK#Uu $D1)h%UI 1Ʌ<$t$Vc H9t- t u!H\Ht$9u1@$D$$<jPS虪 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSW $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$蟿 `Dd<t A`Nh3%<$Dt&u"t$ $<r 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U' tu;uHUhj%'D$uuUh#t$$t$$P't$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPU t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(_3|$$t)`#L$# $ 1CƋl$ \$18m%sl%Shؒ'Pt$%`|$X/h%H"D$PKD$P4|$Xt$P jt$\X( D$PD$PL$P׃L$P׃ D$PfD$P|$XHj,|$\WC p j,D$PJt$Xh<%Vt <$hٙ%V[ hCt$VE IVj蔊D$Pt$l}D$!lt$XPVpD$P|$X.h#W t$P'hD&W hݙ%W Kh%Wy Wh%D$PD$PD$Xt$P jP(&h&%D$P D$PD$PD$P|$XH$;nl$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV)$6?mjt$\D$ 0USWV7Vjt$\t$,USWVVjt$\t$$|$X$;D$$\$t$|$ $T$Xl$ Ul$ UPD$$Pt$`l$HUSVW)$>ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\W Ê@tC< t< u CCu1j h%WA j h(%W) jh5%W jh\%W jhU%W jhK%W jhH%W jh~%W jh%W Pjh%Wi 8j h%WQ ?L$P1T$XPfL$T$t$XVY(1Kj/VS uD$|$PjP L$r L$rL$T$t$XV'1Kj/V uD$|$P jP( XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$R3t PB11j|$\W6!ƉD$V茼yjW t>thV%V V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h%h%OD$Xt$P jP h%|$Xx D$P$<t$X谱  $<PU D$PX|$X hv#|$\W t$1VWjWWWWPn L$P9>t$Xh% |$X t$1VWhWWWWt$t L$PA 9>t$Xh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/Pu 1|$Pt@j/P_ tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$tk L$P9>t$Xh!% L$P ЉT$jt$\# h•%~|$Xq j,|$\Wl * ƀx 9l$Ps%ƅ |$1WShSjSSt$ta ,9h{%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t蠐 L$P9>:t$Xh% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$ft$XI $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J| 8Ut$Xh%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPl fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h;%@D$X  y@Uh!%D$P |$X D$P D$P D$P |$Xn$6t$PvihC%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xhj%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV迉 9]Vhћ%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t& L$P9>t$Xhp%|$Xtut$1VWjWWWWt$t L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t览 L$P9>At$Xh%Qh% %P C t$Xh%Wr à \$S螮ƅ|$PPh˙%SV  jvVj/t$\c AL$1|$P# KD$ɋl$t t OGuh% N|$XoE1j:W l$t2At$1VUhUUUUQ 9.Mh% j=Wy  ED$(@1 t H@Wha%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVhj%>nT$P   xUh}%=D$(h%J hї%Ɔ <h% D$Pǀh% 1K$dVh%D1DDD DD.u hɘ% 1D$(1h$WjhƤ%W1xh"%Wh3$Wphh"WZPhs%WDJh~%W.hG#Wzh%Wh=#Wh%W hH%W> t$ hO%W hU%V h]%Vs hd%V] hl%VGY h="V1Z h%VT h%VE h$V6 h%V' h%V hA%V h%V h%V h%Vk h#VU Vhp%  t KC  t KCWh%Ɔ  xt$P1$ƀhuh{%XttC< t< Cuh+%0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%W t-hz%W thK%W t h`%W t@Ch7|&Vy thf%Vg D$P@ tsFH t t@@1 t H@ttC< t< CuhD%Ƈhh+%wsF< < F1$SUjnJ tUhӚ%1C CC"$f8l$1USjxSjSSWL~ $D9]$ƃWh%ttC< t< CuhZ%Ɔ L$P1S=flF D$PV<  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h+# 1F؄t  H@h %1K؃<^_[]ù@D$PǀǍ0PVjF whK%F -{]< < Chd%G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWSy L$P9>sSh%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/SK tIGC1L$P4 1D$PVSj6D u7tb\$1SVhVVVVWCx L$P93tQUh%tGShӚ%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh%ItF1tC< t< Cuh5$Wt)W跓 Åu"=1rWhԜ%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8U ljD$FWUP >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$V# >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=lm3DWtCT41Fu|$ D$ |$jjD$P, T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$Pֆ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRS j=P޶ ,$|$D$ Vo 1ۉ\$t?t9D$ 1j=S蜶 )9uWVS; D$\EuVި4$Ž t5ƍEjPt$  4DL$hڝ%Uhڝ%h% |$$t#4$P tzSRD$h6% D$tHTMPR莢hT%hߞ%hh6% Vt$t#1PPV t@Tt$ V0 ^Vt$t$Ƙ^h%h%hdh6%[ SWV1SSQ蜧 t&WV謤W蔠SSVx Džu^_[WV|$ t^ǘ1PPWQ tPWahƅthjV ^_h%y1h%h%huh6% D$t L$tHThT%h%hhj%h%hh6%\ Vt$t61tpT^hj%h%hh6%' WVt$D$ L$zVP譠9tVh 1^_ËD$HTt1Pt$ h̞%h%hh6% USWV\$tF+1PPUڥ t.jVUȥ 9^TuVUעV_u^_[]SWV D$4toHTty9|$0uPLjPWmt<Ƌ\$8PWySh %j Wf VNV ^_[hT%h%h h̞%h%hh%h%hh6% USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etuu 8Vt h=%跨ňjjU5 jWU Gt ;D$TG9t ;D$TWUWVurGTL$tIѺ!! tD%WWj03u! 8t 8t h%ާW߅11SSVO tLWV_WU蕙9t!Y h&%舧WSSV Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SVLDžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:x&tg%SGtr7tCtt-SjJ1 8t hp%Wj1u2 8t(h%եx&tg%ScSj0ua 8th%菥1ɅtWV.W^_[]ËCT@$u Cx;Gx_%WhS%hL%h;h6%d D$t%@<t <u ø /1h%h%j;h%! D$t%@<t <u ø} /1h%h %jQh% D$tBHttu#xðÃxux uxux /1h%h%j}h%~ D$t>Ht4t uxjh'PR  /1h%h&%hh% D$tEHt;tu&xÃxu x uxux[ /1h%h4%hh% USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ Wo1=u!GB9r1ɍ|$0+ /1NjB1ɉÀthAu_1ۀ=Q:uD1FFFF FFGFQ:SVrVW_uPQ:މ^_[]Åt 1u19[:Rt1h%hC%hh%o hO%hC%h'USWVP|$G<t<$ $ l$W)Ã|WhV ۋ|$t(ٸF\$$)؃|PjV 1=Q:u+Q:W9u!Q: /1N^_[]hu%hg%hnh%g SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQkO ^_[h%h%hh%h%hh% USWV|$t$)Ã|UhVW t(ٸFx)PjV( ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ* ^_[CPh$WVW 1t߉h &h%h{h%h%h|h% D$tL$tf Hh%h%hh&h%hh%h VD$t&L$ t/fqPp QPI H^h%h̡%hh&h̡%hh% fV{$ 'Phء% u^USWVD$t$V1Ij0V1|$/ooo WVn5x't-1C \'I?r   DE9u֋-'t/11C |'I?r   DF9uWt$V 1ɉt$\T$\RVQ2P菀Vt h 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP詪 tbL$1tHhH%h$%hM8| /IG?uWG9rD$^_[]h4%h$%hh% USWVl$t$|$t1ۅu>t7NL6%tLN& m#tÉS1ۃ1Ct:tV>tXtSh\%t؉8txt@HtPt؉CjV.t.Vt!thd%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${to 1NA~0jhq%Ws uW WZ G9rh$f3 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%NS$t^DžtnjSWC b 8th%h[#荙9hv%~1HzSlt$h%h:'#R tG11CGt0WJ ؃uhv%h% ?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQ[PWh%h*%辘KUSWVӊB D$ L$$t WT *QP\tNjD$$7@uMhٹ#%tQhآ%W o Ph%We |$ t$h%W@ {D$ D$h%$U< t$h\%U" UQ |(6hd%U 1>hx%Q޻ h m#$U 5h6%U諻 h%U蕻  hLN&U h%Ui hnj%US 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I48'h!%W +7$@D$o|$L$ uMD$@tBL$qPShO%W"AO%D$ E|$tShO%W <$tBt88t/SQt"D$pHpDShO%WAM|$ tSW3D$ t7t1Ph$$W D$ 0uWŘ W<ǀ|$ WD$(P D$  #tޣ%Ph-%W; vKLs%t$;=&tRh>%W AsHhK%W 'CPPhW%W  s$he%W SmPhp%W {Pt;CQt$(stPhhV tVhy%WT {xtCxPh%W3 tr7@OǀD$(hș'Pt0ts~ t!V^t&PD$,P9uvh%Oh%B1OĨ^_[]D$D$D$h%W t1PPt$0V肉 tc1PPVo 9th?r%h$$Wx oET Ph$$WZ QjUt$0V! Ņu1UVWU hnj%$V h%V hx%V˵ h m#V赵 hLN&V蟵 h6%$胵 tzh%$k ޣ%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSuޣ% #( # #D$  # #tޣ%Uh%W Vh%Wv S,E%tPh%WP 3E%t= t1tVD%u vuPhã%W ?Q@thѣ%W|$"D$<uMD$@tBL$q PShks%W0;ks%D$ S|$"$<D$@LL$qPPShks%Wtl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPWEm 1tk<.tghOq#W۲ tUh$Wɲ tCj h5%W t/tj.W- tUWe 1t^_[]D=|Vt$ 'Bء,f3H ,f3;G$t$GMEl 1 ^_[]ÿص 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Va 18K 1H(D$ %t%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjSW C@G jPS1W fC $4CCD V$4P8~ UShip C O*W>RQP~ UShip׌ } 1N^_[]WVPRQQw ~u~uF $`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVP tu訓 1^_[]fD$fx(t1ËL$ D$fx(uD$Y V1ËL$ D$fx(u D$+ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS |$jjI`Ƌ$(@h@h%"ljFuJ1ۍl$Sh%j UQ h@UFuCB 8tǍ\$($PhqB@Wmt f<$f|$ jUS> ShlBW/t txD$PhpBWt tZ$$VЃuBD$PhfB@vs t(D$FP>F u+ h%^Ft PV)O1ĸ^_[]USWVt$fFtV)vv vp AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ c FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPr ^USWV L$@T$*@h t$ Vhc%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P3PVh7%S1I/ދ$0$4Wj$@U t|$r $,84$GPĄP$0VhH%WwSYGPVhZ%WR$0$4|$WjU $,t|$w1Ћ $ Q9PVhl%$4$4#]SPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh%$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhVt$$@$@$L0 >}k|$`$0PDL$L$QWhPt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VS t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$   V1(^_[]ËL$DtD$L$tPVQ&S D$ƅu SWVD$ L$tT$$w .11t$|$X+9sY "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`F`^SWVjh0jM 1NǍ\$PSPhW'atrjSjjWat]jSh@hW`tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWV t WG^_[USWVt$+VjUAChu,$t#tVh.#Pj@^  ra%s%PSh%{PSh%I 1BhL# ^_[]WV΋tF>rD&( GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1BhL#` SWVt$tgw]Vhc#j @^ w$zPSh%H GLhP ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGHP%_0wF SPhs%H _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$`yw(<PSVh%KGG0GH%% w$yPVh,%G G0GHI%c1HG8G4 w$xPVhX%F 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( l&|$D$ fD$l$|$Hl$D$HG4N PQhҨ%xF ?G0D$ D$$l$ l&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pww0PVh%E w$ww0PVh%Et$6u$HujGtGht:?7%tP>%I%GHPuXj<c@O;Au<t 4%?u0%GH0ts]Shc#w4Q;Sh*w8P;Sh +w0Py;C w8w4PhD%yD 1HG8G4]@uPD$u>C wiVPhr%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h«%h%hh%n SWVt$^ ShЫ%'BG0+G8PSh%A VhPj81G?6uͩ%EHPV Vh֩%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h-VD$tF9tAtIdtI;u D$ thč%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$oPShV%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih莵 D$ɀT$wȈBBV*QRP@ T$(  D$tz tA<t]<tYD$PPj`D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ K ً\$T$ |$D$0 tQL$\$)9C=|$ BRQP+> Ã\$T$L$\$- AW |$ L$\$)9!D$ C<AQWP= Ã\$L$\$T$|$ ‰ʹ ыT$ L$\$)9t$(D$ C+AQVP= L$t$(Ã\$T$\$ D$0hL$|$0ʋ6D$@@ZD$L$)ȃfPL$ы\$tD$0t,ˋD$L$)ȃf2AL$كt,ˋD$L$)ȃnf3ȉAL$D$L$)ȃDf7t$(1D$ ˋ\$$X\$,\$8u1L$,1C\$4t$\$8\ˉt$(r\$$[L$,1C\$4L$\$8LPL$4\$$u4|$u L$,:t!L$\$ 9L$uC\$ \$,B,;A*ыT$ D$x\$ShP# t|$ tsjPhL$\$|$ P0W PL$|$)9 OGPSQE: ߃<øHT$|$)9QGD$ $ GfGGPS0ǃT$L$D$ L$DD$8D$D$D@1T$ D$,D$ЉT$ | T$D8 B9rKruڋT$$T$4u+L$$1BT$@t$T$4Tʋt$(r6L$$1BT$@L$T$4LPL$@u|$u$L$$:uT$ D$,@,;D$8F)9D$T$ 2BL$$D$DD$8NjT$ L$AЈAL$AWu"D$)Ѓf9ffz׋\$  T$tQAY uK˃L$)9 GM AQSP28 L$D$T$\$ |$fG G|$L$\$T$|$ |$0t>D$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSPT7 ǃL$D$؋L$؋T$B)Á+),PjR_ ,L$1OAhT|$ 1|$CD$PjsǃSt$ P6 G D$G D$ GGDCff_f_1ۉT$SfGEh fGG@D$ffGSf f_ t$WhD$ p\W F Ph%/b ΃]w'6uhmG&V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h ƍG 4$D$,$5&D$\$$%u(Wh DVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GHx%GP_iVjhStSE0, pLJ  twAQ \ BjWhj`jP[h%h%7'sY EX>@P, UB( A J*R>RQP,  ]rts4 t*Mq @T$hRQPPV]hV%2C>t2Mq M*T$hRPQPV]hl%% PjjL1wLw w wL$u]rruG XixiF SPh%F% D$h$PS6ΪNRh%%@u3EpCP t: @ NH M plYh/%(%u Vh+%%h%v$e3=u1HL$h$QP t=w:F hŰ%Ph%$ wsW 1Ƀ8tmF SPh:'#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQPu* hŰ%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$SPVh%! M1C1G G\$"O0)G4)G8uL$YME Ph% A}w s$QPVhа% WuWVt$ Vh Djtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph %>W0Edhč%WWNttxV1ɄutZE tS@;FuK_ PPPSh?% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr jP N@H@USWV׉΋D$$E t @9u ;M$^ PNPShX%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tDč%EHPVK#8#4 u2j1Vh!jj؃^_[]ËL$hPWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hPSWV1{\t^_[ÉjhQ蟻 C\t4WhQjpuhd%h%9N 8u"54V3hW% Whd%h:'#> 1NcD$T$ PUSWV$$($$$$_\ftPhq%h% ch$USY t'sPUV`t3_\t,Ct$?tF Phq%h:'# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh~%h%  t `jW0莸 tD$ WV h~%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r PJPVhӭ%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sI%n1ɋl$ T$Et*u4|%& Vh%"%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% WQ} /6uh%VEiP6ΛVh!uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$T@4$teSPh["Vt$Wh%t$( ["ۋD$t$0% P@4$L$ t/PUVt$Wh%QSPh["t$Wh%t$$7 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWP +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$>PVh% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph¯% v B1F FFL^L$hS`WËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% ͩ%GHPVq^_[WVt$ F Ph%g OhGL^_D$ȅtȰ (1SWV\$C r7> 1H4t${GPhVM: ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0hș'D$(PEdx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVP* VVP ƍF8Pbuz3WMhVPb SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPfVt$|9tV;UVqT1PPD$,Pq ƅuC$t$xhș'D$P+1PPV> ƍC D$~dV`Sn8U`?1PP$ 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&,0 G0 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u7.L$( Ʌt ѹ )QPh%jWF ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h^% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr. t$ $ q>YtiDD$ \$fl$Ӌl$ hT%WU_ - 8th%hj%t$@s"j@{Dž@7k D>1ɨ1QSV PQFRC F CFKN\$l$ [g ! FQg ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF J( oUSWVD$1tW8tQ\$l$G@tjUP u8u@$%@-tPSh%QSh%! Sh̳%UjEds;M$t4} t.@tUh<QjEd1ۋ $M$L$M Edu[Ch2tKhUP FG8~hg%$E$D$E 1K؃^_[]hg%VD$ t$t+~ t3N@jPQD u L$1@tNduFdШ(u1@1^USWV|$\$l$USW& USWAA 1ɉ t&tuttNIHP;JHrƉ^_[]WV|$ Gd1@ur t3uh@uDu HuLtPt$W!wd9t WG1WVV^Gd r1NGd^_USWVE1t$t$4$tC1;PSKu"KtHKUJS#ue^_[]USWVM1D$D$$9?CdEu} t!KtOKUJ9} t&CѾ!! u } tK@} uStPSuVCjQ0 ƅtF;Ct SC## ut PVWSe^_[]SD$t1tKt:t4z@u ZAtz@uzDuzHu zLtB`uI볉[USWVD$$L$utyt$(PdƉpS|$,VD$IT$D$*tE@jWPȚ tmu11D$ D$8E`1ۋD$ $t*EMHMT$4tbD$0jPWV PuE$E E0EVu4jjt @H hu%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUj s t:NhVRPh%j.Q1 @jPW t&@`F`Nd#h%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSPx tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h$%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀijPj781Fuh\%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPhX% u2 tQd s((th\%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh$'U Sh,'U TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU  U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS荐 t=m<$hj.PSjl 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh%3 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPU躎 tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph6%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$džuC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h% GdD$ D$1xG O4SQPt t $tsOdtYG %t$OhQRPh%hWj[u!- 81t# 8t h%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$ D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRh,Qj螽D$ t;t$(h3% j6Qhd%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  shd%V+^_[USWV] D$@Cxt$rj.VL$0QjP |$,wVh^%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh]%h RQh% \Rh@%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP%s L$  uhj/ËD$CNC KFCF CCj.L$vQP  Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h}%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h%|$$HL$Xpx jP$P D$<t$h^%|$rst$h'%$p΁Vt$ h˸%t$$C$x|$D$ƀt$h<%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$hE%t$ 訾 $A D$PAD$LIL$HD$D%D$\ȋL$AdA`$ D$[A`D$pp1ɉ؄L$@tD$@ D$ \$\$ڋL$T$DSD$D$x$x J\$؃41D$QPt$8 K )rL$ ";t$ |$ h}%*L$F0D$[F D$\ȉFT$0JF$N(BF,t$SD$LPD$p)D$D$P\$CD$LCD$DL$HKC T$0JC4K8BC<JRS0K,C(s {$D$uhT$L$A|BQ|u D$t$D$p 9rt$~$D$ FdFdT$0JF4N8BF<QT$ǂfL$A|BQ|Ѓ@jPt$H tjt$Ju1ɋD$@dT$8tt$~ tT$8tbD$@@tLD$x@uBtjt$u,D$x$t"L$A4PQu h%'D$ D$%t$h%ַ%t$PEt7MT$2 ,Hu܋D$<8t$tNGdtB$tD$xdt4D$t!t$ut$hֹ%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰h%t$D$u%D$6j D$@`L@O|$ut$h%몋sLߋD$,9CPut$,t$Vh VGPD$$t$,XGLtbt$,Vt$PA wPD$(À|$$.&D$$h}%ø|$$3WQ%t$4q t$hj%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%$t$et$4t$t$h%|$$tL$11BL$jSD$(D$$UWV}u WYhd0 ƍG 4$D$,$5&D$\$$%ԶWhVjíe^_]WVt$ VhWۭVhWĭVhƶW譭^_SWV|$G Ph%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWPg tF F^_[h:% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Shz%袴L$jQS u h%$BHJAWhƶjj*G PhJ%+WhƶW iSh%|Yjt7Uh~jPs@h%h%O)h%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUhX%! t#@uUh0%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%j봋4$VUhղ%. WjDu!+ 81t! 8t h^%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj< t'OQPh%j.V hq%ر)h*  WhoPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW` uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuhd%Pchd%PMt-u~`?w#F0gF Ph%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh˻%h% jSWN tD$ SVk h˻%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhݻ%V PUn!D$C,9r|$t"w 7hݻ% PW8!,Nu^_[]WVt$ tqwgVhj胥1GGG G XGft^_# Vh'%h:'#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUja8 \$wWh%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWV[ t0 D$ PSh%+ ^_[]h%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh3%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Shy%$ WShS%藫 F PSh%ت t){4t#D$} t*tu Vh% Vh%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E&%f@'9t Qf9Au<< <\$H $D'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%oD D$ PD$p Vh־%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPhl%wD$`$T$B"pF L$ QPh%%P 1Br&$F  $QL$$QPh%<$tD$x%$l$ |$$ PD$$PVhB%蓥D$w 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hPKt $jSjj)W/t WE^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPVа t?jWj$j)Vst"$jWh@hVQu%hݼ%螤VD hݼ%艤1N ^_SWV\$|$1tD$p'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph%ߢWhsW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh %P E]1@EEE,E ]$z t(VhRj jWh,%h:'#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPhg%h%Ġ$1ۋ6<$tD$D$$t;F SPh%Ο D$$hPS6V%Chg%6Jh%蘟e3=u1HL$$hQP!? Ã37@$:VL$QRP% \$\$TSjj[l D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph9%~T$E|$wD藏S GDtL$$SQP _Hbh%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph%h:'#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh%\ot/wVhj jۓ1Wh%h:'#b vF Ph%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7Ej%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t)%tPV"ELPu4 u<Udž6ttFtu7@t'PB;dž ^_[]à Vh/%h:'#ٚL$1jSWV|$WhsjdtxWhS>WhS'WhSWhSws^_[SWVt${Du ?~ WhB%P 1@1ɉKCCS(C|S KtHd sHdit xt^_[Wh`%h:'#k ^_[ønL$xtBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhcjP迋uh%h%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh%PY D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s A 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$'   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $ȥ'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph8%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H ܉(H ؉(H ԉ(|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlRȕ ڃ p7t$ffBfB<$tD$WVPR膕 ڃ L$t3D$fffBt$tVWRωM ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPΔ |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP D=l$_D$ fǀ<x 1fw ')hC%葃R|$Qh/%j W( D$l$ f9<t1}~ QWhW%PEt$sf<޵ fu.Whl%z(Ex܉(Et؉(Epԉ(El6tj!zD$0^_[]USWV΃|$$w Vh%躂1H׋G 1ۉt$$S1ItU" $]h]d]`\$,Džu\$Sjfƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蒀k(UPh%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh%4},WVh%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$t P^D Vh%h:'#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VtP6jVjj`v-wx9Dth3%Vu Vh<%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh%Q|13%8WjjVuD$$Pj軤<$w$'8uJ%=ǃ81%8u+J%8uQ%8u %8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%} ؋?ut$u {`<$uhs`t$ h%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h~%u:fD$D$D$PjUVD$0T$4)̓w!F t$h%ufjPD$DP}{ D$LȉD$LD$PȋL$LD$P9v) t$Pt$Pt$h%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀfD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%]s0 t$h1%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPhX%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%rt}u^_[]8V6)^_[]SWV΋y Wh(%q 1CCCC CC$t ^_[WhN%h:'#q ^_[Vt$F Pha%q1B^L$ Vt$?N Qh%Po 1B^jL$PWVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Whf%p Wh%ot ^_[Wh%h:'#o ^_[ËL$ Vt$Vh jifF Ph%o1B^hVt$?N Qh>%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPht%h%n tjS0Z  tD$ WSV ht%vn`^_[]ËL$waVt$?N Qh%P?l Vhwjd1^L$L$@h%P1|$L$8jQj*j)5PR<Yvu h{%Q<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5PR<uy h%QQ<t+DŽ$j$Pj&j)5PR<OuuK1ۃ|$$8V3D$,tD$t3S?hR<uh%h%ƣQ:Q:|$$tF1FFFFF  F)F.N,Q:Q:9rF t$ƃ|$t.t$L$Aut$h%+8V3D$,|$,tF)F/8V3F Q<@;DŽ$jjj5 y h!%R<8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5v<t$PV;hD$$HL$L$ 1x1PPPWJ jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$o ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$k_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$v<D$PVPt L$@D$D$ 1 G|$<$D$=XV3$TD$j=h,A&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h,A&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=h,A&P Ņt$,]zd 04$Q"hd 0D$$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4^ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H 5] dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=v<u t11jNtv<1w<v<t P]1@h3"#hG%w v<1USWV1=w<MT$ l$(L$DžD$5v<hhw<菄  |$t$ #j hw<' D$w<h #V;}v<tUPXM uTWV}v<WV }t7j L$QP} x#L$9uv<;D$ D$uL$us v<8 v<APQ~ PQ L  v< tuQhhw<荃  |$uw<1^_[]v<{<{<1Ҋ+~,u"1t$L$t' t" t΅tAL$= ~<u ~< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=v<u#w<v<tPI v<t v<1^w<v<tPWI v<VtJT$1Aj<ƃ=v<u#w<v<tP I v<t v<1^t v<t D$v<1@1USWV D$,L$(l$$~ )$1H$`t v<1A\$9|ωL$ tgp9tX tt$ PLJ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$w<v<tPG v<D$,L$$ ^_[]f11f11Ã=$~<u /t((~<11hhX~<PjNt(~<1\<$~<t P襂1@h3"#hR%r $~<1USWVT$1=\<+\$0L$ D$D$|$(D$5$~<t$8S l$,D$ D$D$t$j S^" \$1 h #VyxE|$tt$(PH u~ #WVOxEWVBxt^j L$QPx xJL$9uAE;D$ D$<u/h #Vxtj L$QPx x L$9t[ $~<8 $~<APQ~ PQ0G  $~< tuQt$8S~ E h#VtwEth#V_wwh#VIwah #V3wEHh #VwE /h #VwE$j:t$ 1@|$ u\<1^_[]WV=$~<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhX~<h(~<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=X<u+\<$~<tPL$!D L$$~<D$$tˉ01C؃^_[\<$~<tPC $~<PPhhX~<h(~<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=X<u+\<$~<tPL$MC L$$~<D$$tˉ01C؃^_[t X<t D$X<1@1fUSWV\$l$t$VC PVW  UC PUW SB PSW t$ VB PVWʽ ^_[]WV t$uRt>DžtA=b<t ^_Épxj Phu"S ؀=`<u1F1=a<t0R 1맋5\V3P $b#QQhe%PփN USWV1ۀ=p<t ؁^_[]Q D$ |$GSSPhd<jW&u d<7 t< x<r1H|<$b#1ۃt2u3hWh[%菽 D5l<~ȍQ2w$Ш'<PAu <?$D$-\V3mO h/#L$Qh{%PՃ<`V3@<dV3 |<I9@hV3 |<I9@b<`<a<<<y<p<g`V3 |<A9~WH`V3O<FdV3|J  h<p<1h/^b v1$D$D$j D$Phu"註 +V9 <s^3h<t^USWV$l$@]ub\$<ro%UUUU)3333!!щ%is8u=`<1E+H!9s,=a<1 Q=a<1;t<9v <9r?9w;h<ƅtD$801=b< $^_[]Ë=x<!!׉D$9_|$T44$9r)Ɖt$9vA5<9^=<!9ً $r <<h< |<T$ D$T$1Ƌ <!C! $)މ)ʉȋ |<|$ T$t"Ѓ 1ɋT$ T A9u |<T$)…t0|$L$ɍ<)<$ 1Dt%ƍC!t2)É$)t*<L$ <$)PD$p xPh<=<=<WjD$hpj Phu"] 5\V3G $b#QQh%5\V3G $b#QQh%PփE 111{PZDWhV-E ESWV 1L$ |$ ru\95<s(>tGǀ=<u.;=Ђ<rN;=؂<rDh< DžtVjWD =a<t^=H 1ހ=b<t& ^_[À=`<u1Ffu]pxj Phu" 뺋5\V3iF $b#QQh%PփRD NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95Ђ<95؂<H_ŋ <!9r؅ <9s9s_x< 8!9t.M9wI9rE<8! dV3!9u!=<=<h<Rf ʼn9rPVU>  8!!ōD$p <PVL$yD$PVt$8<Pt$jUV>thŋ$L$Ai Qh<=<=<u=a<)E 1=b<tM^_[]t$h<0O=`<1GDu3t몍D$0xhj Phu"貲 5\V3&C $b#QQh-%PփA 9U7)SjZP)MPjS@ :9/ $)QjZP)PjSd@ tƉ111USWVˡ<!9ta)‹ |<h t u9=,$)<l u=<OE$)ÍFu\wl?'xD$X <PWAPWU=<N V<5<w(' w?'1É;GsG1B TGHO;Mu9}tAtDEWP5u%E9tt9sMxt MPQ}-E $ut=<tGV^_[]ÃWU VjZS> vjZv u> VjZSd> V t$=b<tt ^É01ɉHHj Phu" ҋL$SWVȋ<!9t+)֋ |<| u 9t%)D @A Qh<Y@D^_[USWV=<t^_[]þ$b#VVVh%\V3Vh"#h"h%\V3N%=<u=%%=<ucU&(#=<u{&RQPh%\V3u'&=b<u%"=`<u##M%=a<u<$%=<u$VRQP\V3\V3$ d<|$gfff̉ҍ4މ劄1e#GO wһ$b#"#SUWh%T$t$|$f4SUWh%\V3\V3$ <Ggfff̉ҍ<߉劄9e#FN wh$b#h"#Vh%T$\V3$ <|$gfff̉ҍ4މ劄1e#GO wh$b#h"#Wh"%T$\V3$ <|$gfff̉ҍ4މ劄1e#GO wҸ$b#PPWh3%T$\V3$ `V3|$gfff̉ҍ4މ劄1e#GO wҾ$b#Vh#Wh@%T$VVVhE%\V3USWV΃=Ԃ<tPt <3!1PX`ǡ< <!)ȉ9r1U4`Ԃ<9tEuótP-x<!1PPjhjUP} t(<t<=<=<-<1ۉ^_[]V΃?< ; <v$1u<Ɖ <^USWVP<<< 0trƃh'PF,=t<=<4$t|n011FEEh'PـEEC<(9r:5\V3W; $b#QQh%Pփ=<h<11<9s[ $,0EEh'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEh'P< <s <)ÉE;ǡ<<<(9r$^_[]=8 L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡt<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9<s$5x<!։Ņ9<v6J Љ  ȉ  F1r{@p9<sBJ Љ  ȉ  F<< hV3u%1I#5<!֡< dV3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=<t=<uVj1^_[]VhU3 USWV5<1!-<t E<1-<E@;<v@uW-<E@<tE3t,ÉE uUh<=<t"=<t!<E-<^_[]VhVjS2 USWVΊ |<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$S~VSSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ |<^_[]1USWVȋ5<!) |<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh܂<l Åk jS܂<WN SWb<<;-Ђ<r ;-؂<1WWjhj\$SU t\tV9tRSP_ uE4 j@\$S0 -\V32 h"#Shd%PՃ=<1lj1<4$9v(< 1QQjPjVQ8 @wg1=Ԃ<jUŋ5<!Ɖ)tPtUԂ<9tut݉<$/؂<u1]4$D$x Ph܂<AtA<$܂<C 9r09$v+jSV SV<<uɉD^_[]J/ Vd< h<r!1F<u. h<d<F9r^USWVP $1N=<1!׉) |<D$)ot +t=<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVDGWV;_s_u.G WP=<u.M,t <-},^_[]jPR 5<^_[]USWV@׉9 Ђ<95؂<jZS;؂<u >9uP>S;؂<FjWV *1ۡ<t  <8<H@; <v@j<H@ < 3H <HPh܂<<9rWV軫 u=n0 j@S0R -\V3. h"#Shd%PՃ=<9=<u]<t  <6<H@; <v@u,<H@ <t=<p xPh܂<@^_[]9Ԃ<u)Ԃ<؂<>, flV3ølV3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áj3?D$t$PXWVL$T$ ‹q~y ;q~ t 1~9 QPVL ^_D$ lm3DAD$ lm3DAD$ lm3DA%D$ lm3DAD$ lm3DAD$ lm3DAD$ lm3DAD$ lm3DA%D$ lm3DA D$ lm3DA@D$ lm3DA%D$ lm3DA%D$ lm3DA@WV1F|$ 4'W tF u1^_ËD$t w$Ī'1ËL$1t9t1ҍB|uËL$1t# t|$tlm3LH1H rËD$t lm3DA$H1ËL$tT$At9ut1VD$t$tPt$V1 ^D$ dm3DAD$ `m3DAWVD$ $b#$b#tƀ>tg%+ 0DPWVhwq&h|f3WF ^_Ð1|$w L$t9tøV3f|$38#t$b#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[] 1۾$$T$$IwL$I`q|$ \$߉t`r'j`PSm `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ P% t F;'tm'D$ܿ'D$ '1FthPt$$V Vi Ft$N tVD$PS |$ut$`e|$ \$|$u,1F|$uu1;ط't$`=u-( 01H^_[]ËԷ' r ,$'t u‰,$''<$t9rPQt$ 1t/<$t9vE( |fL$%9 Ծ(v\m3fL$#%9 (vt`3føÃD$L$L$ L$D$Vt$ t$Vh|f34G hł"V&<t"' 0kPhg$h|f3B |f3Vj 0RVG ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t% 0 % 1$^ÐWV|$ W4' tFu1 ^_D$ftL$Q|'1USWV$п$$ u V`  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u##4$Y(e111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$,' j F H @(N]_?[\;^r~uFF<<C><% ^q{t|~F~F ;^r~uF<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF<F^9րրw t$rI{i9s <$=lm3]D_\,<$t~uF F<<Au~uF <F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=Alm3IDJt"m9~~uF <NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF <F"{u@9s lm3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup lm3DAu f'tf`uW~F=@9t8}@u~uF ~uF <FЉL<$USWV t$ ^h.\u/;nr~uFF<<EMŁ'$~]$X'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF<FωωD$$xt~uF <.n~EFx lm3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2lm3 DJt"r 9~~uF <N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF <FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljdm3TXL$21@u"`m3TXL$1t$1ɅtT$T$1=j3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 lm3LAtx `m3udm3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ) F^_[USWV1y19sC11-lm3D]t#=k)CB9u1Bt=|yuA <Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F<FUSWV\$1=j39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}dm3Dh j31҃9v1B j3`m3Dh1҃9v)1BuG <G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF<<<^_Ã~uF<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF<F1^_[]É؉D$G%'t$t$U u U{ t/uՃt~uFG롋$USWV 1=j39v413A8 $A,tI dm3L$ `m3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS|'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQO o^_[]SWV1G9Qs7ӉjRq tF^~uF <F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=j3|$ r3GtD$WT$ou]t$Sd |$Qo ]GtD$wt$wt$wS! |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4% L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ 5k ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf lm3>|$u l$`\$\z lm3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" lm3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA lm3D$¿!DQf_֋D$ !DAf|$$_8tV|$ulm3L$ DHuf|$$_u3|$ulm3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$0'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ F ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf lm3>|$u l$`\$\z lm3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" lm3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA lm3D$¿!DQf_֋D$ !DAf|$$_8tV|$ulm3L$ DHuf|$$_u3|$ulm3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V% @wj/Ve 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPh<H<ø%Vt$1Ʌ1t э^fffffUSWV[hl$(D$$u1vT$8|$0D$L$ 1L$)͉D$,11ȉ$D$411ȋL$$t$t$|$;D$ T$$75@PWn EPWV @PW> PW& tPW |$D$ tH@PW٠ PW @PW詠 i!PW葠 t)PW} |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [õ$ @$ $ ,10 9r 胼$ t+$ $$ FhPWX D$D$D$j1҉$ xfD$4D$d蛫 /$$ AfAfIQPRhW?2t$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ V訛hPWV j:Wv D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVP裎t Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl ,$L$ ɍ$ d1,$L$ Lz9s L$4.2qPh$Py$$,$9s|$$$,$9s|$$ ydL$ɍ$ P1,$ L$LZ9s T$hBJ R =RQPUh$PM$$,$ 9sL$42qPh$P߽$j$,$o9sD$l6$,$/9s狄$ @2PQh$PB$$,$9s狄$ @<h$ ,$9suF9snF9siF9x|$B$ yS,$9s%NM9D?<$ @< L$|I#t$xjhQPR%t$Ph$P$$,$9sL$tW2QPh$P褻$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ Y,$$ |$jj Rjjt$,$ a$,$$$49s獃H,$$ g\,$QPh$P$$9s獃K,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HPKpRQt$Uh$PeD$hL$HL$0HL$,HL$$HL$ PH @ jl$(PQRt$,t$4t$@t$Ht$,t$Hh$P,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@1l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$PXD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPHl$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$Pֵ`$,$$_9sjjjhRt$,$ +$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F4PQhW说1ɃD$D$ D$1 & fffUSWV`[ؽt$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r  l$8D$UPjO tCL$HD$ QPV跛 t2V t+jPj 1ɃىK'l (jD$LPV] U (l$8J 0jUj 6 0`^_[]fffffUSWV< [eD$yXXD$/Xty$/devjPt=ƍD$4PhFtHV~ V@ t|$4l$8$<D$ oD$ $<T$$61PhQRVFAD$ t@D$D$D$KD$pL$T$ t$F9t$D$0l$WzE?tD$pD$ jjRs tkD$tJt$PD$P  ut$D$P uPL ujjD$P k6[ 8[ @ iŋ$\ $X $T $P :)tt$ Po$` tVjQp 1tWhgtQ| < ^_[]ÐSV[L$t$ t$ t$ PQft+Y4 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[lt>h == 9u8jj襆 tl P 1 4辘 0ǃh 'ǃƃl t芘 01^_[ÐUSWV[õ$01l uut!j/Vc uSl tƅu誖 ƍ|$6VPQhW=r ?h@VsǍD$ jPW 詗 D$$WtLD, L$Pjhjjj QD$(P>t Ƌ<$t'Vu D$8 tO 8 A L$^_[]ÐSWV[fl u[ÐS[Þt$[ÐUSWV[pu } D$<$ t$u$$D$P.ut=k<T$JL$|D$x$L$x$PQh$$$Pt$_hlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$\1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$h D$@j PW- K 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $S \$ 8u$$>$0։ D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ]|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR辦ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6pW8G4jjdv6g jjdRPKWPGLjh'v6g W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[L$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[{|$GtB#l$%t$P<t!G t7t9uӾ^_[]ÐUSWV[ tC#l$ t$PZ<t!G t7t9uӾ^_[]ÐUSWV[ÛtC#l$ t$P;t!G t7t9uӾ^_[]ÐUSWV[(t$0t$, ǍVP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP+;tG t@/t;L$uЃt'D$ t$jb…<$uNt$0t><$9tR V PUW >&t1<$W#^_[]fUSWV[t$D$hEt'1PV=:t%D=u1p uVPjmD$@ 8^_[]ÐUSWV[h|$ D$hEt$1PW9t%D5up ^_[]ËD$@ 40tMd D$jPt$V@ ŋD$18t|ud r"u##p u'B"tt$p a(4$WPjуHWPj.SV[=t$ v!v !V!^[ÐUSWV[D$,8tD$,1퐐8@ujHƋ|$(W' F$"jUYF D$ D$,F>D$Pt$_1}nu1ɀ}ouL$D$j=UD. tǃ|$D$,t1PU}7tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8p t 4$ V1^_[]ÍUPj0USWV[E$4$,a 0(jPUv uj:U'- A(jPUM tKt$}/3t$UhVh jVPUbQ Pt$UD$PR|$ jjWjjV$6mt$ IjjWPjV5t$/KD$PVǍn/$0VPW  FD$ GL$ jjQPjR4tqVUW  R_ 0$0X_ 0G(ks_ 8uj/UBŃt$ $0UWw  :_ 0"(QPWX  111_ 0$0P$4)  11,$j$4V$4WjUpP>PWst$t8HPQm&^ 0G($0P$4  1,$D$P?U6M^ 0^_[]Íg(,$UPVWu1^ (1WP$8$8tVsfffffffS[+~D$D$ $L$T$jjPQjR2yD$[fffffS[}D$D$ >$L$T$jjPQjRe2yD$[ÐS[k}D$D$ ?$L$T$jjPQjR2yD$[ÐS[ }$L$y(jjPQRQyD$[fffffY|T$ulÐS[Î|t$kSWV[l||$Wt$t$/ 9r[ ?(WVPj^_[ÐSWV[||$Wt$t$ 9r[ ?(WVPj^_[ÐSV[{t$ 9ƅu(Pj^[ÐSV[Í{t$t$eƅu(Pj^[ÐSWV[L{|$WEƅtu)WPj ^_[ÐUSWV[ {l$|$UWƅttu!)UWPj^_[]ÐSWV[üz|$Wt$ƅtuH)WPj ^_[ÐUSWV[kzl$|$UWt$ tY 0e)UWPj^_[]ÐSWV[z|$t$Wuƅu)WPj ^_[ÐSVP[yD$L$T$$RQP  ƃu)Pj^[ÐSV[Íyt$t$t$ ƃu)Pj^[USWVP[JyPt$0t$0t$0t$0t$0jt$45 Ɖ׋,$t1X ()t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[xPt$0t$0t$0t$0t$0jt$4= Ɖ׋,$t1:X ()t$,t$,t$,t$,t$,t$,Pj ^_[]fXOxL$"wÍ0ffffffUSWVDXxD$4t$dT$\l$lL$`1ۈ$<tyD$XD$T$D$hD$t$l$D$D$ D$$D$(D$,D$0|$  tt Z %ju %#jo%#jx|$L$t\$4t$hVWRt$h\$4t$hVWjjm~D$$<$|$ D$<D$81$ |$ <,L$4GD$ =u <$f :<$F<$f ՉʀЀ r ʀ¿d ʀŸV _@F O?1 G<@& fu  $t$T$։t$<1 tl$<1 u<@TP* <$  |$ |$8\$6O? v 1ҸGD$ $ t1#T$#t$ |$0D$$D$,;D$s L$,D$$D$$ O3L$< =u!L$$;L$sD$=D$ L$$L$$HL$ D$$ D$$y|$ t^;D$sL$L$ D$$ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$8CD$,7|$$T$()9%D$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$D$$D$(D$,D$0T$|$)D$݋\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)oD$\$4VRT$$RQPh;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9sD$D$L$$݃L$$L$(D$,D$0T$t$)eL$\$4VRT$$RPQ^\$@L$$D$,T$()9D$$;D$8sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$PjjeD$8 $~D$$|$ $݋\$4WRD$$Pjj|eD$8 $Ƌ\$4VRD$$PjjPe1Ʌ륋\$4WRD$$Pjj/e~D$$$D$8D$ x@uNt$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjbD$$u|$0L$$tB;L$s5T$ >#\$4K L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[jjt$t$t$t$t$[fS[îjL$T$ Pt$t$t$[ÐUSWV[hj|$$t$|$0t$(aD$ j/U: ,$t|0UPt$ WVt$8IuUI 8uF,t$ t$Pt$t$@t$]t$ t$ 0n [ÐSV[ ]0t$t$Vl- tt$t$V& ^[ÐSV[ý\t$ t$t$V - tt$t$V ^[ÐUSWV4[h\l$Lt$HAQ$)9ʼnʋA|$ |$uƋD$ L$ ׍L$ ~=4$|$l$QPVWlj?]|$l$uPt$W-, Wv14^_[]øS[Î[t$t$t$t$0[ÐUSWV0[X[|$Dt$Lt$LW+ l$Tt$PGO $)9ŋG|$ |$uƋD$ L$|$D~94$l$RPVWlj\|$Tl$uPt$W + Wu10^_[]SWV[lZD$taH8|$tFH81@:u8@0Qj<7< H8 H81^_[þD$t@:$ðfffffffSV[Y8t ~Pqt㋋QXQP)& t.PT$06z^[Í|*PH jfHfffS[.YD$ ~ L$u [ËPQ2  [ÐS[XD$~ L$ u [PQt$ [ÐS[îXjt$ 0 [ÐS[~Xjt$t$t [ÐSV[MX0t$t$V( tD$~ L$u  PQV ^[ÐSV[Wt$ t$t$VP( tD$~ L$u  PQV ^[ÐSV[ÍW0t$t$V' tjt$Vh ^[ÐSV[=Wt$ t$t$V' tjt$V ^[ÐUSWV [Vt$4@|$ǃ( <ǃ, ^ǃ0 vǃ8 #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ< -ǃ4 -ǃD _ǃX |ǃp oǃ8 -ǃ@ -ǃ\ <ǃ` >ǃd *ǃh !ǃl f2Ot^t8tjtfxx ؋tvQjPW+ 1 QTpQTtQTxT|=u^_[]ÐVY.1 T$tpqttqtxqt|1=u^ÐUSWVP[:. l$j+GG(ujjEeQPu u0Pj j36xQP:ej>8 j< ` j^ jv j# j: j'p j# j# j# j-|( j-l j_\x j|L@ jo<0 jp, jrP jy h jz j{ j| j} ǃ8 !ǃ$ +ǃ` !ǃ( ,ǃ !ǃ, -ǃ !ǃ0 .ǃ %ǃ8 0ǃ %ǃ `ǃ %ǃ aǃp ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ8 %ǃ$ kǃ` %ǃ( lǃ %ǃ, mǃ <%ǃ0 nǃ( %ǃ< qǃ #ǃ4 oǃx #ǃD sǃ %ǃH tǃ $%ǃL uǃ 4%ǃP vǃ ,%ǃT wǃ@ %ǃX xǃ0 ǃp ~ǃ #ǃ8 pǃP #ǃ@ rǃh d"ǃ\ yǃ e"ǃ` zǃ ǃd {ǃ `"ǃh |ǃ ǃl }2NthtBt'zxÀ z ϋtuQjPVpx | 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX(x l$+4+ع x( PPu^_[]fffffffX(L$fǀx ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[>(t$0[ÐUSWV@[(|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:`10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;; 8u1E3t%`10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[í$0t$t$V tt$Vj^[ÐSV[]$t$ t$t$V tt$V^[ÐUSWVL$[$|$0D$(T$ 2D$ED$4D$D$x ftW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃx ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4x ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃx D$4PjjjW 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$ 1|$0fx 4)Ɖ4fǃx ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$te4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fx f1jD$` `4rփփ19‰4 4fx fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fx f1*Pjj!Q j S[t$j[ffS[þ0t$ [ÐUSWV$[È|$u'2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(*PtjjP_ ,GT*P趰tjjP5 GX!2@@xGX GXO <W$` OT d2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$VL P~D$$<$$u$PC HuǐuU PD$$鐐<$$u$}P Huǐul$Ut$V VU$|$~"14C;>|.V%^_[ÐUSWV[ufǃ heu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$j T<TV$2@4tV= =wlj<$hVt$ V- V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í(+PjS[þ0[ÐUSWV [Ø|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4`10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$薣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ`10vL$Eǀ3뤐SV[}0t$t$V t V^[ÐSV[=t$ t$t$V t Vr^[ÐSWVP[ $t&T$t$2PWj $^_[ÐUSWVP[Ø 1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[ T$9D$Pm 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[ 1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[h D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW|ŃuRG @tGB 8u=D$3t.`10IrD$ǀ3G @|$tmG  f Hȃ  fftVWq=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)`10oǀ3g 룸J+Pjj Q jSWV[ì|$WgƃuOG @tD- 8u:3t)`102oǀ3^_[ÐUSWV[+tt$339}3AP3՞t' 333343;33PQRPQ 33t331^_[]ÐUSWV[[tt$339}3AP3t' 333343;33PQRP聈 33t331^_[]ÐSP[Í$tT$ 2Pjj $[ÐX? tT$QT1øUSWV[TAx43fTFT$P訜j 袑+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhto DHDHDHDH uǀD$ FF^_[]ø*Pjj(+,*PjjQ舯 j*PZjxffffS[>0[ÐUSWV[|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ(uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[Ý0t$t$V t VN^[ÐSV[]t$ t$t$V t V^[ffSWV([0Wt$<2WV0^_[ÐSWV([t$8Wt$@2WVd0^_[ÐSWV([Ù0t$11;3}:tt3PpT^_[]ÐS[T$t$t$ [ÐUSWV[93|$0t$,T$ $u0\MDH@utl$4D$ U' 鐐t$ D$PL$ QD$ PHx)t$蔋tL$9D$)<9u AT$)RU[t( $4T$4R7D$0D71^_[]ÐS[ît3t P[ø[ÐUSWV[h8D$ $4VjPjbtSʼnt$U%eƅtMD$ $t$UD$PV&tT$t$$V VRu^_[]ÐUSWV[ë|$3t P 3~/11퐐440t0;3|4t3ǃwwLJ3j0jm4tW2Ht<@xX3~3l!P<72@HX3@$4Ƈ31^_[]ÐUSWV[Ët$3t P3~/11퐐448s0;3|4s^_[]ÐUSWVXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([ø4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W! 1Ґ$t$V|$(WD$0P9t$$茆ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj Vn $4D$)Džu |$ $tR1VT$ Z 4$)tWj V% T$L$ (^_[]ÐUSWV`[14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP`y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P D$T$3;4}D$PRjQD$PRjQhNj$D(P较D$$L$ ;47&ffffUSWV[ |$$D$hjjU| t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U6 D^_[]USWV[[|$$2t$dƋl$r:D$0莂D$4muX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U# 1^_[]ÐWVYD$T$ t$w4  p@^_fffSWV[Üt$VO~~tyы9uv0jv,j9p9p 9pt P譜jVj1^_[v4j9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PiffffVX>t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[î|$ uT${[ø[ÐS[~|$uT$ L$O[ø[ÐS[N|$ uT$[ø[ÐS[|$uT$ L$[ø[ÐSWV[|$u<t$D$9% ƉM1^_[øSWV[Ì|$u8t$D$|$% Ɖ81^_[øVX.|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$uT$[S[L$T$ [ÐSWV[t$8tCGX2@TtgAWW@x8tg@1^_[ÐSWV[|t$|$tCGX2@TtgAW6W-@x8tg@ 1^_[ÐUSWV[ ΋AX2GTt tNA t tNA t tNA@t tNA@fy tNAt tNAt tN@t 4tN@ t tN@ @t tN@@t tN@t @tN@t(tt VTt"G8tt V 1t$׋NX2#N@N@Rz8t N@^_[]øSWV[\΋AX2@Tt{ @f @tf@t Vt V1t Iy8tf@^_[ÀfA =fA9fA@5fAf1fA-fA)f@%f@ !f@@f@f@RD$t@@øÐXHTtG1 u<uA uFuKuP(uUa1(uHT t  t @t t (tt 8tt tLt ÐXHT1  4@(1( S  N @I D ?4<9 6@3@0(tt 8tt tLt ffSWV[ìt$8V_ PVW ^_[ÐSWV[lL$|$t$x"1t%<t9u W PWVN ^_[ÐSWV[ t$|$WÐ PWV ^_[ÐSWV[L$|$0x1t!<t9u Wi PWV ^_[ÐSWV[|0t$t$Vې t|$W PWVn ^_[SWV[,t$t$t$V菐 t(L$ |$x#1t&<t9uW袏 PWV ^_[SWV[üt$t$t$V t|$W] PWV ^_[ÐSWV[l0t$t$Vˏ t$L$|$x1t"<t9uW PWV7 ^_[USWV[$AL$I,D$$|$@1 $D$HL$D$ $cUT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$P(nxNjT$u$^_[]ÐUSWV[$$AI,D$$|$<1 $$HL$ D$$pUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ^L$1~t$ ~9J$u9r ^ÐUSWV[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[Út$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux hQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p `912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [8t$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[ݓT$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[ýT$L$ Aq D$t$jVPt$ ^[ÐUSWV[{l$1t>19)Rju uuu0tPU^_[]ÐUSWV$[t$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y}|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p0 F, fFV8 }![, < fN< 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD9@ t$$@ @ $Pq|V\$UT BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p;@ uD D$Pz1r)1@ $Ph WA\$ ƀw @ $PQR\$ D$@@ L$PD D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw@ $PV\$D$px1ŋG @ $h QP \$ ƀ=r{,t$G@ $h WP[ F$h Wt$ P9 \$ w@ $PQw D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u++k+PQhrR4 $8 USWV [ø[D$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ `;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [I D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$̿Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$̿PjQ0) @x H$L$T$ t$`ՉL$)4/L$T$ 9~L$T$ <$̿Pjt$( ǃ D$ ; ;T$ 9<$ to j Pox) @lt̿QjP%( F t3 j PIox) j |j m  ǃ 1;  $̿l$*ǃ ;  @@ltWjPV' yA t`j t$lnx )ȉ }u D$8o@@lU8 LQj `u ;  ̿"UjP& ; ~U   @@xuă tjWmx) j띍̿ ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$klx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$jx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$3jx) j f ; ~nUjP" ;  @@xu̓ t!jt$ix) j룉PS[.@D$ t# PQiix) P1[fffX?Hy8~DyD~>Hlt htðuu냹tt u1ÐXo?@ xÐUSWV [H?AP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ChD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[z:L$9 ft$9|$ 9l2uCUw$-4$t$sk#w|#|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVX892hT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY[7|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y#f>2~w-s q#f ^_[]ÐUSWV[û6L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZ5L$x?9J\~2D$t$|$ Irftf>vf1^_[S[Þ5ǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[5T$L$l2uI~w-ss#w!#ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐX/4h2ÐUSWVP[ 4t$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[1l2tu6@t!|$0QjP (!G@f@d^_[ÐXo1f@dffSWV[L1D$ yOQW~ ;O~ t Q WP1/Wv^_[ÐSWV[0|$D$OQW~ ;O~ t Q WP.W ^_[ÐSWV[|0xWt$W^_[ÐSWV[<0|$Wt$W^_[fffffffUSWVX/tLT$xDt$x.t$0[ÐUSWV([.t$ʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j kxL$d( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H#D$g1fT$t$j xŋd0L$ș)L$4$T$ l$lt$mD$$Յ $$vzx;l$tl$l)"PNx‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tD$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,+E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $`:ȉىӉl$ |$uGD$1l$뀋$\DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $;$t"A$|t+H$D+$,1$uՋ$1ڃV$<=!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,莝RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$\t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$t1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,讘rE,u0M4tڍqu4 $01$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,芗tRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[T$ D$$1Pj= [ÐS[t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[íT$ D$$1Pj [ffffXL$ÐUSWV[X|$(t$ l$u~Pƅ>l$$uj˹hj輔L$tfjVP NjD$uj(P/D$@ x |$(u,VqE\1F4,9Pk1D$tGuP|$(L,x |$(tF|$(mp,V|$(,Phht@Uƾ t$t$tL$t RB(JtRtPYtjjPv IA(tP0tjjPv IA1t^_[]Í+Pjz,VSVP[ T$L$D$tRQPVƋ$t P.^[fUSWV[ût$|$t$jt0ʼnVU|$T$VŸ,Pt$t~Pt$tk,Pt$t[,Pt$tK,Pt$kt;,Pt$TuA1 @VK^_[]ÐUSWV T$L$[]ǃ ,P Ņt'}/u{L$$ t$  ,PЏ/P\}PVOuU,}DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ ʖV`'u,1V='-PΎ$|$ $~:s1퐐Nt:t됐tÍMwUPW虫 D, L$$ t$ [tu{PtG-T$ PQhR~)T$ L$$ t$ $"-t$ $:uw1퐐Ot:t됐tÍMwUPV虪 D, L$$ t$ [tu$ $ȁ ^_[]Í, USWV[(l$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%j\$L$ A ZAthhP`+jj!0G(hhP7|$ Gt\$h(jP|$ "\$jhڌ|$ G9ouG)o\$UD$p֍|$ Go\$UVPȨ W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PKF$ދ\$P0~ F$D$\$jWOF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vmt.)9uUt$VJ t6u0,1(V9ſuUt$VJ ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEP{UWP葡 .,v3l$4uWEED$\$cD$Z-D$|$j|WHtD$4@ T$L$ t017t<,t\$RT$肽D$PztDl$VWQ薠 Ut$P脠  1<$WNjt$D$Pl$8u%EW|$WV W蔊D$D$D$ Džt$r\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$Ux\$8C k$K($fC K(K(|$T$ t$4B-P e>p1\$91\$-4$K\$N-PdD$PĈD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q螇 ^_[]USWV[D$t uy0Z-|$ 1퐐/t <,tQL$u$Pvt2ƃ$UWP菜 4$t$P{ 1^_[]ÐUSWV[;|$ t$FN,9vtU6uCu;Uvt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[Ú|$ l$XhPW uLt}D$x@ȃǃtVot$ UĹ)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$^-WuPt$D/Wqpry-WuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV] }t0EfEfF}WuV1 f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[k|$ t$FN,9vtU66yu]uUU3ntHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[üt$FNy9vtW6xuCu;Wmt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[8l$D\EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1-bGj|UiD$tL$j|U葊t L$U(=r|UPt$P 10^_[]ËD$tPL$ =r-"D$t+PήL$=r-QUPt$T^jjPutt$ $@ 1D5t <,tFPkD$4 VUP舑 D5$(L$tSD$HtJ11t <,tFPDk Vt$P. D5$h|$t+D$Ht"t$wa $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0n$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p n$D$t$HjjjPjfWjQ(.VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[|$ $ ftGt @1@WG(f hwUSX =wb, Ƅ |)ƋtVPUX 9vD|ŃƋGtVPUW 9s D|ŃE$^_[]ÐSV[t$ tavcivXivMiv Biv$7iv,,iV#i19 uǃ ^[ÐXo @ÐYO @u0USWV[%$(E$$4D$$0j:W vt/jQP蠛 t0V$0W  NjE;$^_[]Ã$u 1tM,ut64ut<x f$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP]$P]Cǃa(RD$O@$$,PQhW蚿 t" ǃt}LJjj($(q XPX XPu.P]t.j/V͊t|$uFA$jPRQV'FAT$$jPRWUQV.VPjESV[Ít$ j:Vrt/jQP- tt$V\1^[ÐVY>T$փ1ut^1$^USWVH[t$dl$`L$\D$Dȃ=u$<$y.L$VPj@Q3T$tLT 9 $ƅtID$\WU$R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\$1"DŽ$DŽ脥 $;D$Du ЃH^_[]OGUSWVT[Ø|$pL$ll$hD$P=u$ $t$ u.L$WPj@Qϻt$t$ T$Ijj D$Wt$ $t$j 辡9<$u-;D$PuyL$T^_[]WQU ;L$PtNT$DŽ$DŽ ;D$Pu T^_[]EUSWVD[HL$`T$dt$X}|$@uMu $t9ƀ.RQt$dPj@W艺 tRQt$dVޅ M;L$@uD^_[]9ESWV[Ì|$=uju $tVw@}tL!$cTDŽ$DŽW1^_[ÐUSWVP[D$hT$dML$LL$pL$t$lуucu $tOz=m8@tW=m AT$ vPQj@R x. VPRD bl{<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l$  4()uT$ff׺r$σߺfDfu,$tу$$1蓠E;D$Lu^P^_[]Ët$d$  DŽ$DŽ8,$1,$ BS[^D$u&u $tٟ-[Pf[ÐS[D$u&u $t艟-[t$ P{[ÐSV[ít$ j:Vjt/jQPM tt$V<-^[ÐSWV[L|$t$j:VQjt/jQP tWhVU  WhV ^_[SP[D$ L$ $L$ƒu&u $t]-Qt$Pe  [ÐS[~D$uu $t1[Pz[ÐSV[-t$ j:V6it/jQP͎ tt$V<蒝-^[ÐUSWV׉[ĽR胍jj 腚D$UWt$\ t$j \19tG4$$  DŽ$DŽ^_[]ÐUSWVL[D$D$H1,<jU$ u} t @u D<@u^$  DŽ$DŽ0D$;D$HL^_[]Íl$ E< us{Uٛ8|$jW$! u|$ u}Fu$  DŽ$DŽIu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:p# D$t$DRL$Dp# A @`? .19<$t# D$D@ @`ƒ?.91s# D$D@ @`Ń?+.9r# D$D@ D$@|$`D$?.;|$  ՋL$q#  <$‹D$Dpu# D$L$ D1 <@4$T$<`Ń?|$_u+.19QL$ T$D $L @`ʃ?|$_u.19 l$ D$L(D$<_D$$D @`Ń?+.19 ՋL$ T$D |$_$D @`ƒ?.9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t..;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3.|$D/? .D/ ?.D/D$./T$T$L$ t$ ?3.D/? .D/ ?.D/D$.D/D$L$ < .L/ ?.L/ .D/D/ p# <$<$5USWV[E$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# v3Pv4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# v|$| t!qtAD>1tBD>׹@# vD,|t.tkŷ< s݃1@tt# tр‍ p 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# v|$| t!qtAD>1tBD>׸@# vD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;p 1ttD~t# v  fABv w~4ABv w~4ABv w~4ABv w~4ABv w~4Av wʼn41 @tt# tlj瀍 ;p 1ttD~tv$Qv$A# v$B# $u1 @tt# tlj瀍 ;p 1ttD~t⍃v# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$ف8wр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځp $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t J΃  p t yW 4$l$T$ L$ Ń4p x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]$USWV(]D$<X%UUUUʁUUUՍ4P᪪p t x   x p t x   x p t x   x p t UUUU $؃p t x   x p t x   x p t x   x p t T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yh $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3p 3p 3p 3p 3<$t$3~3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 3p 1#t$t$D$|$811t$3=p $3=p $3=p $3=p $3=p t$$3=p $$1L$t$|$l$3l>l$|$l$ 3p 3p D$35p 35p 35p 35p 3p 3p 3p 3p D$t$D$D$$7֋T$ Bl$l$l$$xl$ p t $x   x p t $x   x p t $x   x =p =t $x   x p t ȃx   x p t x   x p! t! x ! ! x 5p" 5t" x " " D$@P1(^_[]ÐS[KD$1ɐȊt tT Tt t t4 uP1[ÐSV[ʜD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjR2PqD$HPj mZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP$jPD$0Pj%m\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjlt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]GUSWVd[Õ$|D$<$`# hjD$@P DŽ$@D$V$@8$u H$@D$/$@UVlljD$Pgt;uH.WPsi.WP[iuD$.WP=iD$UVljD$3jPWQh D$,u:|$$@PW#x$@L$,UV蟘D$l$0t$\$UVD$ D$D$ D$$$@&D$ \$UV0tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWRD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V11$xUc$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-8/PQRc_h$DUt$@VF j jW  hjU hj$P D$@hjP D$<;$`u`d^_[]D$RW菔D$t0T$@PQhR證l$ $fffffSV[ݒD$ h`rƉPw)Ɖ^[ÐUSWV[Øl$0L/jD$PUFc th%h`) $)D$j PUF $l$1}$K1D=t<$t h`tt$,aōS/& 4$t$L$QWPjbVt% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃\/t$ Wt$t$Pjbt$(V& % %  % jQPR ;& % %  % jQP ; & % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % &  & jQPS ;& & &  % jQP  Ƅ; & jjt$X ^_[]fffffUSWVD[ȏ|$\w ao2t$`tD$@jPV蔑 NjD$@9t8t-oD^_[]o8"u trWD$ID$ ;D$D$+D$<D$8wD$X$2a$g/WQjP艅0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ qT$ t$tt1ut /^Åt0^Åt/^Í.^Í.^Í.^ÐUSWV,[pt$@VcL$DV,~09rЍ,1V8T$$V(T$l$ D$D$|$F4D$L$ 9v|$VWuW$u WVf 1,^_[]ÐUSWVH[ol$|BUƋD$h4$l$D$D$lD$ D$pD$D$tD$D$\D$D$D$ D$$D$(D$`D$,D$dD$0D$4$D$<D$@D$DD$8$PctUV |~D$xt UVP" $tL$tA$D$PW$5t!UV W$  UV 1V- H^_[]ÐS[~njjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$8@4[ÐS[.njjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[mjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Îmjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[>mjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[ljjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[Øll$hUK<ƉD$ D$PvljD$VgD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$g t$ [ UR T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[jt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[ijt$t$t$@[ÐS[ijt$t$t$[ÐS[Þijt$t$t$[ÐS[nijt$ [ÐS[Nijt$ h[ÐS[.ijt$ H[ÐUSWV[it$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[(ht$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Hgt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXofL$Q##wÍ3ÐUSWV [8f|$(l$$t$ D$45D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[ÞeD$ hPt$pA [ÐS[neht$t$a [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[dD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[8D$pML$LjPt$lv D$h|$df$D$V`L$)L$D$PVW{D$ |$$v=D$ t$.D$lp8L$ QjjV V|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V. V|$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>V V|$)Ƌ $PD$2PL$Q, rg $ $,p=D$D$lp0t$ jjt$>VT V|$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7zL$R)уtuÐWVt$  r!̐cw^_fffffSWV[\2t$|$G@hjP j@PW" g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[50$$N$@r8hUtE\EXETEP$t$tAsE@hjP  Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV  h$$VLhVU< hV1;$u Ą^_[]<USWV [È.l$(16t$ %T$$NP NT  ()`N`L$$WRP# ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWPT 1 ^_[]ÐUSWV_-$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ Ws hj$P< g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVd D$hWD$$hPD$;$xu D$e^_[]蜞ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[H|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[ËD$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[ëD$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]H$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$44L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$4$FQ? T$‰ً$|$D$G<uD$ $4 $#u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4L$ |$ )t$)t$$t$,)wD$ L$?? nX4 T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍u4FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N 5FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Qs l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 14&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B 3Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?؍ፅGPGX GTG\GG?$L$u aD?E4FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  5FL$Q? s5FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$?5$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v'tU5D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$#5~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=#4$FL$Q?P$4$NL$Q?D$T$ ߋ t$4$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $sUSWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP覤 )t]D$)WPu8菤 }43M(U,E4E09w)RVP^ E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ËL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU< F4n0)Pv8U' 1tN0^_[]ÐUSWV[t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R肝T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$(#5L$(?5É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+0T$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[øl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[x|$$ $w9>~NQǃ8wHܞl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw w o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw v o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw %s o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQr F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw 0r o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQqL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw q o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw o o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw $o o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw n o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq m $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq j $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$Xh$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv $Y n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv tX n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv W n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu S } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu GS } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu *R } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu Q } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X/<ÐUSWV^L$4t;T$8\$0Ӄs3I͉у1&Ӊi913<ƒT$4zR13<ƒT$4zR13<ƒl$4M1ʉ3ÐUÐXT$J r (ù)ы(ÐS[ލD$D$ P[ÐS[ît$ ++[ffXL$ P $ d, | 0 x8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P<L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX؇D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$ ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YvL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +t()9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX[r\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[kt$xƅt|$7Vs;G CK ^_[ÐSV[}kt$ )tt$P&;F1J J^[ÐUSWV[(kt$ԯtLƋ|$$l$ $P:D$PWU, 1uJ(V[u gJ(^_[]ÐUSWV[Ûj|$GtE/D(U8]wUZt#V譡=yarau D$0VSI1^_[]ÐUSWV[j|$GtE/D(U\wUt#V-=tcidu D$0VӞkI1^_[]ÐUSWV[ÛiL$A1t3)D(U6\NjD$pUTt D$8I0^_[]ÐUSWV[;il$M1tMuD1V[uVt(WJ=yarauD$8H W1^_[]ÐUSWV[hl$M1tMuD1Ve[uVt(Wڟ=tciduD$8%H W{1^_[]ÐSWV[YhPt$ t$ >* t6D$t7<$D8WZt$WtD$ 01GG^_[SWV[gPt$ t$ ) tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"GVq G^_[ÐSWV[9gPt$ t$ ) tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"{FVћiF^_[ÐS[ÞfL$T$ jt$t$ [ÐUSWV[ffQƋl$$P 6D$PUW'( tgVD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6uE 4cE8V<u 댅t D$ 01?E^_[]ÐS[neL$T$ htcidt$t$ [ffSV[=et$t$u_Pj=tciduL$1=tcid^[ÐUSWV[dt$t$#_P=loobul$VEloob^_[]ÐSVP[ÌdD$Pt&Pt$t$` D$VbD$1^[ÐSVP[t$t$3ePv=gntsu?V8ŃUt$UPV t D$8 W1^_[]ÐSV[m>t$t$dPu=gntsuVt L$1^[ÐSVP[>t$t&Pt$t$d D$VrD$1^[ÐSVP[=t$xt"Pt$EfD$VrD$1^[ÐSVP[|=t$Ht&Pt$t$1d D$VTrD$1^[ÐSVP[,=t$t"Pt$eD$VrD$1^[fffSWV[<|$t$jWVz tt$V_wt WV{1^_[ÐSV[Í<j ƅt%PVqFF F^[ÐUSWV[;<|$tzj /1tcPVpFF FW ŃPtQP)~n Vp1^_[]Í`6E66PQh/RSV[};t$ tV4 P4^[Í`666PQh}R_SV[;t$ tV P^[Í`666PQh}RUSWV[ø:D$tfL$ L$QPjj11x@ƃ$Pt+ǍD$ D$Pt$ t$W01ɉV.ʼn^_[]Í6s66PQhURPUSWVP׉[:lHPQhj t}ƍPVxnn~L$N uq$' UC' VP9tBPdnU$u v V1uWU^_[]ÐS[>90t$Pc[ÐUSWVP[ 9t$t 9.t 1^_[]Fu VmF $Pt͉NjFu0PW&lHPQj t!UPmF~$F qWaUSWV[88l$1t 9}t ^_[]ËE D$P tߋMu0QPD$%lHPQ9j t'WPOlE$ED$E y4$iZ7L$1t 9tËA ÐVYN7T$1t 92t^BBtu0^ÐS[7T$t 19 uL$ tB ;D$v1[ËBu0PQ$[ÐY6D$t 9t1Ê@$ÐUSWV[{6l$1t99Eu.E P]tNjEu0PWR$^_[]ÐVY6T$1t 92t^ËBu0^ÐUSWV [5|$ 19t$$9Gt{o F D$D$Pt[$W0ȅtЋT$ՋVtэ\QPRt$t$V+Owo tQ1 ^_[]ÐUSWVP[ 5l$9EuwD$tyEti} P$PtFUu0\t$RQt$ P0+M}u tQ 1^_[]Í666PQh;Rx S[>4D$t9u L$ t9t1[QPjk[ÐS[3L$t 9t1[ËD$ Iu0PQU[ÐS[î3L$t 9t1[ËD$ Iu0PQ[ÐSV[]3D$ t9u L$t9tf^[Ëp0ЅtItRPאS[2L$t 9tf[ËD$ Iu0PQR[ÐUSWV [è2l$(|$$}(ttjPVl tu L$e^_[]ÐS[' jPq' PQ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[íD$0' VP/V1^[ÐUSWV [ht$4NswD$8tZ8@tSr@uppQj WjUVEZ tWVWWt UVI[1 ^_[]Í877PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[^,hPQq' Pn[ÐS[' Pn[fD$w sÐS[D$ ;D$uPt$t$Kw [1[ÐUSWV[ÈD$ t$tP;D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPu 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔lNx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í88a8PQhRUSWV ]D$ \$$p1}<"$N<\u< $1ۃރST4$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍ88a8PQhRUSWV0[Õ$Du wj0n11<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p29D$89D$Ews 搐<<}jt$W tfjt$W tSG9jPW E $AEtLt@<-Eu<-u}>u$h\t u94$"10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U薭D$m$hōA9D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$0D$ jt$ [ÐUSWV[ $j|$hjV9Y t5ōD$ PUt $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjˎUYtjVU?^ |$t'jjjhjt$P臎|$t-$U~jWU] WUfTVUfCS[ jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[m j@iƅtClPV>jP^F,F0F4F8F<^[ÐUSWV[ t3Pj覠tjj@ٖDžuUMOj@辖1t=lPW8>GjPj]o,w0G4G8G<1^_[]ÐL$WUSWV[H t$1l9nU(]N4 Džtbl$~4<$tC1퐐F,t1t$$5U. ^_[]ÍJ=(=Q9PQhRS[^Pt$ [ÐS[.jt$t$T; [ÐS[Pt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(99Q9PQhjRGQ袕GPLW荕1^_[]É.99Q9PQhhR?9Q9PQhyRU:9Q9PQhRS[~L$A4tPQ4I,Dt*Pa,[Í:h:Q9PQhR]U:h:Q9PQhR>USWV,[D$@xl$DuVJ}4tS|$(jWl$HU3 tjU3tlD$D9(t9$VJ$,V~JPt$D54^_[]jjtt$ lAt$DVL$*L$ql$$9.|$FWUPО jxDžt!PW> Gwo 1^_[]ÐUSWV[xl$19}EuBM1tDm $t: $U.xt^Ut$D$P U;1$D$jwt"WPt$ED$E E^_[]ÐZ¯L$1t 9tËA ÐZL$1t 9tËAÐSV[MT$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDUvt؉Ut$P覜 ąt===PQhR>==PQhR}Z?L$1t 9tËAÐS[D$t9u L$ t9t1[QP: [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVq.D ֐USWV [xt$(>t~(t  ^_[]ËF@_jQvPgt҃~$tD$jPv  ʼn$u 8"tD$N N$9u8"t=E>.>=PQhR1jPj N,$Ut7ǍFPD$PU tcD$;$uZujPV tD|$u Wބ1,$jLtƅt-PVF~n W衄t W菄D$$0USWV[y1D$4$G=w ՍjAPV r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[ D$0FuFt PzVq1^[ÐUSWV[l$(Ewd|$, .jD$PU! 8Gw t$OL$oD$Pt$,VD$L$?PVD$?PVqp?PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$Pl$,UD$0 ;PUZtsL$=tD$PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Í8Q>=PQjtRJSV[ L$t$ 9t8V 1;Q u.FtRqPv= 1uyu"^[Íz>h>=PQhRǺ>h>=PQhR診ffffSV[m\ PQ6|$ u( ( V^[ÐSV[t$ 1t 9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[ÎD$t 9u L$ t9t1[QP[ÐSWV[Lt$~uo~(tijPvvMt( !jPvv*t1( |$\ PQF5V7^_[Í??>PQhRӸSV[Ý ( VPƃ ( ( VPƃ( 1^[Ð1ÐS[>D$L$ yt,jPb2F,F0F4F8F<^_[ÐUSWVP[Ht3Pjttrj@(kDžuU{Wj@ k1tE,$LUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[È|$1tvL9uloUp1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[J*։ $|$?uwG8]u<GcjjWr tCjPwwt,t13jjPUt$t1U^_[]ÍW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%B@@}?PQjmR菫QoGP]&Wo1^_[]É."@@}?PQjkRC?@}?PQj|R'S[D$H4tH4[Í@@}?PQhRUSWV[èD$,hUt$0~W%~4tR,$ljUt$4V tjV2tLD$090t9$W@%$W/%lPt$0\ ^_[]jjgt<2 3AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð8#DrCPQhR蕜SWV[\t$~ t 1j Vt ;~ r^_[ÐSWV[|$t$t0t*PVtuj Vm^_[1SWV[üt$F|$uLPVujVm1^_[Í8GDrCPQh$RӚSWV[Üt$F|$uEPVtiu]jV}1^_[Í8eDrCPQhERUSWV[ët$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í8DrCPQhdRsUSWVP[:D$1ɅQh Dt$7jL1Ƀ#hK$GGG wtHt$WՃj W=tjW$$E|PQWq tDj Wt5D$h V|PW`tj WZ7p[Wg[ $ȃ^_[]ÐUSWV [õ$($$WtEPXx=ŋ$$t$t`?t[W5t.H|/t+1]$,9/;9sfD$ .t$ VόH r蜜?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$D tYjLPLUt$u t*l$ WU $t1$t$2$l$ ӛ8t$H t U賛8講8VY蜛8$ ^_[]É,$9tG9t iy/t)rD$ UWPn D, ,$S[~jt$t$ [ÐS[>jt$ [ÐfffffD$ǀǀÐUSWV[T$$L$ |$l$t$u2jGtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1EEZEPQjARnEEZEPQjBRRUSWV[T$t]D$ |$L$tKutUtMtM L$$tEU=WL1Ht t L t L |$$t L2 ^_[]Í FEZEPQjZRhffffUSWV[(D$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PHQsl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dVA4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[t$@|$[fffffS[ޮt$t$jt$t$t$8>[fS[ît$t$jt$t$t$(>[fYXZQ̀QQrS[st[fffffffS[Nt$t$t$t$[ffffS[t$t$t$2= [ffffffS[1;D$[ÐS[þ1;D$I[S[Þ88t j葋1[ÐS[n88t ja1[ÐS[>88t j11[ÐS[88t j1[ÐS[ެ88t jъ1[ÐS[î88t j衊1[ÐS[~88t jq1[ÐS[N88t jA1[ÐS[88t j1[ÐS[88t j1[ÐUSWVX( ?) R4(( ѐ>t1 @u~1ɍ(( >t 9u#;T$t$1 ^_[]Í}hI/IPQj>R{wffffUSWV[å$áL$(3L$,I9L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$L$T$ lPt$ [ÐUSWV(T$ [L$<\$%t$@|$t;D$<|$"v+v{1t$ \$VPmg\$u<+t<-t D$1 1ҊD$L$|$d$$jjdPWU$$|<$u;L$duh^_[]Í0QPj=S[ÎL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Dt3T$8tOl$@toJVPt$DR誌JJTJPQhRo멍JJՍTJPQhRo뉍JJTJPQhRwoT$Hk\ODH@u uD$ j PW誙 $T$t8"u,t"t0LFgPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)JWVPQt$H11҃^_[]Ë$T$|$(9ыl$,}J|$09Njl$4}KUWRPVQt$Tt$Tĉ 맋L$8fffYiȟmNA90ȟ%ÐXߒL$ȟffffUSWV0X$t$DL$H|$PL$%1|$L$WyD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$C T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ C*1$Sl0^_[]Ë$KK1KPQhRNf$KK1KPQhR$fL$XUSWV0X($L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU< T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U#1$e0^_[]Ë$KK1KPQhR_L$XffUSWV<[؅l$X|$Tb D$\}  |$T  D$u D$4tǃПǃԟT$PT$$9L$$0T$,8T$0\$|$ <$D$(\$ԟǃП|$ l$XL$1L$u̟HD$4;L$$D$T4̟>-u FD$,̟t$0VE<+<-~ԟL$ ПXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Őԟ<0̟Пԟȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$ԟ+П|$ /VԟtПuП̟<-u ~̟4$<:tkE$<4$Pv,L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P $? t/ǃПǃԟȃ<^_[]À:uL$:tVL$D$X:L$u^W0̟D8t}:tjWP腈Wx:L$T$,̟L$ $_D$p70̟:t%j=R+@)D$CПȉ $ԟ|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VWND$\(pD$D$ 1T$ $ $.T$tf\$QURO uUM $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:0RQP \$ԟ+ПL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tIRQP` 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tqRPN1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80̟D8t}:t4$Pփ $E<-t<+u:}:1<: :KKKPQh_RUwLKKPQh`RTD$l]LKKPQhaRT|$T;KLKPQhRTLLKPQhRqTK%LKPQhRJTnK%LKPQhR#TfffffUSWV[+zT$t$(+ ǃ(+ ܟ;D$}? 9-u7yI,+ t8--?ܟ0^_[]Í0j-R$tǃ,+ --KL׍2LPQjRRS(LL׍2LPQjSRR(+ ,+ ::tlQR#tXx:?u'1x:tܟHܟ;L$|鉻0+ 0ܟT$?uܟ?؟::~VLUPQRrǃ0+ ?tqܟc0:D$8:E?؟3VLfffffSV[íwt$ tj jV ^[Í MLPQj/RNQffffSV[]wt$ tjVrO^[ÍIMDMMPQj/RQfffffUSWV[ wt$l$tyjj 1trjtkNjD$oGG E̋̊PjQRjWtKjPj V1^_[] V8l$uEU8U(W|$7U(릐USWVP[ut$ l$ME 1҉s9r J9sAEOQ0 t`U)ƒQjRD$ Q E $}E T$)9w΋MVRPt( E E MU9r‰^_[]ÐUSWV[+uT$L$t$ D$t0tUyyMMWMPQhR NpxA)9}8iTTi t?MMWMPQhRMx3rH HPp 9r@ 1^_[]S䐐S[.tt$1[fS[tXt$ t$ P s [ÐS[sXt$t$t$P[fUSWV[ësl$|$t$t1UPWV1^_[]ÍwMMPQj4R:MŐSV[Mst$ tjjjV0^[ÍwMMPQjARLfffSWV[r|$t$t1hPWVo0^_[Íw:NNPQj6RLfffSV[Ýrt$ tjjjjV܌t^[ÍNxNANPQj0R4LfffffffS[>rt$j t$t$0[fffffUSWV[ rt$|$tBjW+~G0t ujW,^_[]ÍwNNPQj/RvK띐USWV[Ëqt$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H P1^_[]ÐUSWV[qj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$t|tڍ܏uft?$L$5t: $fH f@xp$L$H,h(@DH OW 1^_[]ÐS[pL$ D$T$rRQ0P [ÐUSWV[o|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[~oD$t$t$t$0P [ÐSWV[LoD$8pP tWփ1^_[ffffffUSWV[ oT$l$t\tE0~-},t xr }$t jr2U*1Ƀ^_[]ÍwN֍NPQj;RZHuON֍NPQjz(WSwSPQjwRk>VSV[}dt$ t ~t/>SSwSPQhR>~uр~|$^[ÐSV[ dt$ t ~t/FSSwSPQhR=~uN .wu^[ÐSV[Ýct$ t41~t^[ÊV u.wL$~9|ԍSTwSPQhR=먐SV[-ct$ t~t0^[ÍS%TwSPQhR<~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[Ìb|$t$t@1u6T$L$9w"QjVB> FfFF^_[ÍS;TwSPQh.R;뜐SWV[ bt$t>~u/L$Fy |y|9IL |F1^_[ÍSKTwSPQhMR|;랐USWV[Èat$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍmTZTwSPQhhRA:xTZTwSPQhiR:SV[`t$ t"~uDNu;V9r1-STwSPQhR9~t^[ÐSV[í_t$ t31~u(NuV9rT$x 9v ^[ÍSTwSPQhR(9fSV[=_t$ 9y ^[ÍTTTPQjTR8אUSWV[^t$|$t.l$tGMϸwG)o >1^_[]ÍSUTPQjbRj8뱍UUTPQjcRI8또USWV XX^$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ9D$0 28t p׾$VPUx 7+D$p)t5u+VQA$RjP9 7D$)smH1 ^_[]Ë$S(U֍TPQhR6D$4$=U(U֍TPQhR6g$KU΍(UTPQhRQ6D$a$8VL$$VՍTPQhR6L$USWV[\l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQi7 D$ }+$x)t6u,WQARjP7 l$}<$)s8O^_[]ÍSoU֍TPQhR4KU͍oUTPQhR4렍8VL$$VՍTPQhRf4L$;SWV[lZt$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SUTPQhRj36UUTPQhR@3)뒐SWV[LYt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1SUTPQhWR'2UUTPQhXR1VL$t"T$ tփuQ^ÐUSWVP[W|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP2 D$$L$(l$0O}^_[]ÍUU$TPQhR0T$L$8D$4VUUUՍTPQhR_0\SWV[lV|$L$1uLwt?;t$w6)w*t$uQRjQ1 ^_[ÐSWV[Ut$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [T|$$D$(t9D$ L$,ň̍VL$VL$T $t4EtM9wEM )9w+8t;9rt$t$ht$ -d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[St$|$D$VPt$  ^_[ffffffS[ÎSjjt$t$t$t$:[ffS[^Sjt$ t$ t$ t$ t$ t$ [ÐUSWV[SD$$$$$ $$$fzt$pPQj V4ID$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6,'t&6P}&FgPVQ\Z D$@t%8+ hPV $0$$OPQ#tO9xuJ.P}$ $$6`L$U$$$t$%D$;$?Ĕ^_[]ÍVVUVPQjiR*$VVUVPQjjR*$VVUVPQjkR*VUVPQjlRc*ƍVXUVPQhzR:*D$VXUVPQh{R *D$(ƍXUVPQh|R)zX$T$@PhQRW<$D$Pjjj:tD$PjjjxkD$Exit$蓜t t$ 胜jjWy t$XXWPQfW XY XYPQxt$ jt$xjjyX&YPQ%j,t$›ujjx*jt$~xt$莛t$ 肛yX/Yu^$puSP$0uP$$u6$@$8j1,$X?YpQRj/V~tDžto]jPQ $t$u5Hygyj$$2$PQWV ^j$$1$PWVf8]Lj/Vt3j$PQV,XOYVPQE j+USWVh[ãLE$dL$$|$$t$.D$LD$PD$TD$HL$8D$HQPj; l$$D$ WD$$D$ D$l$%XP9mjuD$PQ DžxL$:$u =1 uL$>͍ >T$1ҍ|1 -9si$:WU;L$s>t 9sE.9r9s34$Wh9s맋 $|1 9s$=1 ^_[]fffffUSWV[-t$|$pUl8PPWVwEUL^_[]fSWV[ì-t$ W!PPV W^_[ffffUSWV[X-t$tLD$F$V~nF<}1 PUWRt$t$QjV#$^_[]ÍZWZPQj3R듐USWV[,|$,L$T$ |$l$捃ZUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]ÍZWZPQjBR[USWVH[+l$`D$ D$D|$\SrE$MUu}mZUWVRQt$PjD$JP/"$$ZPQ&jjjjPvoƍ+0 VjjjjW>oƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$kƅbt$$V$L|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$rD$$LD$ AD$AD$AD$AD$AW$L/D$(PlM[L$QL$ Qt$($TPt$hh@Vp 1lj,$t$\hVWo Ņ~UVD$ P> %0Wp0,$xj$uj!Sƅth$\L$QPjG1\F LFuF E;$lu5p^_[]1㍃x[o[,[PQjNRGUSWVl[Ø"$D$h$Ud=$$U= uj!MƅtXD$XUPkF1LXF LFuF ;D$hu2l^_[]1ꍃ[[,[PQjhRJQS[î!t$ t$ v[ÐS[Î!t$ t$ V[ÐSV[m![1 jPV- D$ jVPj Y^[fD$ȉty!fUSWV[ t$0l$,D$tjuj)حƅtRUP1 F LFuF(;D$u6^_[]1ꍃf[[[PQjFR/urޡUSWV[% $ $$P'h@V9l1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$?k ƅ~.V$P$P |) u84$l8|$$uj)ʫƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1ؠßS[jjjjt$t$[ÐUSWVt[$D$p$U$$U= uj)蝪ƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃ[[[PQhRG螞fffffffUSWV\[|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í\\[PQhRy\\[PQhR$HffffUSWV[Ø t$0l$,D$tjuj)xƅtRUP1 F LFuF(;D$u6^_[]1ꍃf[\\PQjFRur~USWV[$ $$Ph@VT1$|$$ $ u#D$P|$WbP|$`l$d$$ʃ|&jQPt$ 9|=P$Pt$S ƅ~.V$P$P` |) uC84$T18|$$uj)jƅ~$$QP1F LFuF(4$W T|$;$u^_[]1xcS[þjjjjt$t$[ÐUSWVt[È$D$p$U$$U uj)=ƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃ[\\PQhRG>fffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Jt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP蜷 ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [X|$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jWb ;D$u ^_[]offfffL$$Yai qyD$A(tQS[(RjjC9 [1ÐT$D$ Zbj rz $z(t RPS[jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[CRjj^8 [1ÐT$D$ Zbj rz $RPS[jRj8 [Xt@ffffffSP[D$ L$T$$RQPn[fffS[Þjjt$jt7[fffffffS[njt$t$jb|[ÐS[>ht$t$j/|[fffffUSWV [t$ D$D$$|$jjUVjW蚠1D$D$ $jjUPjWcD$D$$jjUPjW,D$D$$jjUWjPu8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjRi1u ^_[]ÃtOw OsҍH}4]]PQj81^_[ffUSWVh[s} 5 uj'NX5 D$Pj5 L$@B1lj1L$ED$$1Mt$ƉqD$PjOxx5 L$@B1lj1L$EHD$$1t$ƋEp jPvu(5 L$@B1lj14$e^_[]Í]{]PQjHR5 USWV[l$>jPUZu u @t tQUXu]jPUu t 1^_[]ÍujPVt DžtDjPVt 1uú!?E1u<-ut<+u\MDHt$}D$j PW{` L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ¾L$?w5t<t#΃? ?9tA|t^1^fffffVY^T$r1>w ^ffffSWV[)t$(WjV xqN|$,t?r$d$D?r'- d$!L$jWVJ ^_[fffffffSWVP[{t$tB$5 PQhRx>L$ $´5 )QVWR05 PQhR5 = t@= ^_[fffUSWV[t$D$D$I@t NQw Dى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í]]]PQjbRsUSWVX[xD$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í ^^]PQhtRSWV[|$t$t5$D$ WVjjjP跍1Ƀىȃ^_[Í}^^%^PQj:R葲ffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tP)rjt4)0sD$(8rl$ ugPt$Yŋ$t$bֵ0rD$8tP(Ws4$&#t$#蒵01UPt$ŋD$G6"oD$ G = = D$8tP(G^_[]Í^k^PQhR@^k^PQhRT$(#I93á]LjUPQRV?jUUSWV׉L$[2jeVj+Vt-1 |$WjPj%eyFu<$|$1jrVAt?b $UW`ft1jOau%07\!wQ!ɳ01^_[]ÐUSWV׉[= tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[Xt$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$ŋ$t$]p0D$8tP9%W1p4$t$101UPt$葞ŋD$G6oD$ G = = D$8tP$G^_[]Í^k^PQhR߫^k^PQhR赫t$,|$(T$0VWU jUSWV[Øt$8$8tP#= t9ut>mt9uu+$8tP#԰h1V蟠Eu= $8tPy#|$jWu U ƃu v8tULntt$^_[]Í^^k^PQhRffffffffUSWVH[hD$`|$\t$$UVPWWtUVt$aǃu.Ư8uj@~;$} VPaǍD$9tLVpmA$jD$Pft&UPt$hWV{D$$oH^_[]Éƍ_^^PQj>RQfffUSWV4[XD$\l$HSt$XoL$`u0t u6ut덻(tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0KL$ VR 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$蹛Ń|$jt$ RU蜛|$tUjt$ RP腛|$t>jt$ RPnl$t%jt$ RPUtjt$ RP@T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQwщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WP!Ɖр|$ul$э[_4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0z0赚L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$yzL$,T$$ Qf_4$Qt$(V0WRUt$h$[4$|$2jjdQUјыT$,t$$r[_4$Rt$(QPVt$dVt$d 9wijt$ QRtщ9|$}T$ 4$T$\jt$ QR?щ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRݗщ9}T$ 4$T$\ijt$ QR謗D$ ы4$T$\BJ_PQj8R订D$lP__PQj9R膢mfffffffUSWV[Å$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]Í<`ύ_s_PQhRm>USWV։[q$$F t%G HO =r,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQx D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Í<`_s_PQhR蜝[__s_PQhRr4__s_PQhRKUSWVT׉XQ$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVMLuD$t @ t$?D$ h |$t$(${PVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPOL)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtPYt$FPzYF^_[]Í__s_PQhR蕕USWVYT$tht$1BtBظkw+DtրztЃːt *u1^_[]ÐUSWV։[]F,F tv芚FUPRl$~D$uNtQjP聖D$ L$$t$ F1퐐f$t=tsAuE @u1$P-$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu׏$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=Y_`s_PQhERنM lt$10脌D$/ Njt$$E @D$uPPUu 78t E u;$6Ĥ^_[]ÉNjt$몍_2`s_PQhR`2`s_PQhR|<`2`s_PQhRÅ$c8`2`s_PQhR蕅O_2`s_PQhRn7_`s_PQhERGL$ _L`s_PQh/RL$,USWV[T$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍}΍s_PQhRV`΍s_PQhR蕂T$8b`΍s_PQhRcT$8ffUSWV[e$$c$$tuӇ1D$$tŋD$3l$ 11h@P4D$(D$$D$ iL$L$\QPctYD$|$D$0t$\ d$<0fD$PPjuP] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPvPWu uh3D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P` (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$`jPv? u|$1D$Wt$B;Ƌ$6yd$t$\D$|Ay DAD$$uD$*\ՋD$DJtDHD$D$ $@uP \ DAթD$`jPD$p)NjPD$p D$ |$t$ztG$`L$tZ`jPq@jPD$p /1ҋ$t`jPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8̀< 貀Y1D$ D$l$t)萀D$D$\PjuV |$n8|$ $%|$tcjPu^ |$t&/D$u|$8|$ $tt$Dtu VL~t$jl$ U| 1$u U=;$uEČ^_[]Ë|$|$[|```PQj_RyyQ!S[îjhjt$t$t$[ÐSWV[|= t-= jhjVPt$$t8= 0jF3= = tP%,= u^_[ffUSWV[|$= jjj` = l$= tUQ= 3 = t]1i = 9= wHt Q< = Wk+= t$UWP؟ = u 1T$ Ɖ^_[]Íaa`PQj= ^_[]ffSV[= u*ǃ> H1PV= tt> )VPA1^[ÐSV[íǃ> = tPX9H1PV{= u)VP1^[ÐUSWV [5$ǃ> ǃ> ǃ> ǃ > ǃ> ǃ> ǃ> > = hhU蹠D$ 1Ʌ$t$L$d $t$ > L$l$<ǃ> = hhUPD$ > t$P*gj\WVO t8t剃> 8#tj\WVWO t8t뉃> j\WV7O t8t뉃> j\WVO 68t牃 > ǃ> ǃ> j\WVN tD8tP5> j\WVN t8tP> h > |$$W" |$j\PD$ P]N ǀ8tWfu͍tUWPhth.UW E5xxMf l$<$j\WVwM 8t牃> 8#j\t$VDM t8t艃> j\t$V$M tOǀ8t扻> 'PW#g" > PWgtbt` > D$H1;b> PQ{ > l$tэ'QPfu> <$j\WVWL t8<$tP> j\WV'L X8<$tP~> t$t$1ɋ;$u ȁ ^_[]SWV[\t$ǃ> = t P&H1PW#= t*t+V> {eu䍃> )WPO 1^_[Í}%baPQhRmZSWV[Ìt$ǃ> = t P+&H1PWS= t*t+V> du䍃> )WP 1^_[Í}0baPQhRlZS[þ= tP3bǃ= [ffS[ÎL$T$ j@t$[ÐUSWV8[Vt$PT$$t$,ZT$L\D$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$"l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11PH'U?';$ u,D$$^_[]D$ʋ4$t$ l$1 USWV$[U$ jj$H$DtDžtu!h1Ƀ8-ىL$m|$dWD$KWP$H$DD$&h|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$H;D$$~UP l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11P%U%;$ u,D$$^_[]D$ʋ4$t$ l$1USWV$[%$ jj$H$D$Džtu!f1Ƀ8-ىL$m|$dWD$KWP$H$DD$&h|$4$l$t$ D$1t$ D$,8hUPVl$D, jjV$L$H;D$$~UPl$|$UPV$LV$HFPt$VW$L$L^9u`|$D$ǃ;|$.$D$?11P"U";$ u,D$$^_[]D$ʋ4$t$ l$1USWV[l|$l$t+PWUD uuuڸ^_[]ÐUSWV[Ûl|$l$t+PWU uu.uڸ^_[]ÐUSWV[;l|$l$t+PWU uuuڸ^_[]ffffffS[ރ0t$t$ [ffffUSWV [á} F FEFUVzRu)ʃԉF:FJFx9uRu5N ;Nue^_[]USWV [} F FEFUVzRu)ʃԉF:FJFx9uFpRu_{ N ;Nue^_[]ffSVP[LD$L$T$t$4$VRQPffSP[D$ L$T$$RQP JfffffSP[D$ L$T$$RQP;JfffffYT$t :t81ÐUSWV<[Èt$PD$D$88VPQ`  B hjD$P] (B D$ $7B D$ t:t|tD$ 9r8B _PQt$q knGSV[kK tFK PjtsK 4+K 4K K R ^[ËK HK jjjhjPj1tȉK uj$Pj> jHS[^jD$K );K t P[à QP[ÐS[jjPKK uP>k[ffffS[ilPt$t$t$ [ÐUSWV8[àiuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y\DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P7Pt$t$= ZD$x$W7Pt$W @D$x$Wg7Pt$W )D$x $W<7Pt$W D$x$W7Pt$W uD$x$W6Pt$Wf zD$x$W6Pt$W; `D$x$W6Pt$W <D$x $We6Pt$W D$x$$W:6Pt$W D$x($W6Pt$W D$x,$W5Pt$Wd 1D$D$$T$EHL$D$D$D$ P5Pt$t$ D$@D$ PO5Pt$t$  D$@D$ P5Pt$t$  D$@ D$ P4Pt$t$j  D$@D$ P4Pt$t$9 D$@D$ P4Pt$t$ D$@D$PZ4Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ McD$ Vc|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$_c|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ Vr-D$Pt$V ID$ VC-D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$lQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$@A(|$€´|dddPQjIRh!USWV[{Gl$L$t*t$1Ґtuщ )4@tRjP # ^_[]fffffffUSWV[Ft$$|$(9jVPƿWLjVt$, t$(\D$l$,L$ t-|$,RUT$bT$t .l$(RRl$(T$tX$|$  tQ`T$ <$l$jU}(t8U5E uEFt P9F tT~tE1t(0F t(( F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]ÍPfePQjKR?effePQjMR?efffffffSWV[Ü<t$DWL PVnW^_[ÐSV[]<DV֎L P'mV辎^[ÐSWV[<DW蕎L L PQmWt^_[fffffUSWV[;t$l$VvZVt$z[1u<$Vt$R[DžtpU7 t]wtуUP t u막t$~utQ ^_[]É1ԍ}vf8fPQj1(\DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsfgfPQhRV 0gg֍fPQhR- USWV [81L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2$gfPQhR  ^_[]Ël$ u렍΍$gfPQhR ΍$gfPQhRy S[~/t$t$jt$ [ÐS[N/jt$jt$[ÐS[/jt$t$t$[fffffUSWV[.pL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉtL uj(}ƉDl$Utwn$Nj 0Q 1L utjh=ʼnpL 0ƃL LtMjуtL @1t*n$F UQj Pa$|$z^_[]ËtL )USWV[{-xL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉ|L uj( ƉDl$Utwn$Nj 0Q謸 1L utjhpʼnxL 0ƃL LtMjу|L @1t*n$F UQj P"|$z^_[]Ë|L )USWVP[ ,l$UNjL $tOs;1҉vL ljh=mL $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$|t0tL tuR:t!jуtL tiE$StL uj(螷ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[*l$UNjL $tOs;1҉vL ljh}L $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0|L tuR:t!jу|L tiE$S|L uj(讵ŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[+(t$|$ tЋpL t61=tDtPXǃpL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃtL D$ 1^_[]ÐUSWV['t$|$ tЋxL t61tDtPHǃxL D$L$ƃL L t?1tDtPǃL D$L$ƃL ǃ|L D$ 1^_[]ffffffUSWV[&$tA$1uhƅtcD$E/$tt$$9ux/Ĕ^_[]Z?$9u/8(>?USWV[K#t$tD$tdPV$xaa1ɐ΍,?UQt&UP$y.w8"tVb w1^_[]ffffUSWV[ë"t$V^L P芯L ƃL \ tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PWǃL ǃL 1V ^_[]ÐUSWV[Ë!|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]ÍJllPQhR]lllPQhR6USWVP[Ê |$t$t#l$ t?tajUjW^_[]ÍJllPQhR빍lllPQhRu}llPQhRxUSWVP[$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh׫$p $L$1xjjjU|$ `UmPQhl$XU jjjh@Ujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$}llPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP.T$ )ʼnl$‰$L$\$(l$$|$ t t$it$,D$l$ tEF4$AhD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$9؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUٱ5))\$ )D$Ɖ$T$<*)׉ڋ\$QVP^ Wt$DUP t$$t$ t$0 /L$0\$|$8T$L$ D$ɋ,$tt$T$lfT$Ћt$ 9v8)PU|$u(U蚶|$ |$L$1|${04$Ri0rL P该KL PL L$ <$14$$lyD$0P |$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xWƤt_WVPg UUx~1L$ ȉŋD$8L$D$8B\$W |$ t$dUU |$;$LP^_[]0WHlL$lՍlPQhRL$,8ImL$lՍlPQhRꋴ$tL$,lL$|$lՍlPQh RU|$L$,}L$|$lՍlPQh R$|$L$,Ń|$ \$t t$;c4$葳}llPQhR$|}[mlPQhR$|Y\$U&|$ t\$t$b\$t$0X_L$ÐSWV[<t$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍJllPQhR}}llPQhR[VSWV[l|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[ÍJllPQhRulllPQhRpS[þL tP3ǃL ǃL ƃL ƃL 1[ÐUSWV[e$,E$$$(L uL ȋL u!Q0 L L t%1L L PQ1t $D$uz1L VMVǃL L HL @MQPB L u<\1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$V` tfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$VmǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL SmlPQhR]$<ElmlPQhR,$<ؐUSWV _(T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdlXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWfƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPUޤtL$(U$WZ ^_[]ÍJ m֍l$PQhRs|$l m֍l$PQhR>|$|$(S m֍l$PQhR|$&Jl֍l$PQhR$ll֍lPQhRUSWVY T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdt]ƃdNJD$$ƹdEt#<:tu)FdPW莢u`)nu% N$UW]t1L$$8$m*mlPQh`R$W賧^_[]ÍJ*m֋$l$PQh"RL$Vl*m֋$l$PQh#RL$|$$&*m֋$l$PQh$RVL$Jl֋$l$PQhR$ll֍lPQhRUSWV[l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPj F(N8D} '~wF^ FPB^ uWv$R tƒN ~?:V|@uH)ƒVԋ^ ]LFF$BBQWP菷 uvv^Q K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 蜅S[0t$t$ [ffUSWV [ñ} F FEFUVzRu)ʃԉF:FJFx9u0RuP N ;Nue^_[]賄fUSWV0[D$(}\PQFXL t$M L$ML$f|$ L$T$|$QRj WP'BuOt$ rF|$j WP^ u0O L$FD$D$ PjL$Q袵 79_t$} urP tgM9uWM % mBQPR}Wu19r"y";L$(L xjjP@ PVJD$t$L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPuֳ 1ɋt$;D$(u ȍe^_[]FS[ÞmjP;L Jh P>P [SV[]L hVt$t$t$%t1^[fffSV0[t$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[,t$|$jW1j VWU) jW(^_[fffffffSWV[t$|$t PnPQ ~^_[ÐSV[Ít$ tPFtP}FFFtP}FF^[ÐUSWV[|$(?u nPQt$$oD$t UW}jjjj|$87#Gʼnt$Ptqt< t< tt$WHqt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P-E D$ 聾L$ v8ukD$ $FD$,t$UpmŃzAA jj t$D 8 8tq0|$(tPϭ$tP{GGGtP{GG製01^_[]Ë$fffffUSWVP[l$t$D$ $ t t@u$Ao-onPQj8RZ@QUVwЃt 0$^_[]ÐUSWVP[:l$t$l$ t t@u$Ao-onPQj8Rȶ@QUVwЃt x0$^_[]ÐUSWVP[êt$ l$T$D$$$ t t@$u0ouoՍnPQjpR2t$0@$QVURwЃt ٻ0$^_[]ÐUSWVP[ t$ l$T$l$ t t@$u0ouoՍnPQjpR萵t$0@$QVURwЃt 70$^_[]ÐUSWVP[jt$ l$T$D$$$ t t@(u0ooՍnPQjyRt$0@(QVURwЃt 虺0$^_[]ÐUSWVP[t$ l$T$l$ t t@(u0ooՍnPQjyRPt$0@(QVURwЃt 0$^_[]ÐUSWVP[*t$ l$T$D$$$ t t@4u3$p pՍnPQhR诳t$0@4QVURwЃt V0$^_[]ÐUSWVP[Êt$ l$T$l$ t t@4u3$p pՍnPQhR t$0@4QVURwЃt 贸0$^_[]ÐUSWV[t$,|$0*T$>t .$ tEt@u%ppnPQjJRVE@NT$RQjjjuЃ>T$u-TqGq[pPQj[RT$,$ t|$ tEtHHu0qp׍nPQhR踱|$0EHHPVt$0t$0WRUуt Z0$^_[]Ípp[pPQj}RaS[nlPt$t$t$t$t$S[ÐUSWVP[*l$t$D$ $ t t@8u'qrqnPQhR跰@8QUVwЃt g0$^_[]ÐUSWVP[Úl$t$l$ t t@8u'qrqnPQhR%@8QUVwЃt յ0$^_[]ffffUSWV[ t$l$3$PQWz t"t$ VW WjjPԁU#'PQW: t$fffffffS[~jt$t$t$P [fffffUSWV[Hl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~VUSWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPjD$tk|$jWjD$,D$ tND$1ɅujWjt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWGx9!xt19)u|$T$(l$);$Pw|$$XD$0P螢ƃjPitQ$1 T$|$$T@uX$L$0PVQW?t5W蛅D$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ B‹D$$t $uCr.蠯|$茯1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4Vy DžL$~9t/;$WVQL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j|$l$t$D$Pjt$ jUjVjl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$.jt$ "jt$j넍CrqqPQhR葥7rqqPQhRr]rqqPQhRSqqՍqPQhR`rqՍqPQhR跥ꋌ$hR'rqՍqPQhR腥2prqqPQhR謤rqqPQhR荤LUSWV[HD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]{LUSWV[l$ |$t$t Vz1L$1jUWPV^_[]ÐUSWV[{l$$|$ t$t V*1L$T$jUWPVp^_[]ÐS[.L$1jt$t$t$t$6[ÐS[L$T$ jt$ t$ t$ t$ [ÐS[þL$T$ t$ t$ t$ t$ t$ [ÐUSWV[xL$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]JUSWV[D$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[])JUSWV[{|$t$t V.10L$1jUWPVp^_[]ÐUSWV[+|$ t$t Vޗ10L$T$jUWPV^_[]ÐUSWV[|$t$t W舗101jUt$$PW^_[]ÐS[Î0L$1jPt$t$t$[ÐS[N0L$T$ jPt$ t$ t$ Q[ÐS[0L$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WxuGكs^_[!t_t$t%<FF ^_[ÐUSWV[K|$ u ^_[]l$ t$Wxt t- t(Wxt$WP u뵃!}/=<XFXF ^_[]Ã=t̃~~ŐUSWV[Ø|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MV]vt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉv$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/\DPg%0W$\P$D$4@uW uu#\DxuGws>4$$^_[]ËD$4  !rfUS [UE$D$D$D$PQD$e[]fffffS[t$ t$ [ÐUSWV[$$%= uRl$l4$Nƅt1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHlG D$ D$4L$ $Љj0)t9D$"D$ <u !G OJD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw PO<ōG UTD$t1 .YMPNQPT$ Rb u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRvF4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$踉1єsrPQh1R較D$u‹.x1F)EHftf },$FtpPGu|$t$u N)$xDuW@8/tOF(uIjh@P tFFU$U@<$u~yljF^_[]FUSWV[ۨt$tf8}t v$D>V }t!v$"v$v$ FVFW^_[]Ís|sFsPQjBR&vfffffffS [+lPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[þL$T$ lP[ÐUSWV ׉[ÄT$4xtbq=t= T$4t=uD T$41L$L$ L$L$ D$l$ L$RPQUWV-=u蔆"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[nL$T$ t$[ffffff̀rS[4t[̀rS[t[ ̀rS[t[SWV[ܥ|$t$t-9t!t F9u1^_[ÍssPQj*R\fffSWV[l|$t$tt1WVv^_[Íd tsPQjBRuύd tsPQjCR~뮐SWV[|$t$tt1WVZv^_[Íd tsPQjBR~uύd tsPQjCRd~fffffffS[nL$T$ lPt$ [ÐUSWV(T$ [2L$<\$%t$@|$t;D$<|$"v+覃1t$ \$VPo\$u<+t<-t D$1 1ҊD$L$@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[Ԙt[USWVTXD$|$tt$ht&L$ptCwm\$7x\$'utPQjxR7r뵋\$~'utPQjyRr$vl$l1 D$͉L$4A\$P%gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$~XtPQh&RpV\$4uXtPQh'VoXBuPQhrVt$xo$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPS  \$R'1T^_[]Ë\$~ButPQhsR4c$\$~ButPQhsRc$LUSWVTXD$ L$pT$htwL\$ h ֋\$ 'utPQjxRb$vl$l1 ШD$ʼnD$4֋\$ Pw:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ 4uXtPQh'V`XBuPQhrVt$x`$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Q1T^_[]fffUSWVP[z|$88tqw$HG$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$ojUTƅtF PVW) u$>*jU!t@ PVW) 1*V8t uVV $tD$ 81^_[]fff̀rS[4vt[ḃ̀rS[vt[SWV [ut$ |$t[D$D$4$zU0L$jjPWjQ*1uSU9 u BU01 ^_[Í}uuPQj񐐐9t uD$))t8t)Pt u+D$ PB^_[]Ív8vPQj@RLD$(Sv8vPQjARWLD$(7fffffSV[]rL$D$T$ y9vRVQP Q6Q4P 1^[ÐS[qD$y%9vP PQj@RP P j@4R P [fUSWV[Ûqt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JdvvPQj?RJ눍dvvPQj@RJq1^_[]fffffffK̀rS[pt[USWV [èpt$ ̠D$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV]n|$0||$4̠D$PVt)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$^_[]ÍWwLwvPQhYRF[USWV[(lt$D$.̉)ō̠$Pst)1ҋPL`t14$D$^_[]ÍWwiwvPQhR EUSWVP[k̠W蓽tI010$9r$9r$i0mNA900W^_[]ÐS[~jt$t$t$b [ÐS[Njt$[ffSWV[,j|$t5jWt ctVW(1^_[Í}wswPQjARC몐USWV[ûil$t{jUt=ǾtUWUt1l$UPt$ L "19s#IH8^_[]Í}wswPQjVRBaffffSWV[h|$1t,mPWzt |$t=t=tƉ^_[ÐSWV[ìht$t-VW tPW V^_[ÍwwwPQhR-B믐SWV[t41 |t$t$ t$ W8 uD$ <=u.|$$ Q 9ttD$0Q M9u;Q s|9v9tfPOǃQ ǃQ $jWP ;F04F8uyPD$0t$s )$jWP E0E8u4)  $PjQ B $Q L$Q ^_[]ÐUSWV[eQ tQ 1t0DtPVtQ Hى|$jjD$P tE t5jVt$ F:Q tVt$VŋD$Q 9tPǃQ ǃQ Q UjP@ ^_[]ÐUSWV[d81tR/tL,t4t$t$UX5 uD$|=uօt D$1^_[]ÐUSWVP[Jd|$1|mPWtfƀ<=t^tR)tI1 $ $lt+Vt$U4 u|5=uمxD$8.1^_[]ÐSV[ÝcP薷ƅt(C0^[ÐSV[]cPVƅtB0^[ÐSV[cPƅtB0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[zbD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[bD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[ØaD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[aL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[X^T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVMtGPVܓtۍGPV+tʍG PVtWV 묍xz_yPQhRmSz_yPQhRFUSWV[?t$|$Gt/uTot^REwnt1o  u-GFGFFnFn GFG    Sz_yPQh$R+zz_yPQh%Rt+zBz_yPQh RMGFGF^_[]Í+z9z_yPQhR S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[d=t[v̀rS[D=t[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[Û<|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1dzKzPQj:R]zzKzPQj;RVAUSWV4[å;$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFzl$0PQjU!1UH $\9ȋ$QU$`- FfNQPR$`U$`01Ʌ9$Fx$P$T)zPURQw0*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LQPR$`$`/l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$0{PQ|$W$`Uu.t;$Tg$P$T)D$D "P|$Wt$L$QR".L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$Rw-L$r)D$hD Pt$t$t$R>-L$9)D$/DPt$t$t$R-L$)D$DPt$t$t$W,19D$F$PED$1$10D$ "D${D$׋D$ tD$ $ 1QPt$t$UI,H)D$>Ń19t$un 1f$PL$$T)fv fD$ zVQURt$+L$ ;$T$T$0L$RQPWt(8W$\9vpD$0Pe;fǍz$0PQhWC+Wj$\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGzT$ PQhRx&= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Í zzPQhR2 (WzzPQhR $$bVzzPQhR;苰fffffUSWV[.$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPKt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t菮fffffff̀rS[,t[USWVP[ú,PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf 8^_[]ffffffSWV[,|$t.jW!G=tjW^_[ÍwD{{PQj@RfffffX+L$rÐSWV[|+t$u8}{L{PQhrR*VtF~tP^_[ÐUSWV[+$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$~~L{PQhcR?F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$0JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RYNjD$$fxxt$ T$@>PL]fD$>P8]fD$>P$] f|$fD$f|$"D$<$$!|$hVWt$8RXgD$D$$fxxVT$@HVNjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$HVWP$Pj%V΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WM~Pt$t$t$DQ$Pj%襮T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FP ZfD$FPYfD$h$!Pt$ Vt$8WUfNjD$$fx$!xV^VAV=*h L$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$ht@\L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V3L$tL$8$tYt$`~l$(u2D$4t$%Ut QtFUt$`)L$8uBffU01l$(E;$%b%^_[]QypUǍ}΍}׍L{PQhR}΍}׍L{PQhRc$%]}΍}׍L{PQhR+.W΍}׍L{PQhR$% }ύ}L{PQhR$%~ύ}L{PQhR$%MT4qWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[|$F$ jP蚅Ņtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$Pr ^_[]Í};~L{PQhR@B~;~L{PQhR|$(W;~L{PQhRUSWVT[1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$QKtL$t$ t$~e t tt,…tt$ P~u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RoT$GtItu܍}L{PQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1u~j~ύL{PUhh RA}j~ύL{PUhi R~USWV T$[L$8D$ l$4"t$@jV1]F1t 1Ƀt @u\1<$L$D$ Pl$ U,1~PU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ PQ 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UlGt!D$881<$;D$ ^_[]ýW軆t‹GwtP袆܍}͍~L{PQhRW͍~L{PQhR}~L{PQhRt}L{PQhRMifffUSWV([E$H$<$$E UPM 1U4$Um$DUtڋ$D0W+t4$DptPW tu뗐$@tP$Hp ոj$DWH1$@T$t.$@öT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$a4&t$$DP藙 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$uAT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$@T$L$ ut$t$$LU}`#PQhRffSV[t$ t,FF#EgFFܺF vT2^[Íy\qPQhR밐USWV[Èt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ! L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPÖ^_[]Íy\qPQhRlqPQhREUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [ø|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWζ ;D$uY ^_[]Í\qPQhR茴y\qPQhRb\ffSP[mPt$1Ƀ $ȃ[ÐUSWV$Y8t$8D$D$ L$\1DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RUWjP蠤 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-{ Pt$l$ U{ t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjR薢T$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rhy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$yT$ L$E E$\$l$TU_c/4$ULc$L$$9sD$DQ+c1ɉȃ0^_[]D$D捃JPQj]RAW\$萡SV[Mt$ t Vb^[ÍvJPQh/RfffffUSWV|[j$/1tGljPWڀt)l$XD$\|+WQ W1|^_[]jjWjjUjFWt҃>D$ l$<$D$ƅuUW뚐USWV [|$$(rl$ NBCD3EB 3M t虣1 ^_[]Ë|$,jF0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj[=F4~F:F:t1F;pS[Nt$t$&[ÐD$@ ÐSWV[T$|$9W v#wG,ʃt$<u0 Ћ0茠L  )r;GvQD$Ot$1^_[ÐUSWV[ht$,~$ED$\$Pv(t$Q 9quJi$'qD$D$4$9\t$2D$<$8L$HL$D$ l$D$$$$`$ttl$$;%`t %)l$ &$D$D$et$L D$0Fvt"l$ /$D$D$dt$L D$0vt"l$ 3$D$D$dt$L D$0ut"l$ 7$D$D$@dt$L D$0ut"l$ ;$D$D$dt$L D$0Fut"l$ ?$D$D$ct$L D$0ut"l$ C$D$D$ct$L D$0tt"l$ G$D$D$@ct$L D$0t$t"l$ K$D$D$b`t謆|$4t؊"L$DL$ D$OD$,$t0dƁ Ot yI u2D$4$D$E5L$@L$ D$Xl$$$记Ɓ Ot yI u2D$4$D$4L$6و.&Ȉ^_[ÐSWV[Ü|$xuƁYjVWu yzWPVr$ ^_[ÐUSWV4[H$D$0D$IuD$HL$j.QPjT$PQj.jR_y$tEL$PQVP D.0;D$0u 4^_[]S&USWV([èt$L$-uAD$QD$ +tD$ +u AD$Q\x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$\8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$Ӊ֍PQhRvpːUSWV[s}PfD$|$D$ D$PKlHHPP0ppp RQWjV譌$r D$ƀe^_[]USWVP[l$2PU^EBPUFaPU.PUgPUnPUPU΃zjPU# 1uR\MDHt?tj PU t8u$8 L$A.&L$0t9^_[]ÐUSWVP[Zl$ZPU蹂txF u6jPUg" 1u[\MDHtHsj PUҕ xs8u $8 6D$t8^_[]fffffffSWV[||$t$jWLGHO~;G~ t H WRYjWLN^_[ÐSWV[ T$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[ù|$(D$$u$PcbD$D$D$D$ jWKG0u ǀD$PW>?jWqM^_[ffSWV[,aHt Jt @t A ?t/t5GtU\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$D$E0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4sKjD$E4D$ Cf U0}4D$u0}4WVu`Z C)ljD$ s2\$L$jQjhRD$(D$ Ɖu0}4\$uuE$+PWQjdjV8^9E4BPVu0< E49s)\$jQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$D$ E0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4snhD$E4D$E0A\$Af E4w-\$jQjhR\$E4M0QU0E4A E= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W\9E4@PWu0: E49s%jQjhRE4M01U0)E41E4u0} MU }$"u D$ E HM HL$HM xQƃE t$ HkV|$Wt$PQjdj$$+W2[ 9E4?PWu09 E49s%jQjhRE4M01U0)E41u;D$ !u <E PxPL$ Qjdj$+WZ9E4B?PWu09 E49s%jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu08 E49s%jQjhRE4M01U0)E41u E PQjdj$+WY9E47>PWu0 8 E49s)\$jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$jQjhRE4M0QU0E4AD$X`/}$D\$u M QU Qqu It$K\$QRPVjdj$ +PX\$ 9E4<P$ +Pu06 E49s%jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-\$jQjhR\$E4M0QU0E4AXD$#M }4E0T$WP=;SE }4;E0 E4u)\$jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+W/V9E4:PWu04 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0;4 E49s%jQjhRE4M01U0)E41E E PE Pt$ jdj$+W+U9E49PWu03 E49s)\$jQjhRE4M01U0)E41M AE  L$<%\$AL$ L$L$L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$ST$T$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru E PQjdj$+W`R9E47PWu00 E49s)\$jQjhRE4M01U0)E41\$ E HM L$HM pQJE T$(|$$VPjdj$+WQ9E4H6PWu00 E49s)\$jQjhRE4M01U0)E41|$\$E AL$ L$L$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu09/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E PQjdj$+WO9E44PWu0q. E49s)\$jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)PQjdj$+W_K9E40PWu0) E49s)\$jQjhRE4M01U0)E41E E ;D$\$$+11k}$u4u0u j!}0WFƋE49s,\$jQjhRE4}0}0)E4 /\$u E E \$PM QU IT$y|$0\$QPVRj(jWJ\$ 9E4.PWu0( E49s)\$jQjhRE4M01U0)E41M t$)΍VUUUЃ=x E4\$8.M0ArintAto pA ong Aoo lArd trecoM0E4-E4u0} PVu,W%.-M ;L$-AE AE IL$1\$$+E ;|$8t1ɉ|$ ਀׉L$ PPQjdjVH9E4>-PQu0' E49s)\$jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$jQjhRE4M0QU0E4AE L$) \$PXE M4+U0B  ru0M4B\$ PQjdj$+PF9E4:+Ƌ\$P$ +Pu0% E49s)\$jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$PD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ L$L$$+р਀tsRPt$ jdjVD9E4g)PQu0:# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$7|$X\$PVQj2jWC\$9E4(PWu0l" E49s%jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$jQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+WA9E4&PWu0U  E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0 E49s)\$jQjhRE4M01U0)E41E E ;D$%L$AT$T$ T$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-\$jQjhR\$E4M0QU0E4Au 'E PxPL$ Qjdj$+Wz?9E4-$PWu0 E49s%jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0{ E49s%jQjhRE4M01U0)E41u E E PE E PE 4PWVQjdj$ +PC>}$u E E PE E PoE 4T$XPWVQj2jR=9E4"PWu0c E49s%jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W89E4!PWu0 E49s)\$jQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0k E49d\$jQjhRE46?D$E4D$W\$KL$D$L$L$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$W/\$9E4Pt$u0x E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  KL$D$L$L$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0? E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$9=}4E0)E4u)\$jQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W[19E4PWu0 E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0g E49s%jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$jQjhRE4M0QU0E4A ދg}4+E0-E4u)\$jQjhRE4M0QU0E4A}3}4E0 E4u)\$jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7$+t$$ +f@======2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +rz4|$7$+Rt$$+2|$7$+2z4|$7$ +r|$7$ +Rt$$ +DŽ$ +====2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +Rt$V$ +Ƅ$+=fDŽ$ +==2|$7$+2z4|$7$ +r|$7$ +rz t$>$ +rz4w|$7$ +r|$7$ +Rt$֜$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$KL$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$%\$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$\\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$KD$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$#9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u ηE M4 U0B  ru0M4B\$QVP"  ƋM49s)\$jQjhRE4M0L$M0)D$E4z|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P蒨PQjdj$+W%9E49 PWu0 E49s)\$jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj?}0W3 ƋE49s,\$jQjhRE4}0}0)E4E \$u4u0Pjև}0WƋE49s,\$jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$jQjhRE4M0QU0E4AD$Xw|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$KD$D$D$L$L$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0j E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u %E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$jQjhRE4M0L$M0)D$E4|$t)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u xE M4U0B  ru0M4B\$QVP\ {ƋM49s)\$jQjhRE4M0L$M0)D$E4|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u ǭE M4U0B  ru0M4B\$QVP ƋE49s)\$jQjhRE4M0M0)E4sf )E4w)\$jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$L$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$|&D$,;$p+u ȍe^_[]Ë\$?USWV [ÈFt$,|$(D$ .ʋ7l$Ut$Vt$40RQĦ‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s7%D$D$Q@(D$ 9s$jQjhR)))x ^_[]1))lj$|tPQhR뽐USWV Չ $[DT$8D$4 D$L$D$"u$jQjhR|$4QA$93<$779$xpD$D$D$ D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$jQjhRMQUA+<$-i"^"D$4L$D$ ^_[]ffffYBT$4D$#hlÐUSWV[KB|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v!(+t$^_[]ÐUSWVP[úA|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ } (^_[]E ffGftC,$RWסxǃ9w,$)xD$ hHGftf,$RW腡f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衠 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [8?|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.Q ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[è<|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U远x(ŃtߍE;$wMȉ;,$v [(+l$xD$$h,h,L$ H(ŋT$0PhRQuu苪U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0M(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X:\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jō PQhR|$  PQhR PQhZRgfffffffUSWV[k4D$$L$1w|$ u 00RPUWVt$(t$(QR. 7X3L$uÐX3L$w1USWVX3D$|$4t$01>0N xtNi|$|$8Z~D$D$\D$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$IMmPQj>R ;\$mPQj?Rl USWVP[z1t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]ÍčmPQjgRr 1fffffX0 s ÐS[^0 s ht$ PN [ffffÐ1ÐX0t ffffffUSWVX[/l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tPUD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$iD$lj|$)ƋT$ D$kD$p\ txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[,l$Uƃ;D$vS (`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[%,$$$hWP! x3l$hU$( xUWL1Ʌ;$u ȁ^_[]5ffSVP[Ì+L$t$D$T$ $xRQVP!x9rRQP ^[USWV[;+|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[û*|$t$l$tt$$PW%t/ ^_[]VW t W LJWVUF ͐SWV[<*t$|$jW1Ƀ PVW ^_[ÐUSWV[)|$tt$O#PW$tw 0l$VW/ t WRLJWVUM ^_[]ÐSWV[|)t$t5|$r#u#jV#tjV$F1^_[S[)D$tL$ ttu H1[[ÐSWV[(t$t_|$G?wST>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[<(t$tAjVq"t2|$jV"wsf~ 1^_[ffS['L$T$ lP[ÐUSWVT$0L$@[È'uD$\VvD$ P-ǃx\$D$t6Rg=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$\$T$P$L$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$gt$,PV1D D$,\$hPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[=t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[~D$ L$t9u[Í0"PQjpRiS[.D$ #L$t9u[Í0"PQjpRD$t&L$tu1u 1tÐS[ÞL$ D$Qss)ǀ[Ãuu ǀ[Í0"PQjpReS[.D$tL$ t 1[[ffUSWV[j 1tQ@@jjPj V(O8tE(W5(^_[]ÐSWVP[k|$tcOGQ9u0$jQPi 08t  G $GT$pw1^_[ÍNPQjZRySWV[t$tRtC|$t3~t-00~r4;~rPV^_[ÐUSWVP[Zt$t@F$t*.1tt$Vt 9<$u1^_[]ÍNPQhR뜐USWVP[T$J $Ћ*1|t$W2t94$u|$ l$tW E$F;$} $)Qtu<|uprP $كU|vx ux Pt&D$j.PWV!tl$t$x D$P賹L$QRPD$PWU $t!QLl$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j5D$0$Do4Vd4~PW|$t$8t$HQj%蝔T$T$@t$$P6Stt$6Pj%`$D$@9F f|$0u D$(8gt$|$u$L0V1ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WPT$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRYs l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V說=~ $!D$1$D$$1D$\$|$$Rx1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<Ĩ=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPX 4$ul$l$$T$8)ƒ)19s@Qu蹷1$X;$(,^_[]Ë$LnRPUՊ 1‰(}}֍ՐPQhRv}}T$$ՐPQhRIT$4z?|$4X聳USWVT[3$h>Wt1T$ T$G j(c¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vnhǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tBPWgt1ɀ8 L$L$D$D$L$ t WPStT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]Í8PQhR]8PQhRBKUSWV։[_~\LZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUt$T$ E ulD$;tM gE=t܉t$L$4QP{t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPH{L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR/[D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQZD$e ߋD$)D$Uyu E;D$U_otjU xİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q>ZE0EEEe jUw1뙋t$uyb)Eۍw,PQjGR/4,PQhRD$D$ D$NK,PQhRѕEtfffUSWV [ػt$@|$4u=>FD$FD$\$jt$8t1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$PQhRuG>PQhRۏdUSWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxRPQhRAu]RPQhRdSWV[,|$t$t:t\ttu FWVPFWV1^_[ÍxhPQhR蜎uhPQhRv뀐SWV[Ì|$t$t:t\ttu FWVPFWV1^_[ÍxrPQhRu~rPQhR֍뀐USWVP[|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxPQhRAuPQhRdUSWVP[*|$l$tStuEt8tu-$EQUPEQUt$1^_[]ÍxPQh%R职uPQh&R[dUSWVP[j|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxPQhER辋uєPQhFR蘋aUSWVP[ê|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxÔPQhdRuДÔPQheR؊aUSWVP[|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxܔPQhR>uܔPQhRaUSWVP[*|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]ÍxPQhR~uPQhRXaUSWVP[jt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Íx PQhR豈{f PQhR臈Tx͍>PQhR^4USWVP[jt$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]ÍxPQhR豇{fPQhR臇Tx͍RPQhR^4USWVP[j|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Íx PQhR豆{S PQhR臆TUSWVP[Ê|$l$tStuEt8tu-$EQUPEQUt$1^_[]Íx*PQhRua*PQh R軅dUSWV[˫|$T$tL$t )ŋt1tXuQBWQRP t?t=Gظ UQWP%BWQRP ttG@UQWP 1^_[]Íx4֍PQh*RFf4ՍPQh0R资L$(,USWV [øt$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u.u^[ÐS[Nt$t$t$t$t$J[ÐSV[t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[t$ t$ [ÐS[ޛD$t$ P[ÐS[ît$[ÐS[Ît$Z[ffYo ÐXOL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXȚ$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$JPQV ƍGэ}L$,|$ U(!Ћ$%W|$ƀހ:w7$Dw;t$b\Gn߃^rxo;l$1\,, $*0wkdT$Ɖ*t$i $*0wi (Ћ4$0Wm;|$Yȃ|$ U(!Ћ$JPQV xuD$ ƋL$$)QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$;w(^_[]Ë$wᐐS[^jt$t$t$[ÐUSWV([(|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ l0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[ÞL$T$ lPt$ [ÐUSWVT$[bɉ$t$4|$ |$0t=D$0|$ "v-d1T$VPP\$u+t-t$0u#D$ D$t$0t@D$u20u- 3 E})Elj4$|$t$(VbQ~6Wt$(V73 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2itL$L$ ) $^(D$(H @^_[]F @4$utD$t0ٍwPQj@RXD$,cUSWV[~t$l$|$ jW7WUVt$ jW9^_[]fffSWV[Ü~8 8tf4PQ Džu:j] t.P *GGG ^_[ÐS[~ PQ0[fffffSWV[}t$|$t]WV0 ^_[ffUSWV[ë}l$|$[$PQVx t"t$UV| VjjPt)W4'PQVw ^_[]fUSWV<[%}$T$PE$8FNt,$ @QP0,$NolȃFFD$$D$$Vj Pl1Ʌ,$t$ D$D$D$ D$PD$XǍ×t$8jWPhVr=hVl\D$t}ƍЗPVr\tGL$T$RQWЃ D$ t2L$t*tB,RjQPv-,$V D$;t P[D$ u QP<tj t$|$|$|$ |$|$l$l| |$||$|4 ,$t t$ jQP1Ct$YD$t*L$tt$t$уD$;t P&[E;$8u^ȁ<^_[]ÍʖPQh~R6T_ʖPQhR T8S[zD$ L$01h[ÐUSWV[yt$,INt@0&RQPWq~1!D$8D$ D$kD$ZD$J$ t$7q;~F4UqFDtt$qFDtu&u8tMt$ pFDt4$pFDtt$pFDXt$pGj o^_[]ÍʖPQhR9RUSWV[Kx|$ 11 t5D$0ft$ 9rԋ <.D5tDot-1t PD9tGGP,GT$JRWO|ʖPQhR9Q !1ɋ I `QP*t8 Il$u}ml|4 t  1^_[]ÐUSWV\[vL$||$x$+|$x8D$8tvkƉD$TW tgi9t uD$tL$HD$  D$ W9$u8; H u(!D$D$  D$ WgpD$PD$xD$Bu 76._^_[fff̀rS[Äpt[USWV[hp|$ P$D$l$$lt$L$T$(PVUWt$<9tO $+t$ O"1^_[]ÐUSWVP[ot$vO8$l$ L$T$$t$,PUVt$8=9t5^_[]Ã19tiF9udFqF9ulFyF9utFF9u|F뫐SV[TV1dPmVר^[ÐS[þT1dPw[?SV[ÍTV膨1 Vv^[USWV [VTP ɉ$tG$W$\$1=L$T ~5X $WP%\$uD$T u $hR\$ƉP tPj3t0jdždN-00|$~X hWPO P tܪتǃ @V҉t$>iFs0hFށdN$تt$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$تt,>-00t!t$t=J11ɋ\$+\F$ >-00u D$T ^_[]ÐSWV[QhRƅt(T$j!tV#:181^_[USWVP[xQD$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNP Ń=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[.Pt$[ÐS[Pt$jt$t$[ÐUSWV8[OM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+DH(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}jت[1+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$-1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[Lt$WѠ1dPH$ PjVP W蘠^_[ÐUSWV[kLl$t$W\T u1dPUjVP ;W ^_[]ÐUSWV[K|$t$UX uƃX Uӟ1Wj(t H(^_[]ÐSV[ÍKt$L$t$j'ttH(^[ÐSWV[D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ dUSWV4[øDL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(VmX uƃX VT#D$|$lL$jWjj'|$uL$jWjj~'|$t1ՉNjt$#0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[JC$P@T u1dPl$|$P tABR lP~;yQq|1)͋$P–^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[@UĔT u1dPl2|$t$P tWVP ƉU{^_[]ÐUSWV[C@D$D$fBt π?:t D?:u$,?/4$\$u(\$jW=\$ W?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pet59tx/ux.uHt/uэ|$H4$$," 4$\$h@ WEǍD$HhPW +&y \$n0\$WD$(WЋgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$躳USWV։[2tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR' $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i$QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $X#D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$7)jhUt$ !T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9$l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$ћL$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPI)jhUt$3U\$T1ڽT$\$jjdUR)jhUt$ޙt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ 1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4XlD$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[ûl$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]͘PQjFRq˜PQjGR|$$bK˜PQjHR>ffffUSWV[ûl$t$|$tU6^_[]Ína*PQhROʐUSWVP$[Ut$d U`t,j2tPx $Hp  17"  xuxt)txu8u밾UR`^_[]Ã듍z*PQhRqKUSWV[x d D$ P_   $ L$ L$ǐ|$$tD$$9G t GtO  tGwЃ GЋ 9t DžuZ u';|$r$;|$s<$$<$C<$1 t$ ^ u#t7W蹩u^_[]ÐSWV[ t$d Wy^"  xuxt&t xu8uj贘u $p@@  1W]^_[Íz*PQhR&IfffffffUSWV[% $$$$$tD$$DŽ$DŽ$ $$jP]$@jP]DŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^֙PQjPRn֙PQjQRqT $ ;$u ^_[]8S[Î lt$t$Pt$t$7[ÐSWVP[[ D$L$T$t$ 4$lVRWQP^_[ÐSWVP[ D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[t$}XjWE`HM`~;Ep~ t EXHMX WRjW^_[]ÐSWV[\L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[D$ L$ $XQPR[ÐSVP[D$L$T$$XRQPVD^[fffffUSWV[ÈT$(t$$|$ t&t"qTN @14$t8t$jR/L$0A uy$‰Ņ1@<$1qyQ0uE)ljuދt$$$)1t$ ƉACAAAjQw֍PQj=RCJ׍PQjQRՋ)v1WPV/ L$(9l$QhuC}T$RPV |$(Gy<)ЉAjQt$$jU$+D$1t$ Ɖ^_[]Í.PQhR[L$8AffffffSP[]D$ L$T$$RQP[[ÐSVP[,D$L$T$t$4$VRQPEB^[fffffffUSWVP[t$|$PVG1sht$t$ P x=|PQ+fF FfFfn vF$F,F(F $tjjjV^_[]ÍNPQj>R)ffffSWV[|$t%jWw jW^_[Íw̚PQj;RxfSWV[Ì|$WG;D$w+t$9w 9w9w 9wPWVY ^_[fffffSV[-D$;D$wt$ Pt$VɅ ^[謅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[t[USWV[t$F0u ǀFFF tVu"Vut) aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]ÍwӚPQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$P\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $P蔐D$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q辠,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPƒD$ƒ;T$,v$D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P\\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$w$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$w$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$w$PQhR=EL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$w$PQhR2U|$뉐|$UD$xT$ Ӌ$Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P|DE|$8E|$8|1 uT t$ 9wS$w닔@wl$Pmt t$T l$PU\ / U| 룋$L$19u $P7T<^_[]þUSWVP[ÈD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$肑USWV [6D$ 069rljT$D$uj$jWPH 螔(藔9$T$JHJHJHJHJ H JH RPE$jWP 8(18t!'0t$Q0*)4$PjV5 $L$D$ 81 ^_[]ffffUSWVP[EET$@t$DT$$dpU }jjD$܋|T$\$8t$<EΉ7tƉP1t?D$|=WjP  )jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]裍USWV׉[Wl$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[Cm|$hE t$p |$<$ MM$Ujjl$l$܋||$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPD )jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[àEx\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$j؋E\$ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػx|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃xL$T$vثxv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQUU1$t?$L$U6$1xL$^_[]þTx0ffffSWV[t$|$ty8L$tu1 1 ^_[ÍPQj5RhrfVL$T$ tu1 ^Á1 ^fffffUSWV[ M1ЃωT$(ЃM$U 0E81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<j)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmDD$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػxD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃xD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثxv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[LD$1r 1 9vW<t8Ɖ^_[ÐSWV[D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[]D$ PHpR=^[USWV X(T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[^~5SVH[5~D$0hjP Z D$(D$,DŽ$@DŽ$DD$ D$D$$jPj 0L$(VPQj5D$$D$ D$D$D$D$D$jPj\ js[j[S[N}YS[.}fffffffUSWV[ }t$|$tK1tt (h1^_[]ÐUSWV[@y}uu1)\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋdgt$(PV'T$4D$(hPV'uD$(D$D$(L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQJ D$p '3 |$4t$N  D$0P QVR  t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}E("P"L$D$ffffUSWVt$F98[]H |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[sGu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ËFt$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXEǀ ǀ fǀ ǀ9 fǀ= ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[|DD$H~( 1u 9r1$PƉ^[fUSWV[DL$8?tP胖 wܽ t{ܽ ?u1>PƅD$t/Fn?tP#FF ^_[]1?tPd )ʉʁ oΉoUSWV[Ct$tbF!r VO8}t3Wm}Fܽ ܽ tWKܽ ܽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[Bl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&U]E!r\UG18}$P}T$,Bܽ ܽ ti4$\8}th$PӒ1}Fܽ ܽ t14$譒$ܽ T$, ܽ D$TG^_[]Ëܽ ܽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[^?j,tL$H@[ÐUSWV$[(?D$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V譌?Eܽ Mܽ $t#V舌D$ܽ Mܽ $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[h9D$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [ó6E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[3$t|1a1ŶzDPQjERh P$1D$jjW+ ʼn$tƒ9tt#D$PW&to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F UOĄ^_[]fS[Î2t$t$jt$0[fffffSWV[\2|$t@jWaGHO~ H0 WjWB^_[ÍwOPQj=R 럐SV[1t$ t%FHN~ H V^[ÍwPQjIRi ffUSWV[{1t$atrt!w 11ҊNtgtGɍywt@ؐ+u˽뿁뷁 ՋL$) `1^_[]ÍĝPQj>Rg fffffffSWV[l0|$f jWbG0ǀǀ 1G t WzƋO twуy y wG0tW@9t QgG0PG0ǀǀjWG GG:wEPQj8RG f  ^_[f̀rS[4/t[SV[/t$ t;F0u ǀVNuFH^[ÍwLPQj;RfffffffSWV[Ü.|$A8uGG Ⱦ uuL  O @G0taW@9t QG0GG81t&WXG GGfG u WG t'DVPV訁GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍwPQjJRSV[-t$ tF Ш u V[1^[ÍwȞPQj;RSWV[,t$t` 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPƈ6@VRQWPL^_[ÐX/,L$AA A AAAÐfffffUSWV[+$ut hjx1$džt.%u%D$PQ?1t+ 8$u! 8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVu VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFϞj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNC/t(1Vq(1^_[]14dž$j$辳tJp0 rPt_t u8~)1 9}8tQ݋t PqVtt81^_[]ÐSWV[ü#|$tOW*^_[ÐSV[}#D$ p|$s t.jt$ 1dž,dž,^[S[#L$tAt[[ÐSV["D$ p|$t_dž,1t$t$^[ÐSV[}"D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[!l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNS׍۞PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $w"aύ֍۞PQhR1Vǂ $ǂ(#idž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[|$te^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[X|$(o(o(OG0!D$;G9} $wD$D$ P $L$L$D$QPt$荠 $L$QjP t$=$D$ GjwZ $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wy ^_[]ÐSV[t$ t$t$ #F,;F(~#F0^[ÐSWV[4aAϞj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV2uD$`뒀gt$l$UV݇ ut$f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr{PQjbRvrUSWV[x D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í{PQjbRrPfffffUSWV[{|$oEtjPu7 EjWu,EtP褥E EtP胥DžDžtP\DžDžU9W0VT^_[]ÐUSWV[x|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[mD$;D$wt$ Pt$V9 ^[ffffffL$1s!t11҃9rfWV_D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[8L$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T${PQjbRvT$(L$?{PQjbRJT$D$L$ {PQjbRD$L$_yffUSWV([D$D$른O{PQjbR$u 1(^_[]Í{PQjbR{PQjbRUSWV[ØT$0t$,l$$E( oM;dM9X$E(  D$($I҉t*t$BfD$D$Pt$UmT$< Pvƃ9Љv*t$BfD$D$Pt$UlT$< vƃ9ЉuXAtQjPup ƉD$fD$D$Pt$UYl jVu# T$0L$fT$|$(u 0t$fT$EL$jjjPPQUjT$LM(|$fT$MD$jjjQL$QPUJjT$LGM(FjPu臕 ƉD$hfl$D$Pt$l$,UVk t#jVu$ T$0M(E(jVu T$0D$ED$fEDV<DtG PU7ntkGt PUntNO, F)WPPbo ,$fnT$0|Vnft9uf&BMf9s $fMnfuvv9f$+t$0ftpt$ 1fuf9tL]4$f9r1ߐftMf9s $fMMf9s $fM)ȋ$t$ fs:t$,fFT$$J( 1uJ;uJ;L$0vfJ^_[]1ftMf9tTMf9r1ftMTMf9r1ftMTMf9r1ftMTMf9r1뢍{PQjbRT$@{PQjbRT$@{PQjbRvT$@{PQjbRNUSWVT$[RA,D$L$;t$cFjv7 $FD$Du (Dt&A PWl$kl$}sBu`}U|$W UWfz;L$ {PQjbR&L$땍} ‰D$E)QPPk D$fEDuf$ftNL$uKȋT$fafE|$fEE jU7蛒 Af.Af; $T$sfL$fD$ufL$ 0D$ftpL$ 1ff9tOOD$f; $r1ސff; $sfOf; $sfO)T$L$ fslfE|$jU7蠑 D$8ujP7芑 $,PW$ut$Wox1Ʌ $$^_[]1ɋt$$fDOf9L$hTOf;$r1fOTOf;$r1fDOTOf;$r1fDOTOf;$r1뙉D${PQjbRD$QUSWV[ël$|$Et$jP7w tBMHjP7P E1t+jP7J tMHjP7# ^_[]f1̀ffff ̀rS[t[SVP[t$t$jjjPV:1Ƀ $ȃ^[ÍNn7PQj5R艿ffUSWV[Õ$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$D$$t%ht$W00 $t*+$hW>P1Ƀ89t$1퐐$(j?Pt$轖 taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ZNՍwPQj?RWꋌ$1Ƀ8cfffffffSV[=D$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVx[D$tD$pD$lD$hD$dL$$T$dPjD$@FD$h9tC;D$$uL(^_[]ÍPQh<R j$jU0 볍HP'VUSWV[$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍ4T T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø荗USWV4X8D$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$HLB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$bԡuPQhRے\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$bԡuPQh|R趐\$T$\${PQjbR腐\$T$\$bԡuPQhRQ\$T$\$bԡuPQhR\$lffffffUSWV[|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc{PQjbR蹍I{PQjbR艍w8{PQjbR^;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuE{t$PjbQ螌ujWu\ rF(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9tT$ {PQjbR膋T$Hb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtPNE EE($}fu E(jQt$xsB t{t$t$jbPwэ{PQjbRTD$T$ {PQjbR(D$T$Ǎ֍{PQjbRUSWV[|$l$t$FtPhKF FF($nf~ F(^_[]USWV[æt$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7{PQjbR;몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ{PQjbRB!fffffUSWV0[Cu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍{PQjbRƒD$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$${RQjbPT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$D$${D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^L$<A$iA D$AQT$QT$IL$1t$$ l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPIz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$(P$P PPP PP @(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Þt$t$t$ [ÐS[nt$ t$ F[ÐS[NL$T$ j[ÐSV[t$ tA,j@PV O FPhjPw F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8lD$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPm FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[}t$ tAj@PVkD FPhjP8m F@FDFHFL^[ÐS[t$t$t$ [ÐS[t$ t$ [ÐSWV[̐t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVl ^_[fffffffT$D$fUSWV[MD$$&yd,Ḱ ~? gL$ \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <h 1D$D$ D$D$L$8T$jjPQjR@tD$8h D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$.FL$=L$UL$mL$hjjjPQRCD$L$8T$jjPQt$Ri?L$81 u/jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR>t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjRs>D$XL$~ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$R=tD$8he^_[]fffffS[ [ÐUSWV,[Ȉl$@D$D$ D$$D$(L$ D$QPj( W 1|$D1҃|$H1‰|$l 2t |        t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Áp uH< |$9T$vQ׋ jjjhjPj! l t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tЫuԫЫ|$Dtܫܫ1|$Htt$jWj ,^_[]þ |$ $ jjPQjR:<$ ȅUSWV[kWЫtV6un#dP7ƅt3V#ثtUmuW0$#tUmujW^_[]ffS [ë uoD$D$$ T$jjPQjR99t1 u,PQjAR^  [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[{l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQPOV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP<t,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [èT$0|$,D$(L$$)q092sVPs$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[øL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[è~|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[}t[̀rS[}t[S[î}t$ t$ jt$$t$$t$$t$$t$$  [fffffS[n}t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[ø|$D$D$huET1}8XM4tI$Pd E8*$$E4E0|$ 1D$L$j`QPu8VR0ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$84<|$ Wr$Ƅ$D$TtPWt.$Ƅ$8u$L$ThPQ  $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU 8 ʼn`UD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWx h$PWb U|$|$Tt$h$PW/ |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8ISltC$($,2D$XP$06 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPyB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPg t$|$ t$$tP2A$$t P"$($,uWP t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PA@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[|otM΋uA~8t:~4~"`N4F8 I9rP F8^_[ffffffS[oD$L$ AQ jQ0 [ÐSWV[ün|$t$t+jP6 tH  W6,^_[ff̀rS[Tnt[̀rS[4nt[USWV^n$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLX(mD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqo91pjPQwê1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[gthGt tww$Ѓ gpNjPQwU;u<tww$Ѓ 財4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[LTD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[St$0|$,ttqP3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P| Pt$8=t +l$1jt$8_1^_[]fffffffUSWV[S|$(T$$<Gx:B tzu?Rt*d2 O2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj WV t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$xT$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPOT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍwǣPQjGR(T$4ңǣPQjHRm(T$4USWV[{N|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;DW\P=Wx- jW^_[]ÀO @1USWV[ÛMt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍwޣPQjVR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ Lt$8uN uRt8F0t~@9tRAF0N FFfN ~u VkN u1uVVF11+NN^_[ÍwSPQjt$ t$9vuCNtP|^[Ío2PQj{R 9vt~2PQj|R뜐6̀rS[=t[S[=t$t$t$jt$l [fffS[î=L$T$ lPt$ [ÐUSWV,T$ Xr=D$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E :L$T$ t$t$[ÐffffS[:T$B=s\DP[Í٦[ÐSWV[9$קRQPhWvW] PWjQ t;$uĄ^_[S[N9T$B=sD$ DP[Í@[ÐS[8T$B=s\DP[Í[ÐS[þ8T$B=sD$ DP[Í[ÐS[n8T$B=s\DP%[Íf[ÐS[8T$B=sD$ DP%[Í[ÐS[7T$B=s\DP[Í[ÐS[Î7T$B=sD$ DP[Í[ÐS[>7T$B=s\DP[Í!8[ÐS[6T$B=sD$ DP[Í)[ÐS[î6T$B=s\DP[Í3[ÐS[n6T$B=sD$ DP[Í;`[ÐS[6T$B=s\DP[ÍE[ÐS[5T$B=sD$ DP[ÍM[ÐS[Î5T$B=s\DP%[ÍW[ÐS[>5T$B=sD$ DP%[Í_.[ÐS[4T$B=s\DP [Íi[ÐS[î4T$B=sD$ DP [Íq[ÐS[^4T$B=s\DP@[Í{X[ÐS[4T$B=sD$ DP@[Í[ÐS[3T$B=s\DP%[Í[ÐS[~3T$B=sD$ DP%[Ín[ÐS[.3T$B=s\DP%[Í&[ÐS[2T$B=sD$ DP%[Í[ÐS[Î2T$B=sDP[Í[ÐS[N2T$B=sD$ DP[ÍC[ÐS[1T$B=sDP[Íŧ[ÐS[þ1T$B=sD$ DP[Íͧ[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[D0t[D$t8t9@€tuuuuH+D$ÐffSWV[/0t1jWQw t u1^_[ffffffS[~/Pt$t[ËD$|1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[Û(l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]ÍPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV['t$t8D$ t|$tT$t121Ҁ9 11^[Í/PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[&$0Љׅtϋ$tZRWPQ$$$4UhVH$yPVj#q S[>&t$jt$t$PUSWV[&$$$$0ЉՅt$ tZ$RUPW$,$<QhVt$t;l$VPQhUJPUj%p tWD$ hjP' D$D$DŽ$DŽ$ 0L$VPQj8$;$^_[]ǃJP膺҃¿+w狔у̃ǃƒS[>$t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[ú#D$ D$D$$jVjn uƃ tjljj0jVjsn jIjfffffffSV0[#t$̀rS[d!t[S[N!|jPt$t$t$[ffSVP[!D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[Ô t[PS[} [fffffffS[N 88t3[Ë[ffff̀rS[ t[S[j1[ffSV[ u# V>u@1 ^[Ðfffffff1ÐÐ1Ð1ÐX?Ð1ÐÐUSWV,[l$D|$@ |ƃѱ =sdf Fw% =uɋ 뿐 QUhWL$L$뀋 |$@l$Dt1 t& 9s8u+p ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÍѱPQhR]fffffffUSWVX$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$W8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$WD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$WD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WP}T$$4$4$4$4U$0R&U׶=r,j$ K;$u;^_[]Åt|.u|$XpUPQhWKft$|=TPVt$|UQ2$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$ExnNj$L$|PQ J$L$xPL$QI$ǃ$fB$) $W 9$A A L$|PQlI$L$xPQQI$Pj\I$PQ%I$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbDƅxՍ7Pj H7Pt$H7PjH7PjdH$ 1۸$IUSWV[+l$ |$t$D$@tP) l$$FPj)GF|PQGfFD$@ u1ftPVPyGVjkGG fffG )^_[]ÐUSWVP[:l$0t$$T$ |$D$@t PT$$։)͉ $9L$(B99t$4D$,WPFGPl$UFGUVP誔L$4 )΁r&µuPQh=RCL$8QPOF+l$ ^_[]fffffffS[.jt$ [ÐUSWV[$ $D$0$jUEEt U uEEEjmU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh mtkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+DD$ djVU )P!uƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ PtPǍ$WhhPhE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #5j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  s鍔$P5 $< t< 0$< w , A< vhQt$H ƅ_BPt$^nD$ kc$< t< H$< w& A< vhQt$V赇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< t@PVe< D$<@@@@ @@D$@D$8zj5Pj j$P-D$PD$;t$ s E$EtJ*P|EDt%uHOPWYu퍃PPAVPkt#V[ML$0 ;$u ^_[]VUSWV[t$xP!džft91 9s)tQ!DŽͅtMtt|5X9utf!xt PR!WqdžtPqdžf^_[]ÐUSV[Eu jPc$D$F$FWfF e^[]ÐUSWVx[sEL$ L$pu D$jPbD$3D$fGt$V jWV VWJGL$ ;L$pue^_[]TUSWV[t$xPdž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[ôD$Atbt$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ j PV¡ ^jPV訡 &j PV莡 j PVt IzjPVZ  jPV@ jPV& j PV jPV jPVؠ jPV辠 jPV褠 j PV芠  4jPVm jPVS $`FPC5d$/FP#|Gt^GddGtAPt$'F P|GGtPQ7< < {$H׋$uʶt$0UP $[Py뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVX?r?D$PVt$y D$L$Ƅ|$PVnX?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[x$$l3 h3 p; t|P9h@tP|x$D$D$%D$ D$D$D$ PjjjQt_ett. T$F( th 9tF F$F藋( r R p  ^_[]19u뫐S[Î'QPR j萚SWV[\t$8 t3 9t^t, z t7 9u ~t vGVG^[19uΐS[>t$G[ÐWVXL$ tsAQQBQQAA, tD 49u4 4~ v p  ^_19uSWV[|t$trT t/<t) z A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍>2PQhRyoL$4T$0^L$YPQjbRIoL$T$0z>L$2PQhRoL$ffffffUSWV[t$nEtjPu> EjVtE 1t u1@u)d1Ƀ Vt^_[]ÐUSWV([Xt$@l$<}GtjP7> G ujU蚌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[k|$ t$tGw#jP7*džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP)t2MQUQRP$ EG/1^_[]ffUSWV[8|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$׍YPQjbRi\$8=$roD$L$,td;l$tX14Eju7k7 t%MLH4jP7>9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RE $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Í߻ջPQhRgT$믐USWVhXD$|$|G =tŋ\$jj$W?{$jj$W\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$go ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WgO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhSR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhR|a끐USWV[ÆD$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p BL$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V 1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$08[1\$$ PQhRzX\$T$ D$4@USWV[x~T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJ] PQjyR'OT$>]t$֍ $PQhRN\$L$$t$|B,1o9wl$t$uL$H;qu LJ)L$*Vt$PT$IT$ t$|$)Hf,Jf6ŃsxflBL$fLB|$t(fr$t$t$@ŋP frl$M|Bt$sFD$D$$g$>] PQhRMT$W$>]֍ PQhRaMt$닸1(^_[]Íj]׍ $PQjbR$M\$D$XNL$]֍ $PQjeRL\$D$Hp>]t$֍ $PQjkRL\$L$$t$>]t$֍ $PQhRrL\$t$USWV[xrt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UlƋD$cPULT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σsZʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]Í> PQhRJ$E vUSWV[èp|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ uhDnjt$Pt$0VjtRV tm9u.NWRV? t ^_[]ÐSWV[lot$|$LQjPQWjt2HfyuftfDHjWPVFi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P= L$,1TMGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[lzA =tl$$G)B fT$L$D$ uf͋t P5 ,$Uja|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVmf t׋@f8u$dž wSWV[|k|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[&kT$$wA =tF)G D$ *$Ffu^L$t P_4$jL$t$,t$,jWQPt$DFjWPQ,etjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[it$0l$$D$jPj |$ PQh}RYA>fL$ PQhR*AL$fffff̀rS[$gt[USWV[g|$0D$(pFtjP6 F!Gt 9u7L$ L$4D$ _|$,(?99s$QPiw7P G)RQB D$ QF(n$M1ҽtňʃ0(;wI( t`9! u $UV $9 $!u'D$D$@DW8D$t=|$WP@ |$H9vjWPVtl!|$, $tt$SL$E,$ύL$ WQPVD|$u( t u~$!jUWjV^_[]ÐUSWV0[Xdl$Lt$DD$,9EvHD$PUVa D$$D$D$ D$D$$ED$(D$ D$$ D$ ,$T$Pl$H9¹)QUVg [|$xD$Ptu,$<1L$DD$H9,$vPT$RQT$ ,$uBj)N|$9s6WVt$t$ jRl$\Uƅ|$1f9l$s*yL$)ɋT$zQPRdL$ fAA)fAfDy$΋J L$ LDr2P$ D$D jV0% 1|$;D$,uM0^_[]jRD$L0 ׍|$ύYPQjbR;|$ fS[a1 uOƃ1 ,t%9HuHP 1 e@[fffffffffffUSWVY[aT$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[`V跳jV|d VP ^[fffSP[Ý` u;$ \jjPQjR&t<$ t ǃ [ffffU3}NNNNNNNNNNNNNNNNdINNNNNNNNNNNNNNNNmtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20251127050435Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20251127050435Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20251028%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.99.4 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.4 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.4 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.4 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.4 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.4 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.4xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist