08Qzh<  Qzhyet etQzh@@<@T 08Qzh<  Qzhyet etQzh@@<@TU Qzhet`AQzhQzhQzh$h QzhQzhQzhAQzhQzhQzhA.QzhQzhQzhpxAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhmD$$QzhQzhQzh (08@HPX`hpx $pQzhQzhQzh@HPX`hpxN$)QzhQzhQzhK$(QzhQzhQzh M$CQzhQzhQzh(08@HPX`hFAQzhQzhQzhCQzhQzhQzhAQzhQzhQzhAQzhQzhQzh!QzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh4!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh B!QzhQzhQzh B!QzhQzhQzh!QzhQzhQzh"!QzhQzhQzh"!QzhQzhQzh"aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh?\!QzhQzhQzh>\!QzhQzhQzh=\!QzhQzhQzh<\!QzhQzhQzh;\!QzhQzhQzh:\!QzhQzhQzh9\!QzhQzhQzh8\!QzhQzhQzh?\!QzhQzhQzh>\!QzhQzhQzh=\!QzhQzhQzh<\!QzhQzhQzh;\!QzhQzhQzh:\!QzhQzhQzh9\!QzhQzhQzh8\!QzhQzhQzh:\!QzhQzhQzh7\!QzhQzhQzh6\!QzhQzhQzh5\!QzhQzhQzh4\!QzhQzhQzh3\!QzhQzhQzh2\!QzhQzhQzh1\!QzhQzhQzh0\!QzhQzhQzh7\!QzhQzhQzh6\!QzhQzhQzh5\!QzhQzhQzh4\!QzhQzhQzh3\!QzhQzhQzh2\!QzhQzhQzh1\!QzhQzhQzh0\!QzhQzhQzh2\!QzhQzhQzh/\!QzhQzhQzh.\!QzhQzhQzh-\!QzhQzhQzh,\!QzhQzhQzh+\!QzhQzhQzh*\!QzhQzhQzh)\!QzhQzhQzh(\!QzhQzhQzh/\!QzhQzhQzh.\!QzhQzhQzh-\!QzhQzhQzh,\!QzhQzhQzh+\!QzhQzhQzh*\!QzhQzhQzh)\!QzhQzhQzh(\!QzhQzhQzh*\!QzhQzhQzh'\!QzhQzhQzh&\!QzhQzhQzh%\!QzhQzhQzh$\!QzhQzhQzh#\!QzhQzhQzh"\!QzhQzhQzh!\!QzhQzhQzh \!QzhQzhQzh'\!QzhQzhQzh&\!QzhQzhQzh%\!QzhQzhQzh$\!QzhQzhQzh#\!QzhQzhQzh"\!QzhQzhQzh!\!QzhQzhQzh \!QzhQzhQzh"\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh \!QzhQzhQzh\!QzhQzhQzh \!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh\!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh$!QzhQzhQzh4!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh !QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh?\aQzhQzhQzh>\aQzhQzhQzh=\aQzhQzhQzh<\aQzhQzhQzh;\aQzhQzhQzh:\aQzhQzhQzh9\aQzhQzhQzh8\aQzhQzhQzh?\aQzhQzhQzh>\aQzhQzhQzh=\aQzhQzhQzh<\aQzhQzhQzh;\aQzhQzhQzh:\aQzhQzhQzh9\aQzhQzhQzh8\aQzhQzhQzh:\aQzhQzhQzh7\aQzhQzhQzh6\aQzhQzhQzh5\aQzhQzhQzh4\aQzhQzhQzh3\aQzhQzhQzh2\aQzhQzhQzh1\aQzhQzhQzh0\aQzhQzhQzh7\aQzhQzhQzh6\aQzhQzhQzh5\aQzhQzhQzh4\aQzhQzhQzh3\aQzhQzhQzh2\aQzhQzhQzh1\aQzhQzhQzh0\aQzhQzhQzh2\aQzhQzhQzh/\aQzhQzhQzh.\aQzhQzhQzh-\aQzhQzhQzh,\aQzhQzhQzh+\aQzhQzhQzh*\aQzhQzhQzh)\aQzhQzhQzh(\aQzhQzhQzh/\aQzhQzhQzh.\aQzhQzhQzh-\aQzhQzhQzh,\aQzhQzhQzh+\aQzhQzhQzh*\aQzhQzhQzh)\aQzhQzhQzh(\aQzhQzhQzh*\aQzhQzhQzh'\aQzhQzhQzh&\aQzhQzhQzh%\aQzhQzhQzh$\aQzhQzhQzh#\aQzhQzhQzh"\aQzhQzhQzh!\aQzhQzhQzh \aQzhQzhQzh'\aQzhQzhQzh&\aQzhQzhQzh%\aQzhQzhQzh$\aQzhQzhQzh#\aQzhQzhQzh"\aQzhQzhQzh!\aQzhQzhQzh \aQzhQzhQzh"\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh \aQzhQzhQzh\aQzhQzhQzh \aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\aQzhQzhQzh\ !QzhQzhQzhi!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzh aQzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh!QzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh!QzhQzhQzh!QzhQzhQzh B!QzhQzhQzh B!QzhQzhQzh!QzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzhaQzhQzhQzh!QzhQzhQzh!QzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzh aQzhQzhQzhaQzhQzhQzhaQzhQzhQzhQzhQzhQzhbpf!QzhQzhQzh $QzhQzhQzh$QzhQzhQzhn$>QzhQzhQzh$QzhQzhQzh$sQzhQzhQzh$QzhQzhQzhAQzhQzhQzhm QzhQzhQzh$QzhQzhQzh $QzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzhAQzhQzhQzh_ҟYaIRYv21a40[~2PsCǷTKWyHq/ou#{'VTK&HKΏqFQ$F6~V$Kc;~Jt% j6TiON.het . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@4!$4 (K#K#O#''LLO#''PtdK$QtdNetBSDnAPaX NetBSDearmv6hfA-MQ `10 7LP@@Q  Q/R RP+ p`p`W*0/W:U `XPX`P`U*0/U: .<&&&؝'(&`&&(&p&&1p@-<@@8PPU*P`0/U:p;Vt&&0H-$@$P@PT*0/T:0&&A-@TpP#`/`Jd \P@PRP PQ804 0 0 A/r4"\3P(t3A-|tx @lll`PQpPPU: eP P Z3P(t3"r47!P@H-O-M`Pvy܉I帹X fb@Qx            D , BP,   Ppo`P    㤉p taP \PDPP$PS << pPU (QP 0P(0PP" p p`P` `PP<p Y P  X V @`@@@P P X% DP @ X X% P3X;*z P{`pP @P` :XX^9h Pi(&@8 P]`pP @P` XX$P`N$:`pH`pP @P` !XXM ^&pt `pP @P` X `XIgI `p`]M pX `pP @P` XX--pF ``@P`pPy P XX0 p+(`pP @P` XX^^p `@Y? AQ` p Qp Q X` X @  ` `@ W  p`ds\`pPUP,TD ЍPp@LPزWpU dPP P pPqJ ⃉pj (  PsPPw}PpU] pPpUvWpf Q`V YPS ` VᑖP ᜣQ  ` ćP@ ᝇp8@Y ᲇ@Py@LPU ᷇p᳇`PUqSᦇxU`V V`h< 4(P(((؟((((ܟ(,/ԟ(X((C!a4 ((4(< H44(4O-M`P<U,t,D  0hQPd@Q)  `l         KPP  HP 6LP PP7 RP    XP"0Aq@-T@P V PX P pRpP0p` R p[pZp8 Q,RX`P Qp  H=@P @ `'PZP\)PSPQ/p`@ P0xxP:)pPb᧢ A'P  ,$ `ᖢ 0`T XZ XQ 9/P [ <}`0 5$'X(,/5-H.f5 @g"+g"L5H-R 0P(w5O-OM@P$4$dؤt؄ ᙳePH@ Q' L0XHH<oPfP* iP- lP8(pP$ rP' vP/aP#xdph@DT[8 R Q # QR QQQ QQ pDbQ +>> Px vL PR/U P BB RR/Q  _QPᮆ᷆pQP!T|P TP PH ⒆p  P! Tvp/UD 0 ∆p    Pp `V @ P LP:@ /R @ R@: A0`@/S `V   ( (((50(,(((( ($((X(5'64(8(D'0 }6k6 /<(O-M` Pp;%Pq @~'PY 䵟ԅ Pp@P$$$$$bР  Pg ZU 0` @@ P \ 0YE'pPLPPZ, P/D@PLP ,0/QV/Q/P@ E0A P:`S ᥾  P Pp/Q  PPP ⢅⒅pP0 X 0`P!0#0`(%0#P Xp  P  &*:  S) Z U  PПX : ZC00P%V0 UQ`PA b?2`2P5` PSH S_p2|b Rnp[ P  P' xPS 匟  )EP   P P LP  PPpPU PP#  PPP CP0!AQ'(PP X  Ap,&΄PpOP%Ѝ 06|| |0?N| |O X  6 D'- 66 (76(,(M7(@(777@(77 m70(;@g"A- M0 0@P J Ѝ7O-M-MpP @^ JP, } P pt @XP hPX`P P`V`U(@c +pn  P Q4~ @ p`0 {| (  06pp  pك ,` A`⛟xu @`P$KT4# ၂ P `PP  A,0 $0 `   4 @TP 尼P $D "@PighPP $@᷃+(@]p|pt`{F 0(@(E nZp3 A,`Scs$尀4 Zlpj P O A$D0 ,0    ( PPzJDPG  @P p P(@ YPL8V Np @ Q 9p  P+#Y@P  "PZ Pā4@P (P d(ǁ `pU PЍЍP TPPPP PW  ᧁP ⸻PP QPPQ8P ``⟻PX Q|ᾁPY@((D' ((( ($(7P(9! (<(9D(( 84(8(H-@P 0 <z0U0 ᓁP`0yP M`P U`U {`cP A` W PpwMU bdlp hM-PP 4@ `UP`D'k8u8(8A-M@ `P,рp U P#P l l P P @ ۍ,P XiD'?8J8(280H-@Q pPP \PP؀P <ú0,P 0HA0D'?8V8(0H-@Q tPҁP `T"P/P <᜺0,P 0H0D'?8a8(H-L 0P(8O-M`!V( 弱Q@PO =p >PN `QK   0p PF E 2/`V A $Q B B ֛ ' Q'  Q ! Ѝp qXT k < ,d@@_h))|-,")9e9x989#=9P11909H) HH-M0 00  0㮨 0ЍO` h))H-M( 00  0㚨 ЍV:X)H-"m:H-M8!00 0ㄨ Ѝ^:P)H-M8 00 0oPЍI:P'H-M8 , 00  0V Ѝ訴):)$/)H-:H-M(!00 0; Ѝ:)H-:H-M8 , 00  0! Ѝ訴):h)$/h)H-:H-M(!00 0 Ѝ ;h)H-M(!00 0 Ѝ;H)H-ld@P! AP R0PPP0PaQ8)`)h)  /)h)H-  S<" H-  K<" H- D <"H- = <"O- MP@3eᨚ *p@LE$P 8$( 8~p(d$ PPHuLP: d,U$P  8$('e@ 08L ,b~p(80` ,$ 0 ,3/ p( h$ hz`X @P D` PR`3VP P#   Q 0`@J!S#(`1#6/H@@@80I(I  "@ @"@PoG  \ 0R*[ Z IIKI80 ($03/Pv p@!0$<`_@?``@ 0 P=$ Pb ķj  8!(` `1/ $`崷h  @ 0`P@0``@ 0 `8 0 @`P 0@@0@ 0    B 1/vp@ 0y m< @P\U -;X()T" C!P'h))<X);)BBP)?P)H);H-  P P> PU5!@  !pP0*BH P` H `Vp  `!(P 81/pOIP 8(1/p0e H)0P11h))) <&0!O-MLP DCDpP P g  80( @0004/ @p  PpP/ I P`8@< \P!].# 0@#    *"; pP̑A '%$  Q` $   O pWPWQP p Rp0pRp r* @" " A{/p  p`- Ѝh ЍO{H,D$ ~$ h)))E; )`){;;H)`!i;H-MP\ p@` {8( (03/@BHP {> PUT `D@4 P?(4@<0,,P< !0 8 P P$0$ 4 @ 0# @$ @P (P  ,   0$ 8@P@@P8<@ P@D HL`P `k @p[pU R$lAQ! P :pP P`U: QU R ట  U H yߍۍX1<<\ <)<,/)`>P>)))))l)h))))|)x)t)p)d)l=?=X() =>P ==,!==H-NC P(@H-M@P Pp{k*?P `PU FЍc4>0H-@`P Q P P Q$ 0蠵))O-MMpP  0P ( JB +J]/P08P$0$ J @X`hp { @2s @x0l |0g @0/ W p Q GP P  P.'7g@ PP PPP = Pll' 0h0 @L7 B .@ T  ($$' `$0` C  Q&6`` ` P&PP6P  B &|f0 R0 t60S P @ P`PTT6TVLfF   @P0P,  &  0O P(@ `TRD TP.PF `pWG08[4 @`x))l))X')??))???h) )@4@P@V@)?@O@U@AA?t)@@"@"@"T% )\@@@@@?>>>#?T?0H-M@ LP0<PPPP P Ѝ0|) (' G-P@Up ؁ `'&   墐p>ڨqPUꌑ匡  U0,`00zP4 `QD@@ 0P JP!@*F@ };@ r@/@ ``flPP@ȵ))))P(}MAĵ)8))L)k"cAK-pOP @`` Pv O?峏 .GXP L Pp>(?P  0c1PJPpP LR /0` ``0`@@?l dd`=|P?] (( .m)))P(}MAAh)|)yAk"0H-@P@4 0  @@0h)|)@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,W)8)\'ȵ)|)L)H-X P 00S S P Rȵ)"H- ? #s@('PPP9P P/P dLpP p tPl`P rT圬L㘬@k`r蔹))Ҕ A)AAA) AAp@-@P p|P``P s劆`dd p8@>d0$$ 4p))P("A))0H-@8P (PP qs^))H-DD ㆡnp 00 PP(,)ȵ))@-<<Q@ @0 0AQ00))////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0+oP5PJ`PUx)Bt)p))p@-x@xxPx`t t0````ȅ`Pp<p L) )8))))L)K-Pp@Q؀ؐl  كP `QA=m ``X>P0 ))8))L)P(}k"O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPp(9t" @ `P Pd9H"PP IPf H`P,P(RB  P0,00@7PV !PPP@`Z b0x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @P8P PPPpPJhЍ PEp<册 XpP`  0x) )))h)`)P(!B8B;B))8)L)}k"H-HL0S0 P0^)))A-P x xPl 0N^`pAT V@@pW`@V@@P@P)))A-@!P\PP <`P/Jp!PC<0 y`bp dPXX hL`@ %<0$, [  D)P(~Bh)"fBOBO-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xP}[Td 0pQ0W00 pT`R`Ѝ)|)0))h)8) )L)BBP(O-MBbܲP P@P6Pu U0`/pZ Z0 <3  YPC $2 Q `x`F P R R0,P0p0)P ``PQPKY  !:廊 6P00* T@Z%   00 0Q R P0@ :冊 @@8WЍ0)$)8) )L)P(}B))k"A-@P!P``P  9P-Jp!P  :J0 p hP\\ HUP r:.0(,  PTD)P(~B"BBO-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ0)))|)H-|p@P`T Q @DPp:徉 $$90)P(}BO- MS`p@p PW%@jP Wژ吣 W0 <` Po @L@P`} `@p Ѝ@ - @@PJ肟GYPG`UG P PA p[ᘂ [ ,pPm `T P`p  `0  ,U4 @P, KY K@vPPZX9 @PdN MHG ` Ep[@ 8a [ P < P 0QP @!9؈ S9̈ xxGpPED@ 9^x),)()8)L)`)P(}k"!BO-MQ䱟葟࡟@pP Sp @7Tp`@`` R R0,p00~P5 pQ(A <`@ V 8X *@`TЍ8?h \@P0   P(0)`)8)L))\)}k"C Cx)O-M`@P T prhlZ ` AQ` Ap Q; P<8[X X` A\P`  @^RQ'p QpQXX\X\`V  +P 1p @`0AQ`0QX8X X 3`0p &Q0AQ`0X X X`0p Q00AQ`0X X X`p Q00AQ`0X X X@TPyH` AQ` X X X ЍCh'P(!#C,CO- M=2PPr@o䄟T씟tട`@ ᨘoPp EP# SP`xP sP# pPAP -P$P` ``  0(`@ t-P 6P666`P"QP P !PP HWP,A-P}VbqP "HQ X)PPJ P P-P J2 P*JP l|pPTrPB P>V,jP,P) P`]`Pu u+ u V,P dPPV@,PP PP01 }64 P# ,P0 p,P !P^ h "Xdd <)5CH)@)P(Pn"h)P PTP!J PJP JP!P  P R Pp@@PJn t$0@00;P PPP]   P<X)D)0T[ $Py #Y P Fx#Pj[  PJdQZ  " QpR nR lR  D  p)PPJ`PpQ nQ lQ`P PwP t  }!P  _o oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `t)!P  o oR~Q| P P P +=GP8V <3PЍ`Ph)t)p)l)C)D)("C|)xX"d'CvDT)Y TX)CCd)"4D)))]DB8))L),/T)`'ID4)4)}P(p'l'K-P PP`P `p@P  0PPJpPW@@|)h)"O-MC儳S `@ Z  @ Z A8 J6Rs0紣HhHll. ͜`Pe."Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z`. {pP."P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`x)(h)p)|)l)"CO-MY3 РаPpU W pWppW `P @tP  0  07P pW Ѝh)|))DH-4$H()DO-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` h)d)x)`)8)X)L)P(H-\ R PP < <0PP( Ql)p)t)|)"O-MP`  P! ̰PEp @P  @RpP@ЍS8)|)d)h)X)L)A-M$R R$r QDbL  "sP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J \:@ 0 S0 0pp pp 0p WP@@Ѝ PtF,j| pph;@P@ x)([CD)))8)L)P(}k"K-(a@p W\rP" PQ/+ ,BW G 0\S0S0@ Q  U,| \\⌺TP,e()$)8)L)P(}k"O- M@`Pµ@ P1 Ă弒PP p@Q Q @ !rPe T"Q@H  N` P`@QQq Q @ qPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*+a{ ܹ2P+R{ ͹|#P T @ Ѝ|)))8)L)P(}k"h)X)H-P D, aA1S000() )DO-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ Jt)8)p)|)L)d)h)X)H-Q:p@0 0S)  p#ʤP `N%PP lP @ᇃP/P /9%0 0  P)L)|)DTN !H-4Q @0   TP)L)X)O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍKt)p)h)8)X)L)O-M  pJ LEpPB <`P,U P ` pP $Q`''尔P! !Q Q %QQ Z= Z, `oP 8$Q`+,% XY pU U ,`oP #Q` PP \R  PLQ p$`Q> Q ` ~oPl "Q`,& rQQ  R& R< `ZoPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00oP `Q' DA,(x 2Pp(x !wP @ !P!@orЍP<"H)<)x))8))L)P(}k"T)C));B)D@-@jP 0(Vx Ѷ'P(}k"@-H R <0AT B R @Q: ))H-P  q\Ro MH-M (' 0 0僵ЍH Ѝ/4)H-,! P P@?00 QQP@T5@1<@P- `PpP QUujP @@ xP d '0 pqQ UU @JPf8qT0 a   T0,P00iP PQ**"#^s ٱ/P #Ps pp˱h!P@@Ѝh)l)x)8)t)L)P(}k"G-ؐPp`Pd P s ▱#*k\@q   0!耻))|)P(}k"A-PAQ  1S@pT `j@VAQ4 40$$ 0pp 0脻)|)p'l'h)|)O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍp'|)h)l')X)8)|)d)L)/EO-M`@P/P`P#NprEQmVpJbr㔒ㄲ 5ePrPf@PT|DDDDD,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  Nެ@Q VP  P!  Ȭ VP  PPP `P %PPᯬ< o"?E))))))))X()`! H-[! 0⭯㒬P(EO-uMM0P`P U&  +  Q !P $P0~ P*I!? ?$P  2/P, 3+VP   P \P VP   P PP8P4 /P UP+ '   P!  Îpuߍڍ@+L P t#@0UP H ᤎUP`P $PVr PVD P( T/ P /pP @@/jPppP D [G X Ta  @ \$c 0Pc mTPC0pP   0 qX`尀 @P`` @Pp P YPXP   PT=UP L   0pG.NN-UPeW  .UPT 8-<="#L H-L="#D4  wo꠻))1,2 )!)cEJEoE))P(EE)))E\\\ \H-XX0Dd T  V H H0S \\HH-XX0Dd T  V H H0S \ \HH-XX0Cc T  V 8 80S \\HH-XX0Cc T  V 8 80S \ \HqH-XX0Ee T  V X X0S \\HWH-XX0Ee T  V X X0S \ \H<p@-X X`p@tPp`t0 T  V  p\\p@'p@-X X`p@tPp`t0 T  V  p\ \p@O- MP@G4n`LP  p0TPPp`'SPf !1@GQX`p \8DPh(dltş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP  P 1\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X϶/PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ6 )ht@t')))vF)) )))))) )))Ȼ)Ļ)))))))ܻ)))ػ)л)Ի)̻)X(!@` 4$P$)X$()|')H-  `EP(FO-Mp@"P Py P`P ЍOpPbCPR A娡p@PD4$ l 9l1LP \.PP$ PP L \ lP ASPX  KpP@@PЍ@㸼㵼)4)ܻ))),)FF )6@g" 5S \ S \ \  S / S 8 RL R $ /` S \ )$)O-MQ `VpLPL(P$8<4T HD@ @0, ` PP $k \zkppV \.P PPp0PPLPP X`40@Pptp X  R0RD 40R3PP @Px0P|,pD  U  R0H pPS H * ) R,p0P( 0   ϧx `B? 0`Vủ@ oP |@Q @Ѝ`P  Q .)F)) - F))F)))ػ))O-P x@@P<GP H@@ E$E;@$ FP $FP -P $EP FP `P zЍЍY@@)D)L)GGP(! 7XG T)X)P)9 8HH'H4HGH);A-MP@RFP3  &p  ((a ( p R aЍ5FP)  p   p R x`0 P  p0`JF8P p88 80@$nHOHHHbH3H 1" H)WH]HO-I'#Ix) I'h*)m8@pIh*h*'^IH-M pP`@Dp,p)P VpzDCCV pDt`jD``fDCC 0㞯pЍ('QQQQQK-Mrpb% P"P  @P   "0000 ㊞phBl {XRPLBDP   P xDBPP PC(CP  PAN/l @00P UR pA P\     QQ  @P  & P  P p +0  H0[@(L@Ѝ'i*i*p)i*Xi*i*Il))t)|i*'(Ih)d))Pi*'I0h* h*IO-MMR"~"`|堂V `尠X V@00 T P hB\"`@0 4 H"@2~ 0@""1[aQ I !砐 !F"n ;@ޛ>  BP@0`  |!1~ 0ś"d!0p24 (,a@0P @0宛@  㧛 @0   n0ᗛH! `"0勛[ "N A\\"> ᇜߍڍ(P(Pi*()8)RP0h*') h*hXRP" Pi* PA-~MHP 4PP,` @~,AP~܍'p)'0H-Mxx @P`P 0@QJ 0p q5@Ѝ0)p)'IH-PPT4 4Q$$0 4p)`)i*h*K'KJJO- Ml@PSTPO LP\F0P(!00 !pW* 0〰PPtQJ[PWpo ` 0 [0bQZP Pxd `   {APJ8@u3 Ѝ')(d)h)p))'mLKKO-MPpPPP<PU8찟P@P2:@ 0`PQJP 0go V 0PP0 S P  P ( 3PPЍ'p)')9LO-MMP`VJP@P PrUD3pV C `p~,v?Pp̲bᎎH/@@@pgH/@@pt ~,T?Pr@ `~,L?Pp\H /``@pB`aW WH/@pcڼp`@UI  0$4! UC lUPa 0Xq! P 0sH 0P8x`p!j !``?pq_  [  W  S  O  2p`pߍۍH K@p: 08 5 0 2'p)'m MQh*;M(QQzQPQiL'LLLO-MMD >p ($28 >p #x2@PPP ЍۍcP02PP P pWWNP 1\2422 2P0JhShchxp{@.P% P   (P B P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P QX dP @U1?@@1i*`MzM$)))$j*i*Mt)''p)'MN4NM(^N NNNN*OgOIOO'i*OOOO- sP )YP:PPO@-@(p )p(H-@AP ,[(  210)0)&RH-]>p H  "1CR@-@!>p  01@WRp@-MP>@p @PP NPP  P P  ` m>p   P { `@ЍpO-M@PpJaH0/PjJ 0/PeJ@/w PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP  0@  0PP P (0/D {<)Ѝ k0Pi*8)P(lRi*O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I ЍP'')(TPi*TO- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ .Pp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/Pi*)(TT1T T8)TzT)O-M`P7JH0/P1J 0/P,J&P)Ju@lPP \;P D&C/4P $PJ@SP (0/, `4;'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P n<P  c<P9 dPJrPJ " 00 @/P P@ >88 7<P P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<\  0 @P"F  R.G  R# @>0S 0@( PP $ $8Pi*h*(}Spi*8)ti*i*i*i*i*i*Xi*i*i*(i*G-AMp/@P P`PݾP 圀p Ữ/P x 0p-PP /P PW( 0n-Aލ8)0)0)SSO-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  |NP. (0/P`!P J$(AP C@P   9@ 0@,ЍP帰 EP   0pUP P P !PJX "PZPi*Ri*i*i*i*Xi*Ri*8)Ii*O-M⨔p Za P.J `P+J,0/P&J0sDP "PJ(d P W 40/ `8RP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   8p (Pp@/P dP p  TʜP  p  @PP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P   A q  8W J P PJ  P P J pP ,@ L  F Pi*pi*8)i*cSi*i*Xi*i*)i*i*H-LP  P JPJ(H0/PJHi*Pi*O-MMUp{`  S P `+Ѝۍ@ /PY/P /@8p#   P'`PJp PJ"PJP PJdv P  `97 #G 0$`(+04T@dpGP ᰬaP(  /P P *8P:  PJPJ ( P  p44 \8P` P  "Q + QP0P7F 7+.*PU @Q:P PF 6p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7X!0`*nprPf Pb  @P   㭑OF R] G R4  $i* Spi*8)i*i*i*i*i*Xi*i*)xi*cSBSi*RR0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0h*)h*Pi*OU't)h*(h*,h* h*U@-0@ PR ~ Rڬ~<  thЍK x6t0 1<@Q*XPD +$ EhЍi*p\ \\"=\}K-8M@0 400 r0p4`c<800PpP$  @ 0:oP8Ѝ\\p@-XM@F P 08`N\D ;A XЍp\p@-MP@PP Q `P0 fQЍpЍp@\H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|.:@-A\Q: 2>. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @i*\H-P(@$q``Q a` S HR`U4`-V$``````V P:VHSU|p``:PXQ! 4``,, 0_?`h*,/X(h* ]P(\/p@-`Pptt P XX@P0 :P,,Ph*Pi*^P(^i*(]O-dM/PoX>P `o @P   0U0@JQ_礒УУLУĒԒУУУУУУУУУ,УУУУУУУУ\hУУ,УDУ УУУУУУУУđУPУУpУxhH0HȓУ[@9PP /0 !P|<У,УؓУУУУУУ,< УУУУdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0O /PS0BJP眖ППППППППППППППППdППtПППԟԟș,ПППؙLП`@ППППППHП0ППd\4П\pxПHК P Пh BP ؖПП R   i `{ `v  `ot lRmR oR pRaR eR8h,|p``Di*Hi*Cf.fH-`pW \P@PP` P  JzpWDi*pf}P(H-d!PQ! 0 {@T @1`0V (10S Q Q Q 3PP0S P0S⠔P `P/`P @/Q @4PP/Di*|i*li*ffH-@ `p  W P 0/ /P(P pWxoddoP`8pP ePCSUSDi*hi*|i*K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PPli*O- MM PP `@.T.Pq \5PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K P  P  PZP/P wP Ѝۍ .P P P  @P 1 `+VZP P 2.   +c`apW7 @/P PP  @p.WP pW @ /P P  P P   @ P.PWXP(hf F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V Ri*/>3i*i*A-@PI `PVE qP= a,P7 #V \V `#P` 4P`=(P P!=o(pEaV Q P(P `P@ 4  i*/>3iiwiA-@PI `PVE qP=  ,P7 #V \V `#P` [4P`4&P P!=L&pEaV Q P(P `P@ 4 ? 9 i*/>3Hj jiH-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`V?(P W`Pe bRCR MR mR cR/pP KR#Sp Q LpUP R  `` ``0  (p RP 0 b-4 [-  jjj*kkMki*i*jljH-0@PS# p .SnWpk0Sa`W Qp!@ra`p@ QI D|(| |||PP!@k@d  P!@P!P!@ P!@!@a p0 (T*0H-@P@P  *P @0j*kO-MY; CJP5 \2:BZРL JaV p !  !  p`P @&P- `|P% @  `Ѝ   + A P Q W,U,Q, j*qvѯkH-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T,H,j*qvK-`P p |`AT P++@U`V j*0H-P@P G )P ll ^`PDZXp  D 0$ i @0j*di*"`i*(kkO-MMAQj pG P ,wAT `P  ! 7  P5  _P5 @T %P A` 0QJ P* 0F.*p 0aP  @ x   F @ 0T <@u F+Ѝۍj*(l4lllLllH-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: Ѝ0H-@P@P  (P1 @0j*lA- A`P%  ,@PqW P p M%P) pՋP! `ϋP qPP `PP *᷋P ,** Pj*m)mlH-lp`P @P ,[qW P p j*0H-@P@P = I(P @0 j*PmH-B  PM-`@pW# P!=FP Р+0* R $P  `P@q  j*/>3nO- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ h$PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0    $P 0p p ``   j*/>3j*mm0H-@P@P = D'P@0j*mG-MlP =Pp aV  0 $@ Pp(` Z Ѝj*O-M`V9 @L@8<@P!=KP ! # " # " (0@ #P p P P @(q $Ѝ)ЍO:j*/>3'nG-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  ((j*/>3/G-MpPP/P` ᝙`P$ (&#P pᮉP @0 @ `P Ip0H 8 ( ۍh*[nj*rnO-MP@T) 嬐嬠`pP$P u  p p~P [(Y(@TЍj*i*(((  Q / j*H-l0S ^Q 000SQ j*$j*@- Q@P d  P L<q 0D @&]((n0H-@P <P0 Q* P0PR PT 0rO-MP+ P`弐@p@PP P@PL 0<, ,00 0Ѝn ao1o(_o(j*O- M@Ps`PJMzI( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝ,j*0j*4j*8j*p@-@ Q P``&peRe #p@SO-EMP j@Q lt|eQ +@Q@P@dT   p d @Q:P P /@12 d 0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 |d0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 _GIpD: @Q :!P.1q0PPA@W@Q: AA0 @(\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0    h,'@PJPJP P@poooo(j*Kph*hp-p//0H- Q @P x\ =P 0X 5P HP8Q0  0HV&]pЀX` XPzp X PXsP 0 ЀX` XPzp X UPXHzP 0ЀX` XPzp X +PyXPPq 0iW WXj`  "PR  pWPIW PA 0V9РZ{`4V`: ZP `j PZzpp`A P TTppB @,,ppAOߍٍpj* O-MP@AXL#p@a@ 55vPppPpP?P4 䠟PMp!P$p/`P PQ P 4p Pm/ A A` P ^ ZHxj*X( H- b^P(@tK-P3rP  pR吐G':`: :DG!0 aS P KATk*j*Xk*H-@Q  0Sdd`P@' @qW KP `pPAj* R 0 S$A'  A/Aj*p@-P@U  QX`  PP PpTk*Xk*H-lP@hp`Q `'VPP HoTk*j*Xk*H-@PQ  0S``@' D @qW P pT `Aj*@-@P@K- aK@':P 1S ppW1 0'PR,PP 0 Tp `^b AQ T]`@T K':Tk*j*_tXk* qt(p@-d`P@Q  R @RP'Upj*O-M@AQQ? `V; @P =P x i^@0P p{^b AQ \ `V( D^EЍDt*qt((t{t0H-`@nAP aP@00P@P g @ Y Dt*A-Mc@ >3pPPQqQ Q, Ql&]Q] PAU@TTTT $0LXTtTTTTTTTTTTTPP @G z"p|2   Gp ppH04 G@ @8R p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     (k*(" k*8k*0k*ttH-M@P8`PLLP  IRNP  ?pP  9pEPP@@@8PP8Ѝ k*(k*$k*,k*u0H-@YP )RR0,k*H-  7$k*uA-P$@. `p P Q @ AQ 9T@Q@ AT  Q9P`@ Q9@7@@v@0 0P\o x(t(x>^`P ^`PPP" ^`PPP}lP NQ^`PPoP PU[PU0U`aPa``]P ,QO /P QP Qb9hP Q0`!*(P P P P9pT*SP P ``3o` / /P QPTP 6 ЍQ`PQ|(u*k*pk*/xt(w*G-MPPP !GRRpW A ` MpWp}RdR p`aIP D@WKP iR gR RP6P3 -@p H`PP  (KPtP P 1RP/R,sRލILk*|(x*w*?x(wxPk*~xk*Tk*Xk*xK-@pfPP) !FRR`V Q M`VQWQQ AQ Q +RdQW'`Go",(P Wp' (PPN'PWPP ^G(PP KWPP 00 FQ8QKQ|(x*w*?x(SxbxTk*k*Xk*fxO-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ|k*|(pk*k*O-M@葟 ^P!.UQ`p`pW  ^P `!00[P p paxP& XEQHQ Q AQ P =OQ AQ P )Q S;^PP P P [PP, @ -Ѝ|(k*pk*|k*x*w*v (K- MP-a   p@W6 P2@PU   P PUpW P @PxP^P@ P  @T P^pP $@@m- Ѝx*pk*|(k*O- M@P ꀑ&pPW7 ``P p? R &PPP VGIPJ?IyVJ`pWP %K'` RDP ЍVJ1Tk*xXk*k*O-iMxL$/? c,@_ aT  aopP :P  @T p_W _O`:P  pW p!P ppp0,tQ t 0t1 t帾>6 (R PpPt(ptAtQv dZDeO|QU2 D~=` @  AQ XO @@P @O AQ BO ``OP @UQU dM`  AQ #O `vOP `U @T \`v JP@ `TL AQ O ;OpVP[ |PK tL`Pp lP$PU<<`!RIpt1 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ pW@ptt $pP@Ft V$0/P t$` `Q @QC*`PP?P PPXLPxRj/$Tlx lYp&PP Tl!$P l8JP8 lPhd.T P JLxxP x d P P d hFGxx@Q *hi`P TX%Px @ hLP9D'PEDDDpPP<&PA'Ѝk*Dt*k*k*xk*H-M@/İP FP%  P$  P$ PЍ IP P `p.P   P& 4PP  w*xsl! QU/xk*H-PO+PLL 0 QSQS Q0 k*k*xk*pk*//G-HMc.8A80!<( p@ @`DP80P ( @ ` KHЍ (yH-M@P`pW'㽠`qp@z)F  B+@   K6P0P ?p0Q P.R 0r0S , @ЍN@k*,y O-MP@/p P {PP 0SrP U8 W Pp:9`P㘰WP 08UUPP PP L P 1p PPAP%  8`pGP> ER:UU ~$ @0 k*k* H-`@PpW pV Tc% +_Lt*k*O-MX) pR%pPPP :PW @`Q%P`U@  .Z/P/Ѝ p WQ:Q:Q J@ЍO%x(t(k*O-MtSp`@-b@Q'DhPK h  p"Q 0U'P P PK'P /P  W YA P p   PPe P ~P P p@ pY( 0`@U0 @ G7 p$p@崐`W pp@o p@RPP W    Ѝ@崀`pPp@op`P@D!!bP pP#, w*yX(k*yTk*Xk*yt(y("H-`P@P `pQ%V $P pP@"H-XP@P `pQ P pP@"0H-8P @PP@P0"H-XX 0P R RQ U 0|S:X(k*K-@܀`'pPQ Q:P P:QPPPP %Pv%P`:PPp@<@qVQ`UV Cq `w*yX(A-销P`@T pPQz@p@T`|V:PP ATk*k*Xk*p@-`@sPP PQ  PpP p@pTk*Xk*0H-MpP@l0>00  P P Ѝ0P Ѝ0HTk*|(Xk*H-0P QCQwO-MHT`p@(oPP VP`ppP vP@0cSo  S R X s@@ `@YCZ @` QδP4 PP8 @ `Y /EXzC 9P sCEP B AQ ʉC `Y ptUCTRCP {0 `@ P5 @ `pP|x|||/P$ cP0 ~@Y&<@YCY|YhY <D @@@P .B@XQ&YD@ p  B`@DTYPDhD@ `Lp@@Ѝx`pdd cS yyDt*ȿ"Bz}Wzez(uzw*zzz {zz zz4zyH- ~Hct(G-P!`1 @`!@1q`!A`af dR\0P0X PP= @\ A- ap` >$p p` W p'ppQ*l  Q  RR4 *R[R?R p P  P Ӟ &PP P P  R Pp@@TTk*\l*Tl*Xk*0H-P ,P@@@@Q0Tl*H-t@P hPh`ppP P cP@l*Tk*Xk*Pl*O-M P bAGB2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ K1EQ ЍQ<Q <P pYCP8 fEP టpZ y P p P*p P PPPy/PU/Pr>t(8l*|(~~p@- 0@1 S @@T P`V P@T@@Q Q Qppr $@T % r &`V 0p 0pp*5rOl(p*H-@PE PC \Q`l  Q  p 0s S 0S p QpJpP2pW$Q 0 pW pW 0@PP|P HTTDL44D$Tk*=}p*5rOV}Xk*}H-P@kPP ZP@lP pP@@T QP!C( 6QP@@p`P `pP P(5!(x}|(Dt*( O-TMP)ؠZ Z P$ 0J p<Q` q@P @Q V V V R TЍO/0 PP@ TЍOZ @ `p W 0# 0   I0+P s !!P - "0/!P 0" @/@ q P P! q0S L"/LL  ,Q!p*  z   @ ip!/ J@- P@@P.@`:- P P@Z  T/JpZ @Z@P-`@P-|@P-X p<-P@ / TЍxX"@p*5rOl(!*/Running}O-M X`P QP NPv,QP&@ p`P P T  Z  Pp`WЍX@`V `p=j , |(h(|p*p*p*O-M좟RpP` @paPP ThRhh"`VpЀP PD 0S8` ` pw$ Wp P pW \  \ `YPp ppWp P  Q: ``p[ RPR PU:` 0pPQ" P P 6 RP QP`  R XP0P (ЍTk*p*p*x(t(PP TP Q TPTn RT`TPK50!(=Ht*Dt*|(dt*0H-lP6iN\@P vPww'q(0( P$ 0H}0|((q*1!~A-P``QP PpPp$P@@ @`Pt*A-@P PT@ TpP @7TX XT@R@LBLr`PE0 W`FvB AQ qA ` Q E P 7`Fv]tq`Q ṍP `VH @fX P  1 PUR@ap@ Q` Q  R `V@ AQ j T 1pW`V PAPPU Rp|(ɂ!T (JA!%0H-l 1@T PHDQ R APUP0|(0H-@P P P"P0H0A-@RP Q-Q\P9 Q-Q5U5PBQrQAP `pQ pG`WQ PMpPI ZGH@DX4aX< XBJX@D@ 1@hpp!PU:1S A@  0  R QB 1Q  PTP M87531Dt*+ht*׃Pt*Tk*Xk*<@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 ht*Dt*lt*P 0 @-T@H<QPP Tk*Dt*Xk*@-0A Q @ P  @Pt*H-MPDP0 \ 0 0ЍPt*RO- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  P@@1  3!?`PP0p @ P,` ` PP Ѝ:U H  `:`$PPB(|u  0H-@P 0P  PP P!P P@ @P^@P0 `(p*H- Hp*O-M \ @ TS P @ T*` @,P( PpQԊP pP P @Pz qGA@T Ѝ`(. ȿ"O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍp`(p8H-@   `(p@-@`4P P`P `0p`(O-MQ[@ @` P     @  B/o"D`{p @  pQ  n  [Ѝ`(p*"p@-@MP@ Q `x P x "0`0` 1"6 `hTUJ(8 1$ 0% P`(T"ׅA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !`(|(ԄH- 0`( O-Mw D @ P$PP@;5P))))))) *))),0,0*L*,0,0,0,0)) +,0,0,+,0d+ Q    Hj P KPEP2   sP5P!| P  sc&Pj  `PP pN `PPU pP pQ P,QB HT$P Z6 P -P 08A P0` P    ` P\P PhnP pQ`0     Rc   PQJ Q0P`p  4P1p QQ@p`0j P @Q* P QA P8 {  0P Q,QF f"0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  (@ Ѝ啇P PܰP0`p  ` P P ptp @R*PQ  `(|(`"d(H-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8p     F    P `&`(<@-@P@ 0/0S/00/"H-P@-@S(    @ `(O- M Q 0 ``hR@p` P'0. @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK:L=;|=4>\<=4=>Ox>H>L;0;PP< @PP\ [PZPW&P'PTPl&U0@ET2*0Q0P@0Q~0P@/ P Q @@pT"0`00a 00a!0a!pf(Pc`P(V@A" @T"0` 0a!0p 0a!AR P p@\  Rx Qx< (7P9 6TPU @DP)P @PA 0P  @QZ @P@PP{P  `@{U@#P#P}P@)Q PP T PQ PL0T000 00! 00B pἩy)Pp! B!w @) 80R8x,p!R\P`P?p@Py  0yp\ ER0p@JRRRRKAhHRHHRRRRRRRJRRRHRHH4IRHU@"P $P }PQZ TV 0P@T @@7PU @D4Y p %@ @ TE Ц@P@5'UP @$@>PT ጯ借 U "U `p @ `w }PtP `` N.@P`PqPc0E Q.@P`P^P0@ P3NK H`@PMPCPpQ pAA\ QAQ A xAAp50!1 ( *-@Pʞ`p=Y Y}U ,P@Pʌp# #U%U #UPPr/`L:U!p  yPP+ bPP UG @D@ ]  yP P+@!R P IRt+@3KY PX@LT"1`Q 01 A0 @@A@AP `"Y@@'U UUp`P P?@<P*?U \U\PPv   p@P0@ QR A@Q7P@a@Q1WP@pW- v`(@@T0001|9"000a!0a! "t(x(\("" P<pA5u P PX\P 'PR P pP@j@dp*' P@p@P'P3P"%P%? %#@Q Q@ p B [%P%? %&@ R R@uV%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Qm Qk p B  dX `@"U]J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??P p: P pP 1p:*pP@P P P P@P ` @pP<PT F ,@  PQp @6@QPЍP P `P wpp "p WWp>U WpC!&P |P >P #&P >P <P@@ ` (-P(  @p PQ$` @@Qrvn 0 oP*ljblfHdPb@`4^|P%0p ЍOt!)&P&P ;P    Ѝ`(p*\(l*l*"p@-{\Ppx@xPx`u P08 0Q 08  d\P px p@Z*C`(\(p*p@-H@8Q 8P` AQ h`8  R8 p`( @`@`P PO< P P Q QV  d`!V 0\X1hAp@ր8T`P[ߍKLk*|(hk*`(Pk* "t( R/0S /<\/0S  R 0/t*A-pW |@P`pQ@U U p 0PZ%Wt*H-p@PR T%㯳᮳`W VU ٲV\Q@v$0( ᰴŲ  0ᩴ딇zl(H-p@P`V @P`O-MP@   @ ?3 U ppcppWWpP Pt ,P @T Q @P tQ  R XF P Q?  P"P|C PXP ;@pI ,T @TJ -@0A p ȡRP ߳W PU~<P QB 8P Q  R6  p3L~ P PP/ @p<~P 8~P ұ@p@ @T P|tЍ  Pᬳ~~ t*,q*0q*t*Tk*t*l(Xk*‡t*(((( R/0S /t*0H-P @ 叱pQ  ㆱp  〱p   zp  tp  P0]t*l(ɇ0H-P H@P PP0 2/\P0t*@- P@ T DBPZT@@ P?,, 0P Q10p(l(gffft*K-MS`@ T@P tiii j(jhhhh pWJ0P  R 0 `UP  R 0S T Wr!0po P<}0|VP pðpj `4p{   P#@wpp ᭰P_J`W 㱰 㭰  p ,ᗰ`PYJV`T  V P ㎰ Vo"0p!PP @ ~P P ЍP ЍK* |y J#||" p>|@Q|@<| -Tk*t*t*Xk*|(k*el(<`rH-M@ p`pV`wP P k P `{{{{ { Ipl(xp@-XPX`@PpP p@褱pTk*t*Xk* P/t*p@-@LPU T `V PJ̯`Ppt*p@-P|@QQQU ᳯ 0Pp{`᦯ ቱl(p@-`@ RR9  ㆯPZ{P {P* R t P,UPU s@p0q*t*l(0H-@ PP @ $0t*@-<@P  R  }@Mt*O-Mp$`@` `pR SࣟpvP sPV` pVG3  P p+P -P  uP00XU: #P  Q PQm oᠢWg aQVo  % % [p@P0P`PuPk$WWcZ  01,p- P [ !+"00Q  Q PWFr ㎮pB   R ギp< Y  0O`VVQP J@@ 0>T@ }ЍQxDtA>zzc Xz] <. ,$/X(,/"T""`0q*,q*2"(FO-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP 0 @S[U H u<ЍOpЍ(!"T" !!"͈ p@-@Q? PAQp`R @P``D>Q <Q R <D@Q:P P r d' RHp@P-0" , Zp@-@PP QU,pP Q  R _p `Yp l pU y Upyc (4 ] t*t*ӈp@-@P @(/P P!0H-P @RPP$P$ 0P0Tt* A-@Q @P) x`xpP  ?U U @P P@U O-M@P PP3, uPP/PuPE tPP#dtP@P TQ <PP n@@T@@ U`ttP dtPpPU`PEtP I:lPPEYU@U%Y cēSă@p WWp@WPT W0 T@Lp@@WroᠢYPi@YP P @㰲bR@P*pY Z P  P dDPwH D GP @PeP P  W q|PlP T |8Qthah@pP P T j T@p@Wp@@WT p`@P P wE@@T@Ѝ-PPUP 1"y at*Tk*Xk*u*T( ?n"}(Y7! cwH-M@DPP 8U`Q U PTT TTNPP UP`P`TV T6`P`qT`P PVЍ xwp Q8NQ> T<'8 :V V Vwp U`VF D?P:]w 0p  ȪP6QHQ `6QP`u*t*hpDfPP PXPZJtlfPJZ]Pp @%P`P5 pv 帠@UU)%ij  Ab`P RP:9SjP pYDA\ ᩠\奠@pZ '"f((}L 1"` "f>"s"H-M( 0  Sޟ(k*@-M @a R 1P ! PЍ :떌H-a㹟Ì(0H-@Mӯ@T P=L[P @TK @0@  >|| :x@p 5d0d P` ,PP, (H $@Ѝ0`l*l*\O0 M( 1!~ƍ~@-6P  @t   Q  =PH@HHH H0 0P Z Pk*l*l*pt*t*`(((((t(0H-N@@嶯b 0@S @@Q*lPJX R@@TP,P 0Hk*p*|(d(Tk*u*Xk*0H-MP @  vP   nPЍ0H-PW a@PPK ,L,,,,,,,,ܺܺ88 %  pW pW lc  `cPUPU PU x"p@-P- P`@PiH̼HHHHHXHH @PPhh8888888XX @G 6 Q  00S) ! 0 00S px"P/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /ůP/¯O-M-(MP l@U!%:YP EQ [p\  q%Pr%P  st*Pt jt.X @*P|@@(Wt@X `Xp.aHPxxxxxx`P j q" tV P  `P AHPT,IP $'Q"Q   A tH 1Bgp$⮫$@ ` P  L q t# L p t  4+S +S t  0\ZXX hP`P ӮaA0S0 pQ Q xhpa,&QQ' "Q& 'Q\Q ' P  M   Q?^n vbtfreQ^@-hgP`P apP ZPPP \R R PP0]S 0S MS ^R+ -R PPP^S" cS} " &PP0@pp 7TQP @P%PPPA P cl Hq+ t,  0m$5P0p 'psp dTt  +S+S K 0Gt  A PDdPTt  30 , p @ T@ x ds0p w  0 0 wg   &sp p|#pP\P PE `@]P 0P" MP^P -P `^P cP'   `#@ ?P `` 0pp 7S00CQ`n 84aR 6 rP \P ! A AQ ! 00 nP Pfpp$A AQ  ppR@!/  k`p LPpp`E& $(ЍЍ2%XNP pBT ` !㡚(x*x*M"X(x*x*h y*@y*x*x*x*(x* x*1vk*(ՏA-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P%  @OTHx@@V6 "V? 'V '@8EV@4@2 @0R ʚ@& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRd墚XP@"@`EQRᑚP(Yx*>p@-M`@T" d PpXU @@ BA `(PЍpx*(1x*x*H-`@P p R 0BR0 00p pR AQ ʐ @x*(H-Mp@T 'P"PЍHKP`c [P`+P-PlЍD0 (BA x*(x*x*K-`^PAU:D֙<P0p@E aJ@@袎x*y*H-MP@ /0p]` '0p UP d\ XAA ᥙ<4 4AA ၙ$Ѝx*x*Ŏx*p@-@P  P R A@{tl tAArc"Pp<<DP`A"òF0 ` px*x*Ŏ[x*A-Mp@d\Q  0 PV`P8  0PM`P5 pW1 P<U uU^P P P  PQpP ^U-P P?PPPHP,ЍL@4 `\""IC}Q!f^p@-M@D 0h``Q TP `  QỺP᥺ Ѝp@ǐ"O- M@:SP `p#PPp =SPm   kXcX' iX2 ^PO  ^P(p  $?lX oX< ^P= , ]P  (* ]P" ]P' Q) PX ]P QQ   P P Ѝ "E:T@"~ 2:@""H-P 9p@-M`P 0@-Qo(@ P ( R  Q4 1/ЍpU "N!d]H-M$ 8d0 }ЍH-(Q @0h D9+̌K<8<@0 8D0< "8 < D,$@@-@ D@09+̌@K<,@8<@0D$@@-@4)u0P8 MD0K,8C D/H-M$ 8d0 #Ѝ@-M@(<P    ,Ѝ`tH-@ p㚔PJ8, P᎔`ᦔvQGH8H<H@HHPDHEpGwH\H`,, @-@4t8ݸ,( 8R <  <  8< ,/@-@4t8⯸,@-@(P \D0@ )+̌K,8<@ D8⽸@  @,$@@-@4t0 0&,!H-8ĸH H-M( ㎕pЍtcH-ゕpnt lH-wpot v0H-@ P@0#Phh 80P TT D0P@@ <0P ,00"X""t""H"""A-P`Q @\P  @Qp@-Tp`Q P[P PQ-T`O-MP@pC`-Vu p`Y: i`T c`U ]`V t PP TTY <%AY8Y %/Y&@Y@3Y ! % t ` &X%@ &8% `& &u` &% &`&| &\ <PP s  " Y %@` &%u&Y xz! X%qY 8hY _ XYO` &%F &%= 4PP TYP<"Y ! %`YV%o%QPP Y p `%T`% &4Y %u`&  &%` &% &% tY'P `DBHpW 8bpPd 02 pWP A5P 8Qpp0S) ap @Y P   y0  p W MkKkp 0SW pCk AkЍ9JYo|Dy*Hy*ɒҒے"*18?ELS\dls{"ē̓ԓۓ" p@-pP@`V XIP :PL << pDy*7! Hy* @-Q@&0P@ zt -M0S?^S^@0@ILy* O-tM`@8D㭬88p[- qiPWU!"a@Pphpp 刐ppʓp[pP a8@ p`SpʄD p0(d ڑp $ ґpGP:W W P`(  0p"4Q0J 唑p`pP%P 2PpP   *P3fpPj{0ppQ0P  l pʨ4P  npʄ@@ w04D᪫ X(T( ,/ Bt @&ht@1t@<(GNX"gtM8"H-\ pUP(XH-C딏MO-M`@:㯫\tTo@o  0幹QP ePfP hP vP9KP P HPRP dP 'LP PP# pV QQ PU`Q` `X`[ Q`@p<#AWPP -ᇐp+ :LpP .< p8;"3 .`UP% UP5  㭧`pY"P+ 4   Y"P ` _XJ XH pP : / P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMoU<GpQpXPEpUڈQWWaW&00;p pT&+,P   P  PG@P* d8U` : A%@5P0 &p PPq@UB<dU PP`U0 P5 U$ CpPP@P! U  pQQL  U @PTf/KT $  Ű@P @@JS#h p|tp@ 嶋==Pp 7X#PP+3=PJPUi (PJP 㜋oRUW oPO Pf3WC`<V PPb XJ@P r @P cp P NP PXA!XPA` d2@Pd@\⫌ P6ϋˋD?< }y*D*D*}*H- 0,S Ppy*p@-Mh` R@4T[(螥0PЍpp4 ^  QND*D*)؞H-MPRP@ p`(pO""Q  "QOQ QQ @Ѝ(0H-PP @P <4P [P@P0tG-M@PPQ 0/P .Ѝ /Pt` 0/p8pP 0,`pP   }*T*wp@-M@PPQhX` 0``P $ `ЍpƠT*w Q 0P #:r/ Q 0P #:r/O-M-1MPl[ኟ\h0p!X (  P p ((D `H P> @T1P@0@aT=:aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ ᷝP `"V< X " @]0S  3/`@ " A@ mB*      p P' AP@haV :aP @< |xP4"*  0"q "Q<!Q* :, !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! 5,,C *P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍM`"Š!k"ڪ4E_y*P(d*M0H-M@P 0"\ ㋜P Q Q  @Q  Ѝ0HЍ/P(0H-<<<@P  PQI `0H"Š!p@-fMMx0@+p <4< SPj D壺 0 P yP<<fߍۍprdAЦp@-M\@`X\ 0S  P nP yP=Zۍpd*, )0H-@(( XP 0HP(y*y*O- MMZ% XuU `P!TpY P ?P @P @T\`P:8̛  @@@  0/p4 P  㷤  MT̄t `@(p P  !P tThpt `@( p P  P (Tt `@, p P  P ,S堃s `@0 p P  P z0`S<\s `@8 p P  P a8S؂r `@4 p P  P H4Rtr `@< p P  P /<DR@r `@$kpp P  rP Q嬁q `@$RpW P  YP QHq `@$9p> P  @P 0Q䀟,q `@P  p% P  'P P@倀` PpT P : P T Ѝۍ*P(y*4"Syun":Z (Llѩ-Jd"p@-M0@  0P  Wۍps 0 Xy*P(p@-Mt@xpt 0S  PC@`P 2222VXۍph*q <0H-Mh@ PP yPP 0[ Q3Xۍ0藪seO- M@P P|X `@p`"EP@pX P`P1 9HrP`H@ETP:daP `pP @P` XXX <Xp A8j Z*DP@`pP @P` XX @T Aj`@P`XX  Z Ѝ=hF5P(巙H-M@p $PP7 wP`P_ bQJQ#KA P[ 678777777h7@7kA P 678777777h7@7D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0Dă4#p `V00p d%Ѝ@h*ȫ׫H-P@ R!0 0  0;X   0:X  0:X  0: @( `, T0 H8 <4 0< $${$ w$s$oP kT g  0:l!R@p\`Pp PpWx 0:H;ꅬ "t"ɬ۬(;DTcu"]!O-MpW `S 8@T,PU5a 0@ !R! @ Q;t<;t<t<`;t<;t<t<<@ IP P=,,3: 09CGC@~D"T@ 0@@8p,PCDCphDP"@ 0@p0@a T0@8"  8Q C <P@PPY+ 6N@8 D ,DQ TTH*TTD  8@C  @ f< P @PP+8CQ @PP* 09Ѝ++**  ɭҭ"5" GO\:H-`@\(PP9 0b9P p 0pW:H:bs@-@< 2/R f/ ;0WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:pty*@-@8P wf/w:y*@ 0S3?S q R3WEVty*G-MP)ڤ 0P0 Kꈀ刐@p P pa u`;`@P`XXX pGwЍl*"FP(A-F dd0@ T 0T8D DDP`H0p`F vP(E| " K-M@`BpP Q |Bp||`   ;&`Pp  `2/ЍK2z     "l*p*p* K-MPJ@P 2PC* 2 PA*fF  `P8pXF "Rq1*w1MF  㘡P&?F"P p# 0 ` ?{p ЍT ? ;H `T0 08-$0  /ʯydp*Hl* .pO- MMP@($AP[ AP APCzp   P} 开帀 zp Y Ġ (P [(DC QYP XT 0`pP @ppW` 0QBBR}  zp X  p@n 0(X RXmzpRZ` 0㴑`AZz pW X9 `XP KpXP&;$ = p  0,x PR7 0ֲ 0V`pX Ѝڍ& ` &t0(, 1D!>`!p*P(Ұwdl*xd 2aR P!Lb2v@-MP@  %1P*DD ypЍ,0(  p*{dЀl* sp@-M yp9   * !P @`            t   \@ Ѝp< p*td@l*±ڱ $LpH-MPxx@ eyp P`T 0 `<Ѝm _p*zd@޲l*Ͳp@-MP%@ H L0C 0 Ѝp7  )p*d@d@l* 2p@-MP@p`?PP X?PHo"@  xpЍp$0   )p*wdl* O-$M@䑟Pq` ݤqP p eP]PW儑 @ @@xp аP Q P*ᴉP> @p  xp Q# )0 2 p0R0P P`0p   `@V:Ld$Ѝ(( u~$/X(]p*|dl*ohT ϳ`@-MPH@D Ox8p  ,Ѝb0Up*d@l* p@-MPBPP? @`>P >P >P >P)` h `h`U\>P`HH wpЍp00,  _ TE p*udl* H-PM@` (ApP( wp (AV V( G ` / wTp` H0( 4PЍ(4  p*}d(@l*7%"@-M@ P PPm> P<<  wpЍ 0 !p*vdl* 0H-*JTR0O-\M@PHA\e\p scPQ@Q:aPl@Q TYQ吱 `   4 <5P& @p 45ᗒ P (P, E@P pX  nYđ\Ѝ3X B 6T +4 (`,` 0딴,/X(}D+9F!yaratcidP(} Y|D(Դ{DǴ~D{H-M@ ,$0    븵P(O-$M@P?HXA  "-  up= `P7 p  up0 P/XpP`Y /ZU(&NT  0XhY$Ѝ D!!!= ö0H-P? @P P P P P2r P P)9 P0HMῃ@0H(u 00HᬌPTXMP0^ထ4 Mscidtcidrbmngntsyaraloob q"O-cMPo/00@ϟ娯00/0p☏嘟o40,00000(` PTŚHS  R w  ?B   Pz:g`P /51P pP  pI 0W[ /1P9 `6H@~D0 "MP =sP6Jtp  4` V. V. *"sP UP# 2s D`P  p ,V /0PP  p (l sRP!a@Qj`a`ccDeDeTc`^Del^DeDecDeDeDeDeDebbDebt^bDeDe^4 0@Q&A@QaDeDeDe4bhbDeDetb/800P8P~QxQ,bbbbP <<Qp ʃSP  `/>0P p x p`/10P @sPH  P\8 Z<*?8P8P oOP0 $PEucߍldT/pMPQ+pQXQ@4Q@Q9$Q2 4 0, 徍 r( R( R Q(  /o"Q`墍EQQ! P-b? a)p qP @b? R)p\@( P D@rPH  P?l 0[pno"@PT qpt~O0 ; up=P"5w@|Q@rphOh/ rp8X儫8D/rp.4uIH!L1  |p@p   + R< 1>R B ?0|(p,00 4p.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rl 0 P H U,pp  4Mp @ T LP P0-P P ]Ln/p0o,U  @,<,| ,P P <|l\ PP,0p`0p`}0  P  P QQQ<P`@Q}(4<0@DЍXL* *|*9) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ**D*iO- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ Pqv(-B\S BPav(-m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @sP4 U ,   %Q QP P댰Pꀰ!R$ @@0 Ѝ420****c*K'0H-`P@T 2@ L! $@00*O- MLp`, SPPؠ*@AP 0U $ 0 W PPPP@$ D,U U E㊴` \!` G l$!$1p( @(G Y (p@A (p  Q@( ?D+! ?8  Ѝr*h***O-M p> pB1!?! goP 0%p  R,ЍO``P 0$ !  PG,Pb  z`P Ѝ((*9O-kMM%嬵u崕eEP-0 800  cPd @R/0<īثlPP- TPoP :` p P @T" (P" @@   8@$,  @   7 pcC3NPQ nR R oR|,zXCP   L "zP@Cep# U A`@  mpPp/P P"2 PpVPrP&  MPi p\@'P D'P 4'P\  0P`:AT D@PY.;rQpA  p`P .`p7 z_^a&Pa@P/"P,*<Y+d_밐(!(1`kߍۍX  xd..| |>!***,/ *<*"P>**X(!u zd@ *edA(""#H-`@P\p74  p H-7+ 0≹nSP("A-`PV %p%@[( `0b``P p@-@P3 P&P &P &P#`V P&P `VpP \P P`V P&P `V@pu***O-MM0@TP `&P `V@@l&Pd \ Q vT p 㭰 0$N޷ @P8  nxP0 Sp@`@ F[ᷰ`P -P = qP p   L qExpP @ @  a "V  ٷT JpBP ϷW 㐷^p @P8 P r rV @ LP r rЍڍ }p P P!pPӗ ,QP y  cy @ .P %P7 ?0010A4,Pp[`   )P [  ᕗ ᑗ0S)PP℗ | p >P^^ ** !*!"*,)7!""!}M"B< fH 0/**/*/* M@-M0 @   嫸 cy㟴P(G-p@Ԑs)QUP `Q P Sty`ֶUP 㖶UP @*) $Ŷc** *s  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    "O-uMMرN]p@ @, v\p ppJ]P-JPJn@  P*  P goD pP   p ᜴pP' ]PZ'%8%<5" #峳P P]p   P 8D4(l uߍۍ*! *H-M iP DD 000㛵 0 㓵Ѝ*%4H-Q 1/ m]*0H-O(0P0 @[@'C(P0"*@-=(@''3(@O-CMM@ (000 $4t0 0尀p,P `P 4/P 8=P P0P  ~4PY  (`  06/PR $P , P ,W WPYPYs C/; W p 8 P\`d[v ᐰ I"H * @  `V P  APP `㍭` h0ş 1w<0A 41,Q,! Ȳo8@`PᾲX@Ppp W  AQ  P  mWNW YWyWnW Y@BߍHЍ/***P( )G-MP娣c  Qno wX@p P  mX@PJ4W P  P trqPP\"QQ:2\0/`c\p P:P   0`X  0p il`M PU:P  2`PkP2`P^ `WP1 \`KD pP  @0` ;TW 㓱WPЍP+`xpW"% %UV ( PP ` ` ` 0M`QkW D***zT /)Ja|O- M0` XP pW PXp|piPPLp aWpW!URQ <Wk`l" @THP |PLQ M 0 Ă1@! PX0@0 ,8iP0iP DpQD#Sk QkOkXYx `@@ P ! `o 0D p Ѝ$^$(* X+HP#,30 4080 00 C VP;L#HCPPP , (pPR #0 U($!#0Ap 00 < {VpP30P<@/lr X X $P, ,  RTPL@:DPB QB* " ,B.0p40 40   LVPA O A *P3 X4$ P `0 R  `eV#3 uj sj "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@wxZ +RRaArrAaGu!juM4H-MpP`g@P p00 00 " UP0< @0!10 00  UP i iЍxZ+jO-$M`lp 0@P PR=dP p ! P PP7 L P p@0 @P` i@0@0@@@ LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:hph$ЍQ/h{G-M@XpPNcP  d 0!  X }TX Q $x hr Ѝ]0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! 0 0<P p, YP/ p5/1/ , "O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ4 , "<)u!@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍ8w , "K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `wO- M`XP@ aP Ul L p $ P&#t 6 H0/LpPWPwPP   bfPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 !  PQ P @@ Y:@ee@ ЍO-MPpP@P;:`@Q  Q P`V:&  e 0?@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P *6P PP:"R PVB@Ѝ40`Pl`<@u!I" 2A-P W@B_`V` _@T@ |P p!00|+ed(K_P& (KgD8Q:PQ*" P:R R 0S% r:ddl\`8P $ 2 p p p ****rDp@- @T 0@00T@@Q p 0S @0S0S8P8@@d(`d@@p*******G-`x0X@XPpP  0   p ***O-eM@0 !P R:PpR*h XL8oTHpP$\ 4@0P<@(DdpPR \0`0C !@Q@p0 8! ,`0PF O P@ 2 Y`0`\PL@(dp( Q Q ( @HP YF iP- L(dpp(JD"`PH@ @P< 0lPB TPD @ P* P: ```0PdphP(`0((^a@ PD``@@X 4Q$P; X 8TRpW p T1 K  P | Q@ P @QtQt9L@@ Q.  0 p R0 PHJ QFP B @ `O04X0 oS8T4 Tp 8PX TQD``P8@@p X @P< 0@@PD``pT  Z3q@ pq4Q X 8TR TX @ dPLq   0 T } ,g4hlXX2 \ D`T8``pL p;TB\@< P P0pD``!T2 8|`0 @QR g(hpX;`0L@P"P8 X HTTP P   Lq  !<p q``0P Pw P    XpTd | X  D dp$ Q*T 0l@ AL``PpWP pE@P?p pEPT0U: @ T:U\PL`*  @A0`PpWPs pE P?p pEPR0U: @Rd:L`U*\P p0SPZ 0pW?p00PQ Q:M$\PPP*<  Q0 ; <D`b Vi XP v|:<u | v J!T 0PQ dPLp `EPN  `I E\PL`Q*@dpD`X _d 8XpRTp T@D`P `@IWTp@` XpThpXppw`0 @Z`q`0W:PPW*<  `pX`0bP Pp)W W% P PW!*<dW/* !T0`0P  ' ''$qp P P.  `)(GPd Q: xt`0P PpAdPD`Q*<`P B PR:``0.Q  P+ D``P@TP R pP GdP `0 PLp}" vpP `0RV Q `lPc  PLp"  `%K [@P  K/ 8$@P  1D`ZP #`0@@PD`=\PD`\P<Qm*Q1  dP PL`0p ``<`"PD`P\P`0@gPphhX!`L@(dpPDP>  L@P<@ b",Sdp@p0@,P 0a` ! e"@KP^0<@dpPPY h\ "R:P\ R: Xp0`TAb!HBP<@0aX ` TR8pp:p@p P   0P@p PDP  0,@ 0! B @KPY\eߍxl 0*Z*- 4z]{***i;_7O-OM@ &`P ܢPC RpWdYPT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $3 ! "d  JdPpPUP q P PUPXp`SxOxMhKh C@! 0PO` d 0QP,Q 4d  f & '0 Lp0  4 4    P ! Dd  SJd`P 0o`Oߍ****un"*@-@P ^*A-ppP@/`P `FH @DT dPU@?d*O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0 S ! * p IP" [* p 0< ! l P IP T D 0BT Ѝ*O-ML@P HP PP+ Dp $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 I!D"?"D`6oD`7#@`6o@`/#H`6oH`'L`L2/3?6oLX8<\L01`\XM`Mpp` t}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,Y0ЍTU  +0 BR!q p/G-MM`RQ:@ + T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  ~P `  Vl# 5_ P:i  0AQ p ЍLABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o? T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# l@1/p7 4P0PP R000 >@ 0@@ ` *@P .^;  Pppp ЍۍQ0**h**4*`*0*8**O- M @ ` 4  R000 =p0PpdzQ  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`pQN ULVI  dPB0P`[p`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ***`*8*H-M 0ЍH-AM`p(@P/N  0P@AU:P: @;P T0P ?s0@p:48 S /$/Aލ= *`*h!.!G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF ṛ@PQ u t2/P Pd;P Q P wpЍT D ЍG8 P wppЍG`*8**X**.!(  6*<*O-|MMBNX  ^P` P /r 6* R . c pP dP`5 L@D:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3 03p@$ P$`4 0S R AqR AqA"tvPQ i a  0 [ Q p  P+?PI p `@  0e t `@P:f V<S @  0S! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-xe 0P0p$h`S?BL? @GR q?p9?   0T- p  0ḙP{ yx`*=.!*<*G*(_Qi(*p**- % O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR B(Q 8B r4 0S @PPPPB9P  @ pxTQ p H24 P0`  c 4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ `*`** (4*8(<**(O-MMZ:`P 0Z0*0V0: V* Hp@J@ `` T)`pLWpPH<0@X@0 W t0 0Wt  (`_ 0; W X u Fp 0Wj@X d F@ 0TY Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   & P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE  ( 0`$  p78 p(,tP 7 `X%p 0 pR"  h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg J0 ,07PPPT JT0P q0?Ds`Dc00 Q(`  00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) P$` P 0 8@pP 1qh 1H!0` R Ph 2/$B2/$`P $R?0, h PƟ$B0, 8 ; G)P 5P  xd***(**H-XMP`p@ @rt p0H x Qp  `0DP R  Qt 0L0 Qt LP XЍ`*<*=@-d@ QЀL Q 2/00  R ; Ѐ`*4*O-MPd@tQ pp P p0@S//0 B?0r 0/3? BR p0|0t R :D @ W Q(QQ@Ѝ`*4*0*O- MPX0p@"[ 1 /r  2 B`0 000`0P@Q@%*R# GP Q' pW(,P^`S pP/P pW` `PC L`P <ppޔ Ѝ`P PJP PPp[ Ͽ| L@P  L @@0p@W0 P`Q `8`P PZ*`*4**P***LO-MMM08` ((pR   05P@ T  `V  /r  : S\ * Rx% (%0P?Sd50S <PLRT hA TC pC, 0pTVp 0 ( d $ $ 0 pB?Cp( p[ @  HPH(08 ,0 PUR v8% -L` T ? a0 QSQc(0U    R X(0 P Q 0H $pR,,HP+W( /@  8L'3P @" 0R Q 1/ XQ    TPP 0p@8 X(0W  (00paP!C_@XX   ! R (0 P hQ 0$  0 GHPV /  68&3P [, @t 1!`V'(0P 'pp  Q@@R PPD@@  Mߍۍ<*`*****T*O-MPPa:P \:!p  U :x`U=:@  0`?ᐦ#"$1&(\%R !`0Ϡ&쐟b! x`E`@ doĀ02 T2Q SR0000 g30x`  U  0DD0Q0Ѝ  0%***T*<*  /*O-,MM`HPP1/ @ (QTT ``0 3$JZ0tP@ɯ  ` @ᒕ0"Q%* ` @ P 0-#0 U1S ' P P `P$pP`V P $!2/! Q($ 73` @ pQD tQ> ̲QP $$! ",p㛑 ~7P P $@$$ PtX$2 p PIP $  ! R  $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R PPH]DD  *d*<*P*T*`**T*O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @֐\5)S A0 0   QxP v``\ p?L/ 0᪐0 0ᣐ Ѝp***T`y(@O-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰX?k#"\5 @++`#S !p0ϠB'`r! xpHF) d0! T!Q0ϫQSp ee7 @"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hpq loPp7fPEuPp7]PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P  T:@ 0  1<0h,Q ЍT0"******T*****L**\*<*`**0*P*G-00`P@ ^< !``0P0p P`H p8W P5a&<W0pT 0P `0p@ P` RP  0d"8b"*******<******@-@P nI*O-M  @p WR q0 `B? P``P0V8CP]  ?t V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q pp0GQ d 8Ѝ !<*`***** **-0H-PT@ ?g@P !# " 0 0!**Lp@-`@P TQ HP`@HV*HPHp***A-MP@`pBW(P q1 Q! !G`P +H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝ`*".!*c**<*(***H-P 0@U :xP:@XӍTP HH Pp Q 0BP !  Pp P 1寍PP qp⥍P 坍`Pp P  l0ᎍP(Q 0!4Hi*r*<*`*= "z* @-p @08@ T 2/`@0 &  t  D *ЀЀ`*K-@@P`V DP pP 1QT 2/ЀX:P 6oV P:pPa`**0H-8 B@$|0@P@00H-M@ Pd$0  P @ Ȍn2 AR: Q Q Ѝ0! O-$MP@` P2Q P@Hv U *@2`P P@%$y 0p '!% U R-: Q ``W`1DP p  ! P* F00 R0uP Fa1`$\5S !0 0 t  ?[- 7嘄Q P QP T  \ P PP 1 0 *p! Q\.0 p؃pG pL$  Rp$4 G  $*/lP  =*Ds  X  X  X80 p /W "pp R O} z溯tQL 0P(r z溯H<emD Rzd (0XⰠl!Z !? T pb;wr0 RSrQ 0 Z   0   p3P(& dⰠkP 1 ? T pb;wr RSrQP  0 0  ph||| 0Ѐ Q 0 $Ѝ*** *T*`*\*U 8**<**4**O-tMPs0P 弐4#@`(3\%R !0 0 S  ?, Q P QP kPP X@Xx dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , P @ P$0`PQ d h0PpppP PK1P  R0V : 0 pp!Q\.0P p@Lp$4 pp $   $*-`P d(P P0@0/ PtЍ(`a**T*`*\*U <*(****8**O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PZP YP" 0 l? `R w Z2  R4 @u00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  pLQ( 0 Y *NQT 0 J w*  0P  0q@P p@  0qP 7@  0rdP`0 9*JZ0 0PP Ѝ *`*<*-O-DMhh` pVWP ,PV@Pp0 ` W ` p   hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R ,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `JT Wp  C @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R  0  R  9 0 ,  $h T 8P `",00 08?R00 "<@ R 40$ !   ),@`(  0>P  03! R   0%Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P   0倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0<*`**Hh*0H-HP@8+  0 t(@0V@0*O-MP0@,%/P M.-u$4dpppp [TP!a@Q'vHw|wwzxzzzzzzxHxz`xhxzzzzzzpx|xxEP FP PP$UPl XP BPzp8Pe (P_  0pb :X p PI x PG hc 0XP@8H&p m0  R *tpn  ghpaLTZpTdPKpp R`Y P  `P H`pPUW PP lP U3@Q]PPXX  0/ppJk`,T@bT@f@JZ@P@Ѝ+L*********,/*P***&!(gz*.+1*B**6+"* X(t+j*H- ԃP(p@-M@P` fQ QЍp  0ᲘO-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0r 0od@!!P 0g4$03 0 ̳|cPe s$ @R 0  fPP 0 ,po0So7W'|c4@`/8P@`u/@p2'໽P# ` X0u'  0  7P 1PU B )PU BP PU B PU ؄$"0000pRP Le\b @04*k<y(0P # bP.' ,P ApQ )? ,pW:?1 0 S P pVlP@P& PDIP 4DP $(TP (  00($0@$@b+P P)x*@Ѝۍ**X**/*T8*r*<**Wy*p**3*H*8**`*T** *:*j!!O-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@₼HL$00P(Ο_^A`NP`PAUP Q pX, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  ~Q P QP  hlQH@P  X pd,`X4| 0` 50PPVX`Az T*d@A`0)8P p(@p,ppu`:hp(\ l`pQ @TQ`P `P  (l0h T0  04%TP p` phpPW POK00!  Q :0QQ: \RVO:\P P 0l`hp< 0o\@$"P Q, ,+؋V@(0 hpPX XPS l@0 C}"PQ0 @,/-h y,` DP1  @@pwQGZ"hPBl pR4 Q% 0# O\l`dPY`:@hPQ 0 ? ? 4`_P`LPp0 B?0qJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@ā( ,T`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? W pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN6P> *l`L@h0`P`D 0>L:0ST0= P!  P  0.* RT * P P { 0  t XR 1   P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 **x*TPtXdpP4 `P TP0 `h@ \R 1Q Q  0 Pn ?PT@\TPX \Q 0PP  TP0 @P@PU  8**T** *P( TR\ 0\% 85 =LpT ? pb0 RSQT   % R S<0t p2/*<*@TP@ P 4ᒡp  %PP l$ R +hp `*\*DhQ 0hp 0! +  0 P?P l`bP  PQ # R *8*Q 0hP 0 &$( Q 2/Hix-(*(*P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,7Pr pYXP*(D p/*/cP P$ XP$\T T0 P@T0AX`*qX@`q,@T:T pk@T0gp` @0b P!9Ѝ؍| GC[|X 0( 9H >**U `*<***= *V(*0*L*(*e*y****8*0*@**8WmMld*O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;2PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P `t`P d lP@PPe<`P  ЍP r{0***x*8****O-lMPXW堡1 0 X,QZ x@P Q  pd,`n ( 0`M~Q4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍ**@*8*P(<*`*O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp Ѝ@**O-gMMm"AP 4 v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPJzR , , MP "( 0|Y|I,x9 [ XT!DP8 78 X(p$А?@$P `pH@Qdɴ$ 0p }p(P `P4`(PE((PZ4(`  (RY Q_ ]A_  !'( R   GP @@d(P@RET(PP& (R Q IQ @ Q ;     4 Y84PU [ (@ 0 @[- (@0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  Z X (@  X (@ y (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd V$`*<**? 4***0*P(*8* *6h*- *o00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V &PJ {Q 0KQ!(, HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  (@p P   A  PP@p`Y`Q 0\yQ!L(, (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qeWpW P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0GP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h`] >B&PQ `@p  pP  0 A@ 00 R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P THPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  <*0*`**`!*4*5LXf- *Bs}*;U8*], Q/0/`*O-MpQ\`s/0 AL0 Q @K `PDd 0`P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@#$o PP0 XPUH%@ 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Ph0 Prp?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h  P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ ệP [@Pd$P8 P`p(@FύT@! S0! R !X  xPh UPPDL,PLCX PJLp P2 PAP!THHHTl+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dX)QD! !0)QHPE *****D8*,*PET d  ,Pp  EP $P`\!08 818`VW$̷P1`P. \X0 p`  *`*Q $UQQPQPUp0[ay0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  0P0 P · A(h 0@.o\P  E*P  < <*P 崐 r|e|E p,pW:*U d  `P%PDQ\T ξP# XkP d B$P\TQD  3D 0*x*P(*P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\ ,8P: PP5 0,"P\QL  !T*\*H@%^ PK  P D0<@`400 000( 0000$`,0 0m(pP 謀0 *<J|P   ߍ؍**h 0 |P**,*8**`*<*U x*T**`*'*8 @*QP*u**8* )HcK-Q PPpP`m`@|m@T =mP V:t~"O-Mr!n bR@1% P#  Sm*CCP 4d  ,  P P@P)  %, %*P 3  iPf@UIT ЍЍOAP P P,**P(8**`**! 0/H*D*/D*/L* M@-M0 @   hn  /\jP(G-p@Ԑ0QUP l`Q Pl Bt.`lUP SlUP @ $l jH*D* P*s  MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    iO-uMMرNp@ @, 3p ppJP-JPJn@  P*  P $zoD bpP   p YjpP' ]PZ'%8%<5" #piP P@p   P 8D4(l uߍۍL*! T*H-M &P DD 000Xk 0 PkЍT*%4H-Q 1/ **0H- 0P0 @w@P0p"*@-@㜱@O-MPO``(pVڤP 0  P  P `_pEPK P  JpA@@PV 4MPU/F+\P p)ʒP!" x  RYP9 %, %* P  P jI tQ>Y< `PvH/H0DSm4`PhX PPb8 r? L@pP= QP @ 9PI  zJ>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ౝ[^ `4P\ X[ QY 0p8 8Ė<\S$ P -@$PA` P9  @0X# *PE,T : H P h @X RQ!  @ %_ P0 < %  %*  P  P:= P *0  $ P ` <dQ:( P < *  P Aq P3Lq+ QQ%ڈG R h-PHP*  P > P 0 Hq& F0 aRH P P*a( o  P  4 Lq& , o F4 aRL P P*5xC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | rPp .P* P S Q,QS 0"!& 0C04eQ <P P*$ P M ( (R xQ+<Q) xCx P< (%P P P*kPy DP  H8%<5#"( u8BH0/S8<%  PP*9G |P  @L@%D5#"G BlQL0/S@D% <P0^P2* P @ @ @ pP D**P**sr L0N-H@?@@_!0/@QP,%R{PPF GL***euP**H*`*8**Lq4 QQ-0N R 1PP* P B *P?RPz |.HPL0P4e00P@ XLPDTs *%P  Dxl``PTp 0PpR 1@L /Q `V*Q:QsP hkPX'P y q Qt  cP GPPb W [, U @0p @p 0 P@@@{`D  F? @D`P T P$"Q    YSPPT"2rRBpP@ctpqtQ QLR@  c! !1`pppppz 0 p0pWP!p01|A0 R  h!s0c`AP@P0UP 'aP**L**8**$**  T*`**\*p***<*@? *4* 0*  ,*Q *x* **** ****8**LBAL  m H    G *  **, **X    i ) D]z   \ 9 O- MPU to*  0@P Vp'ʈuppphh@ ?P` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*.P D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%W!\b ? D PfU! lRBF,PPq Q*P _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h 婻@P *,!\Q\UzP P  @h Q p耟aP0 R D bP@pU:P@@]00t*8*L*z "$* \** * *   `*/ *8 T@*<*`***) `  ***D*F ||   p \Q d Q\H\PQ 0 \Q , Q/\/*@*8 TT 8*! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R-<*H-P` < @0X@\p< p X@@0\p垺?φu/㖺 㒺h Hp@-P` @  ^S>Q`p'`&p @T@T  @  0 00P@@ЍE** K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ**P**L*O-MP PX `@V T p@@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ$*  8**`*P*O-M`@@P0r!p   7'P0 PS X0 @P^TB4p   ' R+ [Q ᧖ 0%@ / ' ᙖ ?  p 00X@@d0^P  `Z ]Ѝ$*n s (* O- MPJp`0@Pᐢ!( &P Ѝ 0P]T P& P : 00] P`U ЍO]$*  H*G-PHP<4PJ,(PP? DP ,PP  ?l 0ꬓFP$ P PJ  ? *thP ] }0SySsp@T TQB  PF rARP TbpNP}{pU @ U`P# P"  @P$T$X$*@偶P . @ PP t!@@*Z\hPP ׻ @PP D0!00*;IP ḻ P @dP0 \>(GLA0**P*L*8**D**  <**$**`****7 **aJ * @**y ***N A-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`p@-`D@PP \( 0PpY*e O-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppPX"\5 S !0_ 0 pb\B  ? @@Q P QP  ' P PqP~r `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`ʴP Hx P P PЍ, **p*x*T*`*\*U *8**p@-@P@`@  (P  p@茻p**`*H-XM pP`X@P` @/XЍO-\M`"p&P@ m!Q@P*  XH$% 84 \ЍO詹& P' `D : @`@D - @K &DP/  T `X H P4& ?eH+\Ѝ*_- ^Š!!0H-@l P:\0P jD D1S00 0** *X( 0H- Q$P@**D+*@HP TLP @O8 P 0q *   /*O-M@\PUFP PJUM PVP V.㍳P P8 Lpq|Q ` տ ` ˿Z pWQ  p崿W ׸ ᪿ 80H  \ ?p  `h / C΄L0P_?q`0P Pߍ* \*`*" H-P|@paV Q PR BP  `@*I < 0 0!R  R//*O-M`PL:@PpPE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ*^F**** @-` 0!% L#R 9.$P% "  / #"o  *^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WX"""H-`0S1112 0 B A@o < 4 H-`0Sl2222   B o  @ H-`0S2033L300 B1 B  P H-`0S333300 B1 B  ] O-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MpR `(j@Ph j@X P `P P  pf (`P 㯵 ݍ8 vij d@ -  $ 9 edAzd@ K-M@ ;PpPS`p @0 P3pW `2! ݍO-MMP`pl@PJ   P)  P/㸼P rQp#0@p-VRaPzp Ƞk≟ P `pWiW~f Upଝl~P `n  -d@`PTSJPNJ  !o P?J040 #AP6JUP2JY"N 0U 0@P!J̑P~  pLʍP2!0U @PPZy` P IV VTJ@ߍڍ   P ` P _0U@^`{F~6PgZ@`s[ qP \^/Cp P X 5FF F@A-M@)`PpP  0?p0P  R KЍ0 0a lp0cS@ @*ڮ@P X @`***8**O-MPpPlh@`T Ჩ 2|QTЀ  ᢩP @0$" 0  ?  0 РP ဩ j A0 Z)*?`@ ` @pTP` ǺH1P  0XDP`@ 2V RN@P 0 0R@P) d# 8@V p` ! `Q 0 R-JXP 03?R! 1w R o pP d\P pPT0pp***`**} g *? *O-Mr`V1( !V   嗾P 0D0PP !V #OXЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P FP  Pp W@****| ` !O *  *O-LMp@Xp`P 70 P ,pxP p(PРP8`U e@p '0$ \ ! Q pU+* # @" p> p $` p @p 7$`2 0 P`,  `NP rP d P (p  (p $ LЍ`* *? *0H-Q@!1 #R# @@P 53@@# # dP@L@P 08$@PM*^F *% : O-M(`,@P 0V` 0pP @h`0P " Z P`pUЍA-M`p@(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R p4 / * %  p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 JO@VYJ WW: Sp `y@PDp&Q:  PRPXE( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0 ֻ  xNO@? \Ѝ K;SSQ;D44 $80, (N,DS;!SR00;S%PU:AU0 S@@<`E4Pc' &(@,TpP`0@$@ H,$ P0H`LpP,QW Q QPD@ p4a"0SQ@<8p<< ? N400P P@TpX  # " P@D@X p8P8D@P 6@[48ppWqD@@ PPPTP PTP` yT PPUW D@PpT`V ! bPPp!TٳP=P:D` A "0SqW*P ? к40 0P 00#`(0 D08 R* B8 Q   $D`PUYD`DH Hp'&,(&' @ t 0fMO@Y@4@ @0 0bQ* LBAW" 1 B D L _ MBAWNBAWOBAW  ^  @-@,P ` Tz,,&8P0@ 0 !*~   @-@,PTP @ 0  0H-0@PP 8 R B8 Q   04PU8P0(( ,02  0߽ s   O-M,P/ `p@0 QU    0"P  PPU@@4[>Ѝ 0F 㟽 O-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 0K = N  H-,P @NQ CP\ @`P'`&P @TQ$$ (0 0a    G-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0q 0s ̼   K-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0~ 㛼   H-M@\$P p` DD 0K$ 0`Ѝ*P* H-M@\$P p` DD 0K$ 0`-Ѝ*L* H-P ,@rP NP(I\PPQT`T@p  T vKP pW* *- *M @-,@P ,Q *H-M0P,^Ѝ Ѝ*0H-P@ApX Qdd Q 0 D`QaQ 0! 0<*`**H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*[iP ة @!. p   0[P" OhPQ \XTA 5d#, %*)47(P ᦩA @d AR *a#BP(:RQ% Q UP $@ d#a#*l`P t<@ @ЍH***z  8**`* *   O-MPt` (T P L H D @ < 8  ! @E$@@ 0@@ +  0@hP+  @ᴸU   0X   0 @ qpX DH:p@(@Ѝ X(h" 8 &  G-`P@tq lfP p rP@@P " p  `P  U G1oP S`W $ B p VP$ 4 p Z `P$ % p  X(|"   k N Q/H-$ r0Q0#1"$#"O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-MXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BXЍK-Mp($D` sP f$P 0!   PЍK-MP$Dd' 0د !`   cP`ЍO-M p@P p QP `t `Ѝ  Q 3 P`rQ "$  R($HP    0V qP PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ `P [ a P`| [zP@`Tv T( Z+ ᷔP/ pD 0 PPT $@ 0@P  A P P PA P@ PZ:9Q $ 0#'" ( K ` d $" h   M0H-MP@ 0 0Ѝ0HЍ/M@-M@P 0 (WD DЍ@Ѝ/ G-MPp`cP0 @d`H <0@$LT8P,40$ ;4Ą(4Ap p H  P)$tЀW|p b "@F$+Ԣp !p~I@ЍpWP Ѐ X   0ɰ`pP 0P  0` Ppl 0b p   0ppqp  0pJp P2 V0>간崔  0㊰  ( $p pW' p Ѐ  pst P P $ R~*0pwl hd@d@     f J     MH-M 0 0 ЍHЍ/O-M PP% @ UP!? "R R$ P PP 0 P `  0b`P @  0P   0  0 @Pm P 1SS@[ prs,|` pPp| 0v pXP!D! ^1S SS@H L0  0 `p* 0 P P @ \ 03`A 0 @P`Ѝ  & 1 D k } a  P/@-M@BBQ L p 8$ }Ѝ@/d@  K-@`P p ||PB Ꜵ LLB< pCT $ KB KP( P@-@vP pP  jfQP(( S .  K- @PT0S `pPu 0S"%T  0XS pp `rP0S`%a"$& @p ;q H"m  $$ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 ,B@T(г|  P㐀p0PPpp0 0BT :H`@D 04PB@TЍ\P(.    H-(4$$,0PO-$M@PP |P $Ѝ 0P+ $tU` H0!p *S֮ 0 U0P`p\0h pUppp R0W0 Q pPp\ 0R`_  0Pp $PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`pa P`pV:LP PXRM 0.pF 0  0  0 ]P  4$$  ! $@ `  PARTEFI  x S 9  O-Mp@Q W PPB$GP `  0PPPP c< $ PЍwu   p@-M|` @PRhuUp 0r   cЍp,/   0H-hRLR aR bR*#iR sR tR! P 㰏@PeP@0: RP2 ( Ep @$&@0$",/  p@-MP@QL` PQ Ѝp,/ 0H-P@Q 0,ZQ00,/ A-M@`Pp+ \ P # 0RS sS bS SS pW bS S BS R  UPJ $$2!PЍ,/O-M` oR r 0(Q0Qy @pPr Pn jPi P P^P[ (QQW R 0#"N R " 0#D$p@0 PT + p8$ m0i0 p%P- 㹎P   㳎P!@ @  9/$ p'   T 9/$  p 40 ` 9@PUpЍ@ r Pzp$"! A-`p@^PP  7/$|p  7/$ qp 4 P1 H- sR iR aR Y p; A-M@ P $T`p 0  0P,(p 0`  XP 0`ЍW 0`x  d O-M@ P p儠刀P`MP `V     PP Ѝ,/"" H-0p0P@` 0=`V" O-$M @፜P`   PM IPU \ `I=8 P$3 /$Ѝ "T  O- M`Q 04@pP < ЍOP P0S* $0D  T0#+ JP#   Sp $ 0 T0 У0  0 @p (  $"` D %  H-`PP @P 4pP  @$",/ p@-M`lP  @9p8 0<P < <Ѝp   p@-MPP0($,4$<$$(,0@㸩 0Ҽ&P ` "r <"#| P80 h<P\<(Ѝp@&@孼@ЍpX( "   T    % 7 i O-DM@P8`*r<  rP>aB P?\\     \  tP\ Ī눡P  7=PJ  'P5 , 0<@0,Z i  )PsBP:-LR fp%r0S P t qPZ i@ DbDЍ  ,/aP(   X(\4" 8$ O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  pn "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$SP@Q QT H 0@ CTX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@PwP$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O H H"   *  P/@-@$P k@hO-,MX TP\0R, `Pp @P  0ܧTPTP  0@ҧ ` p 0@ȧV 0  0 $X(F P=@T9(P5$P (PR`pᝒ  0ᖒW0 `P p  VV VX,ЍRfV0 000PyO-MS9J1`pP @P` XX@X /1  `@P`XX X 1pW5 P/$$@0@$$@ 0@ $!GO0 !`0PG `G@ / 0/'@8$ m0x/v/# $ @hlP' x"X(,) &' ! [) ,' 3' P(:' q"@' k' *' '  ' ( V) ?( )  ) ' ( 8( ( () AA-MPPI`p@ THX */(/ 0̌rP@@ @$L 0@S;/[ |!80 @VQT/>C@!8! P0@\ЍA.` .4.V86  P0+&ЍA..PPtq0d W| ЍA. P8$ m0Q P, 0 .Ѝ! ( ( ( W( L( ( ( !( z( k( V( \(  E( ( H-M0P@4ppb #  -+p8 0.P |. @.Ѝ )  O-LM P@ 8`$8 8p4  kPLBP PT 8%p sBP!*T  lppLЍrT P8 $~P PPD 80lR`p$") ) ` ""X( G- Mq@`P  aP bP iPT  a T T  p_ ЍlPp P9P  0S0S `p"`!p P0T 8P 0 * * ""X(O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P }P 'Z48 Sp+lP`p<@P h}P p'W48 <pJ`FG `(`H0Ip4 4800KP`,`$P `-LЍ"!* G-8MP' PP# (L 00 `@Q0  ppP P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`aP p'W1 00(pbRp`P0 R* "O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @{, :/p'WlЍ"!* H-0p0P@` 0,`'V"* A-t A `pP@ `Pp @PP@TR 0 A~"A-MPP )p `p @ pG PF WH:pW@p`0< 0?p`9p0$704$0p`0S0.:8t00N , 8 8$ :  0p` P p0 P` PD00KЍ耜Sؼ׀, , , , , O-TMP+ P@8`ᩝq @L  U@P  "p'P LR  pTЍO]rxPl  0P P H  0H DTЍB- O- 04",/X(`@-@R  R 0 ㅑ  *@-@R  8*O-AMfvP@ "oPpgPc`P $$rt@Py P7 p @@P-\\\\Pa 0 <P -PX ePp@pPPa xP/  NP' !P! ! P !P !P !4P  !lP !XP !DP  , P r P   P s P WpP lP @@T Wp @PP` t9P d  P P #80 FP P rڼ=P  sP P $PW @P X  PP "`0 Py "@ 0 Pl  0Pe  x0P^  `0PW @$ m0P ( PH 2PC $ H@ T: P4 @ ԡ`P@ pWP9 pN4 ዘP#  *P& PᅼXU WAߍO2\ @`* @`& 8XfZ` RAߍX HH H0㮚4h h0㩚 ` `0㤚aj- ,/X(H"m- ;/ - - ) ". !Q!  . - . - v. . .  - -" - - - . . !. .. <. K. X. f. -  TP(O-AMp` \L @iPp FP P$$(,0{PP`@pP  AߍOo  P  @ ɗ(P PB P $$0 P:   P   P, s/ P& +P*U , 03!  $$ $P $P @ PV 8 0( $D`St | $P |]P8 | P |$RP$ xP  rP @ lP , | P | $ s ,2P !R$@ GP$D0 !  0$  J P$8 4@!1#媑!  $ 6 P$ 0ޘ< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`X \$$0`f! Y $$ $PR,<`(4`8 \}$4#S#E! : $$ $P3ppAߍ|\hXp<NpgE| t\0Ua. ,/X(\". o" . - / - v. B/  f. . ]/ - . "$"!Q!/ /  -"- ) - - - . . !. .. <. K. X.  0 EFI PARTm0 N0 00 0 / / / / . @(O-$MMP @ɨP Y R`#᭔P QQ| 0o   P H < 7&` PpgWɗ $0P @o { `+P#  # & `  0 孌P T ̄P %v` PpgW #⺋$1%P`  0 傌P  ᡄ % p"%V   %Ya㏩$Ѝۍ@@ M8J8'A @*D* 0 ݵ 0 0 0 0 "1 0 0 A-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0X@ 3Rߍi@iD1 81 ,1 p@-M `@P x  p < p Ѝp 77'ij1 P1 \1 O-M@`pnp PLP p DxP P, pPP PgP `P  ,P PhQ @ tppb P ohZ 0 S 1 pp P P P![ $ Q 1  [gU  ,0(S 1z0P Y  4Q 1  Y l/7HQ 40L S 1bPZ @ hP 1P l 4P 0 S 1H@ `p@ `p p R 2/p 8 Xp Ѝ|p`` LDd <\ 6 6c! 9 1 1 1 1 1 1 z1 0 P1 K-P! P 1P pjP `@ P P0ZWK-M@ PP ` D`p p fPPUЍ ㆕  8 mp !0 `61 . iH-M APЍ. @-M@p ( 1QЍ. H-@PP p/P)?&` `- pD7H-@PP pP *` ZD!?`H-M, P Ѝ$K"K-8M, PPA $P      nP G`]V q 0p@0 QP PP (@>D8Ѝ 0ٓ1 2 ]2 R!`2 i0H-Mx@sP PP P ՈH Sp Ѝ0 0V㴓5`2 2 Z2 j2 i2 @-,@,@@*(*A-(MMA^@o #p P(Ѝۍ @7`C&P P"ȏ@P$P @CP 0P"᳏@Pi2 2 3 @-M\ @1P P p8Ѝ 0;: 4 : R!i$: @-M\ @P P p8Ѝ 0Z: 4 U: R!i^: p@-M@`P P uPaP P`P p 8P Ѝp88 8084( 4n: 4 i: R!9 : x: 9 @-@8yP , @ 0ƒ: 9 4 9 g"0H-M @Pp  \XP H @Ѝ000 00㤒( 4v41 4 9 g"1 1 p@-M@7P Q`AV*P P 0*p l `PP 2Ѝp4(@4 E45 i46 ; : : H-MP `ppSP @ p px4QQPPp`W 7!n!p`W -!xi 9 y9 `9 O-4MR @T @`P0⩣p lpa`3 `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P 8P 5p p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0嗤] PP@ɏPP @`d@`$@3H*#L*ɚ;6eʚ;8 4 ("'A p@-M`P@P  p ,3\*A6 0H-Pl@t@P qPJP 0$$ $0(3c!9 4 9 g"0H-M @PNp `P H0HM@Ѝ0,, ,0  2: 9  4 9 g"1 p@- M@P `P P 0p l ``P`pp lꓒ` Ѝp(2 2*8 i'6 : : p@-(M@ P᛻P- VPp# $ p0   `q0 ``Q$` P P` @PD(Ѝp 0fㄐ3 4 )9 R!@7 0H-M @ZP P p qڸ !0p@0 pЍ0 0CS3 4 : R!i0H-MX P)P  @p((@Ѝ03 9 p@-M`PP @ Yp 2A6 ////00 / (00 / (00 /$ (00 /, (0 0/4 (0H-@|PP P00D PaD"P# *@P$?Q: ADPP*@0< (H- p P*0@ Q:a@QW@ A@Q=@H-eH/O-M(  uppW df@  R 8 Q P ]t ,04pW px  p\e p<B1@T u @TYout%ttxU`@0000  pVP BWCW NWD aG QsGP&(|CAW8  wrWWX!   $$Q :p 0lW`W;CWI LW@ vW9mW; sWVV`clt!   Ɔ<#Q hifaW lWHcawW zW]V`XcV@`RbNQ   x20S0520S1420S$20S*(" R@" R  $Q  10 $ $00 I(0 c PP !.0{tx  0$ @(` p$PP PP ;PP4?`p` pPxP V  R 2/-x |0*4 (*p ( ( ( ((@*>*?*H (< (,/L*,+"G*H*F*E*D*C*B*A*#4 X(*\4 c!4 4 x4 0 P1 O4 44 |((d( 9 8 8 K-MrP:P /`@mpL߀`尀W00 P   |pW 1/pmPP`  0PPP PPv< (#; P(; ; , (; 44 ; ( R/0S  /4 (0H-M P@Q DP pP 4 pp t@ p,Ѝ0 0P:: c!iE: 4 2: g"0H- M|@P P P  P KL p Ѝ0 0i)/@7 4 &9 39 ui U9 H-b5 0H- M P@, p Ѝ0.i'6 H-M,   PЍ.i46 H- P< (O-MM@Q PN[P).\`xP,`Y  ^<0884@0H,P(X$` hpxpPXP TT BPDpZ 9P: 0  \P4 pP- P&P P pW p p P `P U pTPpY L`p 8Q P HH p \P P ` &py t p p Q tdl H gpQ 0Q XPD@@\ pa PV * %:ХP p 2?pP<%:P p)pPL\pW  2/pW p.f@X@ xP r P  mp P Xd 䤍^p H p@@D@P a^]   $&p R\ HP 0\  3/^_   PX눃p 8ppc`S X"$ @   ,"r4  "d  "V  0N0\ p"B 4  "/,  "!(  " `V_  1/`\P`V 0  3/`VLPTP  \`ŝߍۍP },| Rq,'A i. A*B*F*E*D*P(4 (6 7 i&7 7 17 G7 7 7 $ (7 i28 8 8 ?*vH"@8 >*8 \8 S " C*T e8 o8 z8 8 8  (P8 = 97 Hz6 P1 Q6 q6 H- MP@`P \ p NNNN $@ }PE Ѝ@7 vi 0H-MP P @P ph A  ^Ѝ0P"448@P,0PPPQЍ0?8 T 8 8 0H-M P@ي8 pAooЍ0ip@-M@PP P|{P lll P0 ``㥊D `X p Ѝp$+}!B> {= 2? P*T*X*7i= H-M@P   P l P XPXp `  @P Q Ѝ = !"= K-M@P P>Pp p`(K 뜂 1p8 PV P @ "p 4 <4Q )J HP? `| 0SR+ Rn+ P pZ @TJ xP] QRR T@ PpM6P 2!A m7P# p PP`! RQ ' %+ `V UP:gЍxPD*TT *8i(= ! > = = iX"O= F? = = P1 0 @-mP$@$@{*> \*4 0H{P(^? @-M@L hPHH0 Ѝ 0v> K> > R!T*H-(MP`P& @ P  p(: pP\ ۲P D(ЍD *8 *  * > T*8i(= > > > 0 H-@P `@pP2P @P p,   0}!T*? K> > <"0H-M@P  0P) ? p@-M@~P @PP2P d`@  PLPku, Ѝp 0ƇB> T*P*GK> #? <"p@-M@J]P @Ps2P \`@ R PDP7u$ XЍp{= T*X*GA-@/P @pQPC1P @P p `,, ,02e a2? T*&!K> /? <"H-`P @Pp 0p A @H-M`P P p@  0P P  0p @Aۈ؈ ЍH- P Q   Q 1/pK-M`(P ( pᑀ@Pp:"Q P Ѝ TP"P , 0 gp Aꀈ O-MQU$& Q TP Q M@PtH ₱@PHpzTp@W Wf Wh W N@ЍW W1P  ĄP@Q  /{P@@(@ A0($0  ,pfP `P$@( [ *P (QM VK( ( 0H`P$QD @@``P`Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i괇@ @ `V   Q Q@P:@" hTW T4=@ 0]8P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ z$PP t`V  0@p PP @P `@T  PU @D8 0@-'( ''$K""'"? : ? x: ? A-@T `PpᇁP:ᚸP  0p A܆ O-$Mp@P @UK H`pP#  0@`4/P( P+P SӅ>P Fƅ pH`V 0{  PPUZ Z Yꀆ P 㔅t$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q P 0P -P P P `V"Ѝ @(@Q QQ Q R-0FlFtFFFF f̺P P0 0  0p 4 օ %? p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pBP p`$@ "H-`P@p-P pP @B"0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P Qp"U P `PUP QpA-p@(`P P@ @p P"A-MpP,`P T @$ $0(0 0Pp@Ѝ"O- M0Y$ P 8(P J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP)U' `@plK0X* @  04/PCPYU@A  x@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6/y P@T p@-@`PP P V  P PT  P pG-FM@PU`P` D@&P R  pF` pp P!wppPƘ w@ @p(}Fߍ #? ? ,@ Jia@ @ "@ 0H-D@D4@4,P,0Hd* (l*Ot*(QG-NMMP@Fp`)u(q姂 [V pp/ ) +4 `P*(k) 0pw 1JO 0pw0P,0Q,* 1U(() *0Nߍۍ@*Ki'E q@  07tP(@ H- 1pY#Ii @ 0H-hP@P p T p @жT@ p@@0 (|*O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW UtP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@ҁP$ @Ѝ(@ (@ @ p@-P@QU 0PxQ  000  @UP ` XUQ p@,U `PUp(( tA A- M `Pp@vW W# `@`Up@JV:U` [  R@P P`  u.P ЍH-p@Pp `P   H /"0 T1 H-M pP`@! @ЍO-MMMPc Pp` `KБp] @F 6n`,\qXpYE @}P9 P5 pp u $ ζp !@ !P 0 o" 000 3 ;uP 3P t3 #``[Y,Mߍۍ<0$ !o"IA i@* 2A A #A P1 0 H-M`@Bp pP㐀  pp tt pp A]@+P Hx!U@1P P/PtЍ  iRA L"H- RHD*bA A-Q P`p@ }P PP`V@- M  @p l 2P T q4#! Ѝ !{A 9iA A A @- M  @kp&  ګP   4mP p P T q8 Ȁ Ѝ  A {A 9iA P1 A 0H-D@D4@4,P,0H* (*[*,\@-M@ p  QR 0R@ ЍA A  0#rP(A H-`@P$P ` p)PLU,|  RpA (:iA @-M\@ ᡩP L  pЍ0d  0N}~CB ;E F R!iF @-MP @FP  1pЍ(E  0M_~";E 9F R!BF @-MT @)P IpЍ,(  0AA~tG ;E ]F R!gF 0H-(M P@!T  0p < p(Ѝ0   !iE E E 0H- M| @P tP p  p Ѝ04 0q}F ;E F R!iE E K-M <pn \XH` 1P P6P> | eP XPT :Q00@\p@P`0  `XP0 @P TP }0 @DP AAq X \!PdH qH^;ݍ(( LNB F F ("F i8+E F F @-0M| 0@ p 0P L! p0Ѝ(.$$  p Q P  `8t}r 'pP  pZ  PQ p OH !PPPP pm `V !RAqpP!0   :R P )dP pta@T ,I EqSz o@DP0p  4 $8P p$ $ p @ M[P\P  O Q J   Q B BߍX> kx8i(i,G i3G ?*=G FG PG cG [G rG iG i8yG (F G  iG G !ii#G G G G / 0oP(G 0H-M P@|$ ZpЍ0iTB 0H-8M@ P |$ Bp8Ѝ0i8+E O-UMMd8 @2p*   " 1p$P QPJ+ӰPJnP PiP +İPZ ٰ  PpB||  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `(u (Y:!0(!    0A 04g2P8 P@T: 0% Pc PO 4Z ^U  |f @DpP `dPN  D PEp U ADQ) Pxp4 `@1 ``v\T DP 0  " @T >k4euP )P  0 @@TPUUP  @0P@TP>P Q P=@QG`qtttttttttttttttssssssssssT:%PP[ P P  P  @Q $ttrssHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S"""ePE@ U$K @{PxUPA 4N딲嘢@R 0 p   `'b 0 pp`7@T>aLrth\ P D8, P  K[ ,I'Y.0<Q  20fp3H  0 ` P/Š!# 0 ` P /SŠ!#@-M< @P  LЍ 0wE ;E E R!@-M< @P  5Ѝ 0hwGG ;E E R!0H- M@ Pp t ѡP  qD Ѝ0$$ $0@wiE ;E E R!E E O-dMpʼpʬpP ]p P < 5Gpy <Q |T㭭Ph"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps <@w I }H H v3H )|!I (I mI I Mp@-M,,Q P`@Ao ``` `2wQЍp@ Ѝ/H- 0R0*@-@.JEH / (/ MH-M@Q P`pA?Q:wP!0QЍH Ѝ/ MH-M   ЍH Ѝ/@-Mh@P  0bp @Ѝ*I @-@ᔪLa[p p$׫ҫ(#TJ BJ MH-M    ЍH Ѝ/ MH-M    o;JЍH Ѝ/O-MpfV尦@ fPl@ Q! DXXXXЅXXT)P gFP RPP?PZ ` gPV#Q  ?P &P&  #Q  )P 8-P  P &  P p[0 PN tD尔娴PU`P qPtq oq j .P `XP PpGPG U*@Q @pP cP bP  XUp*Y GP*U5pu    PuP UZ'@[XbqP X Pp ZpP P !d  6/ R{  @Y @PlW  0ᕩp3AuPUPR /P `( `W HL` !(    V  0j Q P p%ڸ qr pЍ.x d ll@ <(t$J ,/K L5J J X(** L L K (mK ZK K 7K 0H-t@<< P, 0Mf P(K K L H-M 0 _P  \R  D 0_P ,Ѝ ( **@-P@  t0< 4 S 0 p00S$0000b#8#M#H-M( 0  PЍ (/pP Qp0q#4 S $$0 Q 0! 00/b#M#8#@-P P$   #Q\:0|\! 0  sS Q :00@0 \! S! b#M &M 8#M#H-P pS Q $$0 Q0 00b#M#8#P  S\:$0$\! /b#M#8#@-P@ q 0$SQ:$ b#8#M#P H  #Q\:(0(\! /b#M#8#P H  #Q\:(0(\! /b#M#8#O-qMMpW嘇` 0@  cPd@PL\0T8(% 0AP aP" 0@@@@ 0P B[| 0pu<<&GP 60Sv0C000PU Pd P^Y P P*u앟쥟`nP  nP  nP  P P PP*PnPP(8   P 0 0000 000P` P `[x_P h['c+P=U 7`P `P -`P `P pfnP anP \nPpVnP U AP(<P( {P `U /`P()`P( Ȁ{ P P (nP p P`  zP    A  z( P @P`Pk( P(-P@T`b㭥pp$rPm'P+_^/ePPlP qQ r'P㈥pp( xQp P \( እPy olPaP:a@P !PQtPPU 4 0 0`qߍۍdA t < ` #=M *JM ,/*X(*M zd@*edA$# oM uM M 9!zM [ 0H-MP0@U , MJЍ0P H-MQq 0 P P(G-P@pnQoQ Pp)pP \@nQ`oQ ``P @|P "K-MP Pp@Ȑ`KlP lP p`VЍO-AMM `p@)P ,$ (IQ $uTzTM $gPfPP/P$ yPO 0 PL @* P( PPB FȰ p` aȀZ [PY  RP PU  `Tc+,$ @P P   0`p $ $ $ $UZN 4pᨠ@oP (  P $L8P0%(%B 0B$L4BT2 ` H P, ȤȄP@@pゾGTPp`P -P =QaPU @Q PP@@@`4 `oS嬃`0` S0!P rt CV`phpV )@PdZ (QpHTpL @Py $ P 圷ZP- , 8yf NoP\Zn( `PG >P(PE` 5PUP(  )PZtXs =p P P!p@T @$ P RP7@Aߍۍ ,QP@Z@PPP 3p h#  Ȿt ]Pg  Q ( , 㷣p0@Pp[n B `*oP  0SoPB 00M "M **M N [ !u !#"$N )N 2 "*1N 7!7N JN #"!}jN P( }N fHM O-,MMPkp 0㨀i P`pOHT2 p$(PhhbhRhr Q Q XI@T f P:T 0D! XP02(P$P !X${P !PqPF HAH`'X  P: X, @X``hP @@ @@P0, 0  @ 0JP ,P , _P, t{,Ѝۍd dX8,ЍۍON #*!T  N  N N N N M O O!: 0H-Q  Q @PiP Q  0*p@-@P6 nQoQ  P# P ,R R<P @P,O_PP ``,G_PP(᭵@p*"0H-P@0H-MM @  P0 "x(0pX  0  @ , |@$"{ 4T#9Q O-Mp`P@l 2P R帒|‰  TPe@ Q$ȨĪHĪĪXĪĪhĪĪĪGP MP3xUPgt d 0PI p FQ< `V  X X  V`p!}ZYppp Y4tZ8xV  V Ѝ (   X($/Q ,/#.Q w!H-l  P(Q 0H-MP @ RQ pЍ0  0 Q @-@ᑬP@` @-@:P@꓇!@-M @Q QpЍ Q 0H-P@@%P /P0$ػ0HԻ R 8R R 0H-P@0H-M @ P0 ' 0ᣠp TlP P  L Ll,Dl (  0U !LR ]R R R O-Mp,P( 尰尀`@ 5oP 0P pDEQ A O# $/X(j- ,/#.Q H-k 1P(R 0H-P@$P /P0$?0H; R 8R R 0H-P@0H-M PAN0 & 0 p kP P  H H(ki A> !LR ]R R R O-Mp,P( 尰尀`@ oP 0?P 3pDEQ A O $/X(j- ,/( #.Q H-Hk P(R 0H-P@$P /P0$᩺0H襺 g R 8R R H-0H-M@AP" 04 0|p L M$4R O-M,(帠帰`@pP -oP 0P phDQ @ A +QWЍO  j- ,/ #.Q X(H- 03t\ P(R 0H-P@#P /P0$20H. R 8R R 0H-P@A-M@ PA> )$0pt 0 @ D `"L,<\PP3X #6S 9Q O-MPp @0ibx LPg@Q!DTlt9P GP8||||MP' UPw| ||| 0Pc ||~ ppPQD0Z  S S  Z`PY[` ߞp' [<pY@tZ (Z PP$||Ѝ   $S ,/ #.Q X(w!H-i P(rS 0H-MP @ RQ pЍ0  0 Q @-@~P@` @-@'P@꓇!@-M @vQ QpЍ Q 0H-P@-"P /P0$Ÿ0H R 8R R 0H-P@q0G-JMM 4P@00 0 0H厝pa4@Pp9iKPVP S QP0 P Y0 0pp 2@E P!ʎ8P 0<p 00 ; p6]P .a]<0 ~h@D L0\`dpl`pPt@TX P$@`p QhJލڍ0 0 d*`#T T T 9Q p@-@ P PP p@藰(P`g`p*"O- Mp`H@0gH [뀶嘆否 @P@A@7PD(DDDDLDDԻDDDpDDDDDDDDDDDDȽDD DLDD\DDl 0@dDp2P/ 3P6PI$D]@ IT( RG a58 yltp l,gPW4P a@]Y 0P P    @B P  P  @           "   $      p $ L <  ( 8   @   , 0  @rd$ tW, wK xB0P }pGQQ0`+dS4R 7 ЍT$-h(S (,/( #\*`*d*=q"h*!T T T T #T .T 4T .Q X(H-p0p @0 0 P e啵 ,,XeH<Ͽ Bߍ V A-MP@` p$e XPh 2/R1QP5_U @4Oe@e 0 "ЍX*V V (0P0/O-Mp WjP `@ p{P`DH @0@3/p@peP;p@6WP ` p@y)0 @ 3/ qZ㋐r P P =YR*$$03e<ЍV V O-M@[ xQ@VP p:XPo pP0`P .d d,@8  0U]P .] < \$Bt`p PT P p  P 0  p8 cq_@ P @!0x 'X D  0zp PQ 1 UP ,P dQ @P+Tt Pyqp` hD U 000  Pߍ* 5W l*h*d*W O-M-M`p(PcT 0 ؚ݊@C 00000   Vg@Qlp  0Py @@  P , P xph  @ Y> 0SPb@ ] @ K> 0SPZ@ SI P  p GQ$A+P@  ᨘp, 0(<S00 p@ Ppp 0ЍЍ)` dXL 4 H $/X(XW ,/W W W X BX 9X dX ?(#.Q eW W H-]c P(Y 0H-8MMA.NP$ 0 (0ᩗp. @' P@  (*P ((x0,OP ` ,(L00@8Ѝۍ0, J=4W W W W W X X +X W 0H-P@10H--MX 0@>P     ЍX X 0H-MP @ RQ pЍ0  0Q @-@ῢP@` @-@hP@꓇!@-M @Q QpЍ Q 0H-P@nP /P0$0H R 8R R O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4qQD"X3\cs2/3?6o7"X3\csBD>D:D ??j 2D p +D p $D, p D$ 0p D( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,eC@ 8p C< Hp CD`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@PC C!C!C0A-P C  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 fC!aC"\C"D`6oD`TC#@`6o@`LC#H`6oH`DCL`L2/3?6oLX8<\L01`\XM`Mpp` T}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p BD!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,vG0ЍTU  +0 BR!q p/G-MM`RQ:@ +S T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_B ЍۍLABLK-M,(pQ@Ppp  PZ`(_ Vl# 5_ PW A 0AQ p ЍLABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@x_9P PP [PpGPPlllo ,8 Q`40,( B@4Q D(|HHh,|(`@.[Pc )[P @۠P+ 2 10  0#DlO "8P `D` 10   0 <-@Q  $$/0PP  v 10   0 80  *0l4 TL 80   0 c00  0 @ZP ZP q#[ @Q ᔞP T 10   0  10   0 0>@P@ Ἇ@_ZP@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:OPX/OPSPf PJ<Py/10 1@@(.  T q, sYP' YPe !  !  0 T X L q( F`  Ap8 @x P P D %#pP[otQ\xB AG@P T@P UHH,H<T @   x00[?ԑp+X z\\p& P\P T+| KP pp W,p`T |@ pt vz Pz? fJ p$ z$p*#pxPt @#@z :*P;PJzp"pm*l j ?rWP@@[ot   zp PpTf) ?VW|)@Pt@x$ P )P*   0Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$%p $@ p CZ0$Pl, p$ D[LP ṬPt p[H `q!'P  0P$@V U   ṏ`Vp V po+ QʌPtfP  RL+ㅫP  Q(*|fP"PP[oQ,P VP &0]Q 0Q 3,80(  @w W ᎏy ኏P B@P @p1G 8*Y Y <*Y Y ܐ%0Bdige2%0 Tp txB@ [?pP[,%B d0@{ȀB_<` p- cWPZ $P P)  )p! P< pP +p0B/pPPI@4B/Xy,/  t듕f` *,` *($*` T*O` @d  8PT*[`Y p, KPrG @  WPm  VPh [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4*(*ʐ!$"0QSQ% @PP*ka   (!` 4*H* A8P  0QQ[oXQ <$!@1H!0[oHa [oPu  0 X*AZ (P(Y D*3!L*8*Y <*,/,*Z 0*Z (b W\ `*Z Z 4*$*.Q R!C|""oZ Z *^Z \*(X*b ` (*T** *^(*_ P*Z (H*@*X(g[ U[ h*h* #ffs'\ \ h#[ [ [ [ [ h\ \ \ K] ] ] ] ^ ^ !l*5^ '^ fH}N =] \ \ C\ [ z[ ([ A-P@'Z T0wxsht @0pKXX`P`P ^pPW?<*P(xc c c c #|O-$Mp Z``  㓨 P@p0S$ P| PaSKC P0@(<(((((8kC P0@(<(((((8P PBS GSPbS gS x0(P` \  ` b R40rbpSjQ72VPYZƟQVQ"P) ()% @P W P%  p@H0L S P  p`0$Ѝ\ 0@ 0<p@0p`0  0b b b D*c Ec O-M-]MMԠԠ1, P@ P< TU ~>A`@0: P`P P`@pC 0p: P P`@p 0 D: ?pp# Wp"  YkP @$X OP X +P Px0 <0o (5,%(,D D R$, Z$ P @P O P @Z B0 4 > P @4A 3 P @4D Q'X P @0 Q*, P @0Ql( P @04 Q@ P ,`@TD ! / P*0\PB\C0\@PXPPU XQ`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1P9 `4  (08Pp8 hpφW @ T 威 dQЀY48R T?QYQQP0Xd@Q4!U:8 JP `4@8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?pQ 0A0E HP? Q !gp@!G0Ep/(50$u 噚z"@0S @!1R\Pu DP x@8P@R8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0zQ? A@pQ`1r< P PPP*!1^QPP! !Q :ACRPܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a <1QpP!a!! 0`;PpWp#Xp1G 0P!0B@1PDᡞ@/X0^ 0;a@/.!PV`0PT3_>QQ10Q0U@A!`? Pp 0;0a@ V㸀!` 1ؑT/ a!R, <*H*`*P*l*t*x**(|*0*((c D* d **Sd ؑa Q @Pp$ x帀@8d<`P0@Q GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  <_Бp 4T?@ so H44p0o0 /LP0@%X\V Qph? ~  P\% R\%R`d~ |d d d e ,e *UUUU3333 *8*ge ~0: P`P P`;p@J P  0P P`s;p SPDPl`F r0TP R&0 댏`H pJPE@T`VA P !1L%H 7+0`'e g Te >@ 딇Q  L+0 P L:S +0j@PV.bGP f@ PJ SBP%x{aP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0_ ,Pz/ֈ#QPP\  P0R0CP0R1,@,@OTl @`XAxFp@8<$Ϡᔆ P0QP\PZ! @Va dJ\j e \*4 `@f, Z !/@ ZJj` Pf pzrRE h [$Q`0pP tx R !x X* PJ,@P xTX\`/$%R0Q@h$l` R/dP}`T P  Pk P P P` <$P plQ>dN4-QTT! !-QPeXPeV d! ! !N@pM!!G tNM$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4lP0P  UZ D4P   0x 0S0# !T P`\uWl`4*^F=f xf **P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82ELPC@ 0p@ A尜DL`lP`PD !LlZ?#\Q @0`d0 80 0h93H L XaAQ 0SApTP尫Aa[*d唫AP@ aPT@TK.DT@@Cf #a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0@P`,*PaP ,  PP? @`,V:T  PQ QO  R P _E EP: _I` :@* h _A E&Ä0 l dR 07E\@!U04@0vPLj @D5Lp0? dL#) P(ht@@`AL㔄_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  Vh U %0- AF0q Q0 ,Pp@X  D1` @ PTP` BX  2/X /14  8h 0 XPq#P|QXp  1`@ UOFK:N\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / 境 dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !Ƀp f @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.AVDV{MP PP\(` PJ `M ?H 0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daD4(KЍn }0{[&%( t* (' x* H*<*P*l*t*x*(8*T*****4****@*! f + ((L*8 f f g p@-M@P`P   4tPt!"$! ݣPЍpM<, 0$H*<*P*l**g M-MMԠԠ@`PSTQ LpW@@! 04#'p( PH P;T9 P*06 q`V 7Q  QW@_lI\ F0KMq *0hKH**t**P*`**#H-M@`P P L!p_'"$" DP L壜T 0d"(( !3Ѝ<*H*P*l*|*g `0S <+ h+ + + 0/PP B1 B/0 //P(g p@-`t[@P\KTPC/EBp0*(O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQRX- p- - - `@1 .Ha@aV&`aV Q_d\8 _Y0<LHYP Ѝ S`R `. . . .  00H!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQF QTT! B! QPuXPuW&d  R  b9 Q?SE먠 g  0 H? ᄡE !?EA0 P9 4{@8H0 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_t*x*@*U h P(>g *(!g h h O- M\T`0dP p e7@ PUSQDP sP Q [XP Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0P @ث 0`/?ᐛ#"2++\%R !`0Ϡ|' r! xHE0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0p/SQE `z(1!2/pG w( X q13?A qX0/x 0 @/TQ% @p`p ,!p`Z`p@+!p@W   N=l,F=8@P0 0 ЍO; t*x*@*U h D**\g T*p@-t`P@P =@P 0Ppp(@*G- MpR `@Ph @X qP `P P  ~pf (` B B (A B B B B 8A @  㙵l)Qp R  R ZP] bP+0\>SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P##FfFX f ,pP T pW }zp"'D P& ;ffPJ{p @ &{p8 Pe Izp_ P P,@ u 0AP@@th l @D 0@@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@A`PVAVeP64} # p, {R  h0`P!@@LPPL RFzAVB( M pL| ׳zHP0 #P`UlkMȰ  P{PrJ pAP AP I @YTbfA0A@  / }yz Z xy4pmP< @ b%dP  0p7V W  y`V_pv.8aT?  ppL(!PpP (P @D @V$ P "P  0| 0}* i ,/*Xi W\ *^Z *ka 8(Ha *ʐ!*O` *^_ *Z 0(*4()i X(*!#'\ \ #[ [ [ [ h\ \ \ =] \ \ C\ [ z[ O-M)E`` 㱓 @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0bQ gQ0`pP p`D"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0$$  b b b Ec c @-D 44@( 0<6dP(zi c @#O-iMPP@uyϟpo  G"1  "" ? @P",R*?`0F|?0V:@'T  W W O@尐TY R0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WPӝ?< W $R,f f2! `VS&Q W01@( ?@d X Xw?$PY r?`n?0,0PDP U:T P QR !bPQR` ( @P, *$E?$A?`,`($ @P@4?/M0C0 (ࢂ0 0`fR `$`8< dPN\ fbX(@DPHL \` $(0,04<ppx\x  T@<%<PGh@5PU '>PB*x /LY\`\ DžP0' B0@PV Kp` Y  d V:VK  0Q RS 1c!QRSTK\ 0 0 0 P30, VPE0V A0p 0`0V1 Lp㸟O pPh(d_`P!:!&{0;qa P8 0 (@0"*z $O0 : )PUP A0@P rRp.0 n Pp GR pW  P@:PP ,.   ^ ,P4 w QPP PR00CP0xR0$=$TmT. X@Pp((,PQ5LPd +㺵 oRp5 &#05   0+'=,l6%A0sv fA@ P  P+" AR*1p71 @ JAp 'P`P:P `PX:P U:k 00 4(p 'AVE A[  P0   0 A(P P$P pᗐ$$pdW:0 & 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.EUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  PP(` P!  T Pm[:[ P Q R !b P Q R$ P[@U PLP \ e@YvP uV %"e%aq' 'd  `l(4miA@P\ gFv`P$ 0@ZP  VGU $$@<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*A?, 0v < (PGU0<*!!U:LD&^*3333UUUU**** @5q0 ;003S ;B0%V@;%P %P@0@~,AU1P\ 0(4(*** 0p'U*$A? >$P  06  0ALP ``PFpe? 㰦6`Tu V `#P p l h dt&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV1?  O3  0 ᴰX pⴰfH8(QS*` 0?0>LpP`JPA\Vt @`Pd`plh|t |GPPr &X2@` 0 Eob@U+2&0#2:0%A0}tiߍ +!    ; 8 0 { 0v 8p   cԐܐ Z*i *i *vj j n n **k 3k *mk k ***#n #) P(ht@*f ! + m l m Zm *m m l X(l Ll h(@(vl El f k g Kk j Lj "j i @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\  *H-MP`PTp`H%G!  PЍ ***n n G-M@LPN TL8QpW,appP9`V5P P+02 q`V 7Q  QWLS:\ D0ۍG9+0ۍ*+*****#H-MPLp`@%G!  ។PЍ _**k l G-`p O=W @ ` pP @  v1PUB@D`Rq@ b1 **G-x`0FQR vWO:BPK P 0@  T 0Q0 pW S Q @p0 pW᥅`! 70fF&0ᐅ0 A0 @ `  *m !4"O-MlpVP} ` W%:( 8@0Qx  0+u06&000A@`(`WO*@WP 0"p&!&T $&0f?"#0(  h0" XQ S 0$&?"LP5Q0ᒀ$ 0 P (( &d 0DЍOhT PH *D4  00" *in ;n n 4(@n n G- MpR `&@Ph @X eP `P P  qpf (`JP Q7G@ Qg@ P1t t t t t u t t t u t t t t t t t t u t t t u t t t 'a 'k 'fkЍ 0io o H-@`pPE: P  V  0Oo H-: XX@jL 0+P(o p #q G- MpR `?@Ph @X +bP `P P  opf (`~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT >3 P*V [aAi/K  p0lp 0PPo0  lP 0APc0 lp mP0 p[@e(QP @ 젍P QZ rPPV ` Pp pFo$4Pv 4Pq  P@TPV젝q0(Q  @oow A 0  000($sU @3P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /r+P@0S  000A B0SR @A@T`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>ap d(G,w0gP nulp `/ [PT5 T@7*<?W?p#PWr jr r v #w 5w r s r r Cs s s s t u < P @ \ :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< <QuPsPqC   TpKp I @ eP P dPR ^A ZdPN8PcPI Q@P AK( (@@ 8  P2 HP%  Q8! Q/GP- 8 PDh T+SD( , `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@pq8P q@   W!DppZF0SX"  W &Jf0 vD0g"Q"\P Fȕp  D0 cpXҜU D0 cpœ D0 cp峜 D0 cp夜  0%00<000%00  \E @( 0 00'a0 U@(0<0"D0 scp  @3DC`p pp0VPP  p0Pd  0 JcpL[ 00 A 00SQ: !Q8H@(0 0, $084p0P@ 0<0 0 4$ P p2P$Q (#@0D q0S0pPd»U BDpṻpPU z  HH0 bpʠV C0 bplx 0 bp0 0|BP`p\j 0pbp P1 *bl-PAPPP P!!\P PH H@LPPPTPXP-R-P,A{bPUm +$+w x ,/h+y (+y X+YaH+y x x x 0+x D+@+x 8+ex Lx X(,+*x :y Vy y  - -y p++,,,,,(ɂ , P( --@=B'-z 'z ---Pz qz z z z p( -T --z 4z y y w w A-pP! @w9`P T  PP ІP QT P A0w(0 D  @(+ 0/ H-- Y>P(9 H-DQ 8Q ,,(( R0-P- -,+H- q`p-u O-M-Mfv @% $=; < #P!qE 0 apLt 0< P2`pL @n0 Peap3fa< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0_P Pu 0{%C ,3`Sp 's  `ß `P pPdXs`P4 Z 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  Z H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPDeA---,-$+,(+7 4z  Mb,- +X+[ +T P(- -0-@- -8+ - -ɚ;6e5wK, --@=B'O-M-8MN_ϛ@  ˟   A 08˟I۟帍席]`_@   A  0@:Q3@˵0  P  A B* 0 @Pt M P  A B* 0@INH˴LN   1H @M  ~P~  A B*  0@8H˴LN@ b&^p  ( *6^PUx<D.nI` T: pP`@P`XXpX シ XPEI U P,MI X:`@P`XXPX d :HI X PV HD PV `@P` XXP6((X =X 2U`P0P 2 * @M P Rx% A  B* 0 (``%T+ 0+8B 4EMX @E0  / RU $``W_ ," H  0 p p BP (PT`Dl 0,9` 64 ,]-p|p~d|XzLx@v4t(rpnlj-h+P(-,+ -D <.`U4P_Eq@T("  p Eqp0TUPQ @*P ,囚 H 0 p 0`pPQHlDLL EDP8 "pU pDPpUp PV,f H 0 p !0D G໴`@pT h尴`孴D@ Pl?XT--,+-8+8-@- -0-(+ +-,, ۀ р s ] D , &        -q :   ~ ~ ~ ~ ~ ~ n~ Z~ 5~ ~ } } } L ---P---x(- -- -{ h{ { ({ ,,,| 9 j| d| p-x-e| V| N| o| C{ { { ({ A-@&aP!Qp0p.p `p Q0AQ`0X X pX.ふPp!pP0pp C `p Q0AQ`0X X PXaqT @P ` AQ` X X X G@4@X97$$Z&T-X-\-P(-`-@-@%CP@jP-K--@@`pw묐$ 0(P嵳X 屳᮳p   ` (+S졳p  X4Ku@@(+| | | | P(A--0M@>T 偳|B|}tRtylbQ `sP PHk @ w(+   +S_ #Qh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S K+6 } } (+--x(8-Q} --@- -} H-M 0$P1  已Ѝ - H-@' 0 J`0  R  B*   A 0A  A LP@dtH8eA?333333?(+T-X-@-`-\-G-`P@p @ Q<QpQ\WZ @@I C(+--K -H-@`p P^U U U  0pQ /`rH/0qr  0p$H(+  ^ 0H-M@| }P P儗L0L 0ᒱЍ0x0 Ѝ0H膱(+ -Ɓ O-M@`  Qᾐ庠p1&` 0p庱 ᴱ 0ᯱDp媱?`奱V: pPW *@@aᙱV`FW:Ѝރ ΁  = O- M`p#@ -R@PP|lT@ l@Q  $ T p | H dPP p xP, qWe``P`+`PeW P|p W@XPZT1'`PWLeP`b`PL 8slsD t %W,<P #s sXm sqaQ s 0|sYV""""" "Vpp8Vp#PYrV Vp @T  Vp"P Hr V娐"@}Vp`Pr0 4 0r]  -  -% X( P 'E M ` ; . o Y" ~ ф !ڄ q p@-8@@P0@,`PP" 0έ - P( "O-MMP#`p P @'P  吇U-P w匧GW夷  ᖃ MP!bBP2H 0S` DR MRᨰPP NR6 RR  A.&QP H T8(A %QPQdP JdP P `bAP P& x,dP -zQ Z-@r)P $u Pq@@lQtP4B! PP(  0PwpWBAi$b l  3P xX0 lV! P HX0 _88 0M J  P hP X0 F 04HҫaҔ L -aA . 0 -, -T -,/(ԅ Y H -ƅ 8 -(< - (( ->-4 - $ - -P -F ^ X(T P(X -8" (D -8  ` -o `!< ; V  0H-^ @XX PᯮH ᫮< ᧮0 ᣮ$ ៮ㄫP(†  p Ƈ # O-MM/?@@`,, l`ll|<M∯\x``T@PP P LL坮 @@  P ,P NQ/P5=ꈰ븎n~P  @;   _o  Q P@P<~@P Q Q @̌Q-  ` -͎@0 @@ 0ᬫp%P,0u u u h D` L < < 0 ' PP  ,@  P La@Q?⌌ $ L $ $ $ $ $ ` $ $ $ 8 $ T $ $ @ Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP Pf[P} F@, PV(& P] S@ P@}PN ?Pt P,w  P H @@| P * :$(,048<t th,@L WPV P: P P @1, d PP% @ P P @ `P `P Pp `P$ @ᱬ(0៫P PK o ``\PXPLPt @1 0PP DP$P 0P PX^0\ P  h +I   >`Pj P@@ PBPD  D@ 0@ P* P PVP% |0 n@@oD zP @d (oPe  0 Nv` 2 |0 8sM 1`. @PP @80 iP` 됕xV[ 4  V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  l d 0@pQaQT@l@hPyppdhPn 㘷  @們Q p & d |P AQ  QD PB   <P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰPy@ThX pm ql[x弱夀P @ P:@D \l Jd`=  p` P @`)Ѝۍ荋 ! d -@ ---P( --0!!   P") ` ( -f z [ R ^, -/ A  ^~! Ȉ u" "D -(8 K-P_ P" `p匐@QQ Q  0B01F P 0p0  p, -( ---0H-P @P hQ\ 0 B 1 <QP @ P0( --, -G-`PP  VP /P../ 6p3PP* t Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SADtPp`FQ @P@ET@EPP/Q@@)t@ Q   0# h`!hP( - H-<iP0P$Y"PT< --׋ -A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS @R R R  \RpQ  " 0w P(\ 9 A-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ R ( 0  0 ( 0 @ 0 H 0 0 P q P / = #44 @%, -(( --P( ?H-MpP B` 0 d@P P P0QLX9:8< X0p叨V`Ѝ-(, -׌ P( ܌ K-pMll`@B 0 &P8iP0PA $吐P! d`PRY  0n .P*  XN$! P p P  0 P  0 PYIT@pЍ(-< -, -( ( -P( @-\\0 B@0 1 D P  R T@-(O-MQP  X0B  P# @P pt X03 dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  ᦧPW  `$`VP@U:Ѝ, -P(  ---( -0 -O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  X?P@0  P P PUt P | |   $HP$H 0W ] QDP nK `V  ZdU  TpP $PX $C(ppp X pP B0"  !d"X W> L  0< @ZpPu BP/ 0 tpf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0  Ѝ-< ( -P(T 9 - |NIL" -ڍ x |INOFNDV 0H-@P >|0x   5`0\   ,D 0$( 0H -|NIL|ONTAPE|INOFND""O-MP  X0 뀑P0:dpp@PXp}PQP@U: E 1 `V P P  ᅥ9 `@T" `圀堐XP pW PP  P  a p$@TЍ, -P(q --( - - H-P  X0 P@T `p P $p$J `@TV4@T (P$@T, -P( - O-M  RRP  X0"Y P  X0P W D븁就P` R]*唑唡lp1P` U *@P  0G  Ф %0&  @P *  " 0ᣤPP 40 R:Ѝ< -, -P( @ - -h -3 C Z { O-MP  X0Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  PU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝ, -P( h --@ -< C G-MMP @8P ,, X0 @TP  X0 ȠP':P ^P `pV  n@T@ `PU:Ѝۍ, -P( я -A-P  X0딀P8`@PP p RFP pWP@U:, -P(܏ - H-P`pZP @o"@/o"PPoR T 0RP P ,t  P% : P( O-cM@P  X09t$0``ҡc rP S0#Np 딓P T @0x#0计 rPTDʢ @C0@#㞡+p P s AP/ $  PuJ(8 ТY`PI@/0`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQPF! 0P [eP ~P2@ PH  P P6Pc  P P PcߍcߍOHX`XT$ H0 γ, -P(S -L -(r < -T -(Ґ $- h - (-T 8- x l 4-0-8-,- "(& O-CM@(PP& UP`p㰐Y AP y k  py@T:]U[ ptXp `P 0<PP P `X:P*P  0 P  0 0SP lNP b [:P Cߍ$ ->-9-, -P(ړ  H-$ 0S  |P/$-(p@-P@`  P ll l0 a ^P  ``4`p0-4- -8-(H-M<vP,0 $0 $˝s L - P(ٔ @-H@0Fp `  TP p@`7FЀ(@-$@   Ph -O- MM`@P/0 [ !  0 01/ Ѝۍ0 01/P ! @0 댁P epP dP TT tpW 0 P  drp` 0 W @`尠0 P  E +%0 0} D`p 0 @`W8-!,-`!P(E - m p@-M@P 0` @P `Fv\\ P ?   +EEЍpP(0 O-MP `4,㰠Q +,EP+Q!R 0KS p@Tc P T:P |  ᷟpP T ᭟ pP 8 0pЍ!-( -P( ̑ O- MM@)jD/Q 8_pPC @P? `P/0젟 !EP. # "  G PqP pU ỹP cpP  P^P @(0/Pp Ѝۍ!Mb8-,-H-P /0`@\HqW !  p@@@ 8-@-@D@XO-Mp P  X0&T rP#@0#0#P 0)먓P `D0 P` D@`@( p`@  xPU T TTXxPRP@`@0T `@  @ $txPiPZO P@G $ TP@Z 0P4p lP 4Dh 4Dx0ST ! 0j $02    P h0t x nt D0` 㭝@v }$ 0 TWЍ_ @# ) 0ЍOh|\}tXD}P P 0Y< 0, -P( < --L -(Ґ $- ْ  D -8 -M b H -C!, y O 9 K-MMP@`/0p P # "  0Pp ,Cp(tA qC@PTD` Tp{ Bp# P Bp) KT CC @ᔝ,S_ ዝЍۍp P@~?^l PTpL P@o0^ (hM8-{ ,-8 -h - P(Ϡ Г ŝ p@-/0@P`8P # " `Vp8-@-4 T#P D@ 0PeC,#P@ 0Ee@C((p@-`@ dPV*P ?F<P # " $@p-*-*-p@-P` U: 0 ? 0P  " , $P 0@0#@$0$0$  p 0p@- *-*-% G-M@PP-:P ?qW!   $p P@`@`TV/VPW ; P pV pWPۍ-*-*-O-MP0p`Р L@D1Z: 0P " $U /dP$ T &Ѝ*--*-*-? O-Mq(@PT̡@OP`P @@(@V($@@`Q(@A$(  ]P `/qt ` @$ >  P  2( #P!: ?,P " $ PPh @ \02@ ZЍ.-X -V -*-*-x A-/@/6P PpPP `P PP O-MPt 딀 q`P O@Phc  BT0aP@U ЍOf: .-X -D H-`@p V: 09| ?hh`1Q$0A$@T @P! $@T- *-*-( -9 p@-@P P P  P ` PPU U PUP` R P{P[400 P@$ p轕 Е  .-.- R /R  R/TH @-@5 @.-p@-@P`P>V  ` @/2`PXP `uKo p) .-O-tM@4PP $$ X0PtЍP多P K \ ₚL@P` @`GP p 0 @p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(vpWX@ T *P@,` Pq ``D@ 0QDO`V `@ 0p@@ pp @0 08p4@ ^[ (TٙL tЍO, -P(_ 8 -Ty z -*-*-P --` - G-MPdP XX X0U[  ?`p n *[ ⥙ol@p ^ [ ╙_x0@ P@PU ᠀>PJ0 >p < Z D\sT=P>@RQ* rQ=4" `!P `8 Po0n  0PP 0Ѝ1tt!`PQ`PHLP p 88` P 0C(AR`PqW qqq R( R*0`pS1100aS110 0aS11 0$0ppS11`$0( P0 7̕, -P( z  8 B d Г < -h --` - -ȗ -*-*- `!0H-P(@(-ZP P@0#i H-@!0S Kaq:pP P@2P ㆕:P官PU Z P0ዘt埘P lP\Hc= Y44 0t -P -0--P(0-a/s i !0-0-p@-dP@`@QpP`P QcLP @p$$ 0&1"(P -4-P(} G-M P  X0 DP  yp Y0\#P  S刓嘣 00+|P0 `%`V Q %F= P "% P XB PbŸ"0Pp0CA00G0LP 0& P d"pk0 <`rR pp1  R8"BP$tP } R ` I>p4ڈ  B? P B2 P2AP P t!( XJaP"A|PЍ <3& X 00!p0 X LI dd00{pA0  , -P( 0-0-0-"(@ -P - -0-4-W w >- B -$ -4-4-ޘ 5-TI< -` --`!"( + ( -M n --9- Ř "H-MP" QQ @P ЍHtt =pʯkX <LЍ$$ 0).Ó@ -(0-P(Ÿ 0-"(m O--, -P( T9-΢ ( -"(>- } f M 4->-ǣ  !I!5 A-Ma A|| X@ე  3 D!DuP-P(a -+ H O- MQ@̱( P ! Q  딡PP QGxx`  K 0`  PP pP Q:pCAW k Q*QW P 8PP  0@!0 $ dP DrP0 Ѝ -h -ў T 9- 9-  -* O-,MMP t0x&00PPP D H`PP (P<<@(P rP`VY PP H% 0epP  0P: *p0 \ 0ᅒ, *pP U #T(%5n( 0  0 S ( Q PNPP`\VF > G|* 0ll$> bS ,< hP. ( P t\{P@P  c  m7p#DP PR ,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $劲 p@̑傲 ƑP $", X⻑ 0LⰑ@B` #0 0Q a0 X♑(P%tPPW (P  PP(@PEUʐ[Ps x `U! V0pG V@Q  1T0Ѱ RT`G(@n`FVʴP``(@a`FVʧ0- 9-9-@ -4-< -h -P( 7" ̙  2 P e - # 0- 0-"(P -0-s -` - ț ( -4-ԛ  - 9- M \ L P/AQ y n6"(0-H-h``PP QLLP :@ @0@P@P0 vh -9-y - 9-O- M3p R cģCȓPXQ0 U0SWluP 5 P 5P [Xڗ# R [ P 0 [P[} Pl  pGWt"P{Bx px0pP P P\ DHP _ ,, Y$ 0P5 Pj  'P B P ZU? pK [(lP 0 xP-lqPP<0p RPA P 5 + + 0  Ѝ  t%+dQl Ō>-0-4-P -0-"(0-( -P(` , -} h - С 0 - ) 5-@ - 4-4-O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0Dy5pP A  Py`@Y Y Z Z Z Y Z [ Z ] Z ^ (P d X⃏P9PP "6 Z?5pK  )5)5ZI @   0 @x>PP D XM<P(P 54p:  44ZU P@   0@ PDH 0'P LP  ,P   XP 5P-L4pԴP@P 1/T  `4 p4 D@$rZ 0P 8[  (2/P pDXP`)0 導pW`P @SP H48E4P @ 0@C |8x# PP @P #5@ `PU 784  44Z 0{Pr p 00P $ XEL `PP  X4 ЍOE`P=  X%7O0|& P ց8ӁdPD tt Up@8O0<yO0  `Ѝ3P33 vU ᙁ8ᖁpP tp@ 03h -, -P( T -8 ->-4 ->- >-l 4g l ݝ H -! l R !;"k >- :-f g o") ( М   4h -l pC-M`@ P *P GAPhUP @PP L PPH؀P 040  PlЍp>->->-@ h -t P(O-,MMD A "Ph`pAU`lhQ \XTP A" PA 0" XP`P P 9 QHQ  A(2/A PXQ&Q  A(2/A q A"@9/A"@9/A  pAA P0 pAA APPPA 0" `PV },Q  A(2/A"9/@Q Q  h傌Q Q  EPRPA P P< P P 0[PP!PPy P P`gQ8j@P!0P ,Ѝۍ -ў T 9- 9-"(( - P(4-h - Q H-MT  P< ЍHV, 0(0P  >- :-h - P(H-L`@HPpW0p$ p>->- >-H-0P Ȉh -9 P(O-EMس@P P  XϋT 8c@XpP PPp 0 ᪊P @0@!4᫋X X' X 0B  B  0 1"$ 0B  B  0 1" 0B  B  0 1<"p 8P ,dP  P  P P  0 Y:XX X# X[ @!!X% X- XL @L!+  6@!  M@ pP   @   4@ ptP 0| Y P X LEߍ, -P( t"( P ? 0 ( -a q   /p@-MP@P  0|3/xPl /p ЍpL@P`q-L< 4 0`奊㊇4 ->- >-8 ->-h - P(p@-M@P  03/P x 0 p ЍpL@P`;K< 4 0`oT4 ->- >-8 ->-h -ڠ P(H-4P4`4@pPP p -h -l MH-M(   4ЍH Ѝ/P(7njuu7omw|wUv0H-MQ  13?  Q 1 Q <R 040,@P0Ѝ0>-Ih - P(K-M/@/-P Pp/P Pp/`P\ 0`PЍ0H-PP NN@P0p `P TT X0HƉ0@?K0  0H踉 8 -, -P(  0H-M@  h  P9Tb,ۍ0腤 >-0H-@  Pᆉ ဉ zP  r P  jP  b$P p Z0d\` S R LN<<0HP(Ȧ צ  " ; I K B-^ p@-MP@ P`P ``PPP8,@, ,0 ` Ѝp襤 >- 0H-MP@P.p \P PP X0Ѝ0HvJ$ ( 0Ѝ08 -, -P( Ť @-@P Q P K G@tP.p XP LL X@=J0 $ @趈. E 8 -, -P(e  @-@P  @pPD/p TP HH X@莈N J0  @胈u 8 -, -P(  H-M`@PR P-p.I"VP-pڐpP x0x| V X0PN@ I,, 0 ?pЍ 8 -ͥ P(, - * 3 MH-Md   HP<P ЍH Ѝ/ PDP(0 -ԥ" 0H-PP 0@.p T@P DD XsI0  08 -, -P(` 8 @-@P O K@pPO-p TP HH X@ŇAI0  @躇t 8 -, -P( p@-X`@PU *PQP@ p-0H-PP@:hPQPU@u: @P00H-@P     {  r t  P P@ , U0B-|NIL" "0"|NEW|KEE@"0H-@PPPDD '0  @0P 1-P(t A-@Ȁp`  AQ  :pP U  AQ  + P   nU yUP(-G-MP40`p@.PP/P << 0$   0p`彆X1 0  0   姆  塆  囆  商l  t叆T  `剆 /H@Ѝ8bH -h § "ɧ Ч ٧ A-MbP x pP d \\gP ,,98P P| P@@p0P Q !0  qpWcJpp_Q-Q\0Q0!|p C^qP?UBJp* Q%  r  * 0,p@PLZ ` @ P  0{,PJP * 0``o,@ 0`f, 0`^,PЍHF㹂D㳗@4㦗F-T F-F-!T (u l F-P -"_ D H-㔗$ A-BM@< P`0᠄  Bߍ F-H-PL@`p *pWHRF-@-$@P F-&0! H- Mp P0@eX PP ` 0   p  gP -)Xo   P`qE@-P*   8 P @PH @P\ \\- XP2 @P$ 00-D`FP@:Pa0@3S) `@BK缋 \ \ ȋ \ ԋ \   \ 4 D \ | \ \ \ \ Č  , 8 D \ ` \ \ \ \ \ l x \ \ `R 0A@@ S3        ȍ  ؍   @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   PB!X  aQ QP 7o/oP" Wt`Q pp@paT gT cT\'  p(P ` p  (@AP @R p pQx `xp@@P@ oP PD  @ P@@  VP P( @ P@@  ;(P P(t , @ P@@  !P P, 4 @ P@@  \P LP4  0 @ P@@  P P0T`K`Q PP $`@P`XX X 㱁hp@P_ 7&p7P `P 7P P  P`L\\iBTB3PP 9p@PP2p@P- <P R' $0 0y` `QV1AV0v QV  `#F-F-p@gPD P@ZP2P " 0P  V3$DP TU 7U UF-F-$Me wL H F-F-F-F-F-F-X(F-A4 9$9(9,9094989x!'F-b`^F-F-F-F-F-F-F-F-"F- F-!1 M '"  G-G-`G-G- G-F-F-`$(hG-J-  + 9 J W P( ֮ ɮ ̬ ]"!~  h L"0H-0P@P PPP0"(O-4Mp`P@P,Pl%!,0 $"00 (P PPPPp0P 3P P00 p0<P 0P ~0pPp UX*` P, R  PyPP `V::x  $p@7P ,Q>8  PP M ~0@P  ~8P 7P P|@tY@p4ЍLX F-F- F- F-F-F- ! ֮ ɮ ̬  O-\MM@`P QH 0@<$\ЍۍOJ~H~E~@P}ě ě ě ě ě T ě T T T T T T T T ` T T  T x x x 0#~#\P{tX`rd~(\s {e8~  {Y x5 8}!p4,0,#W W\P oHzX?  }Q, Q-)"}"\Pz0X"\Ѝۍ}dAP礝 Н ؝ , < }W}T} } } Q\ЍۍO8[j@Q:g@P189 :0T;p<`=Pp`Py}%8;=E4@APBpC`D9 :0<>?($ `pPP4]}jP8 @0R} \ЍۍO}\K} PG} F- 8,H # N { #P( # s u έ ƭ ܡ T խ k ###W d#O-DMMQ `XP}L"@Pz4rXg`@P`XX  W~ 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hXc qQ4Xb0 .pA~hXJ pPz  .0&K 0 .J| | ZP@`@P`XX X }XDЍۍ蝮 ]#P(I- F-7!O-Mp@`V` ` GP   4  4 4 4 $ W W` ``P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P 8  ,   "Pp p P@ P:0WW``- W]( Y /P1 W/`P p!`Wx 0`Zp @`Ѝ_p 0  zЍOC/`XP WP ۠p.P YGP    Ba`P9`W  ?( F-`$(F-F-ܯ ͯ p@-@`P R!PU e1 E op F- F-ܯ H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0F-0H-P@U U ` D\ 0z0  zX0H)r d P(O-dM 4"p(0P$8,$<0 0plp<P{ z/P~ $<0 [pv<@Te @@pQUWyQQY NyQ pwd\1X @|z xp2 0`C`S``0p01 P@pP" H `0`bD 0`\ Pz `@P`XX X {@ T:4(9dЍ@Ό(ˌy l$(װ 2 h aP(  H-M8 ((0$  zЍװ 2 P P Q$zz   F 0H-P@Q  \0t4 0Hy$0Hy  0Hy|\@ p@-M@PQ`[P .P ,P `V V NT\,{ Ѝp@r0$$ 0Ky ЍpJ-J-K-6 L-@-M@T T Ѝ@Tq( 0.yЍK-M L-H-(ML 0    R 0 Q: fy(Ѝ#. p@-MP  IEP @P./P X`P@T^@@ P, ЍpJ-K-@-Q R R  RR@[@"[@0 xK-q p@-lh0 @Q   A.@R$B@@@@@P`@ BU:  pL-W 0H-M@Q P5_EU_oP4O T +PQU ʠ $<P,U$$ A D G H-M00ЍH-M  0ЍO-M`P ,@@Pp-Q":P P PZPP@GQ *,@P(PP@Ѝp@m눱 @-M@ 00 00 Ѝ@?O- MP@nPJhf儖ldv\ Kb@Q   H ( 4 @ P  \ d DP!h4:0 ㌊pTP850 SQR4  50S40S L9RQ(% 0 S9F X9P:$000$@T% PP t{` pGW:PV @`` @`T #@PP +P3 `Al3_@dpnw띂lCP+PP PHPD pGD9tr@PpQJ :PQP@PPhrC eP<@ PqL 0   Qk@R@6 _9 wtqȁ`lLPG 8Pe Q UP:P@Qd Sd , !@!!@ !@!@2f  r  dpPq\B돱 4M-0M-,M-(M-$M- M-M-M-M-M- M-,/M-X(ճ (@Q-ٳ T*HQ-ܳ a5M-P(8Q- C PQ-'E   Y"ϱ "" H- 9wtP( pC-@PЀKx4ЀP P`@ @X`@T @ 0=P MtIUPKp Pg`@Q-(#`s0H-@PGDA>m/9PJd" @X咗  D 8P% 0H40& x 3 HQ-]!5M-K-MM`P Q Aሑ!1@uxjpP l1@Ph pT0T! vY V @G< v 180  83<V "v< & 0*0tv Y ! 0 R 0iP Pq@ЍۍTQ-XQ-V \ T PQ-  ײ HQ- 8Q-5M-\R- j p@-XMlbP `B `PLQ DB@@BP@8<"40  7^PpXsP m/]PJ P3jQ!Q0tP<AU4PHQ xx1(!PlA,a@`Q`P /50P!P1 QQ QQQR0  U hP =7bPU%(M-P M-M- Y"] PQ-= 5M-Q M-M- \S- ,M-W J b 0M-e 4M-h M-k $M-  M-y & n w H-P Qr M-& H-h\R-H-~6 O-DM@P b r$ )Hh@ Q L \ p HPVtEPGA` ᄏP LQL!@1 @ tPhp3@$ P > p$ pʷP  pX ŊP@ d ỆPD8(㲆ݴ ,/t$(p$(X(S-!yt Ct X" H-e tqP( O-DM@PjdcldlsdT {G`P a@Ph 8 ` p 8 AP# MP& "Lpw4PPp pQh!1 E ` XVppP X + 4(PL PW " 0@:V& X*tP: H!0@EP apP  - 0EpPߠ X X ap@ pGWʌ@T@DЍt㺅,` 㵅땵 S-S-S-S-S-S-,/S-$(!S-S-S-X($(P(S-S- T-T- @-(M^ \\@LX880$@D@,   @ @sp  P(0 e n Q [ O-TMMPL<00 8|P,DceHU(@`L P[ 싟K쫟`Lp]V0 0 `[0`x8V4K 4X 8PK+Dx;UH0ppD+@;UL0 8 P V] P V' KP<Q XQ8  PX XP : P |erXQ8 a<P Ddj4X>| @<PT(<@Q3 P18E> p PP%  P| +r PP x#rPpWP 80 T TH<00 07/P<AQ H  X @ 8   8pW P 48 @<&P @P<  @0p4, Z P@&@PP`00(q<@P @P 44 qD#qB q@qPHppp$p \G GP,3,/GpppP hW,%`,!LGp  ,W,(,Gp  V, ,Fp  V,,Fp  V,,hFp  PV,h,\0Fp  V,8,,Ep  U,,Ep  U,,Ep  pU,,PEp 8U,x,lEpW \%@P 0pt,,$$$pHQ p(p p[I8@ E> @@@zpt @ 0G8 @@PE>  PPPgpM P4 Pj8P@ E> @@@TpN d@ 0!`%8PH @E>  Ap; P$0H8@ E> @@@1p+ @ 0@_0tpPXT^ 8Pp 0`L PP%%P @E>  p i7"q18<@@[@T' *$4Y3*4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $$0 PP  0 PX4 R-2 fmT- W-7"`! x$(!$(S-S- &!{ t o h ŵ е 'E W- " 5 Ķ ζ "  S-S- $(S S-B '  O-MMp=^P @TT?QD@oP.PQQT o P 弿 (c$,,$ `( 0p+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD P; =PP4H=PppP `P`d00@D,dD`DDD,@pP _@ = @P  tP W ,Pz @@ P p@  PI  P^  Pb  P  P  PT @Pt hBQ0          aRm p p QrT .P PP@{ @pQv U@TPY  @PW PV {PU vPR qPO T . @Qo Pl}P8 gRi3Tq .PP P@aPUTdP @ P @ Z ݈PL@ =PPF=P@P 0P0Gc` X>FtM.p ``X3 `p0 `d0`F> `;p D`@P;!9Ut (`0wd ㊈P` =PP[ =P  ==P  P9 =4`0@P`0c <BM. p  FnX 0 A``P`d40 `p hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP ,(P  PTTTWP :P`ppd J"PF/ (P P7 P% ( { @PUPL(,P@pW`,P* X . L Ll  Pb Q vQ Q Q \PTtR:"7!PT ``F> p H`4 G 0@ .  =UO BlJ(=lB &&PW  @Q s0{ppP ppy pP.` 堠7 P   PJ 0pPI c 7M. 0- 4 q 5 q'  @P LQWP JP &  F0 ̔0pT@` A$ M> PVp @@_@PT!L-  G @Q  S-PP   `PP h$(`PP PP  R%  S-x$(T- ФZ PZPZQ)Z&PxtL 44@PS- X  ( 6,PP P S-j6 M `0 p P P, PC 0VM.0(Z tP |C 0= 0r 4C0 0,F.0% # D X uдp[ [*  3("S " S"# 7d`Q PP= \P1   +PP P  6,3@POUJTH TP@PU*%o , `d @ PP, @ PP@ ."F @Pg번"-a, tHꎾ |@꓾ Hhl" S-T-S-S-"x [ 6 S-S- W- S ׽ 'E "#!  7  b ("S  Z ־ 1 m  D e  M0H-M0@P00|i 0P P AAЍ0HЍ/K-GMP AN` XZpF` 0 @ap`PV`v  sXQ:#X`Gލ Q( QU`O-$MPP/^P tPt@` /pF  C 5|PⰰF`P$ЍO5$(T-U-O-\M@ `eQqX: T,P 07P P  # " P@*Xp\Ѝ` @0@4` @0@ 0{U- #ն Mp@-Mx`@Pgd iX R LL0i  j,Ѝp@ Ѝ/$( S-T-" T-@-@P \@Q 0 %  L+ pp@P PP <* 80T(PSfS-S-+ T-"S-A-M`P @1P(p 0 WЍRWP& XW QhЍA X0ЍA`P P# PE  BX3 DW W fh! ah ,X   Uh# X  0Ih    0|=h  l\\0hWPЍA*h ЍAgS-S-S- $(!S-W m #) P 0 un"cGP(K-`pPP``1@ p 0 WRW P9 4PW gKd X0KP gU`PEP gQ P gU PE@W hKgW W0g Kg  gS-S-S- $(!S- r tcGP(A-PLP <p P* 00   0tP P d@܇0T ff8< _f(Ѝ0 x붺 S-S-S- $(S"ջ 0H-MP(@  0p P(  0I|@Ppp &fP*P  00fЍ0 x붺 S-S-S-$(! O-|M⠀@<X8P (xpx 0)PpPqP(ppPxpP `u t0( tpp p@xtt(@Q8`tR 8(fTI8 X 0,$(Hp`DP 04@T` 8` @P@@D@@X`H@ `X``D@L` `(p@`H` @@T`PP@ L@0`V$4@XP( ,0t T98,,Q< pY !<0I\ e G ( 0P Ye`Gc0cP 0 0KepPpp Y(p8WT|Ѝ< wS- C $(S-S-S- O-M⼀` `pW 0 0GP}A@@P P0 @p RdAW P  0:ONIDP PA,, `Pvp@ 0wd 0P`Y' 0 P dP`儀@pT d d@pT \d Ѝ  #w S-C $(S-S-S- T 2 O-M⤢P`P 먐V, x x0 pA p[@ T p [  P2  :Pna` 0 `p VP\A嬐  V 0w%4Fo5B `@xp|x/ P0d@c0V  V"   0Cx@|x /T Pd 0c0  ЍS-N < S-S-S-k K-M0p`P 0 sp3 9P,  0 ap$ P c `V  儐Pp@2  pc ` pV: ScЍvu S-$(! T 0H-(MP8@ 0p P&  0qtPhPc :*@ ;AB+@ +S+Ac(Ѝ0 u붺 S-S-S- O-$MM@P = T9 s~P `@ZT.P, PX_``8 0`p VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 ЍS-ɀ S-S-S-H-0 l 0@  @ @ \R $0@BR(O-MĀ弐`Pp @` 0 T  0 p @`VTD|@P Ѝ 3t p O-dM`PP Z8 p@ ^|]J 0 a  0  a 0  .[0<WP @Z P K dЍOEa` (e 0H-P @P08PU 4P 48`PU:yXP0PQ4P8P:pXP00,Q$/  S-T-$( T-O-MMP`c @VP @u앟 F쥟 4TP0U@%PX l l l l l l l l l l l ( l  @ l `   l l   X   l  l   l l l l l  PAP DPYPwPr@Pi PaP[PS PMPG 8P1PspP#jppW  FP P:   L8W`V LP,P 2X WWP P PWGP;  d  d d d < |PgFWڀWI  WV  WpBpR#lPj `XP SP8 _v W; @Wr!0 0  0=Wd A {p[ A VP) mr\P'ZIH D!00 0  0f8 '  Np  ?0P&D] r _*㏕@_T 0 !$!6q0p_] X-X-,/;!X-X-X-X-X-X-X-X-X(D !d  U K-P@(a(q( 2tPP>aPp'D Q Q`Q@@eP! @P:\Q@T tP d}P@HH P_8 _\ o X-,/X(D X-P( 8 0H-h@ P_ _| _p _d _X _L _@ _4 _~\P(F G H-MM@P  ~UP* ,P%J    `pPP 7P ``P   `=p4>`Ѝۍ4\N s X-X-X- 0H-M@  :UP DPP 4  p>Pۍ0X-X- O-oMM 0@@@喬P" 0@剬P*P PpB ;K[p $  .pI @(,P $P* P: @$h  .p0P' jP!1  `]P p,danXaP Z ],аX:@(P.  .nP(P% @P 0a P `]X `7|`P # ]@T: (s)PPkoߍۍ"#!|d!X- D edA'"O-MMiP9[`d D t PP P 0TP PY  =  aPY T XP 1p4p0 MP `P Pa ,%P P x`, p*8  ` @ozPBp1 }x`V P Y p"p2@`\)P D )8_$H E= "2\@pPU KoDo `A`qi`PTEY @P8 U ` 0\<P* U  \  0t]@p V   0f]l@lpP 4)P tPP 2Z0Z8"od !g X-q X-D" ]" { xZ D P( 4 @-@pP dP   p , ^\<X-_ O-M-hML PH (0@PpP- `  p(@W  U$` U U刈 "h` LDP @@dP P( PoP`VT $` PpUB~P1`FV PP0'gǟw `[ `T4P$ċ@  P0`LP HpP /PV{ 8P<PD @@ V;$_` ` QXp ;$Z `FXp G; $UP`9Xp _P0\4 [zZ 8   [@D <0`8P 3d ?SP04 l[d,ʿ 0CP G 0 ,9z p   K[ @D <0`8P@DBTpP (P% ; $p$@Ph ZP ``PWp ;$_`PWp Z_ [Y@$PZ U P T;$ @_` p`Wp ;$Z`Wp [ ;$ sUpPWp  sp`  s A{F_ZP0tl#"   dPo 0 0  0ᡫ t `P; D @P_ 0AWp ;$ZP@5Wp} D[$ ; UP%Wpm D_Z U0_PdeU fhd@Q$_ 0F  0?p 08 0  3@ Qd`P$? H0p"L tror AKHP $0 @ 0LP0 @4Zj@hЍЍhl|Y@ ? ? ?  Q P@V@ ( 2 F  [ I r h O-MM@Ppb n-fPpp RPqPk !Rc P`p sPP\ @@ P AP  a@P@ 3  P  P O@@ FP# < 7YPtP 9Qpl9 R<? Ѝۍ $ k X-X( 1 Sy ; H- ZVP(F O-M@@PZ ,qdP! `P ǀ`H~A@U U @B yP rP `FpVN9`ЍP@P `@`P(B.OP kX-X-X- [ H-P P P||| Yt4hh h0LPd@dp`Y0 SD+ H 괄-g .d."#!"!~iH 0H-@PP PQ eYx0 RP\8&H4&P0< e00 0"#"-: d. ...H-P@P@T`p|T Q\ jTDP 80 %,%P@pX-.Ą-"# . H-P H3  d.H-P H3 "d.H-P Hr3  d.H-P$$$ X3贄- .d.H-P$$$ X3贄- .d.H-P$$$ X3贄- .d.H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0% !T Tp @P P H |@P PP B3Aލ/ : d.P.`.\.K P F O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXqP +ٴ lЍ((y.h...-M O-DMMP<@l P$ <>Pc @@c:xJP <<\ PT <@ BP 0 P3 <P. < 00< B@0Qo0TA0#PP <!@P@PQV,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< U@PQY K9DЍۍU d.x.tA \---X.\.`.D-P P.K -@-a H-!9<P 0 ,,P H밄-- \-A-XQPQ DPD`p@ Pp@x.-D--O- MMP@P\ |PXx`Vpqdp` 0'U忹L0+8@PJ0?P 0U 0 U塹 +0@PZ0$@@0ToPaP nP@pP qPt t@l8 @@ TH0 | Ѝۍ-D-w -i P(( x. @- 0$ 0 @8.} Y G-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0M@WT  P0 2W2p@pCT Th!<P P @!<P PP O/@3   0/㢷@+PA r( @ R @Q  VTt 0U)P@@@ Kލ(3@: / d.X.`.\.L.8.- @- 0$ 0 @J8.} TO-MMP P"<P 2B  00$P P 7PxGGP t\r P@?Pt P7?.0Ѝۍdh 0/㑶 d. 8.x.L.tA \---p.\.X.`.D-} T -- K-AMP-@8SP) `P /+0Ѐ``)>p pPJP  0`E+0>p -8 4R Aލd. !8.} T-  P/JA!H-P ,,, ,0R-贄-  $ d.p@-P@P Po`t P `P -pU , `P$00 RpJA!-- H- 0 -5 d.H-P 0P $$H$r-X--? d.H- 0 Ԅ-s d.H-P P!,$!A?o2Q@0!`@PP pP *AP( 00 8-@P 8Rh@P \h /R\PL  D  RJA!H.x-- \-d.H- 0H X- d.H- 0> - d.@-(@(0 3  R\- d.H.H- 0# D- d.p@-MP P P h/o"Q ) @a/,F@P/P a)P<P@,ʯ@@T P x` h0P t0@  T0QLDL 06ܴ(0Ѝp<-JA!]--`--G j  d.H- 0 @-q d.H- 0 T-z d.H-P PP@PP P ,@0pʨ IQ9,xo200pP`TT @S@p L`@``0`,QQ Ą-JA!- -d.H-MP) P'P  29P P}Q xP ll\P PPP 000+Ѝ  d.X--  p.p.D.0H-P P  P =P @p 4<ll0P \T P 0H+0<80($ 0HF d.--p. 7 H-MP PPL  8P 4qP$~+Ѝ: \ D.d.O- MPS PX!8PK HaHPP044CP  P ;P0 @pP P P *PPP pPpP ;pP3P+ Ѝ d.x.tA \-\ D.-D-H-MP$ P  18P P|  (8P PTP@P4P * Ѝd n v ~ D.d.G-Mp`pJoR@tP WC mP㌑P' W4 lW&T:p`pZH:1P( PP0Q$V/ ;`P cP%) 0,ЍGW`p*Pܻ@ :|` ᑭd0  $V ЍG Ѝ, L. a d. }4T- O-$MP P" t7P{ P! k7Pr  @@ ڼP |P o;P^ PY @żxqxPP2@`BP  @P3  00iRZ @)ᠣ ݱP@P@0 0@ @ AQ`@){縱P%%P Pp  P P  T@pP Ha8 @P   E` 3` 2/PP )J%| @P  P EY& Z2  -|.-(-- d. - X--- O- MPl@=8P LP P{( x(P Pp  ЍаАЀ:`P §P `P"pW p(P|P PP `--A 8B -_-h-ap@-MP @HP  BP P ` 6PU PP 0PЍpd%PPЍp@ 4 P F0 V } G- M p` 5p"/ j P/P:P" 5p P P  ЍPP `A`p<@cP'`PX>p ~pD/   ῡ  /pAP p. P :5P p`./ PPp,@cPP P E4"d. !O-uMM@p`xq|qtqpq`L```lq``````x`t`h|pp`d```fhp\``0`` ``6P |p |-'xp x ''tp t!'pp p'P; 5= Lp0 p pR.t\N.x`J.|Pp(UdhP&PQVxPQUh UlQh /.| d_PG Plp lPP 1/QP p \ P P P P zuߍۍ`>P T/CP--P P oЀ pPpP  T P  \P|P/?05P 4gP@@ T P 4 p%q% P _ |B  vB P `8@QpQ P &p&lN|QQ _P -/t@p t%t#P@P$ \\O 5P  ]!peV ٳ"P~ W|J@ Q;Q @ qQ Q囯PoW p@nPP  d R ?D0  R (` U/? (`͟(Ѝ` R 0m S썢 Ρ0 V4P  P 0( 0 `p Wp  p Q#PP   X`ᬌ PlP `̟КP $P P P"@$P  8̟ R 0E S1 H0ppT0(;@P0 `#p @P  P  p  R `@A#p0 P0P+ P@ @@[=R# .[~0SG/ rP@H[ .5euS FPP T&@p:3Pj P``@h0P  z A4PN nPMVP PL`@|PrKE_p,ɞQPU|QPM PNhJ`DXAP:P |P3 T$x S:P $ 0 %0&   P 0 '0*&`0 P& #  P P  0 㱣! HRh Pd 尸pP!P RL HN+pᕬ[P7 p [^: `P  ᛥP  Q QP mZ: AP PPe pXPHpW |QP/ P P -p0P$ p`%P  \ 0 (0) 8$'* F?P a ! n 0 ,p: PPP@q+<_-V? "F P82# x آlP) `P% P ! P @P  P, #l @P   ?1P h- ۣ-PT0S   ! N`aPT 0!3/`p@P -, ? pP" p,0 S  @ 0R@ " qW P ᔬPO) [~ `pt|Peeee徯LUP]>  PeިP PmGjl-0.8.D. X-- ܄-ЕUYH8@d @_ @}n U  00p@ 0ᐤP  ᯜ ᫜P P  0> &p0Po2  /p kpj/i?#pv h Y, G0< t`0_-_-x-p-à|- `P U嬎8@HU ᓪP UU ᅪ P P lalp1P!H^tQ<!0l0L!2!P<!뼽P  =PP P9 p0-x `p=/pt \2x /p|/t/l P `m p/P l j / =x /\ P <,Q{/ P厗P  r/H.\-,<j/됀P` 4|YpQ`U P P =@ Q/ PV P  s=P A/UP L  6//p !뼻p( `>PP@`D`8@ P1 P   ;  `P P[ QQ + @p  0 P ` 0  ?`0   P `4(@P `@[>6PP5 0   P| P P Q'P Q'0 P$i$YpsPJ `pWo I `-d.} H aTP,p<` 0 p `4@@p<`@( 0P ]^uP6PLPW PfP Pf XPP P@[> ,P ^Y  P'Q]J(0PP 0` T PS *Q.p P0ĆH"n,U#)Pu Ppj,TPk<' 0  (`hP@ XP( k`QJpP셟-Q [ 0QTJPQ pP @/P *R(  ` <  ;0`QCJP 0 ` 0@pY Kr | PP e& 0(`0  H @P ,[> P 0 p P ` 0  P  40KCP  0pP @WP!&# g U w )㚙 /S5 S:x W   0(< Q 0  0(P 1S#P 0 M; p0p0 8  0(-<P <`S#; P \D0 );0pp 0(PB 774`  0(0P4 p  0(^  0pX P PI! E 0pF  0  ꠀ-(  00P<`pD@ P0 @eV aU ]P `WS WG Wpt @Š! P (0p  00P<` 44!41㜪ǫ0.8.X-- H--|.y - -- x ̄-} 5    0 B P - d y Ȅ-  $ T 5  / :à+((I Y hXh  / A _- l G D  O-LMM@  P0P(P,PPPRPP  @%@PWP  40 ,03%P:IP )%P (0Pp ,P P PP*"UP( LЍۍ`P@V= P@P8 /W PQ# P* P#PQ ;EP P4P /P *P  4P ϗ `PQ  @`P P `P`U P CPTP 9`P`` `cs@@P b@&8 +㏗ P8@<( @D\Cp8 pP P,0 !P X `X8S 0"S gK89`U. [,B尲8p `P /XP`` P P +8@t(P |P? 2Hp$1,44PV 4,(4PP%Px ((Q (HPJ0P 01_0l R.+TH244P <,4P48PJ@  P 2(p ($p $ FPJc,P4P ,41/0P 0^@Ѝ&p# rP mP@QR*4 P4 0 WLPpU | lP\/00tPD 8eQ!8UQ ,uP (tA$p B$ڌ 0 0P]TP2 HP.<x p00P `` pOP|xt4$q p1$P!~00p! P P4 唾`_ 000G~`pOpQ_` Qa Qb Q F@[@Ѝۍ <  @0`p@P>Pd"|x$t4q px0$P!~0p0L-8i-c-d----Ą-X-I --}0.d.N u P-z ; d- b- g  @ p ! -, L \ O-LMTLQ LЍOVX @pD P p= (P(, С mP<=iP(,  00( S00@BSCC /p P #P , P 8@LЍ  <zP@p< pƝP #P   hp P` PRp =P0 c W@ ] d-L-̄-Mb s c- O-LM`Ptpp̣ǿ[ǿS@0PW 0Nu@P}@   ppcP _#P  pPJW~ PP  @p@P <#Pe @PJpGPWppP  <# R   0PQr" @P  P P ء ?$  R# P+p#@Wx 0 08 (P4$p0SE/ppP r_ P=@AEpҜPP'  P #!P0  @P  P # @P   +@0~oBᢜPwLЍ#y+0p--O-AM` @P00/0 -复嬝 }匭|00p0Qxo" ,Q P(P%T PP2@   PP Pp" \P @1P[-P !u*T |  n* 'p&h#[ pD PH .PCP= |P8/㴏pP  PkW W /H+PpR`{P ޛ PpP қ P ${P  Q c 0 p/ P+ Q Pp YPG \ TP @ P *, R  N  p  Y`p  { HJPJ!PP 1/P V`AߍPh  TP P o 8 0kP$  dP P [ )P ( P |P # "#P 'tXh\'X`lP@ p H  PxWQQ gP  ` P ' R P@Q(*P  XwP R'0p `P PP4 P i!+ P( PPlvU#` 0BR0 V Pd P pdz a)T[ Ѐ Xx P  E U& # @P  P `0   0- Ѐ X༄%)U YTP @0 @P  P  Y y Y   0BR00R p R 00r( P[y ` V  @P  P # @P \ X0 pP000ᵑq܂GȂS 0 P.JP P` p 0BR0 (U P p`pP`pU  0gpTXz k(@  P HC!@ (:o P 1/TUP DQ '@0 S R Pl P @QPM0 !0  <8 @`p,`(p0PPppAP8V0 e'#(1 03^x- T-\-p-0.D.c X-- 4 --(h--d., aT.T !`!f ..8. " KTX P(܄- w ,i-0i-H. H |-  d-G-/P/p㑌P @T`pU`v+ܠ+  . V%@1dp1PpW u`9P PP0PPJu0QT.Q@DP 8^ w!`!,|--x T 0H-hM@\u LPd ք 8Pp%0- -(h-A-MLQ@PC `lP    0OAP  &( %PP uʴP6T P+PPP`P ۍ@~0P(ۍA4. 4.(|-d. @-,@ @0-c-G-dd@PP LT Q88rPQ $r " BPP0PQ0 ,0Q00 E?SSEA<<AIoQ$N@ (A@0,A4A4t@d!pA880`L!01<<8@@ DDRR AYP\  ܃l@ l!+҃+΃@W+ɃW+Ń m P  G/c- -Hi-r--d.4.c-b-4.P..-.T.X.\.h.y.`...0H-tP4 `P T P,P 88 80(@PP 0--- c-(|-x.c-p@-M@P T 0S00U 0 `S0100 `P TU T@Ѝp@-P Q ttͶ`H@ PJP @4.] d.- 嬶괄- O-4MM0,@ O,~^.>@0@~^~n.Q ^n~^@^pp@[>Pn~ @@n.@@d>@8d@@tΟPx>~P|.`n@@@@@@~P @(+ᾂ PF*f0.0~(.P  ~P& @P P P P D  P l P< C~8P R Q P i 0~P P@@lP\P,X PP T Pll0 0`0,P 4p@DW/ @ 0,  X           d       x                             <      d p H    D  , D{( nPB( 0P :z( +征 0 P:8   0  @  0 o, X)0 eTH|@ z$tp xpjp x댉pip$$P\ Qc pWS @,y( XP ( 0P 7=,(̐ 0P& tx( |P( 0P <xP 0 p $   0"4Ѝۍpq`@ 0E'7w0UA0,@@,  㠓xd7 ŌPZ@W@w@@@|PQ -뤕P @Pr>@P P PQ PQ +ᘀ@ Ttx+a P:?P X@Q@w P , @z  FG|&PP u<|P  u3|P  u*|P  |u!|P  st|p%pP j\|X%XP aD|@%P  X({$P  NDD0Po[,:RP ,Pd |UPld ,@p@P `p00 ?Q  0!`+,tp帓r帣 DV@@04 V P R P 04@ !fP [0,p.8 5    ?@0 ;3? 0 43 P0, $@LP P(,p0 3 <-0-4-g!8-x! H-D-p- @-L-P--T-X-\-`-l-d-h-x-|---------- -Ҕ -A  F!& ;!! G L -V 6! P(--- (/n Q Z ,/؄-܄-D Ԅ-!", Є- ̄- a Ȅ--Ą-+( - X(----- --N ! ! M t } }4 "! , Q |Q -A 8B -- O- M((B44R4bP  RP  ? )0 p  Q PSP pp W| P lPdT! ~$  2/PP P  @P  P     ЍP  @P  , )밄-- --= P(-l -- - -- A 8B p@-xPPlP `@`vP PH1F(@( P p-+("! - * p@-@P 0`PP QP @p+(p@-xPPlP `@`<P PH1F(@( P bp -+( - J p@-d`dl0`` 0HP\@ @rT p--- . --$.H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUW%(O-Mp@`V, PPV( V)tQ@\p1pdd!W MX!P  `Q R L `PI ЍOЍO!V,ⴰp`P p| 0U 0\ HX ` } `2/Ѝ; - @ - a%(0H- $R!R!0S S1!Q0t100 R R R@!084!0S S0100@ P@\U "UPU "U P@PU& P@P!UU U UT 00 0S S 4 0( 0- .$.(.+(+(0H-P T@P PP PP  @00 ;0+( @-D@p0P@o+(-O-M-Mp$  $p P+(<8@ (PǎN/Ꮟ(P(⼎N/ᄏ<@8 P  jP u 0S l%(P@T3 p4 A(5  A%( (  _dUdPj0`Q-@AP @D T$tdPp?DA( jr j X`@ pP:j)0$  uK!uPP:S0:UP$j( JP(10A,qS @D4 -T=IBJ P@   APЀX0 3 A  QR@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0 PR,@@X!@R : P\" Ra4`p\4 AkG   H 0 JT!eP$P!ePx ,(P ލЍ P*p!e Y@LL!@Q5?e,AQ%.v w,BD@b"(r02r 7"cA qdP0| (@0`u `P%3,.A4.8.4.4.p-̄- --\-& @. 0.E ,.QL 0## $#V c ų ! x @- M @ @ < Ѝ0H-0MP@ ߍPC0Ѝ0@-@@O-M-JMPP- F`F?pPQ @C3 -T=IBJ   Ah@T0@`p n3 A  Q3`pX p $ # 0 F=P9[ڼ#!HP1 e0 PK xP?@K P*8#ePvw @#` pp7cDepV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0V`Z pX@"fG ZPyJߍЍ.A Y ! P@PPPP2@P2 AKE4 H 0  Q%ᡏ,!p@Pf @ U: d0@vw @ ` pp7cGdpqQ`  W 0Pp Q0pSh f`\-X-4.p- D. E.¸ ų $# 0.8. 4. -@-錌\@ RHP < 8,P u@p--- O-kMPpPN `@xP/ n5pӫ.}뀥p4P| ZP  P PQ P p  HP P  @P- - d. . :P p P| P  uP P PPJ?P p P(EPPJ?P p P.Qs AQ  KG Q  Q Q q R sP PQ ,Gp @ U Ph | hrP PP P H @ Zq AQ  F Q q[ܡ Q FpK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P ,P  p NFpFFpkߍXhLddi`Te\c8ꡀ- 4. d.-- -|.( . ' 4. P  A-PR@`  P,P AQ  NFP @Q:p '"P%a@ AQ  6F\P p"P HQ %Fp; F@Ddt08A`p AQ  F[P \PQ  Q P ,P Ep D`Fdvx@DFX@@P HH8@P=P PP @q@o4.4.< 4$#H-`tPP .{@P pP 4`pG XpPoB@4.p@-MP) QQ  ]Pʌ! yQpap@l1 R0P0R LP R 8*.ЍpP PP  ' ``7v 0` `/v ` )v ` #v ` v P  Ѝp@^-d.-] d.:!`-<-4-- X- ."... ..-"..!. .(_"H-@.K-MpP`*뼐@? T*  ` ?,` B0pdd Q`Ѝ@NJ $ 0D-- P(-- O-dMPp@`QP PPP `W P 4P V U ~  0ppW ̳̃ԓP `0S  [ W P 0jpPVpP \P ᗃPᔃP pLu u uP p`P: Q  !@P@$ l  P@bTQ d @P@P؇P4 $P@Cˇ`@T&QPP!@PvpWEQabP3 PpW:T@ xt1p@P F PU ᄇ P 8 PU vP *dЍ)t PAP|| 꼄- t --p  P(`-M & . 9 A K t.---|.y - --p.p.p. - d.A-ā`P+PKV q@m P:.P Btt07Xd @nP L nP 888!P V  SeP帧 pP 0RP @@tV  @ ֆpP  1s0b Br`Ą-X- 0. - L -l.h.  . .g L.-@ 0H-@Q @Q PP  mP tP dP T P0 0( L. '" @-@P yB x0 t@Rdh0HT P <Q,4.l.--h.--t.d---H-P @P 4 0,P ~0--- -H-@PaP pP P㲺BpPJ㨺厺P |pP P㒺A@qTP &-4.d-L.V H-P /P&& H-P`p @P /@ R* T 0pRpp`FPt` AQ A PpT,`T P(~ ^ l @-@P x&. @-@?Pp.O-MMP`QQ P RP cA@@P \@ R BP{  wP@@{Q`@T``rp+`rP/P +(rp+#rSpUڤ!1TpppUp Xo R 818a8p> 0R @dP:TU o P    ᚺ RT @@@pc@Ѝۍ-@-x.X9.\9.-! X-\-H.-T Y d.0. X5. p@-0MPP `,㚄 0@`P L 0Ѝp@P @ 0Ѝp@-a A-M\aPTPAPpP 4iP0 v@P<   R0 00 @ @-@U)  0(v"P}Pp@U PpPp @P  @ pЍĄ-X-L.Q d.-0.(( O-,M,rPbP@PB PGq `BvP.Q V  R `Q   Ѝ-t.ad.p.p. /O-\MMp`@^ 0  ;7 5uP HS +7Qm LmP P R PUP ᤵp8  ゴp* P {pG <8HP 㤵  hp0  \q(((7 0nwꫀp0@   ; tP  +l떀!@R[Tꍀ$P+8pP! XH0 m=iS00@,a@ SBCc / 㲀pfP b#P #X![AQ"P<`  P*T0p ThV} `;`<7 \ЍۍŠ!- ̄-Mb T4 E 0H-@Pk0HԴp@-`XP@{P @{P P $@@p '" H-P U @-@p  ~ MO-DM@h h l0 HQa 0㯴넱04|A `=p04P 㚴(80 0 S0 0@BSCS /pP #P "P  P$ pʘP #P  Q  A<@@W~  DЍOЍ/ @̄-Mb/(/H-M$Q 0 Ѝ0H-@P JP0P @P0p@-MP0``P @$`P ڲ0+@ЍpP @-@ϲ@/O-Ȱ " p.(Q)|!;.P(I 9 * !O-$MM̢@# pP'v 9 嘒 @     % \#P` #P P "`@f* z@* @#@P `Q< ܮ# Q#QP-  P'X X  X LOP <` $`@V ᎮP 埈P#  P@P # }P 厈OP  ` P0x @)h< a zᕮ$ЍۍB.B.lE.<B.F.D.B.:.Xt p.( i  PB.B.A-MP P ۍ@*@Q:ۍAIP ,Np H 0 `P0  ۍA+ E.:.  x @- R R0R0C PR R RS@@R `S RH-  ElE.:.K-MpP@a? t E! @DPt| Ph`h@pQWYXF0Q s0W pЍKŇ ,( ,,( 0H-M , PB⬮P 岇ލ0+_p@P# , PǭU í 㱭 y| < j yPPPs奭 {% Xt p.( 0H-M@8/LQm( 0P00f<Ѝ0p.(QfyhE.@-` 0BR`0p0R P X 0X0XppP P\XP L@ L[P 0@)@dP( tE. p.(B.5 O-M`P #y#( U P PpP``[/ R  , M `0`psO@P 4Pjzh ZPPzZ Z Z PP  Pz Z" P  P P PPK PP p  p OP [QqAP  <  QPP _ Y sP > QP Pp6P` P3PxOP s? p0t V0lW8`8 P ЍO'B.<hE.v B.B.F.p.(B. pE.D.  G B.PB.O-M`@ @1 [P) P {P ||p  [   e _PЍB.p.(pE. :.A-MP  P ۍ@@P:ۍAQt`P P`[0 @PP P W< ,ۍA^ E.:. p.(e m 5 H-w ~ pE.H-BM` 0BR`0p0R2 P0 X 0X0,PGxx \}wzwT!@&DD j\p`P. @PpPPXJPOP p P0C # &@w=wBߍdi2w/w@,P(% B.<B.B.F.B. p.( B.PB.H-BM` 0BR`0p0R2 P0 X 0X0,BPG ٪vv`!@^&PP Y\p`P. @PpIPPX#DŽPOP p P0 堪 ,&vvBߍp@啫㒫vv@$,1P(% B.<B.B.F.B. p.( B.PB.0H-M倄vv[p @P PTCkwvtvЍ0 0ehtgvdvX/LAyjP O9   0Lh P(à p.( p@-M `GP @P tP4q  TT H !nP,Ѝp@ЍpB.X"p.(B. B. @-PMX @P MP @P 4\Ap PЍ B.p.( @-@8T ك uB. 0H-D|ATP(Pp ᭩Ip.(B.p@-M< ,PH A !00 㓩e GQY c? 0S$ {/x    ?0 0,S/܍p p.(B.D !JApF.0H-0MP@ lpqP \D0@ $ $0Ѝ0B.JAPB.p@-0MH`@Pk4q P  $0ЍpB.JA0H-,P,@ 㥪:I 0H螪B.zt @-@YT @0H-@PP EPP 00O-$MP]P@ԥp%5p ppp %~`tQ; pOP0@ Q,* 0@$%$5` pa@Q4̉ Ԋ < , ̉ H EPw FP- Pz   Px  pP PP`PpPe @pPe 0p죟`P PPFlP`/0fP. `:P} B  `` k0 0P \p3oP*V  IT`D~U QiQxA`QpP @!00$BssssA0! pA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=|" Xx|dPR -(F.,F.A.?.HF.B.B. pF.,/ S! B.a"Г_ 3 T s ?.X() C!L ?.N b S P(t$#p.(l H- 0@ZeP( H- 0 OeP( O-4MPLs`oP7 pppqt`@``P- ]P  4 P.p Q =Q 3D:@P`@spP@4ЍiX P `"4@ hr ?.B.?.B.B. t H- ?.?.K-M܅@P @GT][@PV X[P /Q% jP,JppUp` P PQDP4U0 p  U ޱp UP(J: P"dPP /P@ŧP 4td@0$S \TQ DdP RP (P : խtP RQ P no#@: 㸭P: 尭P: l|娭Ph: `堭PH: D嘭P(: (吭P: , 刭P: <倭P: <xP: pP: hPh: @`PH: `XPX: HPP 4Q,(Q Q  Q Q  Q A pA pA ذp @@T ,QcP |@Ѝ<0 4u u u ,'@.@.S j @.(q $#$#"A.Q }!DF.HF. F.,F. B.oA B.pF.@F.u"p.(s" ɓ"!!!~!QB.\F.L.(PF.W.(LF.R?!TF. `F.S"XF.R! dF. hF."lF. } X G-MP@뙥7 呥咦_qSmPED0P>,g$$ @ @ ß I ¥徥pl#0S8VpQ PRU(C ȤPJ p<!_!!!!!!G.d!I!&! MH-M  H-rpq#@W P` Ǘp P pWPcO-lM $另㌦YPL0p88PVc  CHH0 @ <0 0@ PlP @PpD ,,0`P@p(@P $ (P#P@<4P ,(ᄗppP' ( 4p@ pp(03rP:|P@p, ᨫ ᦫXPlЍ0h @rP*@<  p@$ Up P PT@`<0mP pP @ @(`$$4$,t@&x @p&Ds& w t v0P$   p,P @P @Z 0(%#!!o!!!!*!&!G-@cS $$P>c2_P`rYl?G#1R# k:Q[.0_P0`vX$$ R$P N`DTp P-P+PPQPr p ^`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhh^P1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN!G.G.}4G.G..S!! 1"!G. !G.!G."! .H.9!.$W(a(.h.H.G.\.(.!c!@-pʈ@@x@t%,P nRTPDP <5R%#IfTH.H. H.Ԅ.lF(@-@\ɧP @H-§PH- T  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t P Xp!\ŸQP KPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@ C0Ѝ$H.(H..\H.0H.`/hH.dH.`H.@-M4 >P @"P u@PDP"P tP0 0@PT x"P t@|!@Pl@hj"P tPP @8P,PЍht@!!lH.!0(!3pH.!@-@P @tP @BT.@-M A @R@ ( (Q  |p"ЍXP<(PtH.!!!!!!!!!!0H-@POP0 Q 00HBT.G-M$!!o" ! & F P00APPT%%봕먅%%HuEPt%t5xU|exutEtTT  HP P<4,%,E,P%P{$u$P  m$4tPp pR P P\dV Rl0$ Pd \ CTPP@$4 6, R PP@ 'P P#̣P  PD 3cs  0@00||#|3 pS dh#h30P0L#L3<4#4PP PP PUP`Q  `A `Y "" |"P `R PQPR L ` AA߷ `Y r " P!PzP@tP Q@@PЍ!0(6!H.T. q"!1"T.!T.!T.a"T.g!T.!T. T.T.T.T.T.T.T.T..P.0!T.b/QT. $!T.!H.!T.!!T.G.$. !1!T.v"T.P T.H.u"T. T.]! U.4!9q!U.U. U.""U.U.W!=!U.U.e" U.$U.(U.6=!,U.U"7!0U.!0(lH.u 4U.58U.q!X  XnO X *P ? bPN(NX>2OpPX >\ЍP!  lH.T.0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[H.(.h.lH.T.T.T.4U. H.l.T..T..@U.8U.G4U.B8U.@-@PPP|P pp ,dPLT #HP(8 @U.(.H..lH.T.l.T.h.T.P/G.@U.0U. lH.(.C( p/hU.H-p0S :Q    h \  S@D4S@#   0\U.hU.hV. !ESC`U.@-MP&@PP tTQ @0$44    0 ЍhU.`U.V. !dU.ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?\U. R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:    @ ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```\U.0H-p@PP\PPHP 8PP ( PPP0V.V.(>(.C(H-^Q R RA 10S* Q1S@-,@QPV.XB(4 1S10S/ R/Tb#H-@P/ `P+ PQ pNP pQ`tQ pNP  pQU <@EV@P@1(0( !O-MWP D T: DP.P bP cP$T*@z kQЍhU. ! !0H-LL444 40<@PPPPPP0C(_._._.V.^.^.(( (0/C(^. _._.O-M@LPP- 帠帰p  `@pT*BP P PPPЍ\U.^. _.p@-ML@@vLPP ` iPPЍpV.K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍ^.^.pH.G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( Ѝ _.^.^.V._.p@-M`P@K   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZYV.^. _.^._.pH. 0P/_._.K-P3 `P p PU @LP@ቘᇘ PpUp W LP ps pp蜄.0H-8@P(P0 PP0DC(_.V.O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb| @! p! ! ! ! ! X" L L     " " 4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` PvVp@Pᮨ0FP e[ ^eP QJEp  Q  p PY  P PY PXeU `E`HuPP nIr A  @ QpP ``NpPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* `P T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iI\U._. _._._._.,C($_.,_.(_.^.V.C(C(<_.8_.0_.Š! !!C(_. p@-`P@H ,Q:Epd P:00@T0Q: FpV.^.C(O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$ЍV. ! Q/_. _.V.P /_.  0) O-MM@PzP(8Po p၂PjJ  Pf`aV^  PV p *PO ߜPI PpQ Q Q   *P  *P  *P mP "PX Z P@⨠℀ ⤠|   4/ ᕜPV 4/ЍۍG. ! !C( !HC( !Q  FR/2G-MPcQaPP2 fPX GΥ G Q PQQ<Z  @ AP? @ T@ PJ  PǀJP `PdP% dpPp Q@`@ Pxx p  0 T 22  u }ЍG.|.HC(C(T !} !x, !p@-Px @(P U p@lPfH`P <`HP p@T\`P p !a!p@-P@Q `P Pz`V V U  p@Up\P XD 8Y4P ,$ ~p@Mp !C(HC( !}S !H-M@pRGPF`pP`P T`P`ЍP 0 !P `P`V.p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍp^.^.pH.G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@Ѝ_. _.pH.V.^.p@-xPx@`V ?F RH 8 @o/o"pp^.V.C(_.@-PP D@@88 @ V._.^.C(_.H-P ;H^.p@-MPE@PP ` @PPPЍpA-@  `pP t P  PpْW<r  pP AN ! !/ !8 !E !H-` R V`:zLpT" PHao@DTB H.D_.H-P`P p@pQTPP P P7P @WN@T @g@D_.@_.@-@9  D_.@-@.( @ R  D_.@-P @P@-u@ D_.O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ C D D 8> L> t> PD > > lD D D E > XE E E F G (G PD lG G D C h; H ,A ; ; ; B = ; B \@ ; ; ; J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p lH.H.H_.@_.P_.(. lpp0>K6DX_.D_..H.`_.? 9P@ Pe $ Pe  Pe  Pe  Pe >6*G._.`.pe=6:{k ˟ 0` 0`<;_.et=A6=),pˡ=26QM PEHpˡw=66h_.p=6$$ ( P 7 P44 P@@ pˡ Pe$ D!p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qacG.Ie`pPk ^Pj  Y\C(~(" pˡiHP I괄.C( pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p ! 0( "$c !`H.>0=xPe= \Pe7 @Pe1  Pe-  Pe) ((H.dH.I<d4 (_.@<[4t +|_.0#@1e`lG.u/%<@4P 0C ؄.b/<-4 N` (h6؂ DC(` ! pˡk Pe 32P zP h"p| pB;4t[ ! pˡP Pe `"p P ^_.:eA,?P` P 6`jw;K48P&3,C(``/P4!`0V(0F`˱0/P p0p ! 5eT>e;.(T(bH.H_..`_.G.(._.|_._.dH.(H.`H._. ! !h_.,C(lc.`.pH.x.G.j !\C(("O !B !7 !* !\. ! ! ! ! ! ! !a !G. !"!t_.l_...p_.x_.0W(X ! t..X.,.G-p8;13`W@̠̐̀@q WP`RU  i PU 8W2e Qepc..XU.K-`Pq@  A  P.@  <`堐V VJ  .  P  |<`@,4T KKH_.x_.)!H-@PPPw7P 0s  xPQ`@`PP`p p` H0((.H.G.`..XU.p@-/ ` k@P@U@ p@`PV P U U@44p@I|_.@_."a_.;!("`.0H-":=2OPY @"P.P=#PV $PZ %PPI:%0Hf4 P8 P P< P9!P QP  \P0\\PT@+Q Q LQP Q2 0/P% 7P. EPP (70H~$P PP$ 00H 0  0 0HxptP 0.0X!0HV@^0HB@_.G._. ! !_. ! P_.|_._.X_.G.H_.A-M   7  ?  I  D  ? :  5  0`@xP1  0z"@TP P0P <ЍH_.@_. ! ! !! !!!!&!Š!`.Q/\U.0H-P@U 0@0O-$M@`S   ;P `nH@@P @ pT W QlAQ >P : 0AS R 2@P ^P  P *Pp Q:Y@ P ᩏP p /@P  JI Z P Y:HUq P@TA$Ѝ\U.H-, $ H_._._._.O-MP9 `pJP,@ PP P:PPP@P PPW@ppP@ W:PЍ !@-~2FP @lll 0OP \\\ 0H<PP 0CP ,<< 0@;`C(XE(?!iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`(H.`H.dH._.p@-`Pe@V p#U `U aU`B@PC@HC@PB@( @Q!@#%" lH.`..p@-M`6e@P-JP;P)-P%;P"&PV@U AU hB@PC@PC@PB@ mQ 0Q@#!Ѝp蠄.lH.`.O-MPPp/w YXpP YP ! 0@@ wBPP Ѝ`wp 0G?@ BPp/w P ?wp@ UBP O-M@`7pP7PUP)GPWP* P Z P@T: <P PP @ЍC(C(0H-@Q P7 R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@ P PE00H 0@-MP3 3p Q, @T T pQ#  :, /lPPH  Tp <, .Ѝ.u!!!3S" @-0P(@P P @.G.P H-5 HG.O-M★P@P P  Z `z P 4U Z z @U Z @{ P  P``pPPJ92P @~.  0p@Z` @ L D  PN G 6 8. 0 p PPQ;t 3 0. r, `@ KP \6ZZ P `P T :@T( PU ` PQ@v7P pP0,P (@ @P D0:,P / 4, R7P M7P @D <,P 5@Ѝ37P -7`P  HP``P T7pPp`47P 7P  7P "P -pppnpڈpPJ P*P X@- YP n* G.G."!K!a T.c!_.!G. H....h%#!G.G._._.G.lc.DC(.@- @P  G.0H-MPP" n/p   P @ @ $$   Ѝ0G._._.P/ H-@P`Q p b ^T,Hp@-M@B nOPP JnP@k-P``UAU DU+ OUaU dU$ oU W-P mtP 0'2 qmi@(p@,ЍpG.!0(`!!O-M∱@PP j @`@U 4P-*P@P U'*  pW 4 P*p@P W *@PV ` ᾁ@V P ЍOz@@P  ЍG.p@-`P  P@_P U  EP T  =P p@NpH-tP  H+HG.H-8/P (+3\H)_.!G.a G. G. G.A-h@P`T%+pUP W PE` 蘒.0H-@P P PyP0H0@-,@P |@@g@fG.H-p )H)O-MP P7  R  P \P P:P A` @3Zp P `@V J2/ PP PЍ!%#A-@s3QPP( P0PQ@Pt4p`P`O3pPP PW RP@PC( !*CC(H- P !*CO-MPP 3pWD ! P`P@W WV `P`p`\`@)  pRP@PWU P [:2@/ P0 v(@`@V 唐唰Pp @W pP pp)P @U`PV Ѝ !*CC(_.C(!!!K-M@P& `P" P2p2p}P XP 0! "X @kpڑk @ ЍS"!@-@N @N !G-00P@`p#Q%QWWP P #Q %QP L2`Q `p`@#Q%QTTP P #Q %QP j%2`Q @G.G.p@-`PP2PWX 0@P`G3P>P;9pG.!!G-MP ЍP RP `P|qPp1 1`PPPHQ1`@P!0CM~QP`V p@1 `V1 l`~V PrP ~~G. !*Ca%!.!_.!!C(C(7!N!G-MP@P>  0@.p6 `,SjP/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލ\U.P.H-M`@P ЍH肾P P 1` 1`PpLD 0!=~ f@7~Ѝ ]"QG-@dd3P EHP & ` ~0Pp@Pppw W 0H-@@2PP ,1P 1oR0a"!K!p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PD1PI De  %R R   0%S sS4P-+@ T0`Q0` 0p}!`}pV3 U @ T@ -iP`p(p4@ P pp[ :P <@@NpL}ЍG.. !aV!K!A-MP8P Ѝ`P @ %R R   0%S sSPЍA'P/p/`/p 0`PZ||@|T ЍA蛾G.!!H-M ip   @o Ѝ0H-MP@P ip&PP%  P! /*Pt iPJ  Pr/Pᯍ$p$PЍ0T.0F(@F(@-M@iPJx| 0,ЍpC-M@P `iP h  #D Ѐ # "q p RЍpG._._./Q@-@/Pp/Q@0H-$4 @0!P 00 00S 0Hs0H`..p@-l@P pp `t(@P!$ %$oB@XU.@-@P ](P@3Q/~`.O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍĄ.Ȅ.lH.pH.lc.T.@-@ ,Q' @Ą.O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍO`.lH.<..|.8`.XU..lF(0(!.G..`.Ą.G-M,@(P`Q Q p tP h@q  P T < P0Pp P 1 0  V0S0/Yp@m+_`P!&X &Z)-"@YT Z xЍGt`.`.8..lH.Ą..|.8`.HQ/8p/(Pq /@/`.8..lH.G-MK P P uP ЍG& p 0=ЍpZ @&P P & Pl`@P% 0P@(% !0" ЍG8 lH.XU..A-MP`%p@p  0@ЍV %ЍAp@-TP@` R ` r `V V@plH.P/@-@ R P R0 S   XQ 0 0C0R,  B *y(y@%yG.pF(`., P0SQP/pF(P R/pF(P R/pF(/`.G-P8ap@T ,P2 @x8@ UP  @0 0$00PP0000040@    QdO z+v+Y*x xT pF(`.P/P //H- P PH- P P// ////0/0/0H-P4@PP {x4@04/O-$M 0 H%UeE(+5 P D/ P ?  . ) P p P Y   uY ) ` p 0P `pP@P U U`p P P @`Vp@@DTʀCV ' p ` F FoopP V Vv p  P0 P)P V VU PPB` @`PTP; lP< L@P 4BP`} Pp`PP`3P) V V{ P P A PsP P`xXP (+ PP`AWP  P0 &  P /( P`PP  0  #PW   P P p $ЍOS  $Ѝ.|.XU.8`..d.lc.(.t.0.O-M D@<`8p@PP  Pp   0m(PpP  0`(@TU<=U>   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ0lc.O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 P.|.8`.0..d.lc.(.H-@p PP~p P P @P@PD@0`kp@P@TP0(0(p@-/P p@ `@P@!! p@Q! 0s B @!! pp@p@!lH.O- M`@"N"PJ@@T{! 000qP P ЍOtPb! !d0Pw  ЍO%PQ!M!  pq V  Pᴑ@XI% !0  @ *&`P T@XP)+ Y `@!& PXPp  0  @ 00 0 @ 0H9`@P `pp! 0@, Ѝ 0x!lH.t.`.`..H-M ^!! r   3ЍH-VP 8H  P  P  BH!lH.p@-@P`Pp P@{`P(P  p@t.H-M@P;`p pP u9P x P@ЍTP < ЍHB ЍHt.\.V!5!A-P@p|`p!&  0E0V< P`P@p@T AAt!\.!O-$MM@PP(P``P0(`{0<0,`v0w堇``P n'P t1PP` 9{P 8W8w8,   4 P  . P  P   % P     `P0 S S  zP&0g"0<S !S <SFP=Q P=S >S<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`\t娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dJP pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP p*&P pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. <$$Ѝۍ! `.F(H((`.,`.$`.0W(aP( !!#env!!*! j!y!!#!!A-MM@Phhh `0 Q ` 0 (Ѝۍ `.(`.!$`.H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0`| < < P < < < X < ` Q- `0TS8bCPE L     ( 0 8 @ NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 (P``0`.`I(#!K! "u U"0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40! PoSk 5ܑPp P^@ )`  0PPAJt!A@Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPExc. c.P.Db.$c.\U...hI(<`.c.lI(!.8c.lc.c.b.b.c.b.VUUUPQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`p8`.Db..G-M`VQ &p@  lPP  㵿  @P@@@ i 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P`lc.Db.8`.G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  VpH.lH.c.p@-@PPJ` PP  P %zPppI(P, '/ 2S/Q/2S Pl"R PH"R P$"R P/Ḅ.pI(H-PCpI(A-M@P`pP P p P@"PPЍp@-L 0 S < <0<@ P` F P pP.c.c.pH.O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍ$c..@c.8c.pc.4c.c.VUUUb.Db.lc.c.c.b.c.c.c..0H-MP P@QP@p2 0QЍ0P.H-l cR:TH0P Dc 0>:0   c.|.|.|.K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0|.|.|.O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  ЍD.|.|.|..4p/(P    |.D.`.!@-X@PJdP 0  0P|.|.!O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B Ѝ|..O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍlH.K-@P뀀倐`PpP 0 0@p`t!c..0 R/$ P  R/̄.Ą.O- M`-P`]  Uٿ =QpPo!pQHP% PP! P uP @  @q  0* dȺ@TP@vdPPP@Y H 3 k 0@ ЍO[(" Â]"3!`.G-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P @mႤP8 @$ 墿Q O M "( ㆺ p p  Y `Pp pPwP w P  pp$pw W p pPwPw P  ppᤥ @P0^ P!T(" `.7N K-逐Pp@4T 5T'#T'a3  `pppP c@ P6T|.H-o0H--P$P 'P!jN>.P ^P@PPPP [P @PoP cPIP @pt@TPD@ HP 00P uc@0|..G.!lH.^!0H-MPP @ 4p D0P0P&0 Qc ꈾЍ0G.|.H-Ma@QdA@QLN@<'P #P j  Ѝ|.k!H-P  q  HP|.@-M  r @@@0 k΄0P6 bЍ|.G.|.p@-3P5 P@jTp `f fP& bfP P`b`<P`@P Pp p@kp|.G.\.0H-@P 0 R < PA0G.6!0H-l0d 4 0 S@0%@$0 :p05Qa#3Q'|.G.H-(0N A R q|.G-\P@rJP z`eP[bXb@D6t|.O-$MP&   ᯨ@唐唀` P r 0I pWp 7P  0 p叨 ` V$Ѝ訄.}|.aO!p@-MPmPH PP``P= @ P Q `@ P-JPUP UP R Q @ ` QJ 0 S  0 S  B0`S`# a `ηЍplH.0H-M@Q Ѝ0HW P P PᶷcPJp ڄ 9 Ѝ0pd᯷LP@P a\@a3Ѝ0H莿G.!0(G.!!!! 00G.@- MP P P=.P(1  R& "0s" @ 㳦P DP0@0S |  @t Q \<8 Ѝ 00J(9!@!\.!"!!H-M< R J0 ==90 ЍJ(lH.\.@- MP P P=.P(1 3 R& "0s" @ FP DP0@0S |  @t Q \<8^ Ѝ 00J(9!!x.!~~!f!H-M< R J0 ==90ЍJ(pH.x.@-MP @/P  @* Ѝ!@-MP @P  @ Ѝ!p@-P Pvp|P pp@ ံ)@P p@Pp ` p@ G.!\..0H-MP P PDpV\P@PTP 9`@{Ѝ0H0`  Ѝ0$W(3!W(@-PH@P 0,$ @.G..!0H-M@P P P,PlP=P MP hPP|  mP wP sP@ XP@@P0@P(P@_ӵЍ0.4. W(W(W(P/L.P/@Q*P/@-@| plgPxPPLHD@<8@gB!0W( H!_!!!!!X!!!@-MP` cRA0BSA@ `hpx *mRnR sR uR+dR kR%       1BPhd R, PЍ@ @p,@  Ѝ !. !4!O-MP!@pP`T* P@W@ T*`0@ P ? : 0Ao?B `W@` XP`T* P@WT ,PVV 0 `@Ѝ<`.hI(lI(K-MM@P P P9oߍۍKȐ@ 0 S `Pp,W:TఀP!ᤅpWFP  @< < 哅0 @ ߍۍhI(P"<`. `"lI(N! H-MP P P*P  R Q ЍHxx l0 0  00 D< (( 0 Ѝ!C(C(^!0H-MP P P(0@ PPݿ@|%P lX0R>  <P S$P Ѝ0蔄.a!C .@Q*P/G.!P/P Qꠄ.@-P@Pp褄.@-MP ,@P  eЍ謄.!@-MP ,@P  QЍ谄.!H-P0P(PBpHN꼄.G.H-MP P P D^R Q  ЍJ(!0H-0MP, P P+@P,P0,, AQ  @0ᶢd@X, *Q @0Ѝ0,,P Ą.Ȅ.m ]!0 +!C!@-MP Pb P0QSSEC ^:   4 4 4 4  4 4  dSeC ^/   4 4 4 4  4 4  C ^&   4 4 4 4  4 4   #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0Ѝ؄.!z!<<< 0 PQR0/Ȅ.`.Ą.$ 0AP/Ą.lH.X.@-鱿@ }调.!O-MP H@P Q Q 2/P d@@P EQ ,   ,      @             zP@ T  pPaGQ3Q Q =QU QQ D aEP3P@U @PA 4\ o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T [QS?@+پ4 ᦂ 0P. @+PP [|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @ԃ.؃....!G.! !!H-M0S8< 0*ЍH菠 *㈠Ѝ؃.!!H-M`P@6p-W0A Q:UT h pU-W` U T  @Ѝ!/!A-M`P) @p PQ$ pP \Q`P \$Q T ``P `Q,  [``Ѝ萄.!A-MP @pP`@W @ h ЍA9W  Yhh -QQW W!  @PN@|W4 W/ W>oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ X؃.e!I!!!!`.:!P/So/Q  /Š!H-oP! P/ԃ.H-M  cЍԃ.؃.!H-MPp`կ 0B PW# &`0a@ S``3S0D0@B` T:V S     b RWV  `&Ѝ/!  RQ/$..@-h8P\TQ @P T 2/$@PK!.J(@ 0S/ S  C Q $0/J(O-M`Q0S@ ` pW) OP@AAQ:-P X T T Do᠂P p  p$PZ  RQ   Q P   ЍJ(H-P $Pv0!W(/O-M4\`@pP1P`pP/  pp@P Q@  Q P kD ?PJ |QpQ Q? C  ODPP 0!U QZu ʮP #P UQ      D\P P 8Ѝ......c.W(.J(܄.XU..H-.H-M 0~H-M@]`P ` `0 0pP|Ѝ 0H-@ `PPP '0.0!O-M(,P 0`p@ !W 0!u(  &*9#Wu(":#%"0p  0j`VPP3UЍK-P@pi`%"Wd$!y (0[$5# 4!0 W0 0dp W2O-M@p 0PA` = @$ U!'  % 0/$7#z4#j& D@0[pTpp3WЍH-MDQA#| "B -=)/ -CЍMbH-M |pP `@P&VI `@PЍ蘒.`..0H-@XQ 冲@P@P: $ @0$.W( . .@-4 4@P ( BPW( . W(`.@-@@ W(Q/O$.@-P @PG-M h!O`P 0m  Gp  E y-PgЍ0!G-M h!O`P 0I  Gp  E y-PgЍ0!K-Mh@Y p`piB PPGpEy-PgЍ0!O-$M¿P`p@0@ Ya@QW@A@Q7@2YJY 0@  0@G@P PPT$ЍO-M¿P`p0@ Ya@QW@A@Q7@2YJY @?@ @o @@? PPPXЍO-MŸ@`Pp@0@ Xa@QW@A@Q7@2XJX 0@ @9 p 0 @pPPPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `ypP%rP `ipP 0P `[P Qp@pЍ@-M@ P @@P6ЍH- @Q 0% pH2H-P@mP' PDְ며 `n@|P PdPdp@`댰Q<HR H(..T.!pH.T.`.H-M0 0Ѝ0! H-@P`pᗰj 㼰1P PPPP @PP @Pv$.0H-M@P P 8,00( (0 0Ѝ0J(0!0!0! 0H-@P߯P !^@֯P 8P0՟ ~QT㊪0pH.`.K-M@jPPPV ap㧪 0PppV"㛪`o"Q A]pP TX TP ƾuT`WpU nTЍ@.G..0!@-@P _To/O-|Mⰰ夀堐P@ ;/Q00PP 0  0`}hoP  #` 0V pB `CR JS0@  S pwp`pppp@@P0S 2<`U,0 [Q0 02@Q0R0s0Z0PU p[W 2@WRp0pqQ 0S @PE T:000    @0+t`` '`# (; 1q0WQ|Ѝ@./A"p p p@@0@@/lH.,.N-DD p0SC P Q 堎,.lH.K-pDD0 Q 1PC010CSPʁ蠋,.lH.H- P  lH.,.O-MpP1PQ Р +0* 0 P Р@+0`* ` BBSH@@P@ x *+@ЍlH.0.,.A- R*AQA 1 0# "  l0`0AP 0$ p%0 @1a^ @ p%` $ @P@lH.,.0H-\ @0\0H0^00N @@\@ 0^0,.lH.0H-HQ 0 @0P0s0: Q00,.lH. @- R <0A01$ P r :0Q ,. P@PP@/lH.@-|嗨xx@x 0tS፨`ቨTᅨH Hဨ< <{0a#.4.Ia#a#a#``#W(`#W(a#W(O-M`P V p9P:P ?P \P@P  `%P6 .P P  @T `OTgaDQ} 67 7@5,7667777@547H77`777677777Q O@T k`bDQ 5777887<877P8`877t877D687779BDQ, D67(9997777797779s !0  0BT DTLTLPH a! @p:TT? P80qPT5)2 K P .P#\ P Po!  'p PmPP`H P $#0 #P RRwP0 X@@%\Q P  ^_w PIp)P@!%pWo P0ja  c"2Pu@ Qp@PjP/ v꺯 Z  r' P6 p !!1P 0  ?FtWꚯ 0 R : p P1 eP ᅯ 0 R : p0  /  pPQPG#  | 0v= Q Ѝ@.@. G.Š!wA !G.Ą.lH.lc. H.D.a0H-@b AR0P;PQ0P iRjR tR mR BR bR0\. 0>S:S Q\S 0SS/.SQ?S/W(p@-@@@P@`@oPBa p..4.W( H.W(H-@@pP<` Q P  `@.@.p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮lH./H.H-@P dPT`VxP lpP@" r &n@@T렪@``.\.U.lH.O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍOD0(0(U.`.lH.@-@PLT !P 0o@a@H.`.\.0!@-@P NO@`.p@-P@U `>O [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,iJgJP @< rpH.lH.\.Є.Ą..D.Ȅ.....P..p.x..H..`.lc.`.O- 0 7 0|E W ) @(pWQ p< 000  00B P4PЍH.O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝ`.H-0,$ Q  H`..H-P  PlXHHaG.a`8bH-@<4P Ha..H-0,$ Q  Ha..㬜A-@T<  P뤡32z(@P xxpP`uQP P00PAj蘒.a`.lH.pH.H..0H-TP@T   FFF 00000(W(...0H-Ps@P" mP hP tcP d^P 2P J$2@@@@@0$W(81!>1!E1!K1!aO-MM@P `pP T |VN|||  MP  HP P @ Q c Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ P 0<40   MPkX /P  `PqEU l&` LPv p!P  $P  LPd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 >PA ppp!7p;0yPᗾP5`FpV1cpWp`ɚ 0`pkW D߄DXP  p00pGPd2Ѝۍ0pX =ꤒ.1!8b#1! $W(W(P(.((W(..Hb#O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 01D`.D 0X , Ѝ蜒..D.P.1!@-P\\\ 0S @T 0@0000 BR蜒.(W(.@-P\\\ 0S @T 0@0C000 BR蜒.(W(./ᤒ./᠒.P/卿꜒.H-P p`˙@|řTPaU n㷙TG-t`P@Zp dQQ  QQ  蜒.H-~P PW`VP Oߍۍ1!0 㜖0 P唖thPTH0@ `~tb#U rT0 kLa|pdXLd H0$H<$ =봒..( ..1![3!L5!.)5!5!Ȥ. 6!5!5!:6!3!E.k4!F3!?3!23! 3!(3!h6! 7!x(3!6!6!2!2!p2!Z2!2!1!1!]7!L.P.t.x.O-MPC HP@qP{P tP rP 2aP bP.`V P p0"pS pX PP  =@TЍ(0 $p0 p`嵕븚.. .?7!L.A-MM@0 A R * CPЍۍ.Q$Q +Q(/Q \Q  `NP P IQPR IAo`AP,,0 $0 e ..4!,4!p@-@0PP@ R RQ <4 0DP& `p( ..N4!O-M[a [h \[l p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00ЍDD0 Dǔ((0 0  ..4!4!4!O-M`Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" IP ]Q [QY[[Y][Y   P R  P R[   pR`  DPX R5Ѝ,, @PQ 0B뼤. ..5!t.H-M@`PpmPn@ P2,TĎĎdĎlĎtĎ| aP dP fP       P pЍO-M@Pp`$ V ?P [P PE@ Z *?P  pP P@Ѝ00@?6SC 稐?Q7@?QW@Q?0|/O- M`PxwLB@@sXL4X dTHPa@Q%爑ؒHX|EP GPX IPvHP\!X@K  "@ P 0P ` 0գP \` @\!@~p%<0APU  @PPU p00 0p.`@p pP PUlPT}D㭒 .x7!P(7!Ф.7!,/Ĥ..4W(̤.Ȥ.X(8W(.<Ԥ.H-] 0⯀}P(P8!O-M袟rಟ`P P P5 APg倭&Pr PQ Qx嚀P X H P" 0?#n>P:.AoRy\`nX>PsPQn\,0n(>PV;P ?0  KK=mP PPQKQPPEPPAP l>0  &KH=Hm<PP, PfP( Pg >P0PP P K@ 0!  P  > oP ( @T@*FP`VP p WV] `[p+Y`P||!|@0p@Sp` @P`P" P@p@@: AR 0簻p,XLpX 3!Q , p0:P! PBQpPP Tp  X P Kg0 ᦈ밭..S9!Z9!p@-@PU, `P VP PU P̼ܼlPP PPP@p谭.`/A-M @PJP `+ Pp0YRۍA O w9!L 0Q0p0Qp \ 0 /vP(@-,AEP \0^R S0QQ 0QQP|P P# Dp?   @Ȗ긮. @-00\ 0S 0^ @T P PP Q QP RR  P \ 0S?o\x/.@-|t  0  L@Q  @ TQ Q  긮.x/K-8Q <P  Q0AQѸ0ڰ = (v!<OQ P嬁q@`\P P  :  0@T( Q0AQѸ0ڰ  uP  (P  ,P  4PP Q X@P @PѸ ڰ  uK{x/P(.>.H-M@P@P i@P /PlPPCzP@-@?PP+@ $p`pPQ Q 5 @p ЍP㦆6! q"9!9!O-M젟@`/pԐTPP`T   t 0; 5P  PPQP@T Ѝ  *6fqP(9!9!.O-MP jptR ğ _>p/P  @5PpW% xxğxQ `p-QW-Q0eCQ Q  `eS kS iS` ``Wc೟@p  FPPa@Q%d$P`p|@DPEP IPH-P<@QP5 SP <p^WP p?Pp^ZP ?P^YP ?P<{ pEQ`T"AQ聟 (  bQPPQ ! M-P  oP, P %P  ZsP  L H D P /P P@P00 {rp븮..`/(".@W(JW(EW(9!,/:!:! :!X(x/..ht@gtP($:!::!@:!E:!Â=!h:!O:!:!y:!S"9!H-  soP(:!p@-@0PPUp00 `rP UP UU@ %t0p@rUT D p@r,  0p@..:!\"P(:!x/:!:!:!:!:!O-TMPRPbpP  EuPP}p GP gPwPPUl@X %P p^ Z u@pY P@ dQP`@2P Q WA ap ap p AW WpZ pX 2p'P ' @P@0㯃d u H, ;!,/X(_;!"$;!`!K;!U;!w Â\;!)|!H- rnP(;!@-M@#P   p Ѝ ԃq;!0H-M@P ¾P P Ѝ0"Pp H-P@P Q `8CP }<P`P &CP rQ e<`V@-@P Ct P   ɧޖH-aq1S  @ P PU  @S*QQ0Drr0S  0qq R q0Cc(H-%%Hp@- `!R 0@T 0RpQt@tQ  tt 0Rp Bpc(@-Q@L@@-R@L@H- 0CVmP(;!0H-@Q0wqP0 ѺP  8sy@P  +ql@@>(XP L  B<*r000 ./$.(.,.0.c(O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$P , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  vP` @`Y kpPP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP P&P <XPU PPN(0 ,sQ  Q0@@0R A (0忣P7 p돹P ;x' (0 ᧣  Q $ @p|P͂PPǂvQ/P!AQ2SP RPF@Q x4,,=P P. <Pg>P) ?Pt ; 0N,,xa 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0S4,x"P0A@0 B0!ARP !@ B/!qFC$pW eP 0٢P P0(P)]epPU$ pP X PQ XUqH5  0  #堤ف PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ   0xP EPPAqP(Pფᘓp cpp|r0S! B  / /Dcp| xPQ zPaPxP@a@(P(@P  /t /bmQp P V.U4Rpf M R  2/p[ P!PU   M xp `P )  ``aA7 `p P P H'Q P`P ;' P`qV4 R  2/ PPP ڒ P,Ѝ 0  (0  ՉD 1`P p fmKjU,.0.$.(./(P(/>!(>!S>!=!O-M@QopR'P- `fP@Ug 0႕UP` p` OP@U 0lUQ 3 1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`PD !VPrU V!   P ( 0q, `PqUP T0  Wo!A ЍO藢>! /0.Q/A R /,.0.O-MPp*@0 T` F$P3 `  L늠`P   @<#P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@Ѝ,.0. @-Q#@TtQa & ,! 3+t ` H, 4 80SP B @/X=!ftp/N @-Q@t$Qa (,$+ Ot |0SP B L  < P  @/H/b.ftp/dQ Q Q/(  r n/d./0H-Q@$TQa 0q ,PX PP,+B2 0H5g!/r ] Q Q Q/,  q# // /aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-X5!!A-PU@" PO`HxpPU-PWP:@p`P P`$$ 4.8.<.D.@.A-M`Pp @U@,  pIp& P 0눀 0p pP効HPu LtP @@u@Ѝw(H.!L.0H-@P\PuTPA04P:WP P*@L.w(H.m(H- Dc 4.@.D.ڍ4.4.@-@4-c,, @4.@.D. MH-M    $ЍH Ѝ/M0H-MP`@ 0cLL ^" Ѝ0HЍ/4.@.D.O-M@S0 &_T @P ܢbRܒܲ 0@ @@ 0@0S 0p0@ @ P P0PlP #P wP wWP P w w   BQ<QY `D pW HPZ kwa Y`p ^wpGW ĈT Ȱ!@pP32PnP|@孎P D@T88D@^T+P& `8"1P2T    0p P<{`8`<TpP@T^P @n |O"KPzP Vv@tT<Oߍ8@08 %@ ZW< 0,/Wp 0&P/X.3H// /.c# /6!X///( /! /,/! t  !!P(}/!/!  //,-.8.`!f!0) !T//X.!!H- 0EWP(!0H-M ':~F%#vP@T + ZrtP@T +` wZb<P00 0㷽Ѝ0N !\.Դ! /!X.P(!H-(PP H r6W /L/H-1WH-\0P P D{)FA !P HN !!O-MM @ủPO `PI 4P/ p  OP; P $bᰰ$P)>pP!  [P  P ppzt  wt / ᬰPåЍۍ聳!H-A-M D3*P~ Q upI Ph Y] 0%Pa .GP\I% @Ia'&G^PPRJ\눏8SP!"p"P7 FP. @`YFp $aFP!""P[X| X)P )P P  P zFP! d,Ѝ pP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p` FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0pp`W:U `pEP pPUZpW} /// @- M!(P: @1  P1JA$*!P RQ 1/P $1/$+R @MFP JPAP=P + Ѝ)Pa  Ѝ@!EP ^@ ڦZU P Z_ 0$PEPHF#& //B!M!//A-(MM@(P+A+ (`+8+~DPP (yDP l 0 @@@@ @@@@@ P((B(ЍۍX!! 0H-MK+P+ҵ P+0+ɵCDP Bۍ0X!!@- MC?(P @O PJ*Q $Q *)P * Ѝ P ` 0#P#f% //O-MQ   0P  P P X @Padq P: qP Rp pQ %R R!"  @G  hR%R; dR ` W p!01p+Qp(iR* sRH" 0 ``@`Q \Q`V Q 0p1p%Q^p  R P P Q Qx@QcP aP<0  3/P3 BP$PPHp ` PX Q Q   1 ԴPP$PPP`V: @T2  Q:Ѝ(0H-M )6P@T ' V({VP @ '| |V d@80T HH [Ѝ044 eVJS\.Դ!~!Y !/!!P(!0H-M 5@P v' P%5PttXVP d% `'T %ͺ00 0[Ѝ0 /!!T&!1!!J!@-(M 0  00 0@ @p@F(Ѝ@@@ 0J00S  BRw(?P(_!\.p@- QD0 @8``P Q 0 p@!T\. / MO-jMp1s? 0TW, O`P6 Z PD @pL,p4 pEZ :[2U0*Py @P,  p5,ppBP‱UP `[ PP  0U pW P[X4P 0( 0bUjߍOЍ/ \.ȵ!ߵ!!/!MO-M H"/0PL2< q0@T 'P P  @'^pPp   P Q G0]cP P * %R@RA* `'P`V*PKP/yP pᗢ/ᑢpX5 K,ǫP& G(, @ .P  HoP ᴫP U  P7 4( 0 U \ᱠ芟9@u sT4p  PQP @ 04IP 吊 I1Wiu끊0x u 0pl;p Hɟ< @6$YP   .PP P P p PP( ~OP "0 缨   "" $ ,P~v\p\\\ 0hh `l`p`ZP @pW (@PWP4(v  0N  pE P[` ,@P @ ||`Wr0D]3- @ $o @Q g\(P4( P (p{ᭉ@ [@P" 0P  P P" ,QPTiQ@P  3@[ E }Sp7s뜵2\P tHr (P P! ` #P    ,QPtg) X@`Y V044X* >P?,DX b Y{Y P@pQZ ,{&c(Bp PCq `HX\ 3;`zV!V u! X @G ` `Z tzzۈ@P 4 `jU ʈ3qX x[  fUQs㜅불0Q P @L PG Y  ߍOЍ/ O``E WX zd0@P @R@cd gd n B+s0F0P , _RAKP  URB P  P @< @ @   <  B<P ><P @qh11< D1ht@/!bt /w(U"f@\. /!!}u"϶!b.Ҷ!!!L/u"!àp"P( tk!n!V!!!H-MLaP@Tքr- p#z%yA! zO6yZPчP 0Ap忆P @O렛P ZJZ1y4x 7ᴇЍ$$ 0+N/ ]!P(u!O-oM M Q8 /p⊯P`D<PB @ؽU<*|OѨ rȨLPH<᾽@ kPpW<⊯< ibY3⊯Y iD   Y 8P P X.`@ 0lPp0Y ]  u 0,@нЍ0p80@tu8@A[@pr `DX @ @ Pa  QkP P@/ 4-@ @0O ( +0NpP0K adP  @  (04p !@sP }]lP 4 A|\8 ␆P$<@P T/ 4H40`뀜 O ,㚮x 0}w 0x P L V<` 0PP VUt`wv (P= K!9 p   PP J0 CP J0 PT OPP ?:    | tL* P{ \  yy0 V z 4c |*QpP:?Q` \P 4*{0}  0 | 0?9yɟ Pp9 QR @V iY 0pt)S0` 0Wp pV tL9p@ip 0 S0 0W   8p㠘@P p h `  |PH 8P  P~  0 㷞P5   㱞P/  㫞P)   㥞P#   㟞P   㙞P P P  0P p' 0{P< 4 ,P] ,PWH8Q,8K,p$4P P<P) 00NP $@ [-$0P #P t# ߲2{dPV W `"@3xxß  F0<P  0U50P2rP) !2p' @  M P B_ (`P` P (3lL!2P A7:G0P P }!y0QSpo\oߍ ۍ0S " t 0JP@T I,D`.!(S!8f#r!!d.`f#!! !!nfsih!..4!Y !!1!!!!Ľ!Ͻ!߽!!˹!!!."!f!o!A _v!!d.M!Z!!h.u!/!g.!f..e..! !!. ,!I!TZ!w!!!!\.P(й!"."!!!/!J!h!T/!;!H-MHA0 PDP 2 N0 PDP 2 @ p. P@( 1 PUAx !CAP `X@\pP`  3APPЍ!ie..d.8i(.> "0H-BMgPP .PQP @0 P  Bߍ0f.g.H-@pP` ,ЪP EPQ.P@P 4@P0\ ዪ H膪f.g..`!P/ pf#K-!MP<|(PPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ 7K!ލg!!! pf#!G-PB@U% 堀嘠`pW Y /W P EQ 0K@  :P p`T:(!H-MBQ DD6<8 4 0/S 0JЍ`/gb./! v/p@-M@P3  @ Q ||| E 5pPt@0h` /QJ50</Q PPJЍp`.( /`/hb.`/!/@-@ @2( /p@-M≁P Q 㣩 㟩 @P dd d0#PXX@L40  cJ<<0 ^J@ލp.nfs!/d.`//׺!/a.H-BMP P RxPhhdP X5TrP H5D"D2 @(J4M6@P$ 85 0 bP !!5 0P !1`  l?!1~h{xx6P, P4d pXalLif8aP ,$!^  ZP  R NwISPfP aH^T wLBߍ`.d.g#ľ......t! .H-M N!oЍ@-M@ A!oЍH-M 5!oЍ@-Md@  0 d  !Ѝ.0H-Ld4P@## 0H]!~J }!M0H-M@ P$0 c R 40@ Ѝ0HЍ/  K!!0H-MdQ PP%#L@0@DP P8#0, P7Ѝ0`/<`/!b./O-$MttxQxqaXa @`"P 4 Z 0r !P7 0㝰P"@`pP P " 0Pp` @ _뜰P!yP! a! @$Ѝ?! //!!X.! /!d/b.`.~p@-MMd @nP  8 㺇Q  RЍۍp! 4udfH-MM `noЍۍ!G-M(@`T`P>LL$0 PP$P``JpXP`  PmP <4 V00 RP|P aaa}P `k@ rPeJPcqWW gP1i~|;h! 0@ 0 t@TP" l 0 PPPPPPhp* `mYT%Tt㐁!u3PW @P ynjQUU oRP܍$$ $0'㷧.`//a..!! ! ///!p@-M@P"  EP`t@tP  06d\ 0z60!oBЍp //!`/!/!./a./@- @P //!@-@P @Tm/p@-M  @P || |0Px| h@hP\h`00  0`&6PH 0`6@Ѝp!/ /`/!!/c../a.0H-MVQ H@HPH8 054, 05Ѝ0`/!c../a.( r/0A B0 /ľ.$ P/ @/ľ.( 0Q00A B r  /ľ.   /ľ.H-M:(@/㢧x 0` \\0 060I0P```%@nߍy( .K-@؀ؐ` 0U Pp`1VW pG0VpPPE P P P/U1US 0p``0 p tľ.dA-q 0R"@0 `pP0U 1US 0CP 0pT@T @ @pGD0Hp <0p@Pl 40Au4 @ľ..... q".t!p@-MP@Q PP<`W 00`2P` 0Ѝp!!!O-kM4@`P : PpDP1!000P4aPQ 1/pPdбP  P [ p@_WUH[8 Y PUX  0N I`4V [  'kpP|P p &`[p  (kߍ`/b.d/)!`./ !3!\! /H/!ľ.@-4@P 1 Q!//`/H- Pd/`.O-,M@ᓡp$@^P @`$(P (``@ `$VQQ P*v( p@@A$>@P@PE pp$1P@* `$PA( (```$VPP Z*`H  p@ ` ;(p@$PPpP n)@D@P,Ѝ 0  Ĥ!]!k!P 0/S/<S0S 00S/0 /S/y(ľ.@-M4  0@@ POЍ!O-MM(00 0QQQ 00 0PPP b堢 p0@%  PO,l_ PR&@a ṃ bUc*OP  05በP G$O`ፄQ  奂+6 j rPJ PH Pa4 P  00倁Q8Q5Q3 byPU P P  P Pd  00NPPPd@TsЍۍ!O!!]!T!/g#[!`!!O-WM$@ d0S  밴 ᆤ/ZXꌄ 0S   R /R/Z@Xk 8DDHtHTQ` Q]` PE `WfcT`qiP `0 0a V`XP P P+ P `00S 1S /S$Q AP` `$PX @D`   @/Z$R P p pWtxP0X` `B\0hX% AP P+ `(P P + s)d  mu|uPh(oP( ,0"# 4\0P $XqNP@P L(( 0@@X  Qo P T0 #Wߍ@! /!/y(ľ.////!!`/!/!!M!y!!!!!!!!!!H-M Ѝ M0H-MtP@diP PTD  ._ Ѝ0H Ѝ/b!Y !˹!p@-PU |@ `P YP  PUQpppT|( 0H-MhBP P@ MPJ< 8/܍0!X.!!/H-MA 5h`rLXqXQX!00@ lSS0<G   H0 0   0 ` @ P`0.P!JP@qjG0 *@0)P 㩏;QGߢߍ!W.X./\.`.!ٳ ,!|(!!A-M`BO XP @ { ㈔P`00U0($ @ލ\./Š! H-b<H GO-M☒@T@tP`=TP Hr@TP@@T ~` rPU O!00 Va ۇPX @epeTK .PH   p@ PPP UP: " ¡P/ 0 ! ᶡ  P  Pp   ᤎpPPKlpჇP|4pL0  Ѝl.(p.h.W.X.!P@-M@P   u1P n1Ѝ /MH-M  0 ЍHЍ/O-MM@  ⛯PvJ ⓯PnJp` ⋯pfopjڹ<a0Pd oppP2\Pn p bP`P ᬮ`ნ JP `=P  ` CP ]]VG P / @yP!AP3  Q* P12 P"P P |2  u7ePЍڍ \ \7sP p] [Yb! 0!H!} Tt/H-M Ѝ M0H-MtP@dP PD  \ Ѝ0H Ѝ/`!Y q!˹! d!PQ9 P P:P-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍXpDHG-`MFPpW~ ѐP ȐP lPŁ L巐Pū ,宐PG妐PH垐PI喐PJx厐Pł o児PŃ f||Pa^`tP$ R p`(Ld p`P$ V:pp0  Y4Qq$ Q $Q$QzY   8 48PQ Ql$ Q\ `$Qj X$Q P$Q H$Q @$Q P 0  "HL "HL !HL !HL !HL !HL  !HL@ |!HLR d`ЍG!PB 0 0㢏2)( @P 3"Q 2 `ЍG!H\"@PP!t@0 ဏ2P@0 w14b 0P(b# H!@PPx 0!`ЍH \ CH ` 0 Hd0S? ! " U 0P 0DPY!HQ,  P`pdp``I 7/(00  %Pp 0\@P 8H 0\ p.t.x.|..........Hf! //u!l!DXp<\!!!!!!!!!un"!O-4MPp PD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S PpfRp |8` 4Ѝ 4ЍO\T/A-@P= P\1/0 ` 0`0F?o2SP( p a P* 1 `P pbH"Pzl P 1  C0"z@A_<O-$M@\1/Pp`Q `V` YMP( pW 83 0P  0Y0 01>0  08 1V0 01e?0  B 0]ŸCPn_P Epp`rPC" ppJ0`PŸP\(P0ppp,g< 0 @̰0Pd (`pPV pPP Yp`Vp 8I  PpuY  PW`PW:uʣ`lp0 pP :P }pP R 2/pW,0o0Pp(p(p p(,(Wp,$Ѝ(( (0.<Tg!!!. @!K-@Pap `P6 pp Q h`"pyhpǑ P bI"py`  p(p崁"Vi`A-M@P `03/P !  0P ` 2/ލO-EM@ $B4PP} B@@Li`pTPp T@PP*u @ 2P p P*0簀GCp0@P\ pP@00@D00 $0 PX00PPñT0p S ZȀ Zzzzz] @T ğA  0嬳n P J 8PP 'P Lp,PH1/PD `'@@LL X4P0TPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DTh k Hh 4pl0 0p0<80`  0P@4P彋VD@hpL<8 PU:@PD`TPd Pp!@ a@(@!EPU  AL " xiPB U Efa" x  2R吠0`, 8<  004 , 0P,|234@`WP  P aP ڼ@@` jѼ0   ǼPpW @  B8O0 7/ ͉ P@PPP ,  0  4 p0aQ$p,pt@`p0p `p4p  p08 <0Ѝ`$pVp. /;!.... }!e!0H-P L@̊P /㚂P PQP/㐂P0!O-Mpw @D`ԂQVHBkT  r * PS  P B)P4R lPY Z P  lPc P5 \P UFP PP 'PP ! PP0# # o "!op㡲ᬲ@[԰PDP[ aP  kP $ Q, /Q D0Q R@FP@RQSSG@QDQ4Ѝ@԰QDQ0 h#p.!TT 8T8 T8.!O-AMMP p0@` 4P`Tp`P% 0`H1/(7 pD0`P` pW   0D  06/ @``T:&T&v0Z8LP(,` :a@h&t@$pt0Z $&v@t0$@@$ pZ<tpH@J Е(P@H蠍 @ ye0 p 0 n 0됰 0 b 0؇h` 0 X$X ``\Xpd<\p +y+}y`p,&W@UP:\`RX彺X 9L P S㳺X /p@8`P T㩺X %@@U㡺X WPTW P@! 0ᆚvDphY $hP@p@ <D0V0#TP4  T  F0P(Q ᩈP iP h aR:,pRLL0aB 3/VQb <  `쀍`#HR@%P!Y*ጠp L@1/ 0xQCJ`쀝`쀍`TPL1/ & !pB@!?܆TT P04@ R  [ P T P0[ R PTP0  8` T8p ι@ ZVH(B`쀍`D( AߍۍT !H 00 0 /---! !!>!#) /0! !-!!O-M@QR p  `0PbU,(PbQLQCQ GQ (lQ cQ gQ$1MQ SQ mQ sQ#    0>PQ +Q 0Q PPP ЍO-M` PX  |$T  P  L  1/1A$ V`0d&P p0 7 ( *H P` 0X P0P 4 T L0@P 0 H 0R  0܅0%pT `T0 $SPP AHP$QZP`P  Q`P @PL 8@<:%P%q0x`p\dO㶸\ 2 P P㭸\ )ppQ㥸\ !`W x` 0d 0᎘8p@ P@,  (  @P` 㘠D XL#H VP0 WD F0" *P ᫆P P! PaP:<qPh L0a@ 3/TP P6 h lX㜀@ (፞p ` 1/ 0yX$嘠圀P T*@ @㜀嘠Xp yTP X0cQ T 1/`*X@P CX 0!!!P  ᾄU FPO 0$岄@UP4`0 V0p0T000Q,p(0P@WT^@8pPV9 `@P%  T RЍ /#) ---! !/-!0!O-,M@%PS  (@pX jf4`P, VV V`%U:V   P  P C$U   00 M% 0ppj(PJ`*ᱫ},Ѝ 0އ(9h#g!J![!T:@-@,PQ 0 4  a808  qAQ l0 0 80480 3/P,41/,H048 TX ,h#4 R80Q0Q(1R Q//h#@-@|0S4 c$S 40,8 0P0803/P,41/,H048 TX ,pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W (1 3R$1A2R"1A2R!1/A2A@ (чPW P0@ 0 @尠V@Pp*,  (0@ @EPJ(Pጪ@UߍpX< 0 0R RH <\H @`/O-LMMHQ h!0Q *1S$QLU )P ILЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0PP  ;x`  6/P pW:HL/..p@-8M@`040 0PPP(sPJɃPTJJ4 0 0sP UP@PoQRQP8Ѝp0H-P H@ᦃPP 4᠃P $ᛃoRP0![!!H-H P 8.@-M0P /P P@/P@ 4,@0 P /P Ѝ.!!p@-@`PPPp@8. @-@ ( (P @S 8.8!K-M@qPPջ@pX@ؐP  &z`P  zTAЍPpp㯴 +@LL iP 0 cF 8.\.I! /S!P(}0H-@P, ,Pa0 0H 8.!@-@P@H-M@Pt`tpPCP >s}P`7@ 3s 0܍ 8.!G-MP`cp@P` sUPp s㒻pX  0㑿܍ 8.!0H-@P5 P0H 8.A-M`p"PP @ y` P`0X0 0`P PK P$P@Ѝ !8..0H-T@P P 0800P0  P:P0&P0.! 8.K-鰀@T& p`P P@T `PPP0PPL  0 PTP . !8.H-P`@P 4Dp` Wr Sr`H..A-MM@ ;~PJ`P 5r ᅹЍۍ{dЀG-騀Pp@T 删P`YP   0᥾@THP@T .. !8..p@-@P`3, ,P0 p@ 8. 0H-@P@ @P@% P <o0 8.!   H- oH- oH- o P/.H-MP ` 0ppp|p @ 0pprpDP0PЍdi#Z!g!.H-HH-Ma@(P<)P9$p >P6 P1 $1/$P  0@#P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@/)@-Q @T R Q p0S@@P@3 @@P@3 g3/H-M(P@U !`  0o1/PwD@Ѝ/H-hMP; a!1P@pPPP  P P P 0PPp 0 0@dpP ` 0pPhЍs㿡P`/!{!!!.!!!8.!!/H- H !|!///p@-`Q  0@RPU @T00Q0SR p 㲱p@z0H-0M@l    ,($RP P=  Pa 0Ѝ0.//H-R p`@PTPQ P `Vp@8$ PR PXP!.0H-PR00@~@Q" % %!$#0 //H-@@P`iP $( po H.H- P W`.0H-@P0/0H-P@ޠ0 ?P U0&!0H-P@!P 0)7 U0,<P000!O-GM  MƿP @蠟P`耟p坠P" P   Pl xP d S:;  Gߍ/!#//!!!!!G-MQ@;`pLl2  P PP PPU :`l` Ѝ!5!G-!M`P@90q<!P㬁N?Q0P/ p P d JP!}` ++P=P%  P = [PP2  0Eu+@h$0[ 6;| @0 |=X@P L u4 5!ލ b!~!tS!\.o! h!a!!H-P@8hp`0P9 T`,`N/P  < Wt,, X!\.!!!!0H-M @!b  0ݰP c TP@Po@ T8 @0ͺ$ ɺ܍0/H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|Ѝ/O-M쥟@P )`Qa(P^TP%5tPUP Qn +0<ጅ 0 0RpFP0hşh R0```Tp &0PHpTPPP@H@Q>@ LPLPJ;P `P TPQ `" R pQ 2 !0PpW:T`V:P Q DTP :@PP0  A@x0xp`0 b]oPHp1`n_rP,p 0`B Q$$ $0ygqd@.$X!2!L!O-Mp@哠@叠P` p P |  0P\r0 bmLLB <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0jVp@PL[:`@儷B %,  PH⍿`CߍHؔ./O-MPQ `$@@`("P `"pbU $Q 8 Q "b@p@ЍHk#H-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*84G-M0PPWCtiPliP~ cyiP ZpiP RhiPŁ Il_iPū @LViP$ R p`(/Gi p`P$ V:< 0 RZf |Ĥ !|qQ0 pq|R8`pdp``J 7/ $@P(0  9@0 h @0 h ` 0 P0h xpP0` pPL `p 0Q $0ppލ........l! //u!aK-MP1< @Cp(0AS*d`80 6/ 0( Z80 pp 7/Qh08 3/ލp@-(M@,0/`㐳PV    Rx 0  0匏`p KAЏ᜵(Ѝp蠨ȩK-0M8q L0 3/P  @ p|1/ P@ p` U0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  Y 0P``PP 唝P p@ 2/Pv 0``PP zP`@-@Q 0 A2/@P 0 @ ㇚ @ @-M@8q 0 3/P9  Ѝ@/O-MM^ Pg[P áP] OP ⷡp ʘ>@+YᵡPd0`0 㚥D@ lᙡ$@+XᓡP 0 x@+X kP"0dP tBP`+XL r0 J,+X0 ; 4Pf *P\@+XT0 PJ( @+{X0Pu P,m PP.묰 +`X[ܠ@唐`p  0-CP  0٤PE u P * Ѝۍ&g!p!{!!!!v!!!=!!h!!!!!!!!!(!O- Mp`G@T: PY Y4PPP, pQ:  PP  0yp|cPPP Y Y 40ucE Ѝ!! !xZO-MM@p/PP P pX`P` P "0@+W PS*A@/_PP `P FQ Q/R ⹟P8JP 1P) P Xh  ẞP&J/Po!0@R+oW`+jW PኟP J P+^W P:k?k`@ᦟ᨞j@PЍۍj$P /PP) @P`P yePve PT x+V P*+V P*upuPj>j@@P`!!!!H-) p@-M Pᛟ@PJ  @;PJ P/`G V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`dp5d%XupXK@&T  R q p5@`TP7 J50 `0-` R4@$ X,`$0P4$@,p0@Tw  00`Xh`P5D00L`,!<HHAC ` eP4<xP@eP;8Z CeP p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#X 0 0h@@P彙  `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`|cU`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(8 va ! //!/!!(0H-0MP   !0Nd @P6U7C @ @$P Tp0Ѝ0 /#) /.H-(MP@q,(P)(p,p10 (0R0< 0F0P0 000```Pp$p, 0,i(50bP`(-(`(Ѝ/ȾL..G-0M@(@ dgP(p U `1`0 p  0`Qp@810n 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P3,p(EAᒉ(E@0Ѝk#p@-M)@ፕP7 P 0`000S0P`pP %+<@,9 P0  ,+' P S|l* de-0TT Z@F. 44 40 0Ѝp! ]!/Ɓ .!!k#G-pMQJ@PPe : 0 ` V " 2p 0a": r`T Pv#͔|"p` \0 aL":0 w<"J&n ,Pf 㯔p0"(H0  R P5 ` p=TXp!0 Q 4 t R8qT TX `  P  {@!p(0+ p p `p  f p( 0 p`+0 0@0 J p_V 娮UpЍ8=0p 0h` <p@ (02/`P  /n !{!6!Ɓ =!E!@!L!O-M)$qQ `W W PQ% P!T11/PPP(0`o"P Pp`H!L1 ` 01/P p$qP P `pp@ L03/P P P@ `V:@V?@ Q<@pR  7p0S P1Ta(h lP`0 0S h 3/,4w 0#hLGfbb 0C\%0;`劓p冓hb&T% 0 `tpphb '0 (寔`\0,p`(PdT  |p`'p ş5u@ PBA@@@,p0  :(P` 0<] `Apf0` `````Wp pF,(ᚇ0ppW PX!\DGP.`x1/`h`plp 0HP pM`ph@l1! ,1/4p<pH@1/ 0`C  ( ```4/Pl`h```!(0l0h 0 Q  01/ Pp 0 0ZtPUi xH QpU^ p`@,P`Po `VppUH ,0 p(pW%  p0UU: ,p`e PUU(PU  BppV+ P^P BG0@ PX SR bpQb 8L0( 3/P px8 08 8 p( 07/xPPpP P t0 P |xp`?p`ЍpH 80 L0H ( 3/P px8 0 8`8 ( 06/x@DxtPv<< <0b/ / ]!x0/[!!!!|O-4MБVp@ `| P/ 0`匔 /P PX  %K/ X P`P pP[ { `喑 PYP(!`P, pap P# (phR ! p"p  cXT,4  `8`@ⴁ4Ѝ` /O-tMPl$h⭱pP @lP X$P    Rp dp`p:( :zzzz`]A     0ppS TT圅 h`$PAJ(P P: P!aP(PpP- ``@`r@@"cJdhb"p\Jp ~b 0 P8P壥Ph h@lPi 4 h: hl6`o ptЍ/HL/////O-lMP8`@8bPp 0W 00V0 $00@ `` 0@ pVp`pQp p㕨P *.?V릷  P:R ,0ST0 S Qp xlЍO 00 8 Pp $,`X4( ,$P `Q Q 803/P ,(Q  RR(  (  ,Q BP K B p,P P(4Q4"@`GR^P M^P GpP,,(($`P P p X:(4,$($P Q `8p L03/P LPTP P (` V:(8 0 P- 88`p L03/P HLP 08 < P    R pW:H1/` [*k8q p Ѐpx@p@ X0T0@ 0 !k , P  0 2p@P@0@ X* S0pP Ah\W $0@ [ 51 07 5$P X*1h2(0 S&*1c20@0WP0@,  QP@p`A R80s@0p 0p@X0pP0@WPZu$4p W!*!P: 0` [g [0p@Q`@`V 0@Q@$0@P [#* 0P` [Y 0x/0p0S P  2p@@0@0XP0` PN0 @ Dp @P@0@ ? P<0( @,Q :R*Abp^ q P rPU  P$0 00Q* 0^qa @PP/[T  lЍk#/!! /T/O-CMPp@U\0`dR `80 R0P pQ0s  BYO p:PJ ؠHppPV p ShP0 dpp`pPW:!8phP @T pPp Sh L0 l@3/h @T:Pd@E oq/AQ"PHp0PT 8HpH1/PPD @RL `T` < #"PLPP{0  + @p8q ``( L0 3/d0@TpTDXP@P L0p @SZX PPdp0`Y:[4*d 8 pዑk< @ pR P D L0P@P `)ZPp "0P0$P``P `PPU4 P H@\ Pt`Y@( \ [ H 1/d 0Up`P (``R$` cX' <T dH@0h@84`,`pgZc PHp85 P \ 04 p0 Xh < \ 3/PE ,hl$R8P0  p p p0}$P JP L `00<@ZߍۍP/8/.H-P0S@`0'@&0 ^3^8/G-0MP$PY qX R" R Ÿ0@p R  @`VD`Vi @H0T:! R !Π p0S `P@TT@TD ,p! W0Z.:\PL HΠp ʌ@@ 0` V P$P, 8 0SW @p:0. Q p @ L03/P  $p W:XP XX @ 0Ѝ/.//./(.//@-PM$!@ * }Y88 8088L @PЍ@h./G-(MPp`W1 PYI 0`0SZ 0,"C: ( 00  0{@w| (ЍG/X RTpLHP0@T  @PpӰ(Ѝ p :0 0S O +&0]PU  PP QU}QU/e  +PPQTQXQ\Q})<, PA "KAP a/Qb2bTdZ [ `tP }AQ  Q  Qa/@T[V  4@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8@  PU: p| @ TP xtlhp| h0 |XT\| T0 @d@`@$P  D ,$$@  0 ., , P H4| @0 L@<@8@P ($ | 0 | 0<`20 `00 (Pd` `00QARQaߍ.P/A!/(./!../h./H././,.//./2!Q/Ѵ!/.O-Maa8@P<tT,}Q|! R0" ߍOPxpW   R/07/P- L03/xP PP:~ǀ`48I00PS %`_p $ 0R ,Rt;$ _`pN" P  PIPTDP`,Iph!P RP,1U A *? &?0UP @P 40#<IP!@D$ L0/3/PT"0 P t I `jMP @P  HPIPHRHQP "I 0@܂@pRoP  > >P8p@T*0x 0SU| C`"T3_"IR/P"I`0;$q _@p &' @LU Ro > > >$ Hq;$ _@psR/0<$ Ro, ` 1"` I  "% @ @@- I    I ߍ! !!!!! !!un"! O!!/.O-MM/`p@T! P|P $P 1/P $ R  0P1/P 1/P|QATTp `P @O~<`8P P / 0  P  _ 0VS pPQ( XQ%0 ^PPTq 0@xp P` `7/, PT0 0xp0H0@M `7/ %,! Yp@PQXQ% 0 (PPTq 0x@ `` `4/T  PT0 0x@0H0 `4/0  ,p! W~  0$ݮڮE CL<  0P  0P|  P `  ډP `^Z38 PZ ,|,D`D@P <P @ 0 P峉P P$PH`YV' <@xP 0  5/ 8 B$0xP0 05/40<  冉P!@Y PP   P JĪ@P < ,8 : Pr  0x BQ8!# Rd(@@;8$PQ , PA ;PLp;`| n< h<8P@T8!(0S ) i 8 ,U<8(@$P!,0S d) W 8 ,C<88p!00S ) E  ,2<8  0;P,p@0`L8P  R8(,40y0Pn0 0`  <T(y0\Pn0   ;((8(P 0   ;'y0lPn0   ;` P  CJP '  0  ;0@3J PP P' 0  ,;@P0LS'   ;T0S&   ;X0S&   ;`0S&   ~;d0SP&   q;h0S & v  d;% j  X;8   0400`0`Vxp)(@$PS8   08Sqpq R  R   Qx(@$P,8P,Q@|P 䄟8p;P84AP 0P`VF $ Q?  L0 3/P HPXP$ Z:) ᙧ TI P/P NI/ P EI  PP{8P 48` 5IP42IUaV{V 8h<P4PP 8`x QI4# 0Pc 9P KP 0 Q0P市P(80448!0z| 9\b% P  +P 0P0PPUOPQ 9 9Q Io0F0F PQ @P @PPPP x < CP@P < <PP t 5ߍۍPP/.\.!/./F!TY!w!!}!!!˹!!!!!P(X! !/./2!k!+!/(./!!!!!!!! ! B!!_!!!'!.!5!?XAB,./@h./(8;==H./2467./O-M@P 0`a q08 0000 pQ7` RQ`V, P&" R Q "t  p 0P g&"Q!! S 8  `Ѝ. pK-MQN@2p34 4@4`4|444 Px` $7 6́pPPP XP 60 6,p! W0x` 7X 6LpPPPXP  60 6,p! W ܍ P x$0 - Px  0% Pw 0Pw p0  Pw P0  Pw 00  Pw  0܍K]!!! K-HMA`PDPp]  0  0ppk QM `l@5556`66,686T6H6 PPg8 gP1D gDPP$U)P$`l@ !n@ `l@PP`l @0X &p& 0Pp >z]PWHЍԃ(( .O-4M@Q< `PpPP TL0 3/P Xo R r P,`! VU $@Q:P P+E⚠+,, PJ4Ѝ9+ ./0H-P@PHL $P PH0G-(MⰂ`p-W BpPv DPPpG wppV889L999 :H:: @v0 | @v`QP !0 C! vp@\ @v`Qvt g0SP  QvD!0 Up@: P P!$1 Fp@+ P P (1 7p@ P P ,1 (p@ P PL 01 p@ ]v(0 ge(Ѝ.n# ! /#) K-MP P@P;;;0<H<l<<<<h=   0 `P``y /P @ 4!08C@/QPPfPo`PP\|0,!< "0POPoIPPE o @ PP< P9!Io PP1 P."Jo PP& P##Ko PP Pn0\ py 0Pp x#\PWPPލ /ܺ!@-@Q BP p$$ PUXdH./@-@C-GP < $1(!,048<G-M] P`nu C4VI>?0?X??a@p@PP  3 38p@T@.$/ @Fu 0!(0S @#,0Sd @100S4 @2 #u 0-܍n!d! !K-JMdAPp]L  0  0pp>iQ  o(@x@@@@@8AdP-P+ 3  0PPw5`l,@6`l0@0d )p 0Pp w/[PWPPJߍ(؃( O-4Mp`8` P`fA`P $$ L0 3/P`8@ V V 4Ѝ@-@$&F(,04+F룤$Q"d  @@޵Qr!A-BM@] P`ct 83 VCCLChCCCC D,DTD|DDD@Kt 0o9 @Ct  0 Ks: @7t`0c; @0t`4\@*t8P`?AP] !tPd 0RX0SH! @=4 @t`d:> @t \0+`0S @?h0S @Al0S @Bp0Sp @C sL 0 @st`Qs0 Bߍd!! n!!y!K-MP Pj@oXpEEEF(FF`FxFFFF G(G@GP EP 0,!< F 0A0Po0;4Po458P PG  0Ov'dPod!I`l\p J`l`pK`lhpolp0  0P  *vYPWލpP PptPotPP P /@-@ QH@QH-@ P`ppp pD@`gC$Q"d  @H~Q!p@-@MP@PJDP R ,@! p``P T X01P @Ѝp. .O-MM|?thX0(P pW pW rebq(@@BP   ,0RU]  0    0``fp pb$ghPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ .O-Tq#!yd|d{dЀ!!!u!!S!(z>@-0M@   @ @00( P, 0ЍG-P0@p `P `Q `` V R:RKVI    P PP8# 0 0)" p 0'" P  2  40pP ЀX $0xpXT/O-lM([ 0  pX  0p^P+ 8P+*`0 d40 P  ±ʄP& (p=0$0 KP   C" $p R0 "[ p[ z yl[Pp̆plЍP P!0H-@ PU  Po0H- 0pS7 0P@Q U `PQ V*`UU U P Rl0၆40pP "c  0p@ "=!O-GMM@8 ;P4PPP!J4 `sp *r0P# P 0ypp PpW pW` uWPPPDP 4` V s#-wP`U04X 8008,D$( 0`8p P# w؀Xk8P3= PPZ 0 #",  #"M(Ֆ8P h vP>$D 9P 4 vP1x@pW W   kP"  cP vP 8 R |8⪬8d08 vP PJD[0`V: <@P1 DP 8 ቬ880p W P p8 Pp8 pgv@    `;`V0   ዹPGߍۍd@!!!!>!X!>!u!!!!O-_MMPP xP .v@P _ߍۍPH'`Z0u@PHւP GDh(PlphPd T 0,`@f$<YOp84PpHLP\e`ŊPG P [ [( [TP*T  ㏗`/\  ㆗P \%eXePP  (  (PX  mP d! 0  b `T`p  eP P  P  P \PѕPd\ 4 @ $8H@W$,L 0HPp><eP X\ HLP8 Y P0D` T0(T0`PP0XԐ84\<P #8T0<P< Rp0< 0(tPd'HLPp <@84,0DP<h 40p8@<8@0`v?E(D_/;` W/ ,0`0 R 4P @  PPPQ088P`8pZ0W P׬P0᠃@,0a[/ 0plpP<t~Ppql0 [/ `p`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R '`xp W:U &oD@5$$ $0 D09!! !/! .0! t!z( ( k( Gq#|d!G-8M@( f`P HP P``\P|8`X&&q8Z`0  $08Ѝ 0l9!N!'"n#/ /H-0`@V PpD6P 6P `pV@p@-P 0P@U  ҂`ςPVʂp@ǂ 0+9!]!f!@- @s@t!A-PP`@pW P媂娂,0LQHA04q8a0W X   ?V   T0`  R Q  0 p?`\p`  ЍO/ Ѝ/UO-\M RW  dLA p0P F P0KgI`@>PQ @0P 4 P09gIp@P@P?HL P PU@P L0 0I0/%$X P@10`d5/p`\Ѝ /@-@P, (.0H-|P@Q" Q0XT D 0"!Q@ PRUR0 0(../H-@P*p- 02 H=  0E3u#0!w!q0H-P@P |T T TEU P *P0T T 00 0 0(../u#0H-MP@P  NPPT ybP @"QQ Ѝ0QЍ0H (../Q /^ .//0  $S :H-M 0  ЍH /ᬽH-M @0 Ѝ 0 ꤾ0H-0MB"0T00    000&P0Ѝ0H-M0 0 Ѝ@-M, $@0 0 @ Ѝ<H-M0 0 Ѝ踿H-M 0 Ѝ8O-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0G0P QD∠ 娰X\`@dPp3 !0@0 ;@@@PJP P]ipgw  $`刵P!1 x2  @(`@(P L03/P X( \,0"# #" 0@ T:$`0 0xp 7/@j$@!yd!!S!0!!!p@-M4  ?0PBT T TT bRPU 0 Q T TT @  0J PCЍpO-R R@> - pTЍ./0!o!q!!!O-tM8^PY 40@ SD0AQ0R^K0` p@S[ PPTTT  rp 0`:T X0W0,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^vtЍQ @ P`P ``P`  T1^ [ :^ q0<>02 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QnB`0Dp  WW T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ xP  <5 `p 0p LQ Q? `V@ ( @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP ^  P $040vP 00U pldD`dhJ VQ? " `>,0`Ģ'4`@r,8 ;޷PJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@@B R R R (0"r" " 09 0YR0pW ,@$`PBgrP T `p W,4,pnP" @0g 4 pP,| dt `0 W UPD (p4P OPPtPU KtXJ`z%  P-"P(8 L03/PLP  @RD @P Q1/  @b+U tp<Ѝۍ$`(p4 0l*0!! !./K-8M8qP/ @X`\PV ppW? " `p>,0Raf& V0  "P 0τo@8Ѝ 09%*0!>! !t#O-TM $H0$P L0pPHJ0H 4LP`P0 4<($D @0YP.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0P'"X$! `VQZu  吵" ?%@Lp?`HL Q pWp  % 0%%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍ//p@-8MP HQ2"d@A` p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&0.8Ѝp/UUUU3333O-M4@pPo? FFPP Z QPکPW   pP pn&P JzPP PBPTW Ѝ!G- 4pq=pW$PT \ '0 ?@`RU U UU R, @"0R Y WP  GP:Y W ᪉P?6"R 22  G/4;O-MMPP TQ4pAn 县 @P w  ;㐴pp ) I ^@XpZw ]0P 1/ BT _`q`VqOPqPUq qЍۍ 0k '{dЀ0!M!f!H-MM@0P 1/ ;9p `PFoP p ]oq@]zЍۍO-M@吰px| Q94`0ᴶ`H pG0w@0P@PЍPt#./un",.(.Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @(../K-M─ Q @4` 0]r Vh p0(@SDD0  p"!@@@@Ѝ./un"!,.(.K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`m`Vm4W  4 ]@@PXRU PPO`m`Vmk!O-M⾀@p_`EfPP V QPکP"0@PKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0#0! !&!p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`P;㤕Eu  %pPePfP lP zP6bP eP  0u$ 0ippW @T  fXp / Z8 X6T4 <F 22,彬Pl YP$   P #`@p tPI y$ ux#p]pclZ' IYpʔP p|KP(X X$X(X#0"P 5$ X$ X( X bŸ2 pRp@ Xpf@ p PF/VYpt!P  fPt pIXpT6 p<Q$[ AX$W(W >W # Wp@P P( yWp$Q P 0@T #P 8$(W@^Y ߥ`   R0q0 P0R0v 1#P V V A Y S#kP@ܮr/r/V!,/a!{ X(l! !Q!ht@P(r/r/r/r/0,!! !!@!!!!!w! @-M|#@(0   ʱ㯮L!P( H- #X HW@-D@pZW0Pz@o(r/O-M-RMp |V4Xx&hd ^)XL~@Ɵ`@ R0`RWF`&W@A X *``eP7 p P. 408 VW P7"."` P ,"."480 6WP zP t 0S $ @T2  A  A$ @ ( _dUdPh0`XQ-pAP WpGW$$$$d$TP`?G!hj Z` P @p:j)0$  u[!EPp:S0:Wp#hP@ ༯p  1(A$QS @D9 -T=IBJp   A@T0j A  Q4@*P :0 %k!%Pp :S0: ` p2&1p|pd`"g P" `'uh 0m P R,pX!@ R :P! R`@ AkD `  H 0 JT!e:PPp!e2P` , P fURߍЍ P* e Y@ @Q5?e AQ%.v w,BD@b"(r02r 7"cAt qdP.As/s/s/ s/r/r/r/ r/E r/QL ,v# w#V c ų ! x r/0H-0MP@  !PC0Ѝ0@-!@%!@@- M @ @ U ЍG-RS PPm!7 `QLp@: `T0 ጮ@`P: !A-M`@@P1 pP@P P:PUPP$-P  U    TP V  `@P!@Ѝ(H-`@TPp  pTPTU!P7p@-P @Tp  `_T@Tpp@-M@ Up D@ЍK-`P* pP  @P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM p !Ѝۍ!p/H-M`P@R   `P+U pT1Ѝ0H-@  SP  PU P R hhP  R hhPU0HgO-MMRO @ PT k p`PH`Vp@U+   0p 4 P #P* PT" P U p PF@P R@XL D <0( (700Ѝۍo!!!!p@-@$P` bP 2 Z Pppp@-M>P`@*p! 0 @pll0< p D0 @upЍpt!H!O-lM K @oP `2p- @ p NT Tp [Sp hP mTh" NSp Tp  [ 1 4 R 'T lЍ - 0 |0 x0H-@P q ]RPpPPq MR1 p000H-P@@Sp@P@0p@-pM`0 @p P| Rp @RpЍpO- M@ `p jp tl0Tlp0pPZX0TPZPT@ @Ph0P Ѝ 2!*! `!:! !G-MMQڠ7QPp@& ` VPZp` QЍۍH-MR @PpP `V  R: `QP c5d`P.`P  QQ*\dP  P  pp `pH0   P`@ffЍA-MM@ P|| [ P1`    mQp* P ` `P  0 @pl ,iQP pp P 9P H<V bЍۍ!W!!u!!k!p@-xMP`@S  j  QQp/  `?Qp$  9Qp  3Qp  -Qp  P ! P0 fp 8, Q xЍp!!!p@- % P ( DZj$$ SPV  QpP$%%pH-8qP :&{P P P NU e0A-(MpP@`6LP$pP8 Vs P !U PP tPQ` 5tP 8P P bhC PK DH!h H',(ЍAd P9 P6PXP5P K_'(ЍA, ,CP $P  dppP 4U(ЍA (ЍAP!0!k!:!!!O!p! @-M@tQ0$1p   N xЍ!!H-MP@pPP= + 0 + );P  0 `"xQ Q RQ 0 0 R\ C PSP HЍ ЍH!!!@-M@pP Q , pP t 0_Ѝ!@-M@ P Ѝ HD  } P Ѝ@#@-@:d-+PP POLP P@+'!0! p@-@`LPp P$  Pp: !$P p,A Pp p@/!K-M@q & ` 0 pP2 PP0 px P3 @ P  > $> >$QE ** AxP @ P | t\PK JHGKp7 pA@ Q   x@ Rpx DH!@@ 0@pV Y PHQ   Pa ox!zpЍ!!!!!H-@P `pxt , A`UP&* 0P P:H H!z!O-MM` *0FNp $$@P+L` !p@Zva7P ] PP@ `Z u\!`1 pPO PxP `@P T`V* @Px  0Px` xQ@ DH! 0 ` `V`xrxP vx*Ѝۍ !!-!Mbo!@-@ xP $ L@@-@"@CA-@Mp@PR `{P V :07  @ЍAP"R P 0r>pWU# * P P `* <0% \ p <0 8X>P * @Ѝ !!!!H-M@`8!QQQ)Q7 Qp P[ЍH QT , KpN||ЍHQ" Q/ QQXtt!Q0 Q< QF,,,!F@p0ЍHk  !: 0P 2AD!\H1Bq # P0pP  ^ Ѝ@LL x@T v@HЍH;k!!!e!m!{!T!\!M! ";!C!3!*!#!0s/!p@-M@ 0hP* `HD1 S8!@ 08P0@00ȌP 080  P 090 00 Ѝp@~ЍpO- MxpWH 0@ P [ ` PyP PY P [ U/ PP' `(  :  0? U    %PpW Ѝ_!K-P 00`PdPp88PxPU!  P X `@P @W@X &p4  PU fIP&xPU P X `@P @W@X %p P88`88`ЍP Xx`@T +@  0P`   0`x8 PX!!!!!X(1!w#z!@-@ P   P@~:O-M`PP4`0` @DP  ?P 8p*|$/8h0,d4bHp[HpTHp &kfJ&kNO쿟쏟0 @  0r?PMPp[ 4P+ 6PN@Qf@ Q$t    ( D   X   l ,h         xP`kx\p国xP8`f(@E,P , x8 8‑E|Q 0pP; 8 0 P:pWG| "P8@ K 0pP 8 0#PsH ! 8 L4 ,!p   ) $Pd !l lɡh !@   0 W *   @Qa ;+8+00M 0 @ppRp@pD Hp 6 P[ tp; grspN P 8(pP :(  `zGP P8H 0 !/q ,8I! p@*@T N`P`@:@ @v`,*8zVpVp8+0pؠ @ `` p@,@ 8_pp  84' P Q R000 * L[8<P A[$?[8P:[: _P 0[ P@1 X @dp x[h X[ ߍ, Fp Tf ,p!/1,p /(p,3 @ 8p kP G 7  p p ,7 ppTpRVV, T88wP @  @Q P>  P: @ %zGpP &GpP P&8EP p$h$8 \  @80P @$0S p P p6@8 +`Gp 8p `<$(dFdh58  LpPFp \P p @,@g($ Ad!Ed48  )ptnPxp d$ 4 0>8ppX 1+b&pXIL4 pp>!1R84 P9 @Pcs P P)!@Tp,@W  0S" QP= @X :8@@$", ,*F @!pW @ P  @@bpW! @8P4`  : p4p@8`V p P Pp`V)0   Q `V!! ( W!1 R  1Pg(!8E8 @T LQ P  0@L@Tp,@ pNF(w#1!0!!W!6!P!>!,/X(y!!! `! ! !!c!0w#@!!!-!%!>!R!y!!!!!!! !!M"0!V!S"g!`!!!!!!!>!!!n!D!!c!!! N!_!k!P( !Xw#!0H-@HwDp PSEp$0HD0H!r!{@-M@p tdPt :DЍ@ 0d @Ѝz!0H-M@ , 0DP p<,,;D,Ѝ0R |l0`XЍ0H<PЍ0HUY!!!)!!@-@Q  ppG-p [7P W P@PVPLP @y!>!O-M@`PP Р,(p R ` `0 P    !  H6@48 P P  @ P@ЍP!k!0H-@LP PPWLPLPWPTP PXWTPTXWXdP PhWdPdhWhRU P # ,PPRWlRU pP  p,PPplRWl0@-@@!@-M@Q  b Cp PQ `0 @kpЍH<Ѝ@y Ѝ@!! !p@-M@Q  ] Bp `PPJ|)WQP| h0 ! @.pЍp@4Ѝp@p7`;`kЍp@!!!!p@-M@Q  44h_? BBPP p LBЍp@b!Q| A0S|Z`XPP `@P` XX  P ȝ80 @p Ѝp Ѝp@ !!P( !p@-@>P PR |<`0p`> * >@p耼H-M@pP tq^$"P'P pPpPP PP@!U8 >pQ: `l!R pP 0 P 00.'p$$lP >P p *P> >'%VptqЍ jx`V >P`lP x[>P p *`> ~>p@ F|!! !!)!!!/K-PE S `X!1RJ q@p ,PU Q P P Q   P/PP U Pp@ `崑U 0G ?!!!!H-P q R 0S   U B  0 ?!!!H-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^j  0Ѝʚ;G-PM PUO @`SO*$(p`W P P p0pW P 4 OpPP# OP( `P Q   Q,p,ppp,<< D0(( ,0 0> ʚ;?!!'!!!H-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p 0 ?!!!H-P T P 0) ?!!!H-PT 0 ?!!!//H-P8 0 ?!!!G-(M$@T < <`$`Q ``` pP8@?P:b <! 0`V: ?p <Q  ` P8 - p <`V:(Ѝ 0Yr w#?!!!  R/ 00/4s/8s/0H-XQ@P P@p P@0@4@(@, @@S0 Mp@- MPO @`V P`q QPpQ   p ?@SHSU HLP Q   S Q ,  S(PQ 4  S0PV Ѝp@ Ѝ/@-@@vSO-MP @TPȲȢPP @@ R D2/(`V P P J `P  Qp   `UVPP/ pLP*H 㭻P% HLpH R 0s qpp 0P   0Q0000P0   QUPH 0aP*y7* P3 8pW/ `VPTPP P     `FQ 2/V pWP,1/4P`4`TP\ PЍ ` 0$ 4s/8s/?!B!!A-M P?0` O0pQp*0 Q  0`0@s Q0  0(PU @F`pPp*` ` p@ pP*W pGp@ PUЍʚ;MH-M  0 ЍHЍ/G-AMp`@Pp `? 0᜗p# = VV@ V L ᰀ@ D兙 =Z   5ZAލ(P(MH-M  0 ЍHЍ/G-M@P`9  p 0YY0 * pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ//( p/|Y(A-MM P++=`p @ PPP ,`,$ `Ѝۍ( /(@-(@@KY@EY(p@-@{``` ;PU  ` `A  .YT U PVpP(($YP/@-@6CV @Q0H-@"Pp ! >p ! >PpP0>@-@q [<p <@">A-M P`@p&  Wt  >Pp !wv PP 0=pPЍi$  L r /Q/ !/p@-XM>PU U7V)@T @`Q yT TPUA @>@P@ <0) 8 > I"P> *@XЍp@!@-@T B@A-M`V @P P  nP Q  0R p B`VЍ SQ/@-@T XB@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`FB @iJPp P!pl XZj  NRpR P$ PP dP ZP@T P @X @P @X@Tx  T@PY( PX 箣P TP UT\X @` 督P \@T\X,LP P 爣P L[LDo,  U( Q P[PPP!P P$R$RPLPH (MP @` ,P PU$, 0 @  pp 0  @D\<pA@ 0@S/,PCP !5SO S1 >,PT P5TdP @h  P d@T!P( P,PSʇCP#:SS S (UP|P U P(@X TYT@,PP 帒*> 6@RU  p @ X!H pHP}H P P 00L ` a PD@|NPaߍ P!i!!!f!'A A- MP `P @ P P P:` Ѝ:P `  p8W bp8  P  !00:P PPA`p ``0`P iQ.Q  ` ``uQ4(0H-M P@9  j  0;pЍ0~iH-@MP @P`R gp `V pT P P `V`@Ѝ xQ/$ /H- M@0 P:`V 0 PpP P R: R # 0`P`VxP Q  Ѝ9p@-@ qM PP ` `,PV:PbM($P`P` ` (`,PV:$PQM$(pO- ( 6@0  00  @W8    p 8 4[ _X+ nP[,@Js PPA  @l2h<@(NP0:d@680 P`8@P4E 8`0p4R4@ Q P A P PP 4 ,(   0kP4P4POP  P P 0 s\P 4P S  ` P`Ap` @R `,@V:@]L @ pP ``,@V:@KLA `0 l2p0<@  8vp0 @` R ,P00 koP (,8@p80aP4 L4R4`Q P @A P P2@P@4@@[ U  *BP P0 P; PA $PN WL|P [G 4P  P P  @r\P 4@ R @PT Q2  㷟PPT P $PT $PPw Ps[o, (0@Jc` dhP @4hAmdhP dI$P W LpP0! R *B <Ѝ؍x~#Ps/!#tz !k3! !!G- P@p`+P `mV?@ QZ 0  GGxw#!!Q/K-PBxP Q @J@QJP Q @J@QJxP@TF " JJJ,(VP X,,PP,(VJ40VP J4,PP40VJ<8VP <<,PP<8VJD@VP .D,PPD@VJ J KJ` P T PT@PH- D0\ CϠ%AˌDq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 `p 0 P @@0pU   `p` ЍX(w#1!0!,/O-4M1C@P* `   x `0\PXXDzDzXDz XDzDzDzDzDzDzDzDzDzDz(XA \n , pP @@,P PCPe /0@ᘎC 6IQ \  @.P )Po $P P pQGP pt\y  @ P P Pi P& li\^  0pWZW TQ\ ?`X\rR 0@@ e P0  0X P P  0M P7 \ ?0X\VrB0 0 5 P 0+ PP\ =@ P0 PQ   p Q Q5Q2,0 Ps @P/P<0@ аP <, @!0 <,0 PV @Pl/P408 㳰P 4, 8!0 4 \F XU X\8 P @H 0P `p @P zBP  0ApPG@\  C  |\d 8@ 0P p8\X  0pQ\ @PY @Ĩ@}R;\ X PPp 0@  [0Q8 \ 0!   @ 0 R$  \ ?X\VBr 0 ! PP 0 Pp  Pq@PP \P  \h 0@   Pc[0 R S4 0A !P pT\F , @P PpP W  04$   0@00@,0P9 \ 4R R 04S 6R 6R R{ 0 R R RsC\ 0@   PZ0 R_ '\ VPS PP\N ,P@``VP" P PF PDH P2 D, V!DHP*  P PP"`\ L @FሧPLp a\ ?X&\6p`@p @P P3 P     TS  \T  \I :} z PU $z\, P ($\! g$pxx"  |\ @=P hs\  Xheb\ ?^X\VBrp 0 c P 0X P 0 0N P8 2f$\ X@```VP6 P P0F@  PY0P !D!N!`VP P PF : PP p0!p  pp pxY0Q 2G!\\  0 p 4@!U!.k \A 0@   P"b!! p PKP@ KP @`KP |KP lKP+ \KPa HKP 8KP (KP KPP KP KP KP KP KP KP} KPz KPx KPu tKPt d|KPs TwK\UP{ <pKPk ,kKPh fKPe aKPb \KP_ WKP\ Vb P_ P PVX PU P PE1@@@ p,TPd =L Q 6@@ m0 jTP (!L  0p 43!!P@ PB  PM  Ph  PE x P? d P9 P ܣP3 < ֣Pw (  pϣPY  ɣPS  ãP oB" U< Q@ @P[U  U @*`hTP +!3[, p4PwY:7U  @P@S W@TPI P PDQ  Q QQPj@@ P PP*Pf P P^@, PP P zP !cj!!cT` lP gPq`lB  Pp4H )A0p P @45]@ P PPY@!P P PDP@ P PhP=\4L, 0 @ 8'87p4`DcP P PDR@,0 p$ ( Pp D P ,@ 0 8(  pP B  PU DpP@U@W@`DPc P PD`D=U6 0D 0@   `U0,Q$ d !U3 , @p QP P0@08, P B  |P P PD_S2@!B cP$T gPP P@P X U U [ \WW\\V  Q PP Hm!!P P    [  WST `Q  Q Q Q@! `@!!Q Q Q@dHP ߡ@P@6@4Ѝ1!@P $$ Q` 0S0S  ,`QRV, ,`,P $ & $(h@) W  @ T@P d!`0\pHP  ` P` !}!M!!z!:!S"!^!!! !Q "Y!q!) t>i"t"r "8 ">"E"K"S"Z"b" ""c!""7"!""G!!!?!, +!#!!!z!!!!!!!!!!! !!!.!!!  E!!O- MP`p@"Py"PP p U [VQ UP X` ~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  e.U!   0RP P  eU P U U P X: PpPPU [7 Ѝ(O-MP`bP6 =@P5 U ``V p=@W P! `V;? 9P @ 㪧P5  A ЍЍO 'P P p? qp F=P     } TЍO>!"H-M@PR `P /rP p   KQ &UT `` pU  P W /G`T ,PT`U ,`Ѝ"/"G-M`PᜟP DP ␟P p P @ q vDPPP< 0 n>l>ЍT F"K-@M @P  `  p  P t t@ЍG-p` V1`@P"P X FGZ : J 0pQ00@T*H_ Q3/K-T`V0 TpW1 @LL Q Pbqp ||PPPP HHPQPQP3P(PPP"Y $0? 0:M"h""y"@-@c6 g@2~#~#@-@P @H-Q# P" gPP# @ P ` TpP3`W9P $$ (0M 06M""""H-P TP gH>Hr= 0mM""k"0H-P @ PP T 0H0@-P @c g@ 0WM"""0H- @P P;= PP00H-P g_ sP @7@P d0 t@ 0mz"M""H-P QT$$ $0al 0fM"""k"@-P @PT@ 0SM"""@-@P Y@H-T R H 01M"""H-P @ c_P ` pTPE)`Wp@- MQ @T R R" Pco P P)p ` 0  Ѝp<< D0(( ,0 0 "M""""k"O-MQJ pRL P@ < n8P< eDPTt`P ` :P 6P U U t U  pp  `  0ЍHH L0 44 40 |"""<" D"$"""M""k""O-4M@P$mdipe P TTI$8`a+P $ |b%P ̠$`  pT Q a P P T8pPPN9PPJ!PETc|X P)|TTQ88aP4  P& "P P P TT R  7P <[8 8+YP XX$PxxQDptVP c_ P< Ȱ` p}`PP+9PP' PT P     p 8P 4P bV FP p@`P `Hi .pP$ur4Ѝ~#~#/"="F"T"""h0Q03Q/A-Q TPp Q 8P @Pf`PE TTQ"tt PiPtt_P88ZP xxQ( @9W [ @p'P O p P W @; p}P T@V (( (03~"ӱ"""v""M"c"j"H-P QW/ 0;"""H-P QC/ 0Q{" ""H-P Q Qo(/ 0}`"+""@-P @Q QoB / 0E"=""@-P @Q Q@@oB/ 0)"K""H- MP6 @PP 0@_oP!PU ` eP `/PpP `VP ` Ѝ(( ,0 0'Xs/"Z"f""K-PP*~@.`DTǁ `YiT d\`QPi/ 0nXs/"~""H-P Q  ^  N/o"1\ 01 CR #^ HN$$ (0} 0ix""""H-@PpEUa @@WgxUȀe8p@-Q( PR+ `@P P pQ  0p@ 0 p@LH 0"~Pp(( ,0{' 0_"q """mB"H-P Q!. $$ $0v 0 ""K""0H-  @PB~Q0~#z "O-TM @PP@ixpR P P0xp@@@@xPU A`@?P: @PUPU @`@?P:z @PU p_xk  0Pq$P!xU [PP TЍLw#0w#Tw#Pw#M0H-M  P0 tp @)@p@@Ѝ0HЍ/G-R'P@U`  R R* R/ `PPPpV# P* aP a ZpP dd d0EYE R  @T:q 0/"/"S"?"H-Rp`@PWU L0 p P `p``P QH RU p`ށ" 0!0H-P@p 0H+0H-@Q pPWP @QH` 6PP!PU:X^g"P(A-M@`PPPT  up' p P$ !R* | 0 Hp PP ` 㮽p1PP ,} $z#ЍA oQU p` !qZPUЍ P PP!p0S < ,Q >0$ J}"" """ "bH"l"O-M`Q @U >yz%QP P;@, (('P p #  p Y  |p p P% P P P P P pP `PY 4 Dp !<p x;@ . PP 0S  p @ |p DP R;>ps @Yu   Pok,%,5   p` L0  e%S S pS H pM P pG $ pA  p9 PP tQ0$p ` p'  xP <p ;@ !Ex`V# P P   P`@Ѝ`Cp D `Rph|p  P `  V  #{p T {p  `P=p dP/ 4{P& $vP! qP lP gPn b!P PP_ P[  !p}  pw %P  pm %P x`V %P`V 8pU @ pM PP 0S  Ep9 @ /p2LH v"""""'! 0!!ށ"!! "~#"#""q4">! q"m!A"M"["f"o"y"~#" !"""""!I!"A-R 0S P`@8p p 0S"H-@PpP$  `P.P! P P x WP HE .P`ḕ`P @j  +"H-@'Qʄb(PA p`pP @P` XXpX `{P:4R`pP @P` XX X M{ y y y  y!!!! !@!! !!! !!!! ! !! h   y  y  y y y`@P`XX X zXHP(6"!) s>="D"J"R"Y"a"h"s" "c!""""r """P "? A;0S /A+ R 0S,0pQ l2 R Q,0 /H-QM`@Pmp 0| x` *Q pPE E *Q:ǖ`G$$ 0xQލ"!!"O-4M$\(P PQ< 00D9Px `B0`,p@PPd   P  PU@ P PY@T,P &P.   6G,P P(@$PT=  P   G,P P @T,P%Y" `P#PX  0X  0\@P8P 2 24Ѝ 2T ""0H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \ \0O-MSXP` @ Z8*@p` `V3 P@PH V :QG TE?YP>@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N LVI"`Q V`FЍ;875O-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ \Y!V< WW\pG`5V/ WLH! pG)" `( P /Y YV W50 )\0!00 0000pG` V W! pG``0@ U:@`V W  P P@7@ЍW (A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P NpHXp H"p(H-M`P @P pRW PP t-Q0# t<8 W 0DvЍ""O-,MP0 @ \pP(P  0cp P P( `p P   0 p0P"L  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'$!p 0!pth 0,ЍO|L@W 0( }0,Ѝ4""h"<"%"""O-GMMPD@`p, pALpZ  WvpQ T  OvpI =7pD W  @   * Q+V42 0<p' P 7p!  [ OP      @  0ppAK GߍۍmoW R@ p W 7p )+15 =@@C e  .0CP  up P PdH%up p.   up p"p  p up p  2/ 2/tZ up pW:bpx@P`TP0PPEuS 2  7pp5l  un" Y @- @  Q!T  D03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p 0 A-M `P+p@ Pۍ@@sP ` )P j@///p@-MP (`P: @"3 wp1 0)``Sp0@ `Eptl 0" 9p@ `Hp Ѝp萈#""""0H-QU @p ..x0H).0G-FM@>P+ pF`d   " P `hp F?;`> *| F?.`Fߍi0H-@M@zQ@8 @PoQ Q@Ѝ0IG #H-Q  RRP` 0'"."9"$ /Lo/0H-@QP  P t 0H-(M `Pp!@\ 0cPP pT !W:7 P(ЍiH-M `P@(  p  Q(`!Pp ( ``PЍ8i(iH-M P@` p $ (PnPqЍ:iA-M P`p@n  @TЍO-QMMQ PTP @T HQJtp8\ `KPT`PpP @*`PT`  P T`T`XP3`T`ZU| px Pp{PpPH x|hH 0`xPT`T@ p  9GWxP Z "  P p ` FVPT p ` FVTP 0  T P  X  @PPEq pQߍۍ88 @0$$ (0 0"I"""k"G-MP"᠀@`P P 0PPp Q f*P p 0PPp F` P ,4,0@`P'@xPԑP   "P\P  Pq P k@T:+TЍ83"A-(M P @`Q Pp(Ѝ0'x Bp pWtN 1  QD (   RQ|@|  8  Q& X 0Qx x pPTPP8x3PT 0"m"w"f!A-@Mp @`P@   !U4 P$! U @0P@Ѝi@iA-p@0G0|x"PWP`R*_)P |bx `EpV X||p@-M|`Q H 99p |x2" Ѝp#G-vMM@ p+Pp U U``U`QQR ARj*Py(Q`Zv $` r xPm   Em? pc SP$  RR}RppuQ  RQ  RRn@ P !.  4uph Q s AR:Q*wP$0`P$R p7 P " ( RQ QP P) P  &Px`vߍۍxP @H@,PPP` m[V`P` `RP RN% &5 g?P ;1P hP*,E/F?0  0GpHR^;  l0 "p : $L 4ii@""H-M 0,Ѝp@- @0 Q*P`E``U`@ Tppp@-MQ @P P R xЍp@4P5PIP' @)/$PU ` xC@PU x@T `>P* P @T@ЍpQ/@-P@@@xV@-P@@@iVP/  Ҿ#O-Mp(@@p$@P&P] @xPPpTpp`  0gnp.pP :pP  0p- Q'P$ (`  h p ) p  7/P$  p $B#P 84p (@Ѝ""fB@lB"O-M`P    `Q4:  0Qp@T W pPP -P    00 R :   q Ѝ#H-M0 ЍgB@- M^ *@ @  0 Ѝ@-@ <(@9(@-@p  p bp~B G-ZMP  x Y   , D   d`!.(ZߍȈ#؉#gB@#X#K-Pp@`mQ™\ r崀`T 0R ,0TQ qmQ™`,p V:T 4` bmB,P@Tp# """O-MRpЍ@PU.* U /p `p!W*P%W Q  PPR  0mpp R  mpt/ppp"6"7!G-MMRp @`0GP P Pp  pPfPЍۍ \PrRt mPp XpG`W ./p _R }mpGp/ @-MA/( R r@Ѝ @R S 000P Qp@DTD@O-,M`P$  h  @  _@  y0XP 4ou 0HPk PP*P`JP=`p  Z8PP6@P4 Z( Q(  j0$p t$ ( $8  P`X@: ` P"P ` @v hXp bT`Y@ !0PP pLPJP `Q( # 4Pm ( Q   Q  Q$ t (b$_8 \ 8P`pW:0p QQ 0p$t@P- 0pP$ p P$($ P P(  8  P`W:`,Ѝ  "" "O-M P帀P"@40$5P $Q``pW pWJ P0l  jp P" 0P` $Q:` `P0  Pp 0  Gp P" 0P$P P0  3p P0x  )`p 0lP p$`,5$ 0 `p 0,P ,@$`%  0p @Q b@>,`@T:A{s R @`+,`@T:pQ lbp,`ppW: Q F B`0 P1 ,@`V:6Q pW Q, P" ZP X!(p   0@}P(P:0P (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍ" " "+ "C "X "g "0O-$MQR @cPPSP Vp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 QS"P  BR    pP  ~ H  0 0\P crW ~0H-@T P PPPPPP@P*"02S @"PU 0S, 0 00H-PU @L0@-@\Q \X\@-@`q `a`H-M`# @p4 P0 pp_p% 0 pWp 0)Mp   V  8p @Ѝp@-M`@P5 0hh \P  R h0@X P L0DH   _N E$ Ѝp@4y " " "I"`p@-@`hP >P:&Tx R RQ TQ  p >P:  p@IF "@-@A{@蹿 `p@-`V @@PpPX 0 $N 8L p@\pt^ "`#K-MP@p `$PH` " 0 `` 0  0  *@0`PHvH V  `0`8PG PK:j @   *@$M`(0p  d$M T LH0:HP[P hI 00RNHЍK$48sM  Yj@   4P 8P  @  *` @  PdQ Phq $CM 00 (P<PPfH0p 4 1@8 1@0 1@4 80 48@P\i`  0.p(h`HTż P hdEP ЍKNЍWL 00D 8@?? " " " " "2 "R " " " """ " " "t@ "1 "G "!A-MR @`  0Q 8p0 0S  R-  . 0P Q :  PN | 0P Q:3 P 0 P:P 0{ P;P 0p P  60P Q:Ѝ1  0G "w " "H-@ P` 08 l A\ 0080L<c u`He " "`##0H-@P P Hi$ hhL0HI " "k!H-MP@`p:P PP dp` D0 @zp Ѝ,ЍH ЍH$! "K-P`p O @Q$   P":A  P  @  P  0  xP d &P  0$ ` KL 0:4 HK K_ " " " "pZ " "p@-P`K@P D 0Q 0 pKpcSc {pQ0S/080 dQ Q/ k!A-`@VP 0Ap ,1 P i P P<P $J v - 0P Ps PPoHPP hPdP[  $A "O-YM`Ȑp@R L@P@QP1P}PLPا @}Pn  W/$oPg  W.!.. R 0S  R 0S xT0@   XT0 P`p (P @  R?D, @8`h4P KKPP  8dP GQ* W8 (R8Q cR R SRcQ8h (> BP* "0`  Pi WWU8,PT0S @$0(S D`VW W8d R 8h``S 2 8$(00CS*0 8`0050p0$0 S. D0S+Go <0Q$ (AQ:8`6< 0n/ 8 F ((!Q= ;WW 0W(@P*8  00zDW  0`DP}W0 (@P:20 0 0`YW 8`W4Q (AQx:300(@Pl: 7` 0QK 00$ + ` 4`  ` " `"4` `P` 0 `W :R $ (` V3 ` $ 00 `,0P:(AP+0 0o$0l `P I h6$P$ Pp`U R: ,P+ 4P `PP0`P& ",P,P `"4`PW:P ($ P 0` l$ 0` ,0\$:,P$04W(@P:9? 0`p0DP 4Y (APM ` {08`(P (AP8`=( e(0W0`   4WDP (APd< E 00`P :4 Z (@PF:0`P0WR  M 4 <CP Q ` 0Q7 (8P@E`P,P 8`  0!`( AR 0QV 0` C  0 ` 00`PW  DPC+JPEKKhP[ `ph p8`P^ ,`  C 8p PSE 㭤w@ C\P 0pw-` R,P2@P' !: 3 0*dP $` 0 PPU`P ',PX  0@Yߍ<`P:!.C$P!+C$H! Nr / @,\X@<R8HNDTPL@<< TaD:p R{K(APp 0.4^!(@P:0`t0 ""#g"J"cSc"""Y{""/"""K-M`pP@P P 0ЍKpG `W:@Q Q ЍqW:<Q:Pp R:pP P p pWP \F ~P   `    a9 ov4P0q!A @/ "N "Z "H-` P@R :Tp `F0 H?pPd@ 0HH"H- pPP @T `dPE0 HHH Q \Q0 H0 H "w "O-M@p xPU% `;U PQPUT P> R* P(  0Ѝ"0H-@PU `^ \(ZX@xP P QQq p 900H-M@H PX P  Rk (>P: ' P 0+' P P0    }㐢PZL @  +S00 @Ѝ0Ѝ0HzD "@O-M MḐ @(P8p< pH PUP P`i`H 0ȀpPp@ ((q. `DQ& P(  1p 6 @p3 tpЍ ۍO  N>@tP([ @(((> * (P >Q 0*< 0<  KpF% @L@2 @@ S! ` iP'   00 ; Z(taP( (((1pt!]4 Ѝ ۍOW  +PPp U$ Q PP   8;@  50]AP   F$!P PP    cQ0S0SS 0 PcQP 0$P 6@Qi cQQSQcQ0p i P Py cQQtSQcPo l@TP LP P * `EP PP cQQ}SQcPx$C L w ; 0<@Qf k2c \( P `PP  h dPh{0cSceSPcPhe    .^d@= r 0 `0 P0R  $@ @@480 BAC0 48\  $ C  ~Ѝ ۍl0 X wT5!"'!""";"$"P(i"Q" "!t""6D5"0H-@0 0PUhP00H@O-MP@pWQЍP PdPd  0Pd  P@Q P;帠8< h $Qhhd@ P  R ]Q $'<H9HP P PtB <`hz `{P P  0 Q 00S A AR:'   `" " "k!K-M@`p P P$PQ6B >i@P-  #PP w 0 UP H[<8(! #H0 @Ѝ hhF"k! ?`#0H-M@0P Q  RU 1Ѝ0 "#p@-M`P@\P Ѝp @.P\ 0 PiphhyP TT@  @$!#" (" 4G-AMM`@Q\P   p _p 0 `V\PU  P $ _OAލڍ!0" G-hM M TX pPP0`0@4P  XV@p XX DU `p T$hЍ ۍ!="RQ:0AQQp,| Rp/O-MḀPPT@1P> R *2P  0ЍO P (L Q Pf0 q W 0S: @@ nDQ  0Hv a V^ 0S:  50P Q  Q @P  yP P  Kp@h$ @ @pLP`p0  0PPK`VP6`@K   60PP@\5 @H@ ЍOJP`00  0P|PP6V`VP l 0LPI  P PA P 8@  0Ѝ@ T  0  2P P   P : iP 5οPP < <Q 1P P@P  0%`#JPK? 0Y 0 J@PP 0 =  P `  \T t i 0嚿 @4RP} PPL P ` Q Q@ QVPM`@`$QDN   60PE QB:<@d 0 P hh  0F2 $) "P)   P0oP QZ Q <`:   P0SP   : 0 6 0  Q*P A  P!:>! 0PL ( R h1幾X! 4 RP*y P   P 0@㴾 ^ `l m Hʾ\PPw"""""0" "B"n""^""k!""" """"`5D5"N"Y"U"O-IM \pP &HLaP p` X! [>tP IߍOj P @at Pj ,0 60$@@{$ oR003p 40@m'P $ R ", R QP ,@$`%0 P>Z   `W @@ ` P=Z x@dX A P@0 - IߍIߍOY"-" ~!6"Y"F"H-M0080PP@UЍ`P  P  p@0H-0M@: 0᩽P P ,,P    ,= l s 0P 0M;0Ѝ0"0H-@, Pp !L 0Hf" D5 H-p@`PQ ^P P P(  P H HHZ " "0H-@0 PvhLh0H"0@Pop/A-`@ P:P qP@P fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUp @  P ȐY PhP dPa  $d P PS `d|Hp |Hd H 9 ٴP$  ҴP" p8vPMP%  `j |  පpP ~p  $  cP Hp`Hd8dX r7p  ㈴P ` ӳ|xp |dX}P e  k`P$ PUOH₲ WP P. P* 8 P% Bp @oW W  P P < 0  # P  PȀX  P$p <`5$Sh0`O Pc pttXX 8 `X`dxQ XSh06 Y` ݳP `(H VH ˳P `Hp 㽳`P5  < { t崽5  < p D婽\Ѝ 0*~#""!"-"U"p@-PE P$ R@pc1P _P [P WP  ₽`V  R 0S `Vp0QP    U dPdh 0e_" R""K"@-Q @b P  Bz"G-M`@pP# PPPU4< P P p  PQnU`@MT  R PP 900@ Po @S$  `p㠠p9  0ᑼp  PP@ P 88ż@ cЍ6""QD1 ""K-M`pVo @P d$P R3( ,0 aP  h d *JWPFPPU ⎼=hP dPH0Q RQ PU( Q,Qh  XQhdPPHpЍ""PP    Q/G-MPPU @ `xq 00  0 PTЍO- M0@< Rx!R fP PP p`PP"Y Y V' P PA 1 ЍV P PP1T= 0S; Q4P5 ` P` ` 800@ Po R[P: `Y ЍO. `` ЍO肻6""@-P@TQ    P@ p@-P= `ɿ${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P p pds/`s/(hs/p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V w4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  ` {8[ L= K4@Pw@K s@! ,P  = (0,P $ HA[ i P ) Q ` Z `<Ѝۍ , @P   ,P 8`s/ds/(t"/(H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P -~((( 0000p@ls/hs/ps/ts/@-8@P ~  0000ls/hs/ps/ts/O-MM``CP P R4Q Pq sP 0SA  "0SᜎP   AQ 2 000@:R#RP\@o"t `P @O}  Pq PPq P Q ` QjPPpQ\Q UPQA:Q @} T\ `@: P90 h}+  R :R|R   0v`P P H}` d`PЍۍ00S\S000ps/ls/!hs/`s/(ts/K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `WWW$X,XpqP%mRb0BS`WWW$X,X:NR RR TR nR rR tR     @Ed P P EP P q  ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP  + dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  Pxs/|s/@-<@< P (OPxs/s/y" O-M8P R`$$r #UZ  PK oA쑟`  P( pq[ yPgcP  P J Q   P Q  @P{ PpPZЍp0 p+P ,P S 00P P P S0RS0s/xs/s/|s/w/H-pS 8@ P ll@p@-@8P  PG@DP8`8PP 4{Tpps/xs/s/|s/0H- @ PPP {P0xs/s/p@-@ P  P@DP8`8PP {Tpps/xs/s/|s/H-Ps/@-@P@s/O- M`p[ pPP[@ @P! X P tP P[ X Q UP0@0``P z`P Ѝs/xs/s///////@-MPPP <4@ 0PЍz/z/z/@-<@< P IMPz/~/" O-M`Q<@8p P[ V``P 8bo tP8 0p) Z ޺P(  P  PJ Q@oP  P  PJ Q  @PAz Pp)P)  P  P ~ P y P s P m P$ :PPЍ~/z/`H-MP`@`pP0P  0p`=PPoPЍz/H-M(( 00;PЍz/z/K-M`p@PP  0p(`pPPooP@@pP gyU@@Ѝ~/z/~/0H- @ PPP QyP0z/~/H-M(( 00;PЍz/z/K-M`p@PP  0p(`pPPooP@@pP yU@@Ѝ~/z/~/H-P~/@-@P@~/H-@P`p` 9Z 3T -N H&0H-M@6PT PP P Ѝ0 P@OT@P @@P P (@l$ 04/~/~/~/(" O-,MM@P ,ЍۍmlE0,(( 咨p  %$5@ 8E,e$U/oP b(  P P P+p X( SP P (((H@2Q6 jjjjjjjjkkj,kjHkPkjkjkjjjjjjXkjjjjjjkj`khkjjjjkkjkjkkjkjkOAPL PN pü3 7/B\?P;88AP2AP+(&!P@P@x P@XH`q(PI(  Qj 2pR R0Pb0P@@`ņ`1 0`apAp 1`p`q1@qP RNT C , ?ЍD//X////O-M4P Ѝ $Cp 07/   #p07/ # 3c@ P2Rr"T` 2U06/"2b@ 0bPS2Rr"T` 2U06/rRbR PB1/! @6 1 A葟ءL 0Ѝ "!P( R/QQ/d( 3P/ !H-0A CANr R 02| R 2 s~ Rs~ Q QQ//t8$"(Q//-$"(///MH-M  0 ЍHЍ/0H-TP@??DP ( E> 0H٢P(?J  MH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M0@!Ax !l ! R Q: P @ᕯ@꒯ЍUUUU3333p@-8`@P\P P UppИ#Q/ /И#O-M`P P@ pP:p@L `P xW!* P$  $P`P㄀( @,VV`'  `0 0pp0000 00pP偀6  $[@   P * @ F P:P  $ A  7_ P R@ p`0p`"=SLP 猣<<<<<<<<dܣܣ<<<< VQ<`J 0 @7QP30  @/< V"Q<`"J 0 @" PW >#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X PUP P P,H AqPV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R _``ЍTUUh p/A-M@``>Q$A QA ЭЭЭةĩĩЭЭt * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ $]?P^ {P=`0P*0,Q < (0VP 0 DQ* }R X g. `A $  $ zPh 0 @-0  @&0@  @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP  8 P  }RP P P* *0BS p`v P D {R P*$Ѝ/(K-M @\Y  P:PH```JY0JIPAı(((((((LLLLLLLLL(((/y`qPLP  O$  F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0Q @0 F @Q*\S{Q $YЍR`0Q* 0,R<Q*X :0VP  V RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n /(@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A Ѝ/O-4MP@Q * QP2  QP/ @  rYP  S00@7 <P* ^R 8 P*]Q -Q- P &  ] d0  $ 4 Q }*x0]Sy  R*-S]P$i-S! [S'R%* =R9 :R Q:P ]R-RPP KjpPA*0-S=Q;* ]R8 -Q/-`.Q:P]P-PP=p PJ*Q* =R]Q P'`W Qw:\P_:WP WW w  ppQ PW ~XP 0!p`PxuQ*x50 `@V:P  ]p p ݣP> p WP PIF!  p`崂PP !  p墂P !  `嘂Py ?yQ:fP`6/P  u ,PuQQ`P WP 0  P\*P* :R]P  PP s P g r0p00B^NP  - Q|*]PwP{8 P 8< Q  P  0`0`&$PxiU `P P ] PS `P`` P PV`pP x P`{P'wP' w? (p P@ @@P  APt4Ѝ,PP  E@#4ЍOPP(p"""/(И#x(((p@-(M@     pdrP(Ѝp@r`] N`(Ѝp(((p@-PPp@`Xa!EA(0S0"(0%P0S0"P0% q 0 !]app@- S* @`PPP Q PP@ 0A U R  Q R    p(/K-P@ S@SpP@ WW`P   PpGP P444,<F 0v @ P!A># " P>   oPp  hPpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ Kf /H-q`@PPQ  ,( UP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  x(/((@-@ P*Q* [R .R. Q 2R1:QPP00.S ]R/A-@X 2R1 :P`q0pSWp]W `00S:llpP MPnP pPWVP/0#)"A-@TPPQ 801 ,P !(0# RR: -'R:0x888@@p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  W,0  X:  ` > F,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$,0P pKZ-p`P0 ,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$ǀ,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:ᘀ,0P $PKP#RR>p&A Q PPPPPdP(HR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp88$,Llx888888888L888882 Q@  0p@ @P> @ X:} P70>S 0ph `Rd\cA^^ p @ y0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(x((("O-,MP`TQX PX p00'$@  D | @(@p-+R0<hhhhhhhhh$t    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q \,,\\,,,@,$R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp`(HT(hx2 Q@  0p@ @P> @ X:} P7      d >S 0ph `Rd\cA^^ p @ s0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(x((("O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0   $ , < X h x                  <     M> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ x(((O-DM,(`0 4$ؒ   Dh  0lP\P   8P P X8l@Q$ ! ̌X <<(l@P  p pP@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ oP@Q) (@[%P ᶅ ᱅<@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍ(O-M8@S*P`  >#RR>p&A Q 000dR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp4X(<L2 Q@  0p@ @P> @ X:} P7` ` ` l  8!>S 0ph `Rd\cA^^ p @ Hn0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00(x((("O-,MP`TQX PX p00'$@  D | @(@p-+R0##X#0$8$H$\$l$|$&&&&&&&&&$$$$$X#X#X#$%p#X#X#X#p#    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,Ѝx(((///H-! // //0H-HQT xD x , x x  x x  x x  x x  x| x d }xT xx )5ЍZ| { { \} { M m  { O-MPQ`@T P p P P nPoPoPa@PThhhhhhhhhhhhhhLh  ·P  ȇPZ U ງPZ T ଇPZ Uhp PZj UZ< PE ( P?  P  ~P  xPhZV U4 jP'  dP!  ^P | XP h RPBZ6 UZ UZ UT13TTTT TTU  ЍK + k ; x Yvx L ?x $  w w p@-`M`@048<@D F?P@@@@:2 0P qp$ 0H ܊p ͊p  a@p@@@ߊPH ŊيP׊P  LъP`ЍpO-DMMp@|"0BB @ @!yzPB  " 0! <R5:0V/ `㈀t`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp T@P3/H%#P  BP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻKhO-MT2PXPP@P" p P. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@ P9P P 0P @PPP`PpPPP P# dstdayminsecTa4 A b po 8q] q to tn O s$uA^ 1  f C Q |s| Q ? _ R q0H-PX @p `]ZU:኱00at T0T0 P <  Q/0P  Q/ /" "0H-|0|0 @ R@ P  0P @PU UPP@T0 0! H-H  P 0S !  P p@-t0h0Q L F P0Q P`VP  p`'H-PP @p PP `QP`H-d`@`P p `P PQPPH-d`@`P p `P PQPPO-M`%P6 PIP5 @p`P  P QP{  `'pPY W nw c`P Y```Ѝ衯 T% H-P@Q p`[P `Q,Q  FhAK-MP@Q p`:P `QQ4 Ѝ FQU& | rpPp```t|Yp!"PpW |Ql 07/Ѝ4Q$ l@A $T @-@ @O- M`pPP PPQyPX @%PP P F H `\PC `nPoPo@o`=kmP PPQ P Q0  HQP S h#`P@P @ Ѝ  d> O-MMpP@{` aP:mPq  aP /P P 5p G-vPk 1<0 pppfpe νP| p0 fpT `P{ `尒  `Pn  #P 0p  [pv  "wP$Z gE 0ffp#  Ng2({` vg!{`p mg{P/ns _g {`{` Rgp@ z`Ѝۍ 0|p b`P    0`zX  0 `szd@ e 4<, b = ڍ D=g f T ? \ k H-M   0epЍH-M>   0epЍH-M?   0e p ЍH-M8  0V pЍ P  / H-v0H-@fPP :Jz? $  0(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(408 0@S4 0@P4*# 44P*``404 R*>(4 8 0BpS4  @P4*# 4 4 R*p4 @ P@p(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(04p8`@Q4 @P4*# 44P*4 Q@<84pA 4  4  P0R:X @4 Pj R*>0 u04 R*#004  4 (P4 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  R4 $P: #  @P:  R*004  R4 P: #  @P   @4 QBLЍ%#jo%juH-M00YЍH-MPЍpO-MR @ `pPJP/ >>>V \K V DP VVK ajY -P BB`qV P >>>>||||AW P nnnnT aT P  AV ּP T B T 忼P hh p?@ hȠHČ pp`p P@ P @0( 0 000h 0 00P00

Pp\0` f`V2 Q1 p P @墴T,@\0  V 封LP:4P0pP   pW   Pp\0 H`P!!rAD |  ?p , @QPJD$ͻ,pP @pCPA!X!F P ADX   P P?U`,   X Aq P:P`㚮P  `V    H`  HY `P R 0'ACH``PAD | !  ?p ,H PE U @D⼀d$[@\$DKpWpCEPCL>PpUPC8@`H 3PCT@C H UT4``0`W`@ PP\ph4`pV,APF`D |  >p3 ,H PU@a @L`8PA PP VP`p Vd,PFA`D |  >p  d,H P U@a Q  `Q`800P \0P `䰝p,`KY \`B AXZA`@,pd @ T5   P P$U`,p  T డXP: P〭P  X    T0 `VEg\pW QD<   P @߲T`,` W\[:P @=P^  @T  48qL` TAX@0ZG`,@di Y: d q PP @唲T`,@d YdడXP:TP@P d [    8P0P `V4H`,ZI \`开 q, @HXJ@T6 Q  P `<V`H`, Z X:\PX㗬P  [   ,LPJ `唰p,`K QQdgLpW5 dQ$   P @T`,`d WdL[:P @GPh d @T   0HYZh `l q, @K\X LQPPHPdH`I@TA dQ(   P `嗱V`,d YdH`[: P\P d Z     X@kߍ`@OOhHGp@-M ,,`(p@0p 0SЍp?`Q/p RD D  <0($0 0S ?@H/?d>>P/q RD @  80($0 0S ?AH/=<>>P/p@-q RD  XT P 0P 0?#B0SP \H 0 Q ^,@PA@@`0D```PUh``@*pl==P/H-H L0?A00S 00ȠČ0 0̠ȌS D<h<<=O-,MPP,ЍP |80Ip$p 2;`P D V P `Q: PpA pW ` PݪP V ;P! 0p ?c00D |LW0H0 m;';PQ``VP,@PqP@U  >; q,Ѝ0;:p@-`T@PUPpyPUW@p:p@-PP`@PpaP=?@pH-Q$ H ?30000S 00840 SX0  | D0R 0R0 0S :098H-P$ H ?30000S |00840 SX0  | D0R  0R0 0Sx8 8 /hO-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`pl mTpn`PPD\ 8pЂT X0 0p`lmn Q L(   MЍ887p7 88h8777L7888\7d66H7776h76h76866|7|5x66A-MpPPOPP J`㓬P @ T  ``> /`*p`zPY n pU ipP pQhPG  0PPPPPx(P:  0PPPm(P/ p+ y$p'  0X(P  'QGAP =P  P j^PpW Wp/-@Ѝ( ,@4p@-@ PP M^(`V (V`!@\ Qp@83A-MDQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0Ep!!QЍLh0 p 11Q/G-M`pP+`(P UpGaP>3FK뀕P ^ >γ<˳^ȳvų8#³:㿳0'㼳#㹳 #㴳H#㯳p-㪳-㥳_㠳|㜳o㗳p㒳br㍳vy㈳/zン{~M|z}u9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0HD'0'>C 0( Pp ЍĿ q, A HX*H-0' 0 ( Q谹(      /xd*O-HZ p`Q "P !?>`APQ0H P Pz p @`v @@ KQ e p  `!>0@!Q QJ q" R R !0`Qq  0cQ`Q 0 UpxAT `Ta  0 B`pdQa @ K. A7Z Q "P  P P p9 @D`vX @V@ KQ p(  `` ?>0 B!0 p;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!RQP&d$$!! | O D  O-M@0f  P`R`P IYp|0 R  L Z 0 R KPm E( $ x!R  Dlh<p$(&IP  KTIP  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj  [ԢPd P``p$V <P>QPV[ⴢP P`@`p$V <P>Q@PV ̪@ " T [  \PEQ \P E W \P~? @ pA `pP _P \[ P TP#  ZЍ\[  [PP@Y[PPPV [PQ [PP @Y [PP P PV [P( ៧ M uM H0H-L@[PJ 8[PD >ZQ08 QP@Q8 P  ;P+mQ,P P PmQ! 0 A R:;Ao0Q 1 A R:;Ao@;Q 0A P3@@00% eH :H @-"TXl@000  |@' ,0d@@0XX00H<0 0@Vtl`(Q/  X/p@-@P`` V PJpQ PP֦PUЦp@ͦO-MM@PP6PT M,P AqDD!D1 0prppp P 0 "pPU) aV NY W ,K DYpPHX`  0"`VpЍۍ 넸DDDfD O-M@PQ PsPp8$Q  BQ   BQQ9&! P "P  0 P 0`0Q 0`01`N  ojQ @82LЍ Q  A AP ̡P oq8<Q q B Q) q-(p  P@ x!@@; ]P7P3 L'ip  <PJp =P  XYI X PO@`"{\p8L0H@- (@X:p @ @@-@M:p @H-M0< R    ЍhO-M(`p@PP U PJpQ Q 0Q[ЍK-Q1Q+ ZY# Wp@P@DT P` 0"`Vp 0 "`K-P`p Pp W PJpAP P QO-M`$P@ `QPLU VQ"V Pp ppp@ \PhP LD8|  @[ np] w  !>qP( PU YpD Ip P wd U Ip8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ \PPojPP xp|`Ѝ|| 0 mMQ 0 X   l\ܭ L   ܮ4,9 ( @ lPp@-P@p p@@ [PLPojPP 0(Lp TH-PPQ oj@ S pᔡP 00A  BcB @H-PPQ oj@ S pbP 00A  B1B @H-M@ R  0 Ѝ(Q/  T/A-`q@P qpp PB =PG      papUqP UP , Aq@ll0L 440 9Lq4 \4 4 4 DO-MXK ,  1!q1saqQ P `RV EP j W*  0sp Ws: W`D0H |X-p ap W 0@ ЍЍ@- (@6p @@-@6p @0H-(M$ P@ \(Ѝ0`0H-(M P@ O(Ѝ0p@-(MP D@6p `o :(Ѝp(Ѝpp@-(MP@6p `[ &(Ѝp(ЍpH-M   ЍH-M@  ,00   ЍH-M ,0 0 1 00 0 Ѝ0H-MP `@f6p  ,0 00 P Ѝ0Ѝ0x0H-MP@K6p  ,0 00 P Ѝ0Ѝ0(Q/6 ⡱0@-D@@p lm$  lO-M   @LP tOP  PjOP Ѝ6*0lm0hF p 0  P, PЍ4@-@= @P l 0 \  /*4 ` 01SPPD@-@= @ P  l?:X01S6 ` PPl@-@= @ P o t Q 0OS*` PwPA-,A=~z@ P D _ZQ8 ``: P - P  08 P@Q 6 0po8PQ*P8` 'PP8@-@= @P  R  "+ 8 PPp@-@@PP%`= ` P   P  0oS*` PP p(P8<@8p0pA-P=njPQ z@Q$  "+ 8 PP Q v@Q  ,-  X@-`@=@Q [Q  ,-  tA-P=njPQ ?z@Q$ @BK@8 PLP Q !@Q  ,-  @-L@=@Q Q 0 . G-`=P`Q @ Q+  @0p,@-PP@P@8 0pPP Q  @Q  ,-  H-4=P H-4=P xH-@= @P  R):d@ `H  P t PpLpp pppP0A-@= @P U R dP0@ȀplPdp<L 0pLl 4p0pP0RP\p@-P' @=@Q Q,@0A,@A1@0L 4P@p0H-P5 P=@ PP  R0 T,  0P!, ! !0P!, ! ! @P0PL P0P00@-P' @=@Q Q,@0A,@A1@0L 4P@<H-M@ P|HmQ DQZ QP1DQڗPP@DQ 0px  tP P0g5 0 _5:  < 0 0R5PqЍ0=P/H-崹H-L R ,PmKPH-P  Q P!P,( Rs3 /( Ru3 /8 0S s3/h,/* Ru3//*/p@- M  P@ ` ```E `` `;Y 3 ЍpA- MRPQ =nj R Ѝ Ѝ PJA@P(TP tTp! Q` iTLDA@P pf$ 0  Bp4( qp|P  l5P: 8  `5@@ X5 XR5G 0@/ @*P3P Ѝ4lt4$dHA-Mb=`Pg A@PSP!   Sp`| Pp QP5PH@@PQQ  TQQ  I PI  P/TЍp00 R/* P@@H0S 0PPht@pPXd HH@@-4@@P$S4@-(@@PSԊ0H-MP@ P,P gp PQ \  TLPP  Ѝ01/Ѝ0ht@dHH-M\P ЍHH     SЍH-M\P R<  Q, RЍ脉D,4H-L= R ,PIP<H-8  PPH-4 , PHP@-P xQ |@Px@P @  34/*@wE@@/0H-P PQ @ Q Q00tQt0QL0Q 00  s3|P @`灖|`0@Vzpx& @P@|08P Q @XPPpD X|$pp@pAplldp@-@ P P P`5`0PVp@-G-P @?zPP  X `7@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`npP `VO-M  Bp T P  [rH`p 0PBJ [`Fp P bP P P(@ PJ JP Q P@U  LJ@W  @ J@Z   L @ЍO-TM +p R TЍ]p!R @ 0 t0,4TЍOS.tATW |! BR8   P,`G 0TЍ € 1,` `VS@4p  OpʀY`t 0@ 00 0Sp pt t1 Q 0 0,+p b YpG-` PPp Y@AAP@Y ZXT  P@P DQK-P pP2@P+`P:P$JpP $K`V(KV QX !`?ppPV pPV ۛpPH-?Lp0 S @ 1  0  PL 0H-@P  R"48P PUX P R 0P R 0 0R000,`Q Q QP V0H/PD  R/P@0?30Q/@ 0<( /PP/0Q@?R/@0</Q/ R/Q/ @pR/;R/p@-@@P?`/p0S/p@-P?`@pH-Q`QX =@ 80 0@08 R($( @ @-R0SX-@ <@ @ 8@THD@QO0H-@PU XTP@? @<8P@@'0t0H-@PP XTP@? @88P@@0,p@-Px @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP B  X0m@ 0$`0 @ 80S@pp0H-PP @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@     08Q@ @00P@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQxH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQ0H-@ P_D 0H 0H-@PR J 0 P  S GD 0H0H-P@;D 0H0H-@PQP J P  Q #D 0HH0H-@ 8P@&p D 0H00H-@P0&p P J Q  P0C 0H0H-@P&p C 0H0p@-@ l`P&p V J P  V pC p@{O-MP@`p,8HT'  㔀-H 0 ᠀ @D PT  0pڔX Ѝ\O-Mp` 0PGU(@ 㔀G  0᠀ PE `U  0ȖpڔX ЍO-Mp P@GT'㔀G 0 ᜠ堀 @D PT ` 0ፖpڔX ЍH-M 0 0Ѝ耻O-M@%p2 p`sGV) 㔀hG 0  ᠀S `F @VP 0ApڔX ЍO-Mp`0P5GU' 㜐)G 0 ᤀ娐 PE `U @ 0pڜY ЍO-4MP, A\pXaQ  @QB \$YIP PK X@PzvPX @X`   T@U8`F  PV p pc `VTU8P   :֖P X@ T P8P  !p aX@T P㯉P' 0 @T (0 pQ 0 Q  0hPPf @Uq, D0|@0縐3p H LPEpG @U(0@   X@Q[ZCAZNTQ8P % (0  p0S0 RPD|p HLP`P ( 0A@p Q0@ TP,X@` (0 P P  @ xtH0HSD#P0ᰡpP:Xp@@ PֈPN @pW@ X@ZPpG pG?PW P  Q%Q{ `Vj,@pQp_D|pIp HL `!PVMP[PT R 8P R P P@( 0@ pP0@ aTP,0( A % nPPP Q `E@(0F  Q  * P4Ѝ,, a O-MP @pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,PDBp@㤰D 0ⰰ pG @W ڤ 0 `ppڤ[xj @Q _ T P 8 O Ѝ, X? @`rxt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q HTHLP/88!R!RQ@@/8P/48!R!RQ@@/`<Q/(!R@ ,@ /ᐬP/$!R@ ,@ /ĬLP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/dP@/A-PP8@ `@Q Pp fp 4P } P@@萩\40S \/A R QPT/D\ Q/A0SRPT /$  RP00T/ЩPP00T/0Q Q//0Q Q//ԩO-M@T Q lP\PHX P\T \ ARA `PhVTV[Z IQpI W @ Z+ Y  0@IYʔ ` 0!!6G W`Fp,0!PPPPPPP,!PJ ZQ`p,D |    MpM p`WQI P pIV 0!!6`V,0 !PSPPPPP!,Z!p WPP`,D | 尡  p `PVЍP U 0@9PYP ЍH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A/P/P/P/P /P/P/4O-MPF @P H?A,0DP   p@Y*  Xaq | P]p pW:0@  $ЍЍ@-T0 0SQR,,r@  @ A@FFF( R/,0\  R0/Q\ @@O- MP5,`p@䠟 @T)Q PPaBQH0 0A  P !(Rp (X! 2/p < 0 Ѝ ЍEdhEXDDA-@(P $Pp(pWa,Q 0QaB8pP,p0 p,Pp@-@(P 0P`m(`VpH-H  R <0Q0 RCpCG-P pP%  0 @ QB `P V ``0BV` V `QB   P BPPPC: ` P>`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $ܝD̞8ȜO- M@"ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, ņPPl j,0὆Pe ,Q4᱆PY 0 H0p4,PP P4Pp 0ZPJTPP*`pPY, PPDp`兎| `Up 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/ጚp@-`@/P`*P0T0p$ R Q P8U=PpLTG-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@蘙̗$$0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P aPU   VPUP0 P EP/8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0pW(Pؔ0H-M @0P@0Ѝ0p@-MP @lP```Foo0 b` P `PЍpP|O-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP "DQ HHP `P$p(PPX`@p GpW ,[D 0`@P"0S  P`H-M  @ 0Ѝ8P Q/H-M$000kЍO- MQ@R ЍPP @P, `P0w 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp8P4D pP= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R} !Ry$Rv RdQ8pք Ԅ҄Є@f8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0pW(`p@-X ]80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8pP:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMP@PQDЍl`hS`F@RN@^A@VL@`t0 L`SC 0 0RPPppP oRPB 0Ap0 pSPVPP@ x b 1p 0 V` ,  [P,P [Z x@  $P  0!P 0  Q:꼉P/H-Mp@pQo :  tx 0P`a%P?9 D 0` FA/   ЍH0H-M 0  ЍO-\MX0P8  P0( G  `PRR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S,0spqs p8E R :[,@``v@[P Pp,0PPE1PPP0PP 0P,p00C1@@@000~`P8@ 8,@t 0SO(,p,@ ,08q0 (,p`(0Q pR ppW8` p@(p@W@ ppW8`,@" p BR`p@@ F`0 V (0  B0s`Tq t@A@T00T@0p 0sP<@P@0$X04 X <0@P X T @q Sx!Ttq0L  P@D0Hp  Q`Q@ptPUHPD @Q PD@DpQT:P @Xp0@$@wPP@pQAP0@@u@T @Pq@pEPEq@UPD4P@LUHDLp|P00p pw : $X`D0 !vPQ|Lp 1q pyb p$ 0 `( AR  p(@p`GT`:p@ p Pဠ(p p`GP`@0(@ 0@T@P0:,@  (0 R (0`V0 `V(RVʛ\ЍK-MP! 4\008@?SPp ` @ BpGR@DApT0  0ЍЍO-qxpD! $P= 0Q@P L@T.,m R! ,0 0 SR ` R  ,0 0 S,,!,1r 0. 0jtljhi 8up4@P9$e`  v @pPUG/@TPP SPCA| 8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P   P PCA 4Wf D@# D @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp1`FD Cl 40 lCxDC  xl<8  xlTHdX0L$8??,th88H =x4(xlL@P$H-LP @88 PC B:x8 RDQ/lP h%R!R/!Rt%RQ/9 P/p9G- 80SDpWlUUhUUQU  xğx@ S `< P\lT`1ppp0v4DP@\0``` $  P # ' 0 p@0@lP h0P0P0P   0 00'ΠTʌ Pʝp ,T,(PHJr |\ R```ǡP?R``o`ǡP8Ro``aǡP1Ro&`bǡP+Rg2``cǡP$Rg>`ocǡPRogJ``dPR/'V /% P   pppp` R R /*P`p`P0p W1/+P0#'1qa0( x1p`Z0 0 PP! TqH  Z% PP H 1\0 H @,PP U !T``` `  R00QUtUUUU 5S t0Q%D98888776tl4l5A-0P Jpa``VPS Xa``VV<1oj00`V%`AVPa4 (40`BVPa4 (40    1oj'NJ Pr`"qpWpr`V  03D33O-p! XS T(D$<XE @ T T' Q0,[S qP0PU00S0000`VP 0`VP[@,`` V T1p00PQ 0pW20<2@-^:J00`0S4'>:00?:0S0C^@1,0 0(0AS@1,0 0(1p@-M@P)J\ R ڌP v`P!lP0ok Pr`l R -P 0 0 @ LЍp//.@-\JP\@ T،r@L@@v4/H-  0S h0/+0 #''.*8P , ..8H-8!?: 0S%0@S 14 (400AS 14 (40 0 00S `0/+0#''> :8P , .`,/,G-" R t" @  " \R@P P hP9 P{'r"QJpP p! g @1@q Pᴖ ql! P  QEZ8'QJr0"<p(P p! / @1@qPᴆ q   r"Q ]=  q l  ` f@0@<*l,,@**\+$* +`))|*D)((0H-xP@PPPTP <  0@@0))4()/<)0H-h@ Q pP QpP U  xPn0 )0H-@ Q pP QpP U  ]PS00H-$@rPG0@(0H-@qP>0@-  0 S QPSZ\^@, T@@@!\@@@@ X'@-0P RQSZ\^@,0T@@@1\ @@@@0p@-P0SpP ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```%O-Mxx#p X  Y rPCZ @P@P0DUEp ЍO` F@P ppp TT8  C,!!g1Rv`@ @Z}0 @00(@P0S0jP@`p' U!` P @>jT D|_pN HPEU KPE[*Pp?P P尡 : @`@dP+ P `VP Z 0p`!pp 0p B Q( 0A pQ 0@YpЍpp %0H-@ ,Pp 0H 0!0H-@Pp 0H0 X!  4!O-TMP" `Qo pqPC[  dP @P G PPR0@[iTЍP$0 A pR? 0` L  pp WpCI 吇(+$P @ P TU8  P PP P P PXppH$ppPCK $pPC P  Q$`$P@$V`FpPCYIKP3 @Q! ||h qp@H$pPrT@CEt!)+ $$`YpPC  APQ J $ ,(pQ1@P0W1Pu p@W1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@T @PP! P( A Q PQ p6h4TЍ 0H-@ 0P p  0Hn0 0H-@Pp  0H`0p@-P 4@`p  p@Mp0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>P [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr MP P@7/@DT PH`DpP PPЍP qp*P@7/@DT 00`B/P[^  Q H-M0 R!R Q L ЍH/ $ R p\H-M<<000 0ЍH-M0@@ (Ѝnh0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0d|llA-M@Q,@PA P 0 @|1 2"!1K`p@pA% a!a @ pa-P `V $Pp`Vp fPP@ @Ѝ赁NXH A-M @ R  $ P? P0 $1 2" 0C`p@pA ?> @paP `V $Pp`Vp nPPOЍkL3 p A-MPQA@PPX `Y0 0H!2" @ pA0p$4|q@Ap " a@qxP* aV$ @T $P pp@T WsP `P`V X PU Nv`PЍ-?L*S 0 O-DM4lP_Pw $t4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1  808084U<%%!1KP@%A % a!a@pQ `P =eP P4pq`o1 80/84T<%% @ 0A0P$\4@$A #" a@QP8  8P01 L  80/8PS<%% 0CP@<#A ?>@pQ q`P g ` _P2  Y PP.  RP*  LP& | FP" h @P T :P @ 4P , .P P   ! Y P P P:bP=T ,@ t @Y  t@V c@ ,=pG w P`Q6@tP@t@DЍV cDЍ-?L*SkLN40 | 3 5 ݦ < +  ?< +< < S O- M` ^P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA`  0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ Pb- @ $<p wr/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*  0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0TO-Mp@`PDpQ$ %QpPp1@ Q:cPsPplP T TX V @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ t[<[ 00@4@Ppd[P, 0pp$P0 PJ PQ$ %QpPP1@ Q:sPPlP Z Z 0@Z @8PH T p@T` Q Rc ,Pd  4 @ `@%T TP`%V `40 P:,P^PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @   pP&FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo@ Z4 0 pP*,P W,` ]P 4,0` 0!pp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 p6Ppp2@or.Ppp*PWpp$pp!p W \ppP}P}PA~V OQ  p OPq  P %A@Q" OQ}a ARI/A AR @40 P*,P _,`[PY 4,0`T @4 @ APT:%Q Q    ;R ?R eRP P @Z ,p[P 4,0p  0ᡢp444,  ,p_psߍجp MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//8K-Mp`PQ`K`P# P Wp< PpZP  @TpT Q# X+kX)X! T tXX P XE X9 X6 Ѝ IpP Q  (P P  㣂p(P  㗂pXЍ<4୴, ᨴht@z      h  \. @-M0S H@P - ЍA-P`P p N@7\T  DpW,P &P  P P P |P 0A t     O- MM .pP /P  0 ЍۍOP= Q/Q9 ƼP6 @`[V.Ẽ`P& @[T  Pp  0`[M V Wg@? P$ @P`t@:PUppGTP:PW g U g  0PF]P P9 P 0 㳠P 0FP% @P@`t@:PppGTP:PW g U g  0PF"P P ЍۍX     &   O-MR `@P pP %R%XP P  A!XP  7P 5 XP  GP YP  S rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P  $P`P PR _Z$PO\Z$ %XP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ 9`ЍG-MtPp!` 0W P"4#@PpP+b Qw#@P   0$p pR$Ѝ P 0>$P  0pP  Pp pؐ dDtH-@` P! V T PP`P |P p@U oQW2 U oO-$MP@  PP,PSP  ``OYPF p|P  刣P  Pt @@P,P `SP  P`  CP p@KWPg  Y p[Y P pPPWP PX P `(, (, PpW< 岰P`VZ`VJ $ X @TP WP $P2SP ( $@X㰰( ( `P~@IXC$~PX@L@@PDPTHPLP3 Pp`sV nV fV    P &  0qP @T p]X $Ѝ,v3W  - 3 A-@P P|``P,P PRP  pP X A-@p P`UP UVPPRP !Vpఀ  O-M` 8P. LpW @@fP@pW P Pr @sP nP P@@ PZ  0|s pW: 0Po4sY nY fY  P H DPUP @UP'@P#QP H @DP pH@HH@sY H  nY fY,H (@0H0%P' ,Q0@H <P00@H 0ఀH @ H  HH @HHLPLЍ0 0H-@ PUP eU0QP!0@- \ s\ 0@T sR nR fR 0S00+A- pW `@`pW P `P sP nP fP` P``M0H-M@P 0 ^Ѝ0HЍ/K-Py p@P r @P m `( `8 H0QP*  `pQ`   p@Q  p岐Q   pP @p @,@P ,(` @ `<@P <8`0@ `L@P L@HP@ PA@-0@@@@ @@0 @DS  @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@p `PVP &TP!PTPP A pPK  H-@`PpWP SPPPP `  P  O-DMp @ P  ,P ^P00\P00 PII|EP|@P@P\P:  DЍZ P:  0 T P: 0cPPSP `< P`P,POPH  P<`TP#Z4 @ P@ ` ,P= ^P00\P00 P`F2``P,P^OP  Pc<`P ޵P T<@TTT@TT T0TTq `FYP T8Zd Rc #0P< P @ppp Z <8,P < R  0 S Pw @ dzP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @N80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p <0PP Yz0R < P Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p <0PP84 PUR <0P @pPePPЍ0kL 0!S/K 0H-M@x0  2" @ PA0P$4\lP@APH " aP@0PPЍ0-?L*S4 0H-0M@PRP 0Ѝ0`P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,{P | p` `Q  mW|`pQ  `P|37`2`F``$mm غll@-P @OOO O$O,OO(Qkk/kQ/pk Q R/$ R R 0S/0 0S 0ˀS0000 M <@$0pPT/Q R/$ R R 0S/0 0S 0ˀS0000 M,04 <@$0pPT/K-@P P P $ RpWPHP`q&0V`v`fVP8Q(P(` (2/8 (` P $PP QQ @R 0 ) /+ 0 M,@0@4@ @@@@<@@@$@@0pPTH-`R @1P8S T, 0PS(00 0$.*P$(3/P `p8`@ jP P$ (2/`ص H-PQ @1P8R T+ 0S(00 0$.*P$(3/P P`8P@ +P p$ (2/PܴH-^ 0S$0S\ 0Sd00SQ q Q@0 ^<@<<@O-lM@Tph P $P[hPlЍP T/ R R \ /+ @ / M/+(  A?04 \ ?< /P0p$ t , X <@` p 8D   P\pDppH < 00LTtX`P R!\|,<L0d< H dp $L@ <  Pf `PV*U 0EV*S  `PEV *`PU X EV*R `PE`PV`PV `P! V*`0S]  CV*R  CVR  CVR 0C`0`9V`PU4  EV*Ry  EVRp  EV P`V*`PU 0EV(*S  PE#`l`P Q?:P`$`0Q`P A p w:lX(, Pp PAW P <L Q? XTp`PP`lPL` PD V*0` PV p`F0pS:L `^ XN\ U Qu V`0S 0CV*S  `0V 0CS  `0V 0C~S  ``@`w  `PX`P VL7`Py !P28B`?P`P C? PXU ` U PUPU`   P` p`T AP`@PJL\pv `PYQ? LP`F? lP<dh\ Uy*XP 0V* `` V `F 10P:``QP@9lPPLQ Q) P*V `F P:99@ઑ@( P*V `F P:90@U !0CP0 P*V `F P:99@ઓ @P 0Sd,00PQlP``LP`U:P X(p,Pp P`$`0 ` `PP <` >H? 9`0P  Pp8"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PE괲P$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  H0Tp?? `PHp  \kT\`0pV aHp  \[T\`0Vd V)dHPed `pHTp P00C\ Q  LTp HP)ed d `p'Tp`´ H` TpL` + ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P E Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@`f ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ W P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:$  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1 2 `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#` P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PNޫ X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `p|Tp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q  % " Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍ R,2 0S0S@@T:S@?LRl/@ <@010<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPThQ R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 Z  H O-  0@   ,QP @0Y 0  pWpW   0  LQP. IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW  T 0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0vpWpW   0  LQQ0 p $0 00Q ,P Pg,P7   R!4pWpW   0  LQPI0 00 0  00 > 0q pWpW   0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW  " 0  LQ7$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z_ 800 00 1pp t l Bt lQ\ 0R8UP @Ch l\ pWpW~  { 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\n pWpW   0  LQQQ P<V Vd  0p V LD  ptP\l$ pWpW   0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (ЍZЍ  <pp0  000  4pp0 00` pWpW  7 0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\^ pWpW   0  LQPQ(ЍM@N0@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  m 0  LQW 8\ W p Q\`F P,\  C0V   0  B0s@ `R' , V&*<l@P 80Al0 #lPP8 0 C, l@V`l l 08C,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l l P,R@ T@T 8  %, l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  u 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8  0(/+3/PP p/+p 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD  ! 0 b $ 0 BP`kp@-P@P@T `@ P P 0 0 "0pO-MKP tP tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCzl`\pWpW!   0 PAU PЍlP#Q.\ 0R8UP @CDplP\`V`V  W 0 @ATPPPQ/ \ 0PR8UP @C`l@\pWpW  $ 0  LQPPP,99O- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC`l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\LpWpW   0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CiplP\`V`V  | 0 @ATPPPQ/ \ 0PR8UP @C6`l@\pWpW  I 0  LQPPvPt2H3O- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ /X; Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. ; P> 8 7 6 G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" 8J G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" `I H-P! 0  @^   @`AQp#pP` pE  H H-P! 0  @^   @`AQp#pP` pE  G @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/& U/ Q `2/DO#(XX X080b$0 ;0,+  h$H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   H- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p VH; ? @ O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@Pdp @-P @f @? 0} 0 . MK-M$P @$ 0p[PJ` P  0P[ pЍK Ѝ/ 0U 0 1 C H-P`p% P @`P$T `h$=;@4$$l\ t؆ꉬ p@-P @Q pp PP `pP'\\G% nP @@` Ppp茷q kH-@P PQ  pJP `pP&\\% 9P @@q`@蜶 @j(Q/ 0 S /̵Q/8 0 S //Q/ᠵ H-^ L0 SQ 00S P x&DM Q  0 S//شp@-@P PTQ p P ` PM&@p蜴 Q $ 0 S/Q/(I K-M@P, P`Q%V# Q  P ` p0TP S0gZ@ Pp Ѝس K-M@P' P`Q V!   pZP x0x p0 P0`4Z@ Pp Ѝ(( (0; 00 D   P 0(  SQ 0S /(H- R 00 S Roı H- R 00 S Rop P 0L  SQ 0S  @/  PQs() P ,00R  @/ Ra A-M(@P PP  P:`P6 0 P- pP( P0 P  RQ"QD 0P  ЍTD H-$"i}}0H-P Q H88 80 0fN$$ $0 0gF z H-P H 0 0t1H @-@l\"P XV"HI<M"P ||||0H-@ P ` P  P P 00H00HDꨭXtH-P 0 S 4  PQpo" H-M  Ѝp@-P$$"!P `!p!( P @NN!ࣵP `!&pppP\!pLL L0M 0x` D{P{{{Lzzzzdz 2 = H-M  ЍH-M   ЍH-M  Ѝ@-@T  RĪ /Q 0 S / !@ ! Q/ q3/@S"# Qr3/ဪP ,0 S0! 0/ĩP ,0 S0! 0/ᄩP ,0 S0! 0/DP ,0 S0! 0/0H- R x0P0U0A  t 30t00 0 T    t :@0輨p@- R! 0P0UpA 0t'P0``R  0T0   '('R@p$0H- R |0P0U0A ! R 30t000!T   ! R :@0|0H- R |0P0U0A ! R 30t000!T   ! R :@00H- R 40P0U 0A  U0H@0D0H- R |0P0U0A ! R 30t000!T   ! R :@00H- R x0P0U0A  t 30t00 0 T    t :@0Tp@- R! 0P0UpA 0t'P0``R  0T0   '('R@p0H- R |0P0U0A ! R 30t000!T   ! R :@00H- R 40P0U 0A  U0H@0x0H- R l0P0U0A   t  30t000UJ   t :@0$0H- R x0P0U0A $0t%(000R U J  $((%(R@0蘢0H- R d0P0U0A  U  0t000UJ  U@00H- R d0P0U0A  U  0t000UJ  U@0|0H- R 40P0U 0A U0H@00H- R d0P0U0A  U  0t000UJ  U@0褠0H- R l0P0U0A   t  30t000UJ   t :@0 0H- R x0P0U0A $0t%(000R U J  $((%(R@0蔟0H- R d0P0U0A  U  0t000UJ  U@00H- R 40P0U 0A U0H@0xP 0(  SQ 0S / 00H-Q DP@PT0A  USSZ0$%o00H-Q DP@PT0A  USSZ0$%o0耝0H-Q DP@PT0A USSZ0$%o00H-Q DP@PT0A USSZ0$%o0踜p@-M@`P``` ` `Qe(PQa +R 0R -RR  p9:D"P5FxQ PA :  2  p:$"P   k"p"P P , P uЍpLH-$\1i(i0H- @0  Q@ PRP0 TQ @ R*0T300H- @0Q@ 0PTP0 R Q @$0T*0R30@-@jg0H-(M@P&* P0 P    P0Sx PzP yP HP(Ѝ0,, ,0 0 (  PH-P 0 0@TP0T`Q URSZPP!&oPH-QH\Kfe /0 0CS/\/H- ᅣoH/K-`@Q p0 PCU pP<S p0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP`p,`>PX` P\ ޢP/Q PY (>Q (>Q $Qx PQq  Q&  Q@=R(  P R0!$PP"Q qR  PR "R $PP>Q  0 0 : P O- MpQo*0`QP@ QT "QM  \Q_" @SRH 0!Php|ePWeh_  \  Y  V @P ?+6 R 7 R P ?+7 R P#P P.0  4 T1?.! T 1 ?.!00 (R ) Ơ?1? .1  PW [* P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X\@P ЍX\@ 0 0$ ] p O-IMp@ T'pP90ZPP4 <T<Tp T" TP! P`Ge P AQ @PZQ+[0A S2 1\@60@"Q3 6+Q0: 6-Q06 |60A P01:PaQlQsQeQ( PrQuQeQ(50@50 @P5"Q0(50 3/Pu E/F?PO 1A 4/Pa  E@ @Q p<Pl` jP"  jP  jP\PR PM -R-P >Rpp<pP> >P pPP4  0 0CS!  E/F?PP3P! `~EFP1A P4/ 0PP Q ~PP Iߍ< pPP (PP Q 5P[ PP P@GEF@PxT4"Q6 $"Q6 Pd\010 P'   PO PDH P9< $0 A3/P  0@P 1a 6/P  aPVa  +P PXU E/F?``^P P~EF`1A `4/ 0`JPtruedatadict xhṬ<4 p T -5L6 ̄ O-MP`,@}p? Pp F0f pW*0  0P崧rz  [  0 : 㜧p l@   Ѝ G-p0\WG@0uSČA0IS*V0 a0I S:00I S3'P `A0ES:a0E S:00E S%'pA0GS:a0G S:00G S'@A0DS:a0DS* `00D S'` 0000H-@@P 4P,P0P4P8P(P;"P5 0 ]P, P3*P "Q :Q  P  P x  0ppP pЍ,, ,0 0! ! $ S & @ n 4np@-M@004 R;P,S Q R& `V7 P)  0Q 4,A4P- D `ЍpQ 0j 0ڹndjЍp`Ѝphh h0 0ZŹTT T0y 0༹<< <0 0c㴹7 ^  : O  H-4Q , 0A40Q H @@ @0 0(( (0 0 * B  O-M@T*P `4P  p7P pP P Ѝ ЍOP HD `P <  *@P<Pe4P,Q\ @ pPX pP\ ᱶP H¨PpWpWv  @ PW-  rP% P  P  P  2/P 4!T  R! P U ph Q @ d pP^ ( pXTT!T1 0೸!1 0)㫸!1 0ࢸ 0 0 0 0 0 0㈸DD D0 0dlkk\jjY i˻  | l3 Ͻ  T i {  W ν B K-P: P`VA@V U1U144P pP' 5 , !$ ,,P  Q,Q 0S p+ pQDD D0! 0 ,, ,07 0,g  ӹ  @-@@H-Hl,,44H-$ݣ34 fkhp@-@P ``QPNP Q < `R4 Q ,a8p`` `0 0㠷LL L0 0)㘷88 80 0peO / Ϲ 0H-@P P H  Q< 0H 0 0g@dk  @-@DP* 0 0N2 # 5 H- Q 8H 0  08믶 ! 7 c@o/K-S, `pP@V  cP x P,Q 0Kea _  01 0뫵 ̹ H-Pp@P `/ W  P  ``/ pbH-P@`P oop, WP@P @aH-P@`P oop,WP@P @daH-PP@pQPP T@ p`P  @ᐫp`A-@P PQ P`@V pPW eP  PjPUP (`@P `_Q/ 0 S /_Q/ 0 S/x_H-0S L RQ R0SR#D_H-@P  R  `PV U P  p@U DD D0 0,, ,0 0ܵ^ ߵ Q/ 0 S/^P 0(  SQ 0S /]H-^ 40 S 0SQ ޔo]H-MPm (PPi@P* !0 8P$P\ M  J`p A"PL $ PF"P 00!01 0m 0 BP1 `piP+ `0 2P Q P P` pIPP \` pЍV PƳ \ k /[O-Mp(` P@pW=Q@1, A rQg U P V T/* A U UP V P* A3! P V P* A2!0 V T7* AP z-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q ЍL @-@P G-MPt*Po PPb  Pd  PU%:p@`* PR $  PJ & PB ? P< PEUU+  00U@p` `$P$ ' P =U ( |P =wP d ЍG ЍG8 `@Ѝ(( (0 0tϳXР |VN  H-0S RR oP P88 80 0㨳$$ $0 0㠳벬 b p 0H-@44s ((PTPP0$""@-@T  RTQ  0 S/P/TQ  0 S/P/TP 0(  SQ 0S /XPT0H-P 0(PP @ 0 P xPP h 0 P TPPPP nP000 00 0 ! `!lX p@-@@@P@PN,``Gp $S / 0 SJRR R 00 SQ 0 S/Bo/R0H-@@P  ԙ  //H-UP 0 0p㧭렙 ۙ O-GM  VEF  0PV QUU Q 1/`@oUP pO T 4/  2/pT 4/W GUW WqWq> PQ 1/`@GUPP>  2/P T 4/$UPpPp# T 4/U. 1/Gߍ 0 01 0 0)xx x0 0!|| |0 0hh h0 0TT T0 0 눗 ? 2 ȗ r  h  З H  ( ߗ }' P/ O-KMP( @p$TQ QFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( tP Qq $q(QQ T JI/0P @J_Io($  2/ 0PKߍ 0# 0 v //@-@@0H- R PP @Q4P  ,  @00XX X0 09MDD D0 0:E00 00 0;= X m 8 e ݔ  b 0H- R @PrP  R00G-MPP*@PlЂp/W5`x (08<<bp\W W  0:P `p[PX Ptpnpfprp\KPH FPC @QC >P; @;Q <Q >Q&1`P. g&Q&&`P# a P mP p &`P l P tP ;P`Ѝ` 0 0d^ y &  0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H 0 0I둏 b , p@-@P1*`PPQP& `pcPP P<YPP /SP P `pIP P>p@@p 0E 0৪녎 t  H-@PP*`P%PQG P ppP> P QP,PQP0 `p PP) P%<PP P `pP P/P >HppP P 0 0YF A-`PY P @TT pQQ>PM  l8PC W` p 4/P5  P0 P" P( `)@<pP P  P  P @L P  zP~`{I p/ 4/K-MPP @)pUPQ. p  Q:?` ꀫ`|PPxPۍ!1 X 0*yp  `P p `xv  Ap ppp`P`FP W '>PΥP @Q/Q /Q @P*U @U P/Q A`lP`1 p gistX/.plXXXX kj/A-`@PpP AP P @*QrP@ LL L0 0B 0 0A A N / i @-AT \ T'@QARS ^ DQ B@R S ^   0 0ZѨ G-(M@RPU tP0  ` p  8P PT(Ѝ@s u     /     / 2/ / /     / 2/ / /     /K-(M@PP `P Tᆤ$P-P (Ѝ(ЍK* 0  B0  ppZ P QPT T (Ѝrs Q   /@-@cT p00S@-@P @-@PH-P kX?H-P `,?H-P U?H-P J>H-P ?>H-P 4|>H-P )P>H-P $>H-P =H-P =@-?^ ʎ ! 0@T 0 @S^ 0@T 0 ^# O$-A(? b  @0PH  / /t/\@-@P 1/p@-`H@PP 㧨 =P ppH</H-㕨-H-3H-P ㈨;@o//0H-MP@p 8 PЍ0 0 0;vt @-M@p L qpЍ 0 0;Ӧwt@ ́ 0H-MP@p U U UVЍ0DD D0 0:㰦U OЍ0tO @-@p 0 @@ 0 08㑦^t  J | 0H-@PP $@(@0 0 07{ 7 0H-@PP (@0 0 07g 0 0H-@PP $@0 0 07S * E @-@P X A    0 0;4 ɕ @-@P ( 0 07!(蹀 } @-@P $ 0 07$跀 1 R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@V P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pg800 @  0  /UUUU3333  0H-@PQj   @  Q d8@HHPHXHtH|Hpc? b Aa-lswr  - w-! Q -QxsSr - w-  Q -QxsSr - w-  Q -QxtT    0 0 09㧤e{ { G-PB 㴎P) pQP6  pP.*@縎`qPqP`@pW   NP =PᡎUp@qPT% 0 0>TYz z # 20H-M4"424R 0PPHD@P< 80*  㸥@po  㱥p ttd PP|PxP4p \PXPPTPPP P\oBK ㊥ ㆥ?@QPN-P-d-0p-띏8 0  Pᩏ<-U vP L@ splP L N Jd L@Ѝ0"l7j /ٳ 00x/O-MP@P T D "P =pXsЍ`P+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0q@I" 0 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?ku u v _00,O-MP@P T D "P pXsЍ`UP+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0͉@I" 0U 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?uk s s vs _p@-M($`P4@`P 08PpЍpD*O- M80`<4P P@]:@p[c WpVpT D#P:PCף`գD0  @̣P ȣţ`P Q < 80 Y*P" S*P"PPPV < 80W Y: S3P@ P  Ѝ@@ @0 0K(( (0 0Mq q q `q q :q |A-MdP`dp@|@@` R |0RЍK tC\' p@-M(0@,4PP`pЍpO-MP@P HU P[ LXh#  T`E@+ pP""P "" oPi b ARE0!X    t            $w t!'/w '%w u'*w z wTp'!w qPQ( xQ*Q@  D  0L j0 Q)! P! ,!` L0/Ѝ P   @`DpL0 V    Ѝdd d0 06LL L0 0٠044 40 0Р*m m m m m m nm m m &q n n n ( 9  /mNAD8/O-MP0`Q S U Y S + @T@@ лЋP VP` 0싟ػ + 0@@@PP Z@ TT QT P-PZ4 4`$ pP+P -Pp 0j `@v/ 䪟 z PJ @ F Q FQ`@gX\ P p0 R ``e 0SAA@ i`ĩ z YA J @@ EQ EQ@|gX\ P 0Q R``k 0SqQPq4 PkH@( 䈟丟B  ``Xq q@-ZPP PE =㟒PPu `@vp:Z P+@opቒ0 P WZ;Q :Q0( Q ,PP:P=?v` ЍЧ z GY@ J pE ;EQ 5EQEfX^\Y P 0Q R``k 0SAQPA T`PU @ppPU  LIP9PE t  0S 0S Q@Z2 LPZ :PV , P50% BpP @@TPPa@00t RP)S' ` @P:PKQ 8-P+P]X8P :P ?+ @R[SG 0O:PDD#P :PaW@@T R#P :P|-P+P::Q :P?P!30| PpP  P@P@< `P:PZQ 30 # A-P+PPW0``!@\1_ 00SU88!@41 00UK!@1a 00Y@ @0 0ם0S6 @0 0˝0+\ 0r 0 0㶝00!01 0㭝Tb 3c 8c b c c b b b gb b b 7b b b "t#t!  A |pa [b $b dhhغi h lTTD"P<$LL h( H m uG P   ԶĶa 7b b ܴĴPlK XaI <G J K-@PQ T 4P+ ,,00 P!-Q ``pWp% -W -pR)"2 0 xpW "` p`::W 1\b-p``-P pP! :Q1Q `:P $$ P>a" 1 `0P?PP:P lP 8< 80,  $$:P:P ?PP  0DD D0 0R㉜T?(( (0 0S6] ^ p] ] ] ] Lĭ4dܭ < ) t^ @ ԬЬ ԫP^ L@-@P  @  0 0/FO] ] @-@P @E 0 0/29] j] k] H-MP`QP3@]P P p 0PP 0PP PP5P ` PPꖝ`jPꐝ`dbP剝`Ѝ\A-@ ` 0Q pS P1Q*P pE↜ Pp pAWp  ᮐ Q! H-Q Q Q+s$ 0 0~sAQ3T 0 0hϠq  0 R1 R010 I[ [ [ Z +[ ?[ H- X*,0 X:p@-@P`P o 0p@M 0 04F0Z eZ  @-@P  0@M 0 0A0Y Z ^ 0H-@PP o ;0HM 0 06Y Y  @-M@P  0jPЍ 0 00Y Y Y 0 H-P@P p0UaU V`qw 0 0/՚CY tY  A-@`pQ PTPPT qP  0oPW Z Y t@ ;UP9tP6 0 Pp6T x0 Gp-x~p+PPs T | ig@ 0@!@3PЍۍcA P@@HH#H3 0iGWS,,#,3 0j=J#3 0k4D"2 0l+>"2z 0!Zt"2{ 0Yk"2 0_ bLPJpڄ@Tp|pPLEx*|(}p P$tP!IP" DPt$AQ@@/ !0P0 @ 02jtp l/P/PPT LL HX X,! (! 1 0   07 0O [P P O 3P P O P O O O q v *H [Q ]O Q O 1O Q uO O Q  S R R R R R eQ Q 6Q P .P Y TbP _ {a{O jO O-tMMFp`@Xp\ Qd Vl TWr Uz P @@0 DHL;p  $p`,$p,{ @l@pT ` /pPJ < >pY=뒗0P ,@,ꉗ#P`ꁗ=PQ4 y p h 0h`ᛋP  ใd @ 0h  僋P  ࡃ  %@[ Tj@@p,圤@Z,9 , $P@T(rJ,0$`  R$ Ბ  ` ᫑VVX@崅PpP P\P{ pApKP g,$P@dბ \} Vw P` jP`P `@ `P  <` P,P `{b`pTB0 @)pPtЍۍ?h( PJxiPP(h 0忊P`s0 P x>, 0P 0ؔ 0 0ΔV 0 0Ĕ 0 0㻔U 0 0㱔{@Gt0  }$9F G G F G ;F E G !F E \G F E 4G l$L L K K xK K f C`I J H H i\H @-M@@PЍG-PMԁ`PpVLG UO pZU x@Y[ !w,pp0  '# $(  0@3P @ L8@t@Q $q,p$p 0@@LPPЍ'> 0 0Utt t0 0\\ \0 0 DD D0 0MC C wC %C C ]C C fC IC B BC h ,@-@P  @  0 0~ߓUB B B K-M⼑@Pp T^ ピW W&U```U` 0 p-P:JWPW p ڲp)8/$3@/@ pp p!0P @ P#PЍq= 0 0gHu@ @ @ K-(M@PP. U6 T? Dp$p pppp 0 pp-P`V  0@6P `Vpp(Ѝtt t0 0#UXX X0] 0T88 80^ 0 e? ? @ 9? ? ? ? ? ? O-MMR@P`X Y [ T"P  0@pOWT PK < ; pP\<PY  @+㮀8+yjP< < )<"P @@3pH  PA@=p\P <PH' ppT pH@8$p9OJ KQPPЍۍg< 0Qptt t0 0U^\\ \0 0K[X<< <0 0@N-< < = < < < ; < < N? K > _ = = = = M> @- MX@ @ !0 0 Q Ѝ<O-M x xZ7 BX> TF  - 0P PU  PRK  - 0P ӄP  0` Mp Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P.!P/ @P/P  P  0 !!PQ @PQP  Pp  0 t`   :-P +P&TP- @P,T"` 0P*TP! @P3T"` 0=` }o `noXP p x XP! - 0PTP `K@X Pߍ: tt t0 0ཐXX X0 01㴐T<< <0 0੐5 F7 N7 5 "7 b6 }5 6 $6 h<@- MT@@    ! 0 0z Q Ѝ:XO-U.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35赘5 p@-<`P@`(00 @pp0H-M@P 0PX@X P@ P/Ѝ0 0 03Yd0 0 r 1p@-(M`P  00 0 @PP@@Q d`$P @N 0`@P(Ѝp 0 0B&/ / i X0 {O-dMRXP` Y 0p`@" F `@Zz  0@@Pi ,P` p ꀏS  0@`PP KP& X?   0 :@P,0@@p% 0,Q p$/A-MЀPpU" W)pP ` V@"2  0d@p (PЍ5p(( (0 0FW0$ i$ # O-EMMR@P @PjJ<8u` xpZ xp|X 0<qG W+  RUP⠰ W+  RLۿ@P  WpW =P9PPT@P(JY)yP @ T p"2  0g@p  @( ᾿LP@Pḿ0PP@PEߍۍk44lH-M  0kЍA-xM耟`pPVt) @O kW)&pP `P U@"2  0d@p (tPxЍ(4p 0 0H ! OO-MPQ U ! T 1X  f'9  \PPPppfc >f  @L``bc <pdc gPb!5_|Pb!cQ fQH00gQ%P3?gQ%b!0`1 Pf1#0-5_f1#gq 0=pa1`1#PP0`1#5_fa0=`b1a1#P P0a1#5_`g1b1#$P0b1#5_a f1P(Pg1#05_g1#b! -,0PP`!f!" 3?0f!"g1 -00pa!`!" 3?0f1`!" e1a1#4`0a1#6o`-g1t`8`e1# 06oe1#a b1<@g1#0`4og1#eA0@=@.P`1b1# @$` `$0OgAb1#0pp`=`p)@a1`1#p' p'0xϠ`1#b! - |`pp e1`+a1#`&p&0oa1#` 0c h p p"p'4`da'ea&`pea&a@p't  p'/'.od `dq8` `.`&&hqdq'/eap'p /}@ xaq` cq'`&o&Ph!p' -0Ppp P`n!p'_'opPPl"d!a!"`c1`%o&& " ?-o D`da0(`xl1d1#@&dP0#O$$Oa|l0@bA` nA$o&o&l@$ @tp`p`p!d''i cb 쿠nq ~ p$`'o&&caP(h pmvmzA-MhP@? @p !R/0H-MP @|P*JDU ?P :|?P: |p  P0 D  P0  {Ѝ0舉X/ Mp@-M@{`0T` P P  P J 0` 0PP  @@`Q Ѝp@ Ѝ/JJtJib`R0H-@PP^ I \ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0 0 0by ; @ O-LMPP @<8400 ᩮK`I 㠮D D"@{@{PD0@G0 ppPaIQ+  T`8 ' (8] 0 (> H-MPPD @a`P 0(A@T P p@T P P ZvЍp1 WR P  D`p=vP vЍ 0 0tX r =<H  H-HMP`P6 @0 Wp pᱻP" @0 Ipp<PpuPP WPP+PT ´PHЍ 0 0>Btr O- z ͸ 0H-P@P U 0HOKHH H0 0nU,, ,0E 0nꤷ x IO-MM<p` P[ U ؔW Y ܄Q$ /pPQ @S.*qp@Ӳ Q0/Q TM/QPpU*/Q Q[ Y [     P31 @$ 2/Q"    Q :o/U/P     0 $QЍۍE   P P[l  00   P @⭤( 2/P   PU*/dd!d1 0nUJHH!H1m 0n@,,!,1n 0mY:  ! 1o 0m0 0C 0mYT 0E 0m[K 0 0GmBp 0Sp 0m| |0 0Gm [T ȴ ʴ ( t Գ H F F  X  0 ʳ O-MM,0`[ V ,tP DW TT @(`@oU$@ **`iPP! PU:$ `P< DT  00   PN @0괐Y ,QGP (,0 p P.$ 02/Q%8 Q!DTi P    Q 00+[ @J 1/pP @ :/P H` P, :/DP   d 0R0*  .RK   .R R .R R (@ Y RY$P P3 (, &P I@P/31!@  0 P(@d, P I 0 P , .RP 0    0 S @0P$ 02/P8 P{ 88#83E 0ilPU#   "  PJ` @HV 1/VmP7  2 -m5/Q%  ( P0G0 RPI(ob$m( /`$QЍۍ`D`D!1 0kVa 0 0kX 0 0kR 0 0kK 0 0kD 0E 0kXll l0/ 0k\V f ̫ R _ a | 7 5 T  , ƫ b  ٫ : 8U V 0PW O- MP X Z P X:U Ѝ]*Ɍ p`@ 00 T 3PAuPR PF V: Ua?pyT! [pyT" &   P =P=\Psl P =P =\Pb ^ 10P! wT P M J @G D A#PP P P P P[\P Ѝ P@$J <g&z aT ~ g H-4P %$0P H-pPPD @!P0"S S, Q\S `  "P `Q`P@P `CV: S #S P@P00 0CS   T#P 0 0hꍠ م H-RM@a` %P fPRލ P  0 Uppp x PP 0o\PD%PQRލ, 8C  # 7O-MH`@PY U VjPxx(x8 0_lhUX  H8p@<8a x( @"`p4` $H ǟT T Pp`,Pp(P2$x, hY Wd  0@4pU {P) ,`0 @  `  GG@`,Pp(PUpw@8< 4,$`Mx ,p pG@GP) P 0 ALHHp0 P$  P(} GRRQ RRQ RRQ RRQ RRQ RRQ RRQZ RRQS RRQ RRQ RRQ RRQ RRQ R RG@Q P G@Q RRQ RRQGY :U V^GP^Y\ I,p PYgP, 4pٮpP; PGGP GL 4GPG G G GP QQ G@"   ,p pP @ Y IP  כa` ϛY `P  4p$p(P`pBh<;hY$4p`pp(P /hx G*G@'h@V +U hGƛG@h@V ,P@@,` @[  g h4$gT@P@կPЍ`\ cU0BU ǼĘ   X ==<,<X<~-99H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpFI`<v`  QhDO-MPP? ($P  `!p. Q  p" Ԡ԰@K   RQ Kpp庩`P  p``Ѝ 0 0<e " * @-hཽ`@@PPPJ4@T@@ঽdp@-@P``PpnpTa"`P<`g` zp(XH-0   G-MP OLP. `P*  PJ00P Q- ,q@pqApSڀ0  TdL<pU DD! pZ@$ЍG@&Ppp@T T P PP$`P00XX0 0 0b T ; xHd vY H- P N`H@0O-$M`p@Pf Zn Vv F `   p P`pP X pZQ*Q) ?QHp/Pm PJ .PkPh ZB Vc Z/P`<[Q+ \Q Q X qP @#X p*Q"p *RX  p/R0 R0 @Q X A.Q  R pZ V  Z/R p/PV /T @P~V @xVX\\ `^ @!@/oo"`0p\]\4R0`pX  @@  r@OoB=r\P /P ; P pX  @r R, -PX ```\\ PUP\`X pppP PR0@S@@pt `T[` @[PVpRP pPK /ATpPpDp@X  q`V, 0  P/VP  p/P PpXX X0 0{aZ<< <0 0|`Vp$Ѝ3 d < A @**d%%@-@P PT TS P T 0I P lb70H-@lP<^P X6^P Wb0T 0T 0DzO-MBp`@ 0 ᝖PP u0b`-Pc``oPP `  0ზpQ  aPM PPG p p  `  <0   0@kp) XPP1   0pWp @  0<P  `Z:p@@ `L@@`ᜩᚩ P ߍ% "  O-MBp`@ 0  PP ua`-Pc``PP `  0pQ  ӣPM PPG p p  `  <'0   0@ڕp) XwPP1   0pƕp @  0᫕P  `Z:p@@ `L@@` P ߍ \ O-MBp`@ 0 {PP ua`-Pc``SPP `  0apQ  EPM PPG p p  `  MH-M  0 PQ R /ᜲO-,MZ@TP(<  ;P8J|jf`^ R :R|R  P :     PJ @g[P a[P pXX XN: PX@ Xdz Xp ,(  q p 0(i p , a p 4PJ PU ,HP@ #xPp P P P  P P P| Px pPt \Pp HPl 4Ph Pm Pi Pn Pj Pf Pb P^ PZ PV lPR L rI  PD:8 6420. ,$*((,&0$%5 0h\48%5 0\+< @ DHLPTX@@\%  .L c, 00p,p 8pX4 80pp P @LSP >P @BSP >P @8SP >P @.SP >P @$SP >P @SP >P @SP >P @SP >P $@RP >P{ (@RP x>Ps ,@RP n>Pl Z piB`@RP Y>P' @RP O>P! @RP E>P @RP ;>P @RP 1>P @RP '>P  @RP >P Y `p  0@ Q0!  /S` `6^  3:S3    ϟ0Bp5Q p "UUp zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   <pG@3T 0@ P>pO  `  ` 0@ Q !0`/SPP<V``3 :S003`00Lp ;Q t  `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q N  `P:0@ QI 0/RPP6S003`:R  30 0FpA4Q-4 `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   5 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0 `@PP W<P @PP M<  P|M  `P80`@ V1p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR Bp ` P8?0 lp/ 0@ P 0/RPPdS003`:R`3  0ApcPp P @0Prdp@+0A/S<@!`0`pH`0@ V:T@`  @V0A`d@ T T. 0/RPPdS003`:R`3  0ApcPp(.d! R P.0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p4-0  @p @$ `0 0C P\ pPU \!0C0@0S0 $ 0`0pC W@A P@p P V   0 Sʁ0A@EQd 8P 0 MR`0 TR RS K@@@@@CR 0 RF Pk`` @? R6 ,;00``@/Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A8  p $(L`AVK*MQM0a a0p$( ,($  pɟ       phɟ B  } xR3 800``@h JQ. e( 0B0S 0 B  p\4(R2?d A;Q<.a(Q50\ a $( pBQ JQ, axW W `   rP pP@ Pr$(PpzUH0[DV 4 {9PP  t9PK ( @l9PE  e9P? ` [9PA  T9P<  @L9P6  E9P0 @M 99P6 @M /9P.  @@@A.a p$(@@@A>a 0 $(p  <0 p 0!a(Qr  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3$$40` # pA@q? `/{0Q"d  G 3cc#scb0V03R0!r`PpfAB `r B% I,pb8/!bB(3qRB1/0!B1c C AQA"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W03b4Pp`eA W B R:4 b0 G B 4 iQ Q3> B)0GK/;!`lqp'qqpWQq ""q R3!40p #`F 5p0Q"d  G 0`c#pcb0V03R0!r`PpfAB r B% I,b8/1B qRJ 0Q0 R00 "Qߍ QQ )\P ף$Il T*)G @F <  G F F F F `O-M@<PTHPP% (( P p1 R 0Q1W䀟 Sp |* W 1  DPh`at  G `hP:@TP1QPЍ̕\   {,M? h? -? 5@-0M@ xP0Ѝ@-0M@RP0ЍH-0P H轵O-4My0 [   0 0:LO[ 0 0;BO P P P H@4 ΅P0 Q4Ѝt,x= *> h# = > : 0H-@PP T PP@P0@0DD D0 07NT(( (0 08N< = #= < < = K-PP( X0 pW! K@`@DU QF \7@DQ F 0S  SQ``DD D0 0HNX(( (0 0IN!< U< Z< ; -< B< @-R 0@T@ 0R@B@QBOO-M@PPE TM 8PS `p1:PR  8p1 JD [ X 8P  8P pp P }8  5C= .C:p:hh h0 0C3NTLL L0 0D)N>8OpЍ: : R `: : : $@-MQRЍ@蹕TP @PЍO O@ЍO-uMM‑pP `w W O@F88!81 0DM @p7 @P:iO/~@$E E堥ǥOW dE`E\EU< 0 K px  E匥pEE@PJWBP@Puߍۍy9 9  0 MH-M  0 ЍHЍ/MH-M 0 00FЍHЍ/O- M@Pq Z `Z^[\J~DB0P @ P ǖ0P` aa`` 庖 PZC1 C[  P`X P' `P [[Zpp{p0 {/kD Ѝ` [ `P ll l0 0?LZLL L0 0L44 40 0L6 D6 b5 6 6 5 5 5 @-M@C(P ~A "( 01/`p) p 0`VP <`V?D?N`p eP @`+DЍЀ`#Dp@-M@C(P 6A ( 01/`p, p 0`VP <`VCMeP @`C MT`ЍЀC0H-PP< e@LP@ @TH EP0P P Q P0厕 (劕  冕PU* ~,P z4P v8P r0HoLL L0 0KK44 40 0MKP 0~2 2  Z2 2 2 0H-(P@Pp\0HTi̧@- @@@\@ڣi0H-,@@ӣ _\P̣0hdO-M@Pt  `P0V ` xP,`p0V+p0 V% P 8 B/o"*k"0PB`pV   (` @ P` @p0V`W Y$*U".VP@ЍV @ P  BQR Q Q QЍЍ 0 0F6K/ 0 0 H4  R  *4 8/ᰤ 0X\S 040:8 R РS / LxBH-P`@LD @pV  o`p@-@P`L 0A-p@`PP T   pQ} @ Dt$Lh \VU U %VSpQ:pP P W FnP{ 08DP\ht0F3-V ^V?V0P 0Qv tv _Tv   $W@v P P} v z  v Q Qo =Q v#P)v;QlU 0@0 ̠ ^ Q+W@%0vp;pWpcSb`a `0XV^"w Q" s `0dRdS 0@ hf $ &V" ` Cq0 0K0A  =V  9 20`$ ` DD D0 0HT(( (0 0H ' >' & & ' ' ,pHl  LO- MpPR O XW @T2 `  0PU+ PEP'((U PE@T P &. U PE`U F"J 0 0!HJ` ЍHH H0 0}pHX,, ,0 0eH% S% S$ '% +% K% % ?k 0  00}  V})* A-qPpW2 !=@EaV P $QPXLP+ V(`41/P. V<  $P6@`@`P= EpWpQ 1/|tV@V X   0$PX@/>3HYpd|ZA-qPpW1 @EaV P $QPXHP* V(㐋`01/P- V;  $P5@`@`PΎpWpQ 1/|tV@V X   0$P8X@迿ԗЖp XXG-@Pa `CP\ qPpW  U` "= ,@ QU ZDPC HP U' $ P1= apWpQ 1/U(PP   41/P $@Z $81/P />3\$`PVԔUVG-@P_ `BPZ qPpW  U` x @ QU Z)DPB DP U& P0pWpQ 1/U(lPP   n41/P $@Z $81/P 꿿`(dXTܒSTG-R`SPP 0/`p{G`V @@ P ``@@T p P l``` `0`p`@ 0p@``P@Spxd,TRhR\RLRK-R@SPP 0/``V ppGw P T``ppW `Fv P ?l`` `0`p```0p`  P@Q\ (؏ QQQQO-MMP `Q ぉP P/P P *G&G {pv AP PPj ``p/P PZ @@/QQ.P`T T.P  PX P/ C: {pC  P /Q P J P [ { P/P PB  e ,VzP$J @PWA  P2 p  :p'p/P  P [ /. x ЍۍF? [/ FeF>bF?_p@-P Q @{p@p ƈ@TC {pppF9lF"P/yPP- zpp[F"P h`P zppJF"PW@P zp @pp@-PE `@\pH\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 00  pE p؉Љ؊A-PpP. U6 @R" Q `p:Q 0S R p 0SRpGS@R :XR :R@PDD D0 0CU(( (0 0C % i   p@-M`@PP T V   0`'Ѝpll l0 0CTPP P0 0CV44 40 0C=   Z _  2 ( O-LMM p`WH* Z3 pY9 tDPA  TT!I@T pQG  R 0S Q:Q |Q P @Q:Q |Qp QPo 0PS @ p,VJ 0<)H`  0P tx`VJ(H` p$0P4``Jp [ :H+PUx@PfH P7W4 @0P@ppP 0#P pQ 0 R 0S Q:QX |QV P@Q:Q |Qp'7 0BpW4``9P P P :P \PpVp ``p,Z:0P,@KwPD ,J0$pW x(t40P@P ``0SL4($4`D@ p ⃆P p@@4,P (Vt @PP `@:PtPp  0pSR@S@Rq =R @R @Ri @:R  RD( 40@@H $0H@[ {{$:d 0[  F B 0S:S 0A0pQ:W:,0` AV` A 0pljP , D@0 A I` I @p*  *@q@F$C ,@\ 44w  T K ᔉP T|C  XDHP LЍۍgC@0;삟aC@`2pP @=@8P pD 07/p P 8p@T <@p@1/=P~P  #*1/pDoᠲ 1/$ @P vC@C@<0H-@PP T)  R 0S  R:R |R Q A R:R |R0HH H0 0@T(( (0 0@Y 1  0H-@PP T! P z  00000H9HH H0 0@T(( (0 0@y Q {{x{|{|{H-LP C<000 0 000zzzzzO-MM┴X  Y |DP@ l$ hhtR pX4 P @P 4400SN @$  P   AQ 40 000@:R#R)P\@o" S`PU MP|#  P dP TP HQ R  R\R   2 0 ` Q pAQ\Q Y PRPU :Q P h`X X`P:m  PBa 0P`  R :R|R   0@P P Ap`5 `PЍۍUPP P0 0J?Y00 00 0??ꀡ=     W ,z z zyzVwyyylv`xxXvUW* 0 04>Y! 0 0*>Uhh h0 0 >WLL L0 0>   o   G M.   m   K-`pP[ Vd Xm Wv V~ @PPH 0p:P R Q 0 RQpCR@Q1 =Q`@V, dd@㷁P Pp `@T @Ed sP Pd@`V:V EpT O?  [P W9  0" 0=V 0# 0=X 0$ 0=W 0 0{=Vtt t0 0q=w\\ \0 0Fh=) U)+ 1u ]DA-PpPL UU X^ Wg Uo @Q> `p:Q 0S R p 0SRpGS@R' #R @R! 0R xP 0/p0`C V:a`CVpV:A`C6pV0S0" 0q 0<U 0r 0<X 0s 0<Whh h0 0<ULL L0 0<e{OPuM}O-MMp @PW$  P 8( //P,D 0t  b4 `S[&bKP``$pN4 "2 0E<($@VQ:QX@`P@F` P0 zq vq qq=K$N ; K$N/0 E1K,D$N `Y  q=P @PFLdL:P `  P ؀ `AР Bp0 Jq($:P4 ~ 4P = =P=H$PKВM $d؏H-  \MH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 p QKHЍ/TO-$M`xxrp ` UTP"  0 `币OPP U: @ P  E p  p0AP\ qp X#p &Q!&H@v00 &P"3q"  Q$ЍE8 P9$ P2 @"P QX" 0# " !  P bPHP  )P* H "[ /,pp P $Ѝ (4@T` (еP ,< @< /P6 4P<,,l \ Z^T^(`@K(`V*TSV:@V + n WD  VD RN@ ZT AH(` ` 4<@ 0փp (`P p <(`< ᮄP4`FP<@<P7P _/PV@q@D  PDP,,  T@,Q[J 0`@`V@T@T ,,<8Dq XRD,D 8 0-8 0     0 0 0 0,0 0,D H$$ @T @i`Vs@T T # 尀 D Q   !1 0N3@U'@İ $P, QADQ3ll l0 0/3WPP P0 0%3t , Rߍ 4uZvMvmXs$?rqq ް  <&`;@RB    "@\DDeD%` ` `X @  6/P X@ P P$Y:m0D`@p ;x 9x 7x5x(PKߍV04D`@ (g/@Y P W p$0Q+* @ LpRp( O~`P W Pg* s# PpvN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%*  0U 0&%g~,@T?ŭ  H-M,`0@pPr[Pp$ H]`p 8  "! @  "!\`&(t!(@[(@`ЍO-0H-@PP T 0H DD D0 0Bc#T(( (0 0CY#ˎ00-O-MP@P T D "P $pXsЍ`P+V  -V  `0V   p0VpTp xP0@ Qa@"Q#O*p`? P0 @I" 0$ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Q 0 0?"ktdnt_p@-@M@ P`   0 P @ЍpP  0`c@Ѝp0H-@P WPu  -P0$@W$@0 0 0Fp"np@-P`W@t  Pp#PW#PpG-MMd`p 0+f@P# 8  P fP(( ;zP sXPJ  7P  p#Pp Q p$p>P P#P#PP (z(vk tkrk#@PPЍۍnfs0)(0H-M PX@p   P  Wp  @s#Ѝ0O-M`$p@ KP Y  PP@eP T pPP pp`P`&Y P NiP8 `E 0   Wp `FP #PP j 0ePPoP VVp "P]  pH@ p` Z*` pp W * IQ  Tq`T e@P&0 0`V `V P P  QQju` PG pP$pPЍ 0 0 d$ǔ0H-@ `j P P[jU 00H-@PP T  0HMDD D0 0: T(( (0 0; a9l~O-LMPP [ YK"LЍ ,< 0x [ ,< 0y YX 0rdP `[7 U PD<@`: XL[ PXi$ PU $` @Xp p;/P  Y$ @`W` S +;& 0I xKx+x;'@ 0> \+\;r 06 X:H @[T% pd`T@P$p@P@p  ;/P<0  S$p@ @PZ<P@U@p  ;/P<0  S$p@ @`Z<`@V@p  ;/P<0  S$p@ @PZ<X@ @T)p` p , ;/U$@@p`PPPÉf84!  Y$@`@W$p p;/P I P%X*Y*@HP8p D0p3/HPPQ @p@W:D4T#$@@p  X* A < Q0X H0A@TA 4$Y&*p @ ;/HPP% I < 40Q R0A< @Q: p  $<@0pQ@T0Ap<@Q:@p$@Yp:  P;/PHP,gi <`Pf i8p@( `PV `V` 0  0S  P00P@p0CX3UX4p*U, `FpG W3 X3 W1* ;/P4H8PP P 0 Y@Z*@ p 3/HPT Pዐ Yk*p D0勰  P U8* 0 3/HP P U~*D0  3/HPv P Us*D0  3/HPk P Uh*D0  3/HP` P U]*D0  3/HPU P UR*@ D ;/H @4PI<D[[8 @@p :/H P<PѫP: P Xf$  Z $p@ XP9/P  V$ @pUPp>J*:'@ 0*:r 0X:Hf⑶ V@0$0P@ p2/P   V$0P W0pWP@ 2/P   V$0 P @Z0PU@@ 2/P   V$0 @ pZX @0@T)Pp ( 9/ZPD$@0㆐L p8   V$@P0W$p9/P A  0,X* PU*0`@,PHD@ P2/HP Q P@U:<`p8,T $@  X*  A  Q0X H0A@TA$@Q': p p0PW R0GP W:0 pQ:@ P2/PH( 8$@ pW*@ @p2/HP, G 8 0Q R0A@ Q: P@p PW @f8 (@p PI  X  p  R ` P @P[0A3R`[*R0,` pGH0,` X3[3 X1* 9/PH8 @P@ PPr <` V+*@ 2/8H<PP` V*@ ቐ2/HP<@D@YY80@D:/H P<P`ѩP:"$@D@@TD9/HP@M[MMh( O-Mp@vp`P8 @( TQ P.W T" ,P 9/`U* pPV`P PT #UpP@@6}``PDWЍcKLK-R P`p@9/P p`VG-M@Q `PV V4)p P CpA 0`Vp `Q  C`P6v'U/ Cp)& .`#0 Cp 0 CPJ ` ` 0 CpPЍE H-$$    @ ؿ 0 S: 0C00  3?0/0 S : 0C01   /0H-@ PR08B   00H-@ PR08  B   0 A/ 0 0SC ///0Q//0 S: 0C00  3?0/0 S: 0C01  /0 S/1 0C0 /0H-P@P U %rP  >0Hr0DD D0 0W U(( (0 0X GGF]GGo;0H-@PP T  0H7rDD D0 0gn T(( (0 0hd F4GRFF GGH-P@P. U6 T> UF q`P  >[rP pqP P `P  H/oP H}o 0 0w! Uxx x0 0x T\\ \0 0W U@@ @0 0X EFEEE3emEEDEEwEW90H-P@P U" lqP P P4oP 0H.o00HVqDD D0 0 U(( (0 0 qDDCIDDDp@-MP@P U$ oP `,qP P 00 rЍpЍpDD D0 0 U(( (0 0 CDBYCCC H-P@P$ U, p`P nP pP nP nP HnDD D0 0N U(( (0 0D qBCAIBBBp@-@PPE TM P P`V T_ FP p `T< VE V ppp`p  p p p p 0 0I T 0% 0  0  0 Vp44 40 0 @AA@|AAI@,AA@yAZA @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q* W2 T@T!  0S  Q@Q  0PU 0UR  @LL L0 0:J W00 00 0;@ TZ??*2?g?m?O-MM(Z`pPQ00Pߍڍ$KP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  ᣘ@TJ P T*0S; (I PRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8< ||`2 0|P p P0"'00p @0p P P20 Gt&w00p z PVpP Q:`&6 0  P`J P^*P&P6@pI 0 PPOJWM & 6@pG 0ݗ PP>JW<%5@pG 0̗ PP-JW+%5@pG 0ỗ PPJWl%l5@pG 0᪗ PP JW 0%05@pG 0ᙗ PPJW$4 0@Gሗ PPJpTpp[ `@` H4Z@$00  piPJYI`p [f0pSa #? Ip s0MP|J P PO:x0 bo [0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @<[P' @LpP P PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @᠖PJp P:p0 <`deP 0P Qp pP0 P  0LePP p| -<U=8 "R ; :65U;z; lɾj^96;k:k:@kj:j&:j9jG-1MpP@ `W U V] Tf C/<eP C`Z=C R0S 0@P P P  `&`$ P P tpP Z0! pP P  %` ` P1ލ'xx x0 0V\\ \0 0T<< <0 0 3E323223O-GMȡp` @P  W pQ P PV KP@V @P5wp  0 p0 P 0S:pp PY Y `0P  TPGߍл H-M`PPJp@P Q R 0S R Sp@@TpЍ0H-@P oP UP0 0 0@@/'0P#/( 0H-@PPP P0r 0(O@U PP O0/01O-M_p@P`S* @8 T8p<`4@A 4PPPP @R@_`TP  ` Rߍӯ?O@W pP 7O/40S  4 QP9 B$p. AT- pcP` c 0S6"#QSP @T R 0@S:  0~p 0Pf0P  x` P<@@0 Pq0lxlll ` `q ax0< Q9Q  Q P   P0 S p SRP`U p UVPSR UV`8`Q4 < @0P.Q QPx P] 8P%@Pb UP HPP< @0 P(c AN(Q C;p :]PF< @0@P>l-P PQ4 @  t P < @0%P* P NV `P N8< @0< < @0P0 P0 `Z0`V ,,P `V PpW$ ,P/ P P P  P ,B SPP P l l+l;u 0,P @`\[PH8P 7,(<0 P px P `< P9Q QQ   QP0 SQPSR   @0@]P 0Vp SR 8)9B 0v0@P" ||||A< @0-0P2@T PPP<AT < L@U PP L <0V `V`g`e X,R 4Q 45P R[ `JP @B? PJP GP B? p0@@`PL>H pp@W= HP U:PFpPP2 Q @@qLQ@fL R R R<QPQ6P 2&6 0ELB(  88 4[$ @80偢 @<z4@P P?B    ,  +!AܐY& S Y @<`,Pp00P@pU*P  RP pqʀ0P<  @PdP_  0Q @0 8PxJ P7PpJ  8pf $PP PC B<<D      +!A R'  T R <`,Pp@@PpU*Q 00 SQ q0sʁ@Qh < R Rp 0p 0 BaP@P40pRP PP$PPBOl >8 R8P-11-@10@`0 ( P`V J,P Q @@JQJJ,Q UC J@P>@JIi "" d t ';+G+Л X Trk& 4 @-@ HPt  @ H-P P R  R' R R.Q*/0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-M`p@PN WH PPD PP9*P   OP P PYJY'yP 0SS 0 P X QQ P PTPЍ$$ $0 0WbܛO-\MM||0lX0p0 pp0000 0$0(0,0@Xp P W T֏@P} *0PPw  *0PPi #P LP DP pPPW `` P P P HUP.P pp +P8 840|P4`V4 p`V-  P4PUtt!t1r 0uHPV `P Hp@Z!  Zh4p 0A 0OW] 0  0DT\ST  ,QdX Q\Ѝڍ/sc$ Uo C~nbWUdIHI83М O-Mp W  PP @@@ N`PP PVZP: 8tplhd`\XX@P3 XH 0]X@P' 00  PJ !  0fP t@P@T^X@ !HP$ H 0)P 0l  PJ !  03P Gd1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@TLPF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7]h@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@T#h@Q507Ѝ> K-XM,PtqP @p8pP0V\5 $R2 R1 dV.@(V%h lP QPo PPph   R?p㠑@piW   m*)P*#@pP: D YDD D0 0bV(( (0 0X, O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b *rjn1 d1 ??+?#0H-@+T \L P R0 0 X0<3 =H-@`Q`p`+T \\\W `V Q( X`V. X. <O-dMMD WPD`0``P V +P pL 4`@DP$@XHp<(,Ppp P@XHPH  0wH`q t8| tW`ll2  0+@岰_*[[ [ [ <[ [  NWa1` 0+SPL%0H`P *pP 0QP-7PQVP!4P 0a `P 0dЍۍO7 NvpPPW /`PdЍۍl7 @  \- - l,@ ٿ9 `: :A, 76GG7b6x35~t13>8  | d g: H-AMp@`Pp 0  OPJ` P .^ $QAލ8 H-AMp@P p 0   jOPJ` P o.6 $QAލ 8 A-MP0 @ 0GO`PJpP Q.Q Q.`ЍK-AMⰐ@  0   O`PJ PpP Q.Q  P.T ` PAލ6 p@-`P@Q rP  @QUpH-@`p(PU Q PU R( \ UT1p@-@P`(Q  R  R<l UTpTpC10H-M@(TPP   PU RX U$P @PP8P80P0 @)Ѝ0C # 0и/0H-M@(TT T TPP$T T PPPPPPdPPt   jU$P TPP4P40P0 @)Ѝ0ח5.ܷ/0H-@C( TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01\ T000000000p0P0H0H0(})/qftwquo:<[6?0H-@'Y\ ~'p0 zT0aMp@-8M`HP`@I4@PH .0~Ad00. (@U PE =04P8Ѝp@Ѝ/ƍ/ {O-MP`PP@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P* P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P*{ P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ . b O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@`( O-lMD Q@@R l   Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<+$p 0+Q a@\p) b%!AqbdP@ $p 0 Q a@p* bd%!AqRd`@܊#p 0Pϊp`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/PgPY N)Z J)W F)lЍQigMbsEYJDY A Y X ->Q0H-@P  0 .SP Q0* B/o"0 PAP P.PPu00$$ $0 00迣K- MP#P]0 ?;@@04 P_ `?nP% Ѝ袣H-M@PkPK kxaP`F tkPB `kP> LkP: 8kP6 $kP2  `pP,$ pp .`PV3opP $0<H`pTpvЍH d Z` veiH-M`@PukP( Q PpP ppp n.PhP U3opPpTpuЍ 7B p@-P@Pu`Pu` V Po`2p 0R0p0Rp \ 0 /n0H-M@tP 0Q PЍ0#0H-!Q  Q  P@@PP Pt0@@P!0    8 @-@@p $,X0@   0H-P<@p ,00H0 l p@-`@@Pp  0p@p@  H-M`p@P|p 0@<8 40 p< 0 ЍHЍ t  H-M`lp@PRp p8 0bЍGЍ8   / /  H-M`Tp@P p p( 0ЍЍp @  H-M`lp@Pp p8 0ЍGЍ   H-M`tp@Pp ,(p< 0 ЍGЍd  $ H-M0  0Ѝ H-<p HD_G   0 ;P G- MPD`tP@@, P    H0 Pp@ Ѝ O-M M` PK⨫⤻ {Pd q!PT  D p$` $``P `[  U!PrP `\P P .PP`FP Va V*  p u @DK[P=P.P T p T.@DK`⨛VB*TP(:fa P P嬻[ ` pDD?07/K `FV P*K 㨛T Dp TuD  㨛 {K  PbJP[` W *?0 06/ @pG W . P*K 㨻T   P =0 p7/ @  圻t}k pFP@T<4<4"<4 ll l'<4TL $<4L3&<4<41<4,(l(<48<4,,4T L T T <4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4.<   /$; P Z.P P PP`V`F[ : Dd 0 p7/ @  L [ : ID@ p BD`  `?0+ d `@ P$+   P*?0 p7/ @  @ Pj : D \?+ 0d k@ P+  z P*?0 p7/ @   Cx?+ 0d 4@ P+  C P*((?(0 p7/ @   Cd >0+ @ P{+   P*``>`0 p7/ @    /$;PMJ> :P J P P<:  Pdd?d0 p7/ 0o@  `  / ?PJ~py +R    P>0 P5/ @V   P< / ? PJ@?  ӘJ@ [7 : B + p+?0+ d 3@ P+  B P*00?00 p7/ @>   :P JN@P JP  P}:  P?0 p7/ o@  ` ꣗ 4^ @ cڕx ߔ d ?0+ @ P;+   P*>0 p7/ @d   h>0+ @ P+   P*?0 p7/ @    Ad ?0+ Q@ P+  ` P*?0 p7/ @p  p Xz ʰ +l @X  p  d  0@ P   P*pP?  05/   P* ʰO _p  @   P*  01PJJ7  P * P   Px  `dd?06/ 돎 _ /$@pk0 kPJ P   P?0 + 0d @@ P+   P* =0 p7/ @ V  ʀ 儭+\ q@`V    d  0p P:   P*  @ <04/ [곎* gL, J1R/0 SP PyJP  P:  P?0 p7/ o@  ` Í: K^ O$ $` [c  d ?0+ EP P+  T P*>0 p7/ @   pW- wP J P# *P@  j\XTP+;2[R@ P*LL?L0 P5/[ @W  A ( +@   /$;PDJ P=   PPP>P0 p7/ @`  `  ? ? K ? 0E [ @ P *\ \=\0`p  / ?PJM  ;}Z [A: >d <0+ C@ P+  R P*x x@  0+ d @ P=+   P*PP>P0 p7/ @`  `  P *+\ :?T [u;+H1[@ P*HH?H0p 7/[ @  @ꛅ[҅p E  =@  = +`?0(( @?@ P(  N P*  ? 0 p7/ @"   J1R/0 S[U:xK  E    /$;PmJ Q*`+\  Q$L  8 z$ Y? P  - T=d 0p P6   P * @?04/ @  Z   k $Q:cꛁ[ҁp m/D ), ~nVUUU 럎 _ /$@pk0 9PJ P   P>0 + 0d #@ P +  2 P*?0 p7/ @   9l?+ 0d @ Pi +   P*?0 p7/ @   H9@  A9P  :9?00 rZsqr [: %9@  9P  92 ?0P0@ P P   P*?0 p7/ @    /$;& P1Z pVq P@ ~@ P P  R P*>0 p7/ @    @ Ro.p [s*~p>+[J0+ d P P{ ` +L  P* =0 p7/ @   P'*ܿ H n^ow| Gmm@    P *t?d 0+lPJZ Z  R>Y@ @PY p   E>pPTPE P   ` P *P `p88?07/ @Z  `x P )  P  `p>07/ @.U  `K⬋/*X:.eQ   P  `p?07/ @PE U `( P*nkkrl X   P  `p?07/ @  `?+Ld 0ZY0` 0  PP .pp0S PupWZ.pkk4 `P@QC    P* p?07/   @+ h嬋 K" $P Q L[|: @✻y?jjT P PJP P :  P?0 p7/ o@  ` P*Wiil h@K  `牐  [ P .@  `d 0p P   - P* `@?04/ Khh` g{gg i  Pv : 0Ѝ@  㴠 P  ' P(JP PY P   P*?0 p7/ @`  ` Q"* _  OP% :@ ⴠ`$;pPg P J  Q:P :Yf|o`ʰ P+ffee G#@0 0PE Y dp P  u P *  @>04/ @0U   @0@PP  N P*  pxx?07/ YdXo`ʰ Pde k"c>d @0 0PE Y  [p P   P *  @>04/ @0U   @0@PZP   P*  p>07/  ABb P8:)  P =0 p7/ @  wp[~:a'bb< #aa8 ```~` [m:?0+ d v@ P+  ᅿ P*dd?d0 p7/ @d   >0+ B@ P+  Q P*?0 p7/ @d   l?0+ @ P+   P*?0 p7/ @   PP @ V^\ PT:.  P?0 p7/ @  D@pt ?^^ ]"^ P$-  P>0 p7/ @   3P`  P  Q?0 p7/A+ϟ++ @K0=+,p`==Sx*@K0SrP!h H8 !  ! ]z] P!  !%#       " t S\\ P!  !%#      P "%"      U([ P!  !%#      P "%"   P  #   "!    ! -L [[ P!  !%#      P "%"   P  #   "!   P !"      *[U*Р+JPEK[ZS+H:*@K0CSHYhn`ʰ PZZ( Y @0 0PE Y gp P  x P *  @ =04/ @0U   @0@PP  Q P*  p?07/ wXX@ Q2* P:  @ Ptt?t0 p7/ @    /;~pWW Y% P`:  P>0 p7/ @  <>00~ @p ~@p"@YJ n`ʰ P` UV@0 0PE Y p P   ូ P *  @?04/ @0U   @0@PP  w P*4  p  ?07/ 4 TvUجD TT sSSS~S U   P>0 p7/ @   PD. @8>  @0 @1+R= B0 00+@ PtJ@ P* =0 p7/ P@T[⨫*U@:8ʰdA `  ` P p <  07/ @@D T  P*lRT*+\   R$ K @ 3RQfR cQ$ @T< P  - i?d 0s p P  Ⴛ P * `?06/ @  Z   $@KT: QQ4 P;+#[@ P*?0 p7/[ @  +OPPd ;+#[Z@ P*  ? 0 p7/[ @   wOO MON.O   /;POJ P*J`-1R/0 SP @PJPU P4:  P =0 p7/ m@  `0NN( Yk P:  P <0 p7/ @  D====YAl`ʰ P M@0 0PE Y Dp P  U P *  @ <04/ @0U   @0@PP  . P*  pt t;07/ Y P: Q :0 p7/A  h IJUZ   P 90 p7/ @   P6  @)  /+@ @,/+R8 B0 00+@6PJ@ P*80 p7/ `@Tkp{C*V*:ʰdA   P   P705/ @@D T < P*k {@ IIH I 9HGH FiGUGV   P70 p7/ @  Q\6+A @0@+}.+Rk5 B0 00+@P_J@ P*50 p7/ P@T[⨫?*U+:ʰdA `  ` P p\\5  07/ @@D T 8 P*t ?FFؾ EF'EE< ; serial CnD CCCU   Pxx4x0 p7/ @   P# @3  @0 @-+R83 B0 00+@PJ@ P*``3`0 p7/  @R+  P20 p7/ @T  娛[2*U*:ʠdA `  ` P p<<2  07/ @@D T + P*~[U5   P10 p7/ @   P: 0 @ m ,0 aǐ@ 4dPߍ ۍl ABBVUUU ; refrestry ; expiry; minimu; < _::t 8>9ܱ ܲ 9:78 660 L 6b74b5 k44 2v3 34;>>P <<4 @nA C@@X >j? =̕P == << O-M(`,@ P0+P:J@ pQ pU `Pa Q p\Q Q .QQ pG0`,@Q W UQ;Q.Q  R.p Q*p"@p  R *00 P5/ BwЍ.Q Q Q pWpG,, ,0 0// .6/6/O-M`P@V:"pP TT2T0 Z(( (0 0?߼G| X A-P`KpU. X Vx@0VP`. Q p`07@V0@3&b``7@` V0@3```@V@ õ 0 0g㕼k/o/v///ᄓO-TM`2 |#$0plu ` P Z:8 P<32 ! W0)PPH P $k  A$`Q` 2D`p02 @ Pe  Ip  %GX <2Hp02 @ PG Py I P P@QAU 1M`02 P@ P( pZ I p p@JP 4Z[XU 0 P$1S`02 @ P % P-Ԑ P @RP  00P ppWJppp pAEP QTЍeE.‰%I$ųMn: |{ {zP y L ܏ H-p@`᫷PP( U E  APEq 0 .S R:0pS\WR: S\R   .A-MM`P `+@P J +PJGoBPЍۍ-e @-Mr @ 0IPJP*Ѝ +ЍHep@-RPPp@`PP  p@]p@-RPPp@d`PP ^ p@?0H-@P1P  0Hp@-Q P@=`P PprP 2 p@ 0H-P @PP :Q DP [0$0H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0謻00H-P @PP  D`P @00  h O-M-MP@`t@ p@`P P P P p p p |@x@:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW DP9 6 P4 4,DP. 4,DP),& #x|4jP:PPoP qoPTʛPP8P_ Y <4P |jP*RBk@x? ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4܁ x xYH <P\ |4 jPV@j @ Nꄁ X 4 ll l l~l<P o 0 !  Q"04,DPL K f`"|  @  |x8@pPxS <P |4 jP@j @ @x|4 0 4( 4@ 1@  |xY$4 ?8nP cn$P4~ P9||3\>#%| A-P@pW  `P P ^PA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0ClDD D0 0Dd00 00 0E\ 0 0 k0H-P@P P Q080QQ R:0088 80 0e%$$ $0 0fUl5o@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Q] 0P*r-w--xH  0vS-S rS  wS xS S //H-\:$  P/P/ Q Q/@-@P ᚮAQ @ R RP///o@o"/ /o@o"/H-/RR 0 0pjH-4 /RR 0 0pXbP/P PQ/Q /H- AR*Q *QQ 0 0pα^H-PQ0H- P @ ZPmPkP gP;cP@0p@-MP@P"  AP Z`L`JP ЍpQЍp 0 0Z㕱LP/0H-@P QQ P:PPU:0HH-@PP `V pPܮP p`V 0 0VPO-M[# Pp@aḮP @[X  P*K! !@PK ЍH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0\ P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ Q A a Q1 A/3` Q3 A/H-`pP V P 0P@T PT S00DD D0 0LsV(( (0 0Miab9J00 b O-Mp@Pp PT D P"PXЍ`ᥫP+V  -V  `0V  p0VpTp xP0@ Qa@"Q#9*Pp` @PE" ꭱ `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍA@Q 0 0?ݯy00_ O-M`pPP W G"P ] XЍ@P+T -T @0T  `0T`W` xP0@ Qa@"Q#n*`@P?U  p 0儫UK[ [ @pI" !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" Sհ! @T "Q/@X QPPPЍA@Q| 0 0?K^? rQJQ H-?Y MH-M  jЍH Ѝ/G-`PG YO 0@FQ`V lP,`pPVPt  WP F  ᾣ@TP@F ᰣ W @Z JDD D0 0B㨮Y(( (0 0C㞮)dp@-@P@ <`b>U  J? p@O<[ p@-P@㖥Pu`Pu` V P>`p@-@P u `@ 0 06E]bH-M?  ЍG-MP`0ٯP @V   0 $P pܯ 0 PүЍpЍ 0 0O-MM⨃p`0WXQ0 `Z Z \AP |w/r .0РPP 0  ,w; z; O-MPp@P@ Wp W (k`P ` `P ` P P P ` P P`dהP @ @oᠢ@P ἣP Q : P  A  ` `ZMTY ` P%H`Q*  P  @`_P ` `!P#XO#`P  R:0 BpC0R*& K ߍB@Xp` pP` R?ᆚ JAP@XPpᶡ`Z*PP EkU@ X@JPqᝡ`Z: WJAP@[ PP88 80^ 0K `} |dK-MPP6 `PqpWP( pp@U@@ M0   Q  n@ yT ЍЍ 0  0fKD:4: :ʮp@-M@P`9,0,)0 Ѝp9 9@-M@&   9Ѝ88H-M@PpkP P0`L0 @qЍЍl8|80H-M@@TxOp@@T dPP D  97Ѝ0Ѝ0$xxx77O-MP`Pa Uk \v P P Ѝ  R !1MN 0@ `LpdV7pK``pW [ p帐 pppppW @8D1D!DNM0 [10 @%1NM0 Ѝ 0 06 @ Uhh h0a 0 @\@@ @0b 0 @|꾼ؽVpY,AKAt*/AO-$MS@PQ  Z T# T P $ЍO]`/@@#@3 0I㸣Z$$#$3 0J㮣TY Z @``T``` :T:P} rPp` P P V1@ `@T:TBV Pj `PM +` `P  <V `@T4 +Q`P- @P T- DP  A0ppB0P.T  @T4Q`P `T0` 0 QP P$ЍMP`PP`P /`PP`P`` `0 0ZODD D0 0F`/ ɼs?ռSѹ{<[ee(- 4, , , D, l, A-MPPY Xa @ `Ѝ  00T @ xP `9T pP 0D P p@q`p` 0D P:.T Q*p@p`ЍT @ A Q  ` V3VX  0ЍDD D0 0mrX(( (0 0nh걷[:ȷ;+ O-|MV@`PQx$ V, T4 T[w V 0p& : 1P P*: %[ϣ/̣`S%5 0H'V%5 0IT[W V`\  0t 0PD  0 P 0 PąW 0 0Pp,04 or0T @s P_oPR0pYt"W pTs@@0Y t P_o PR  @pZq00@Z 0q P_o PR  pXsPPX Ps @Oo PB  0p^u0^ u @Oo PB  PpP `\ q 0?o P2  p q/o"0P0q pWqJP. X:[C x [ [[ @ TX*[:XW W W ,P4PP 1"@J /P8P6P 0p! :/P% JP"*:/Px Y P*: Q* JAP ` JԎ4QP|y Q`PxP|ЍJ 0 0h̠V 0 0i vxx x0 0㹠`` `0 0㰠d) ޶/9r3J&|w3X[,l# # O-MpP@PP P㣗(Y$ `V$ V, VU1 + 09/p ! 0XP <X6w2P`PpPpPPTPaPpwPp`PP @Y  꾡P P   PL U PP  Z   09/ pu 0 0P@%0,RP <X8 0 BS0< @X0 pP  U 0 U  EPA0u0rPP @P  ULa? pp9/p 0p P @ P U 6 \PP'*)P PЍ 0`9/p 0P @ P 0P! Z@ٖPtt t0 0G7dd d0 0.@@ @0 0"ꃫz&P# ! _/a|O-MP@pP U` p@Z xX]p@Z[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ <PZ  w@pppZ@> @V[; pP6 p@  W)  0WPpp_oRWWUPU U@@ U@U @ U UQpP PpW j@@P@ ЍȕЍ 0 0h#ꤧا*"Sp@-`@PP T$ 0 0GFp 0ap``@ TPpDD D0 06T(( (0 07&Yj!17H-M  2/Ѝ/p@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 0㨝T(( (0 0㞝H: chp@-M@PP T( `P P P 2/`  2/P `ЍpDD D0 0hT(( (0 0^H: w~0H-@PP T P P P  0 0H/0DD D0 04T(( (0 0*xjP10H-@PP T P P P  0 0H/0DD D0 0T(( (0 0ꨣp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0 0࿜T,, ,0 0ജꤢ3xp@-M@PP T) `P P P 2/`  2/P `ЍpLL L0% 0}T,, ,0& 0r꜡8p p@-M@PP T) `P P P 2/`  2/P `ЍpLL L0E 0;T,, ,0F 00ꔠQh%6p@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0YT,, ,0e 0ꐟXd,1p@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0a㹛T,, ,0 0஛ꌞm~`AWp@-M@PP T) `P P P 2/`  2/P `ЍpHH H0 0wT(( (0 0imꄝrr\JUp@-M@PP# T, `U2 P P P 2/P `` 2/P `ЍpЍpll l0 03TLL L0 0q)44 40 0 tbL[o(kp@-M@PP# T, `U3 P P P 2/P `` 2/P `ЍpЍppp p0 0TPP P0 0ؚ44 40 0Ϛ4M"!n;p@-M@PP$ T- `P P PQ 2/`  2/P P`ЍpLL L0 0T,, ,0 0~sp@-M@PP T( `P P P 2/`  2/P `ЍpHH H0 0PT,, ,0  0E}A-`p@P1 V, W6 PPeP P# P  03/P U 0  03/P U  0 A/DD D0* 0(( (0 0#ꜗ՘|x kN?K-M`@PPb Tk Vt Uz V P P PN 2/PG  2/P; p` WP5"P P P.W$ X`P  cV Q`P```X  ``  `Ѝ 0^ 0wT 0_ 0lV 0 0&bhh h0 0YV|LL L0 0OsꄕɖrzX0u cy;Bz0H-@PP T  ;0HDLL L0 0'T,, ,0 0D2yH-M`@pPP= WF TO VW U` Wh P P P) 2/P"  2/P  R Q  R 0S R 2/ЍЍ 0 0ƘW 0 0໘T 0 0㱘V 0 0ঘUxx x0 0㜘W\\ \0  06w  l@ӓG wͿG-MPPb Zj @T `TYL ᗔ`pT T T<` 2/oP 8 2/P* `P-V+@T T! T$! p@Y@xP p  pTPW  ppp pЍ||ppHH H0 0/ Z,, ,0 0؏tWKt0H-@PP T /*0HlHH H0? 0T(( (0 0 ؗ0tTH-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0W 0U(( (0 0ㄗrH-MP@P3 U< `P* P P P 2/P  2/`` p 2/`P  2/P`ЍHH H0{ 0:U(( (0 00ꐌd~qh<G0H-@PP T 0HLHH H0 0T,, ,0 0 pԋč0H-@PP T 0H{LL L0 0T,, ,0 0hcVp<70H-@PP T 0HHH H0 0˖T,, ,0 0Ԋ܌o0H-@PP T 0H0LL L0 0ॖT,, ,0 0<T*o(@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / p/ 0(/ $ / $ 8 ̠ 0/O-MQ p\P Q*0 @ P P*.000@@P PAS01P!0P*@P0AQY YcY !P*@`pY: P $PJ`EUpPGPP` ! ~S p@"0D:SG`10S\*@PAQD!0D^S:0SO*)Pcf`51&VაDd0 ey0&fPD0uPd\PP`E0@P3*@ P|`  2P$J`p )PJ@p \P pQ PR .P* @Ѝ(Ѝ\[x^~*0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  ʼnP sQp P 㺉PQ ` 㲉P Ed @ F!p W`` X*p@]P LQxQp   QP2(@ U1*@0/R# ]R* PbS````  P0R| z ^x@ T" @` Vh* Uf* 0pS P[  `P]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Q(Ѝ RЍQ X* H Q@(@@ d O'((A-R8P0U9  0 PU. U'*PP`@V VAU`PQV!P`V*UPPE`Upw`VJ@@@@@`꺔(C h H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PQP!P0[0Z1*` ·  Q*?0 0P `T@@X`V`(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pqT!pp P SP@ P@(TYTpQX @QUAPT qP!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ (`W @(p㞓pPP Q* H P(P}  ( u@pꃓ XYz(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P +pPP Pލ; H-BMhp`@Pp 0'p  0!QBߍ; Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S(00S00H- Q 0S AQ:Q BԒђ(G-@pTWo᠂P` P0 P1*T`P xP@pTWꤒꡒ(H-@QSP`p R xPpGP`W@A-PA@T  zQQ*q(Ap`PJPQ`@]?@-Q 0S  AQ:Q @(@A@ MH-M  ЍH Ѝ/@-M@ p TЍЍH-R 0Sb 00S0 0s 00d O-M`PP @U E @"PXЍpᶋP+W -W p0W `0W`U` xP0@ Qa@"Q#L*@`pQZQWZPEUP@@D"광p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRڐ@pX QЍA@Q 0 0?ۏrkGq)fG-MpPW# U+ `@$A AaO  |x 0dA`A\Aqpq p@!Qލ9LL L0 0F㞏U00 00 0G㔏< eppt=pqpH0  MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/\ O-MS \ Z@Y@@`ЍpP0Q  1ApU/W kLP%p@ ᭄P@Up`T@*VJV:@V@3D    @P @`@V P 0 0@!nUnH-`p@P  0P0H-|@P@ ppdPP P P<m @0 !( t !  ) 8 0H-@PI 0HH-`p@%h dPuW  ]8 0ṁ Han H-CMs@PTp, U @  PR  `0!P0G 20" 00b@P8($ 8@P- PLP3 @" ,0  P),P" `P 0  3/$P QHP  @,PCލ8֏a`|QP P TaP` v8U ((1 0P~@\P ( R $2/P Q 0 0~PP P0~ 0̍UO00 00 0E iiiii84 pl=l| p {  .O-M@PV q1 p0R0PD \Q\a\q\\\P`p X0*P     | u n ЍO/ 0 0Bgggk+i{'j0iiiqhH-@PU P P`xqpP* X` PV:H (` P  !0p`P0PP`p PP Q `ApP [V pT   0 0ьemfe|@h0O-TM`R  xY X pPY P p,pxQ @T PQ$$HH$  (T$$ Q "$0 0$(  0" tPM ZR P@p@ [J VAQ@@d0\" XVPQ  0400FP  P QII0S  | 3/@x Q@Z@`xXtpP D$Q(( (AWpTЍtt t0 0&+\\ \0a 0X%<< <0b 0Ջp#bbbabbabb@ v hv $Xv u  $t (t t O-Md\ -p D@D  420S$Pq QPP! ``V*AT pW W P P U \\pppHDQPP `4p`W*V P  R  2/P U  @@ 値GQ 0 0|tl(Ѝr {`TLr / 8 H@,q  dLPp p 0H-P@iP00HuK-MpP`ဌ@ @`0 0pp2P `@Fl@h"Ѝ G-MpP`0Z4  0@p @p P `@FG@C"ЍO-|MP堰x $P Y| P%P,0 P%pAUW@qTTTTT\TTTTTTTTTTTTTTTTTTThXXdpTTTHTlTT  TTTTTX x TTD  T T< H 8 p $ 0 0,0o@mW `#/p~ P0(Cmp|@JpJ.PSG m̌)PG?[;5#msPQ%Q7pP%RnPpP\̌ s01S ( `쿟P 8L[Rs00 Ba /@!B BpNp T.T.nJR3/>@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:D P@! P堰gQ VQ, Hp!0  P Y *P p [PE5P Y: P Y: )@P"d 0Aspg@G'v Cr r 0\ Fp`灁 Q H ` P R 0SR( 0S%⚏ Qp aW``aPPePP UW R 0S  R``0 # Ѝ-00L)T ,S R T<|0H-P O@P  P P@P0A-@Q `P' P P:P  P|PP `嚏pPFW_pPTPt PPP PP PQPVp0@_@E xPp`VUTC@x0 O-MРP& @P aZ Q%  P R aZ_R  0~ h %,a p P 8(}pP  PZP ``aP``Z```V RBa P  PQ /+m FX /+ ( C @1Q0!>,!a 8!0{~P1@ %, 0 P P  P !!Rp 0PUP .0"@0pZp SpЍ 1p pY`\N 0H-LP@P<k0000 &@0$M d0H-PX@LP@k4 0 @s0L IdPpL 0H-PX@fLQ8] 04 P(0N/8Pp@0S0`Va`` `V 0pP@`P8Pߍe*\`,@$m F,7`  PU Tp pp  0oBC,m 7`8PF, @Q 倁T /+o, 0 B(P p  0`" @7P 7  0 @7P 4`0PTPTP@`-00,  O-nP 0; ;P  0 ;P(PJI PJOO <ЍC C h0H- X\ @LA@RPp R0H-P@P P-,3(,< 8H܇08}pW4uxty`h$to@~x0\vw0tzm0u{ nPĂ~ ($qp q0D ($r0Ap s0TQX1WRH YOJYM\KJ}\IQGJ1QEUCJUAT?JT=`06#D` 0:&00`,0R10J?o2 <X0@ 80H /XJ Z:FTU U4@;4PP P6\ f,(pP @ !P @ p\= 0WZ s 0W(`W$@W ~ȿ0W(@W$`W 8W4@W0hD`WS($@0$~!P TP 00  @1@0`T `XP00\PWYpL  R ?; Pp WPY<GY$0 `@H$P p$p!W   WpPp CY0 pP0`0 0S /+ppP@W p`  PD @ `pRB   pZ P(@$0 pɏ0(@$P 84@0XDPS($@0$p 0P@X40r [ DV ^P  NP :@pTpP&H `4@P0pq0P U pWWpPp00pP T 0SS0H ~PߍFۍz&댓 P T H QX PAX QQ0X01 T P  Y5HLT  [-Q p`Z p0yP pZ pZx@1TT HT LpLLL Pu P>@P0p0p0W0@P 0[0ET0͠X p pȌTX@@ @!`00OKP0p W' T XA0P@"`S@U0C B @" P?/&@& RJPT !  R }PTL`T VXp@`V1pp@PP k ԑ ` O-|MpPQ <Q ` R` >R `0 A R+A"Q#:Q`@PF@QxDPH AW !P Dh@ 0"0@pp  pPppD@PX@H㰡<@gNI0Q <Q0HH  R >R5 @ x a H{  o@Z HP o H0 A R+A"Q#:QH8pp4@8pp4HJ@Q00Q ,Q;Q{xAt, (8p WRPT ;P,Pn` pPh ,QeLP` P], xa0t@0d d@@L0p ~" Ao R % l% /O..pWpJD00S@00p0|S@@0cPm{ F0  @T  0St 700 P}|Ѝx@/ax@PD'@@p@$@pP 偱 000S @0DЀC0Ο$m F RaD00 @@00 ,pt    d` ( F͠Ɍ@p ```# `QT#`3PD /$0$PJjD00Q@00 aW p `8p8 L8 tt"t2!!a"Rh2a  3Q\"P F-) p  0pREWC 0p|Sh0 0$p$pW0JDp0S@0  08P0{8 0 p 01$0$0SJD0pP@00 ?  ; 00  00p4R< a $ $QJ@\l P 00,  (,p0LP (ȡ!Q)\P ף(\ @- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s szpzT@^ l @- MR JRR@@00 C Rln ̌! 0 B Rk00@C T:Rb@S 00 C RZ ! 0 B RW00@C T:RN @.RU00 C R@ ! 0 BRA00@C T:R8  P@.R?00 C R* ! 0 BR,00@C T:0 B@ R, 00 C Rn ̌! 0 B R00@C T:r  /R@/yyyT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$IO-$MR"X *0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0sƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0gsp%P0 G`Zs."D㐲(97 @AP{p { oc 0>s`.08s [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0]'@Q.0]@Pzp z Oc 0r@.0r@P[p{}d 0]%`Q.0] & (J/0 !# F[ BQA! A@ `p{ d 0](PA.0]!xT$Ѝ{p(_d 0]PE.0z]p @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$IųıO-M($0 0, 0$0 ppQ 0 PqR?"c@qGw@T0g003`Vg pp p3`ꌷ\ @g87&s'47v'P07 `%  p"1'?w&BnpVw^gppp30V6/  3 " X  0 Ypp H&   J  "!pP<W:*pATƟ 1/Q0X0eQYࠡ0eEuإ6T%@uV%$ `0 P#q%U&n`VeNU```3pUu?00030  FQ; ;0W FQ0 0 ph``/00b  P P地Wp,$ (@04/P | Px PtPpPlP hP 1 q೘ 0! @"0 + m   P 0! @"0 *^ W p 0W 0PpPњ PpP* uFUQ"hUEPʘ0@ ?" " RJ0,$ (p8@4007/P XQ\P pWJP   !!PxJ,$ 0(p7/P 0 0luTf,Pa ,@T],(pf UU,mP@DF R,`VeF ㆡ`FJP, R , PP 0 Q<,$ 88h07/ P | Px PtPpPlPhPP8<|Gu ЍL PjH PDPe@Pa<P]8PY04Pꉈ*(\)\°Q(\\ףp= ף-000H-@PP T   0 0SP@Q0rsA0DD D0 0ASsT(( (0 0BIsb:nn @-@4P P 0/0H-PPᙼ뜩@T  0啩 3/P |u0H-ph`@P PT@ fu u P` `K-@pPP UWY% W- T&9/P pG§PP`Vptt t0 0Fr\\ \0 0GrY@@ @0 0HrW_p@-@`PR  p@" 0 0rVp@-@P`R  p@  0 0r-6p@-@P`P' T VP   @@PD  A#q B0S0S@Ldp 0 0Jr^pذxO-MPtKll\qpW9 PP @ `U P P#Q P  1/1/Y p `PPW:#W*`@@pW@xxp A `PT PT@UЍ h0H-@P$  A#q B0S0S㝵P ll P P4PL0 0 0qnThԭO-sM8p `Q W$ [, v4@P$Q QAOVp|  0`FdQ`Q\Qqpqaxa@pPxx x0 0P]q[\\ \0 0QSqvrT!QsߍIDf H-M0 0 Ѝe MH- M 0  0 ЍHЍ/De H-MЍH-|pPpX@0h`P`u`pPu` V XXPw`h\e P  `0Q`0pp0Qp \ X0X /XZd MH-M   XЍH Ѝ/\d MH-M00 0 XЍHЍ/d O-M@`S; p!W!VP Yj Z7 gP pU6@Q 1rT @S -P[p IrmpC0 h9!1 0=pp 0 0QgpW  NepG-PP  @eZ0@  gpgI/mpЍ88 80 03pyg^kUg%fMH-M  0 ЍHЍ/MH-M 0 00GЍHЍ/H-M@PP8 w,pP/ `^P+  @,)PJP7qpp  00`|pp@$0 p(,   0hpЍ 0 0>o6gi` _ x` _ p@-@P Pf`Ng&p 0 0;o8Nhp@-@`Pk RUP TPdp@-R@Xp@-@PQ; 0QQ dP q p @QcQp 00 B Pu`Q  VcQpp 0 0<>ofp@-P@`Qf( 0@fp\] O-MMȯ` @X0 [ 0QᴾpP dP p` \  PhAP< ~[ Bp$v v堖Odv`v\vohvBύƍ, D0p&6Hg 0pƍˠƍxƍp`PJg3cP`X@ h@ BlcBd8 4,(pg\0p0``0@帐D$@@DP[U%UT, p`V J dBQ :X P aP  /? 0dnPg00pU KߠӠdH`@ Pt P *P@0P@0D P:$T6t @ZP*8lHPTlx$htTTlxT0<( H @*T 0D P Qd @ 0D Q:d vPr >@n0@ Pa\QPS\0@XP @0@ Q!P0@ Q:$P7Qpl$ p ` p `00pQ@ 6+@/@,@) @@@ʌ@! @ @ˌ@ˌ@Q `  \\P ̅0@`  ` zj@@0 A R1@0 A R:0 $QR pl$ Pl p 0R d@R `P`P P`Pd@`PPpl$ @? 0p`P / aTX0Ppppx0Q@p0T ` dp`P`Cd`pd`pDV`V`CPT `  0P'PU6 DȀ@pP PD1 H4d`I     P P @p  Pn `n k   7  QD `D/ d   * ~ Q: `:n`' @3P `    P `P ` dPT P `o` 5  O  K P `BlP{ `{DP P `Ts @ELpP@ XBP|P `Q dP  _ 0gPo  PR@ Aq4Dd P DBPDX WPT`P-`0u` DNPC/`T  P @GPd@4 uTAd@ : UE+e- P jP cPQA110@000 B0 0P]B@@  l`0Q`TPL pPX@H`dAUppp@\H`dP U@P U~XL\PEX@ RX\L PLm UjLXi|\ EQ 00d@ T Ap@LXDP, @PH`@7  P `@1  P `@+  P `Q `QQ `QP `QP `LXLXpD?P `p#oxP`ʌ Q00BB/Wp. p0@``LXBP@P_*c@T- u{ڀUB)k`00PB/`(Qz:d`PtP `PUP `P NP `XP8P `P `P `PPP(P `P q`-Pu`B_@j0 0`PpF ˭PA @BO`j0 0p0 0P `P `P `PP ````VD`H`dP: UP J _T0P:tT d0 P p Q R R R0%"0.!R!U0@P@*  08@R"8@S p 0\8@@ p @T$8@R8@0Q \ `\P 8z T@8P@p@eWY`Pd@`@LX H`0 TQRZ <J`JT儀VP V?0P0 <:hpP Q h[P p G Wp/ P :hP gQ h[P0 u/? 0h00pz!n A0  @PTS@0Rv 0rqPp8@  0@O!@ E0 k%\ X pT 0 R@ U: 0P`pc! F00p0d^ X0T0S X  0V0 P X@ g 0S@X@pP ``` ``gfff/? 0gQMg0P.    Q :hQ P hZPg0/? 0rg0PgP     0 Q  :hQ_ Ph hZPb XbhVpP VpPp ;:pXN QX ZPpg0P G Wph/ P :X gQ kZP0 O/? 0f0p!/? 0fPg0X h/? 0f0Qg DR^R PpPp =:pX= QG ZPg0?`QT D T@/ P :X gQ YP0 /? 0f0pXX/X? 0zf0QgT P Q:0pX0 P#R@ dP0pU5T2P 0  S 0*@0pPED4P @H T @T VQO:hQ; PD hYP> mP 0P(00 BS0:X gNP- aY0P00& F@#/0  S 0:X dPQ CY0P00 )@dP04P SA   :X gNQ !Y 0P  @ 04EPFP?R0000?:X gNQ7 X0P002 @E UP R  :X gNQ X0 P  /? 0qe000@,S:X6 P0000gT ( S :X Q X P  {/? 0*e0P/? 0eP/? 0eg/? 0ett/t? 0d./?& 0di/? 0dPg0 JRQRppPp =:hPl 0pQ: h#XPg02 D T@. P :hP gQ hXP0 pp.p> 0d00pgPX P\P LQ@@PQ  LPXpPE\ pGXpWPp@@UpXPpLPP\p pGR :hP Q hWPg 0l KJ -= 0:d0Qg PP\ppHWpWR:hP Q hvWP `p ` `,`< 0dQg 0\@PP | pRp s:hP= QG hBW P -g0cG Wp  R  :hP gQ h"W0 P  + ; 0c0_*H *: 0c0Q g"P0pPP\TdPhP]bG(  0%B/Q0  :X! P* VP$ "\ \)\9 0ccr )9 0Yc0 )9 0NcPg0l (8 0C>=c=;=P.("ϻ@% t% & & & [&776H 4 30s>=X '; 36/:g9 j8P g286K44 2 ϿG2 V1 [0% 0'z.% H-`@PpW 0@UXO-4M`Pp000@0 $(, `VP$ %P@p Q * 0 @ R0A :$Pnp AZQn   l , , ,   ` H L , ,,,  d0  8L L @*P2 0@ ` Q0@ Q:p}p0A P3@!p0A P:$QDW+:i @@@ca [ YWUpp0A P?!p0A` P:$QOW6:f$Q@ W : `00p 0W` p)YJ* pY : p p00p 0Wp$Q W :  00p 0W`ppW* W : `00pg 0Wp `@W* W : p p00pI 0W@W* W : p p00p3 0W  /  s@W* W : pt p00p 0WoW* W : @_00p W0Y > P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:QPI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@㎦4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0]gfffK-M@`V`PT pC^pA^Q Ѝ p4^p2^P .^@*^@Ѝ wQF<]`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UppP `UG\ X G`GWP!"+G@Q '"00@0r pPu @Q P USPO ;P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  \`Ш"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLZP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQkiP (@ W,p{J @v @1`t8c (@TZ T  J@DK Q(@R P 8:P @8@8@8y@P  P QkP 8p<0pSD0`'4p  S4@0PWP o  pPQ ` `  `PP:@ (@@` @Pj VV b(@P  @Q+P8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y P! $(P*< 8P <p_ 8P ( P#P6 Tnq(`Ph@8~ T@0W@ PЍЍ[[ 0PJ @8 ,pP` @P`@8p0PPDPPV   8(@`FP  8 (P @P   w( P`W`P @! L(P 8@Pz@EXP pD4$PQ D @ @ 8P &@0P< Y BoD [JR $P PPRm4P f YXPD6  P: P  8PV Z.  PZ(! 8P @ (pH@ `P`40 (P ,pP@ 8XP 8(P4/0(,pi,p@T@D0P f`,p0(`4P: Y8 3P 8(P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1D ,p0(PD     h H-MP`@XpVURPPP Q:RP PhXpЍcXPTPR ":S S/$/ /0H-@PP:P QPiPP@0H-P`@pR:pPpRP p@Q   R@U0 12 O- MP QepB`  @ IS T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-=A-RM(P@VD@,  (  `H  0s $` `````SWFW)H-땎H- RC/A 0\R#R! R/p@-`@P PV P PVP≙`P  Jp 0 0?U.p@-@P QPi`P  mJp 0 0:uUÍyH-M偊ЍP H-MD" -=)@/  ㇊ЍH/C0H-MP@P  0 P BpЍ0 0 0;2U+n0H-@ 00: P:P P P! J& @0000 0S P/!C/H-P@Qb  @P `Q PQpAG UGV f1O-M-MP@`0`apP` t p l d@Y JR:*Z Z Z +Z -Z  xZd0x!I x0Z\ 0 0xSM$` xl0 Pd\00x  0 XH 0 C RPP ! 0PB 0x000 C R *XX! 0BP `` TDS R p`@@T  `R0Lp@d x 00S S B0 x 0X p@@p@LJ0S @0pxp0@0S @1 Cp R@L:20 C R*0S  \` ph@1AV VPpGࠡ`Wh@ ` `@pVPVЁx0 @@L `pEQ[T  x0p+S -Spx00C Q0Sdp0x0 0R C d70Z d`xpx, 1BpQxh@@0pB@`0D Q `x`0 0C0pB@ Q:`F0 `0O@ F`NLRNlpQdph@Qpg@`T[ \0h0T PS 0P0aPTPX0Z @LP IC%Px2 P x@xx) Px@`xT`P-0ZhP@@X@ T B+ ! 0 PX Gp5Qd0L hhpQdR$ R4R;ʸ[ &p  L 5 [  (A6Pdp pT3`  p  0 `,Pp/`PXHpr(@ hp%`Rh|`!L !B pp  p0` 0P PX\0 `h@0S*   ! p#Wg ϟ#SG@0Ltp A ``t`'jP +W `@00psEc /    p!W8 lϟp0!|@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\꿃` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!< U!0@PP4U28<Q0  P p_ P$t X%U @Q l0q0pS*`v 4pl8|PhUXPQ lUPlj l eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U p9O  `1\0 @`\0X 0Q @0 !R8<Q=l! RH@PPH~$ 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!a X |lPA|4pQ b.PPh X`Q pQAH NHV f1lP.l`X<  BQ| R`P XhPQ pQAH NHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R B O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ N"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-mK-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! bAP O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝ 8 O-MD@ T `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  K"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp JX h 2 @=@ ` v @ R K"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q zJ"P@!@p ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁNI0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@08 H-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P = TQU  tPU P # xxPtPEQLUPP $H  @ D d d 0H-P @!P:0HOdPPQ TH0!S A ,0Hڟ ! A0  H-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! W<!P : Ԑ7!P: ΐQ& d0!S  XPPQ O0`!S `Bd! P$! 萼 P  ( t TP13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@GZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP ◞qpWHPa pqpP }똡 猁PP$ fPG pT !P:Q [1 0RA P  A@[ p`WP >pW3P pPP HPQP L!PЍl t 8  $  K-` rW WPF  V:RUPF 1` fP@VPPR5Q:UPR:LY! !P: 3lPPQ \ɝP0!S 4罝$! x 8 p @ 0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-M@Pp U E@H((!(1 0EDP3 ` @NyP3JpQ Q& zp%   P2P @`  lhP`  \00@$ 0( ,@|EyEOЍH"I ȯ Nz0H-@P :@PPPS;0 0 0=CvGb@-@P @P@ 0 0ICG2Gp@-`PPE aP rP wP9,/ < 0e@CT0APx5 S +S4 ; pDp 0 0>=CEFFp@-@P; P3 L: 0P QQ 7P Q 1/pPӼ 剌0P @ P 0|0`aa: ``pD p 0 08BE5Eb@-@P 0QQA  0 0;BDDڴ0H-@Pa P1P HOD @H0P @ P 0<PPP 80 Q7P%P^8 PPG!$P  5/PP0 @ P0 0 0J]B,C^C, @-@P P@7 0 0;ABBBH-M0 CЍ0\ \ \P NЍ4 ~eЍ Ѝ6@  //O-OM`PC<Pwp4P3 @VQ   lxP }CPyCPtCV 0 p x|Z zҰ pDp4,  0P8P0  iBV 0xP P > X P 6 Q P4P PQ *Q Q4@r>P3  P0!! P$00poP0 p|@P73(, 0<0 R5PX Q! V0 XA/Q fv12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0BP-BP3Q&@P"l ! 2/@P(pSP !D 0@0!NPu vaB^BP@1YBP Oߍ4$$噄P  p`0 P  p`0P @5BP91BPap l =T0A-@P‡P UQ `pᶇP U  &1!!UBPAPH-4!@9 P APPP 忉@P  @!岉P UAPQ NoppWP p juᕉU APP/0H-@P჉0@-@R * 0 0@^AA,H-Q pA@-@S A,  0@6@-@ nA,  S 0@\AO-M@S`p $PPJW $(XPv Z WW)(Q;$ ($($[  0`PU  P([([$g(p (X!1 0h? R(Z (Q 0*P  (Q P$ $!1 06?@,Ѝ(p pQ   0pppQ Ѝ 1S R00: W $Ѝ 0 ,S  Bp  N (qЍ77,67 0H-Q @0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ ᢂP.  pؑ ` D' k? !paP !( !9 PD  , U , 0 ЍO_gЍ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/㺕p APP`P@U 8Q 0,`kP ލG?OD?,ލa3O-MP@ ! `2/,( 0<V`Q0 0b P{  尀@X_:@ `YVZ :FW wP,Z 0 p~mP!y@mP3   0!P  `@㲀V `Y ) Q] QA0 m P;@ @P g R  Ѝ ve P g P  fe P(@Y TP ( B  ($ @$=O-Mp`@ S [9p P`W  p P` pgP P7=$X@P X ğ  W礄研 40 0P Q Q(  00sp Q,0p     WqPJPß " Qg =`V` VlVh# [ "! FRa 0   1R 18 F8p@W* Pw/p3p 0-PU 0" $- .Pa PPPR w.    p:  6 $(!4!x!l0, > $80p` " (12/ Q, P  ` F P,  .=O@T p p@Ѝ$p( 2q"k-==P` = ` ,P ` ,P pP  < - {XX X0) 0A;aFb14 p   ( h  .+R''' L 0H-@Q P-P 0<0A-M@`pQ P-PW <PЍ P ` P r 0!P!@ -P -G- Q|  D Ƞ " @!D!Ƞ! #@#h#L0"8 "$ ! @ @BT 0 `* rQ~ QP P Q"40A Q0Pp` @p`P @  0@ p`@Ppp``P`p `0p P0p` P 0  0 0 @0 0   00  0 0 @  0P. P) Q"4 0A0Q `@P``0p@P`p0 0 P p ` 0 0@ p ` P 0@ 0 0b9?_"""G- QW @@T* rQ~ QP  QP"4 0A QP "x"4pp00`@"`@ @P p`Ppp```p `0p @0p` @ 0  0 0 P0 0   00  0 @0 P @  0P.  QP"4 0A% 0Q 0`00P@pP@`p 0 P p ` 0 0@ p ` P 0@ t h \" p!t`!h! P#Tp#x`#l0"8 "$  0P p ` 0 0b8p@-P@Q `+`'`p" +p P M P FP ?a97n`P`pp@-MP@Q `_+`T J:Ѝp "    *P @ !pb1   `! 3+L+P Ѝp  Ѝpb1@-Rq0 @(9@-@ / ?!BCY5 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW# Pp !;@a @V p0oW  q pYpo@`W@@T 00 0  `pW; p`W:BpP- P$ TDY ā o2   ndPppYpЍ` 0ppdP0S  @!4@qWF 0 Q  ![( @p@ v Q0S0`S 0pdP@ @  R `@@ @0 0>7,(( (0 05717$H- 0A1Π\1>-1!!K-M`qWWЍ@P {ppW R T T  0]dP U P 7ZЍЍ 00 !     /p@-`k@p PV imp pY8`lU8`pA-CMLaP@`,/mQ$i !1,P00 Pi P:48?-$  k,Pp , mp  kp T mp  k 8@ kk8@P,PCލdz BO-DM p` @@Q P(P XXw P0S@PP%7X(P 7@ QDЍ) ;p ,00 ( 040 P(p0S &p $0 8 8 <0 P `PX  (P 1 0@p7 0cPE  (P0 0! ⰱ BRᴰ&:QQ @P*p P :PJ   X(~䱄 P[   K(4  ' Pi 0XP  7(]P    !   BR *0  0 ^ |P @S@P0n*pS*@ 0! A 0 q! P ( PQP"!娱P P PR  P@U8*pQ!  ' X    P] 㰰o a 0 0b4 0 0 0b4 ,, ,0 0b4\y KQs |v u ot Cw}O-M`PQ @g'@ U U =P P p0  P  P@@T *pU*  P 00'07b 04P@X)*qEoR@P  P 0  p @PP@@T*   'UXX&X6b 0M4<<&<6b 0C4  Pd  P PQ5(5Ѝ D&P `P@U=*8EP @ & @P `QA & &D`P 1  ApP@U*  lP  &X  P@U*   p&o"i&, P_&Ue ZO 2! %P~ `pZ@@T*pP A&뼡Zll#l3b 03Z Y㴀 pIx !01   & %P? `W pG & %P- `QOu P `@QZ?  %qWD  2! X%P `WP  %qW @Y㴀  #!1b 03x p% (%P `P@U*奀Yⴀp %  %`P 0 0b2  cPtt t0 0b2hh h0 0b2#W]          O-M(p Q R QR @P  p   p  p E `P@L @Q01`@X*   @R 0 A(@ Q R QAˁЍ ( EWT Z J  P[ @@T*p P  Pi ZK @@T*p PQ P9$P2 @ QPP  $W㰡  갡    0P((O   0ᰡ P Ѝ(()Q #P @ @P@U<* ?P  d$(( ( ( U$  0 0b14dd d0 0b1aXX X0 0b1l(( (0 0b1/5 SYO- MPp,ATw  2! #P T`@ p@ @Y* PP. yPdP ^!1b 051 p@[  AR 0 1   #.@Z+*  0@S000B @ #P #p pPxpPp Ѝ,, ,0 0b0+1p@-P@Q "P    d#Q `"P    U#ppp@-M@P  0PЍ 0 050O-MM`p@PV TUP WJ@ PJ P1? F @Y:@/T#P 1dP ЍۍI @(XP>IIY*F  @;zYFG    U -Jep JT$ fpD1P P p尀4? %P P0PpPfP* P1 /P HX]f/P   P i1{y88 80 0C/GZ1@oᠲja LP@P@@D ?T @T :0@P@@D ?TT ( H- K-@P6 `P? q<W (7W (7g)7[ ( ?W (?'R   8L @D((P ( 2/ Ph8 P @-0 @e(@, $@/<[H-\H- P @-8@ @IP @DHL@/ZO-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P`U48:YY  0@pT(0( R`PYd@`UC:^= @ T4*Z2* 0Sp8p"pPU(p(PUS4p4p0P0P8P8W PPpP 0P`pU:@ T: T: T *I8 800S P`Z*B PN}`@PU048`1^ @X@A:P.QBXc/jy[P  P `J V  0  ~!P*'@@ $ `PP p$ pP ! R PP3P@@3P8`V( p 8`V 4@T U P @ P @T``nXPX@c/ c/ pX@X c/U Pc/ `Z( XsbpX 0RPU@ pU X;P@lPߍ X@ pP T !(4b@V P p0BPTT y`WP ` P@P@8@ yPU0BPT$T& y!0BPT%T? y0BPT*T, y'0BPT)T+ & yzP "~ y0BPTT y y`Pf VP?\ yL@PUꫪP  t X 8 | cؕ 0H-P @P08PU 4P 48`PU:\80O-MbP`0 00SYpp@Qp( pgX  Q{@`Rx@ p 0Rv 0ЍOIP`@~Tn U `W:` `pG`PX @PT:`RR p衟p ` P`~Y; X P  ( X Q  @ @U   XPX@R@-@P   0`[` p  @X .@ QЍ~ P pQ @Q0U@ W  1fY U[   x p @- 2A! "@ @0H-P@Q xP  " 00Hp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R009 B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/A-M Q$ 0S) @ 0A  Q `rPV*`V@@T Pr`U*PU"Pߍ 2RߍA>B O-P U  @A,P  5/@PX !P @ ЍDD D0 0G Y(( (0 0H Oss'sZsasp@-P$ @* P`U) P`AV ,0 3/PP`VDQ 1/`h@@c\Pcp `p`@` \p@-@P& PUpP`@V ,0 3/PP`VDQ p@/@pp 0 0V uqq@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0R/q Q/ R0/@-@P5 P 0 P @0P S0 $0 P   a 0 0<2 (nZnf O-Mtc@T` P @PJ p @oᡒW  PLp(P{TPQxPM"p0 @㾘PzJPPq FA/QV PPPPP<PPPPPPPPHPPPPPPPPPPPPPPPPPPPPP<PPPPPPPPHPMP9 ux!  GڀpYP PQPp*  6  ^PP P U C   PЍ`DD D0 0|V 0DD D0 0M j+k mm D p jk'p@-M`P@P, U4 V< P ?p*A/o"P  L  Q(   Q Ѝp  Ѝp ll l0 0 UPP P0 0V44 40 0iiiii\iiiL p@-M@P1 0P`0TaaV `a0TP Oaaa0UTXa 0UXX \\\Pa0`Ѝp 0H-@P 0`0TQua0U TPP ma0 TX!0XXP`0 @-@PP 0`0XQXTO`0@y`l 0H-@|P 0Pl`U 0\Q\`:a0XQXTO`00HU`0 @-0M4@@,  P, Q0Ѝ4 0H-@PQ 0 0H> 0 09t,@ffup@-M($`P4@`P 08PpЍp O- M80`<4P P@]@p[c WpVpT D#P:PC ` D0  @v P r o `P Q < 80 YP" SP"PPPV < 80W Y SP@ P  Ѝ@@ @0 0K(( (0 0M,dd|p@-P`@P PV' P <PJ% 0%p ,phh h0 0A`PP P0 0BWV44 40 0CMc&d*dcddccH-M@P`P- P3U; p|  0Pp P ,P ЍH<Ѝhh h0 0TPP P0 0UU44 40 0VbbbibbbAbbUH-MP`@P  pPP 0pJ 0s *0<  Ѝ@@ @0 0i(( (0 0juaaaQaaa@-@P PP@;@@ @0 0{(( (0 0|`Laa`(a`2=00긺 O-M`pPP W G"P  XЍ@P+T -T @0T  `0T`W` xP0@ Qa@"Q#n*`@P?U  p 04UK[ [ @pI" !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" Sڅ! @T "Q/@X QPPPЍA@Q| 0 0?KB^?H- P Б눷 ^H-  PБ^H- P Б ~^H-  PБtF^H- P Б e됶 ^H-  PБ U]H- P БF ]H-  PБ6r]H- P Б'똵 @]H-  PБ]H- P Б \H-  PБ\H- P Б렴 l\H-  PБ4\H- P Б $ \H-  PБ [H- P Б 먳 [H-  PБ `[H- P Б@, .[H-  PБ@|ZH- P Бm밲 ZH-  PБ]ZH- P Б N4 ZZH-  PБ >#ZH- PБ0@ YH-  PБ!YH- PБܱ YH-  PБ`Y @/ /@-M4 @0 3  96YH-M 0ЍH-@P`p%4#@ W5#0 p@-MP P!`/"/R?#?@@//" !PЍp  0S RP/0?c0 3??oP/O-M(@Q [ Z# oo A R>:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /Y@- 0@ QjHQ / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-pP@Q`T W   Q 0 0aTTTs R US  R/ /p@-P`@R Q U T  Qp 0 0dySS2 S#%U#/!R  Q0///-R/p@-Md`@ Px`6666PЍp( 0H-MMdd@ddPRP  @P#  @@p 5 둜SRSH-0 G-M pPdpKXBX`@`PA`` AB+Q8 `````R000!01U0P0 PP0  0  0 Pp$ 4 @- 40 0QTPލ^a \G DG R+QPQE R|E ew E 0 K0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   4`QP  Q 1/W  3N5dL @-0M@ $(,D?P:\ D   1, 6PC0Ѝ@-0M@, $(D?P:5  0 PC0Ѝ@-@95@95/ H-M00 0045Ѝ舙 MH-M 0 00ЍHЍ/P / D H-@-D@@4@@p h@//////l@ //O-4M@PqPpS@qPi qԡԱ!1aސ  0`Q*@T At @ T@(!(0 @PQ  0S0 0@ 0R:96,($   (4/4Ѝ$$ $0 0hdIII(K:KaKJYJ`///O-M`{@Pp`Q T U v p`PUP %P T4 0ppxZP l($8LX8HXd*XS 0H Q 0H Q: P Q 0A0@ Q: 0{wytio0m i@ea`plQP0 00p`Q M I E/BX ` y  m p`w I ǟ Q`c   p'  | `t  h 0`Ɵ 0x`QR `<JpP p@ W pW  K 0`k8Ɵ Y  M `V <@pp9p00?o#0Q -0CpEDppʀ%5V 0 @z0`&  @z0` @z`0000rRQ P P- PWp  * &2&b @S0 p9p . 10a@S `9 0Q00 p Z:p0   0! J0  Gc z `: p 00apG R  p 0 p ps 0  Y+ I 0 00P` T4`FVZ ` T04 T4 00Z` T*``` RP T04 BR  BR T04 BR 0W T 4 4pWp P T4@Pʃ ~@| z`tp``v0 TKppxx x0 0UH\\ \0 0v@^TPЍ@ >>>h>>lc1tCC db@Al A-@P PX P`ppGX`WڼP 4/P 0 0:==> K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P ZP pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0scQJ`PUXdUd XP  >P $QЍۍ| O-MMTa@ PU`p Q RЍۍ̣ ' 2 ' 2- qpqpQ'`0HX'  0cPJ`PUcc   0 `oP`` ``d 0 O-MM⤏`Pxt  T PP Pd `a || Xp0y  0 U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG (̌P? p. J./̌P2JP P  Q%Q Q QQ  QX ̌P  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  dp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A b`FU  ZTJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;P4 X0Ç\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0UP ]P[``s I0 / i\ 0pP,PHX`a8P 0`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|w,P PuJh&0[,P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 hX0Y t Le! R-p`  ,PJ`  X0X P 0oO+@P ~ FPD``儍h G0 dd- q2`\T\`'LF"P ``8 G0 - .` XE \L($!  X0L P`` G0 PP, ` \hYJ \\PP  P t$P``刋h vG0 hh+ `\h x " XPh 0, 0Y  8 \LhP% hZPP4  `  XP 00ZY P^  `P \`L  L v\L X0 L\`P 4PY @P8PcxtX$HTPPP@R9\ p $|X66PPgP5J. |J| *,PJPP PPP P(@ MP z PJ o  +Pu> `*WpPQT@pt}_J^ : X2d  *PPp@DhP`q *PmPA h@_ Y`@ ` 0  @X0hPq R:q )PPA  ,T hI q  R,#J)PڴA Xh1 `a   XP0h0Y  $Pp` E0 xx$ DUPp  $@\`p`!! QX0 |`a  p X0 R ` "\ R   y qW )P6t xl0p00 07/PU qPEP P _ $@SP $Pp` dE0 # ݃p B RP笂h`3$Pp` EE0 PP" +@Pd ` wPup` ,E0 ! ृfp$b$_  0 3Sl`QP X ($D@Y$@|htQP=H  RH Z \$@PLP *<'P#p$ <@U @=P`` DXX 0  C`< &Qߍۍ`C#y#t"!m xu H#`$#q o x&&v Pt 'o G#@s &$$n o z ,/V/x $-N-| 0P-x z .-V.z .} 1| 0,y o-w w x dx ,,x | V1P,r y %tq G-8MMp`P4@, X0  ;3 P 3+L3 /CDPH30 ⹂z@4P8Ѝۍۜ\l j l / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ (P P(p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp  N T 0A  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 , &\ P$Ѝۍ˛PȐ А 0!(/<  | 6 0t#x s0/?r s0wpp庀PPP`2`h Q g Pg hg f [O-4MMp0`` [ R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^ʗ=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ ZP0P4ЍۍpPPP Z Z<P0$ R f tb GO-MMLP  X cU  V2  " `@@ lVA@lF5 p@@@82P PpBA<̟<`8 … `,(@ Xd d  PQ `` H\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 }P `v+0>P , \8H` @0($$+0>P #P;P  P&  PO  Px  P  P P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  MP ;Y yPJ@Y@uP( 0@ P h0 ,P  Y;Y yQJ@ @NP @ ᠥ 08Px  1P,qH l0 P0hP P v @H54  01 @ <0+PI X PA /F_P& 4 y PA F _ P `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (0< R(P2(P<P(P%(0P x|8ddl  P |ᄨ@|^"p 0rapφA}"xX"|3x#%5v 0UUUPg" P`P v;Pv.P E4P1 `pHpPP a .PpRW :P@.iPPV*GWp {DQ PH@PrzQm P   &Qߍۍ;arpaip6.intZ   (!/ P O S Ԛ4R P0S Q sjK-䁙PJV  `Q vP@PU*p A AX xp C!Tx3 |p / Z4P T40H-MA I!4PTPPy!Ѝ04p@-pM|``lQ /!`@@U@ P l QpЍpK ̡G-`PJ pQ v_@@T*p X" r3P@ 0@ PQP# R!R 0sP@ 0s 0@P O- M`@ܡ X iyP  ,t,Pp  P P  rPr   lPu  eP  ^P  WP  PP  IP x BP ` ;P H 4P 0 -P{  &Pw  Ps  P  P P P  P0?Pd6Pj xfdd` x[ PQ xMId xH:    Z& P ?P? ! TCZ P ?P? ! @C(PP P P  Ѝ0ru'xG`1JV$KA-M\aP`@l3h##<10 "=p Q9xq, sW qx|0x#T0%0P00L0H\X`H 0xp 0 xP T T000Ѝ?T  pppЍ8,H-@PJPQ vO`p`V*p q Q/ Q/K- \R 0pP P U0pUa@V@@TÁV C `@ `@ `@ `@-0@@P @9CxTA  @-@P @92x @-@@P @ @-@P /T O-QMP@P pW xP P`+P  , P$(`#X:zP(`U#Xt* P P<Px rtP PP `htP PX $ P$8  P U:$`  E Z #P P ` V:   F ZHPQx* Ru ,(`PE$ P$#X:H @@ @_:X`   0W G:1pGWB:`GPpR;F `FQpPXx V(: 2PP FP f`Y:  IPP 0Qߍ( 0 @Qߍ @|0@@ @0 0|(( (0 0 p@-M`@P. P   vP ` ;P PᓣЍp Ѝpሣ Ѝp 0 0d;0 O-M||x|| p@T ,X@@0(@|Ta TudDPdpHHHHD$D885T pU U X`VDQL PQ Q4' !R6 (Pn PPm pAhV@F5 T&2 /oAo"VT`F`A@DfHy V*P U*'D<P0XpE  XPE& 0W785,%!~%Q t dTH@8P DR(T섟pʲt@Pp$o0S !<34010StpaVqtq X(:`P 'Pq Qူ1Ȱ@ a-P PH@A ,P ! B гR @@s娃pQ  ',Qq  Rၰ1P/ 'Pq.*Qpp1%Ȱ ,Pz DAPa`,Pq ! B @@r@Q p@@`^p ,PS @ E@ Q0,PI ! Bp  ddqd pXA@P8P,P@-ЍP 'PqnjQ`1`Qp(P @@N,P A` PpPp$ЍЍ\{4#$TXPHL~8 @t؏̏ȋ(8 (7 k|d4܍ȍxL@`~̋ЋtH-MPPL \TaT`@ P@DQ 0pP% pP P ppP pW:PUpЍ  !  0t5Ѝdd d  0 0:E1 D0 4    O-M Q = R  LP @ P XQ , P  , 0||p0t|p0d, PPPP|P p 8\P0  (  :R 0`B6V  `0`P``R ` ;R`ۧ0r0vP@v0@PK@ `|; D0 h+Q ` H+ @@k` 8Q (Q + 0 S ;000Q @P) ˟ ;0[P,P *   ,j`VhVPhZP(P 0  0 R0,P  `P`FP  EPPP3 R@ y*P) F` ` P  UZ#P$ `@ p P ) @U@pH P t p @T@,XT) `  890q@$ T@+ rPv P  80q@T@ Zhr`PH@|8 T0pXP@V  @, H@@8 04XP,H@ `V@ )  P  D 0য়  R`P @P"PP @4P\@DDLT`hpxhR RT& @UP@y* @ R P` 0AS006P |PQ `;Q`ۧq@vPv0T @ 5  R00/䤟  R& 0`AS006V ``P``Q `;Q`ۧ0q0vP@v0@PP A6P 0Q p 0 P :RSEC@\$  L4P0<^ ( `V ``B6P @R P ;RPۧr0u@u`S PsPm,2 0$ Z><AЍ753FP) @P P p匁 p`V *PDЍЍ @BЍP2 Ѝ\d렆pTD0 8$/ ԅ؅ȅ}6f܀pTls,}T p<(d z# P$ # 8zz{{(s̃ȃt}}}|}L}<}x||w{D|@|dԂddȁyxHhy܀w|p0tx0$8w~~~~~||t{{`w@~0~ynZ0H-P @@ D R08P'P  !      P0#@P000 0 00$wvwvwhwDwPw!A-0`#PD @ `#P= P`P[p`P,PQ!0` P0P``0P0P  P( `P$p(,v$vvuvuuuuM/O-MP稱q娡娑威 p P AT `Mx@hdA`T  , PQ!0 00 @P(P P$ |x  `1P0PP0ЍuuuutttXtPt!P `U  @mPKH/᤼ /l/ l/(l/l/T /k/k/k/kH-@@T ppQU `aP r&pp@@l&ai&@||0|p|`|P@t l 0p`P@@@@@@@k|kLk@kkh jkjjjjjx$H-M,, ,0 0 2.Ѝ hj@-@P `@C 0 05v*K-Mp@P 0`pW$ `Pn*H P0 0-`P域P5 `P  P O  -0㉟P P` Y D  0p P)  @cP P  PRx|\ xPG \ @P!   ! @V78&  ! A@00@ 0 @P   R @ W ! !2/p s@Y k`@Ѝ  P  (l ` L    0H-@Q PaP!0I0K-M@PQ `I`EPp$444hH4\pW"`K($p (?! !`2/p9 rP W! # `P- W+G MP P( ( 0$p`!@` !2/`P$pP`ЍA-M@`pQ PPW `ЍpW W !` !2/`PG P p 0`!@ O- M@!R*"P4 r  W W( Qbp `V pV "{PP 0PpU W 53 3 5 ЍO- M@ZF*ȁQϖpobw W U Ql>"P' H\ap嵖pobw PE WVH P   0 PV Z Ѝ Ѝ   ЍO- M!R*"P/ b R ["*V&*P !@0p@pW@@*Q0`P "  0} P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0N P ` VЍ  ЍЍH-@P`Q ppV VP PP2@ P. ` 7oP"kU'(SP $ @P ` oP"KU $@$ P G-P`p p:  @Vp.*P  `FP01P `@V&*@`V'*F   @R 0 A @Ahh h0 0;PP P0 0b288 80 0)NVUp@-`@Q PPPp   PP P  @@p徕PPpPpO-,M@P`Q pp U,ЍO P Q !P2/p  0=P ,Ѝ!$ #p($  07/P0    Pp  07/P p  07/P   Pp 07/P p$  0 p 0ᘔP P H-MP@S  `Qp P9 q `V P! @ #sr_ 0Q Ѝ1QP ЍЍO-M`, -PH p  pP5 =@@T%*  @q000r@0qPU P @TQ@ q0[1 [ [ 0b 0R[P@qW KPp FЍ`[` 2! P W!000 >qWyǙ͙G-pPP G,`R  QE@AYt  @ttQڰ 0@? T*8 00EB8  00B00B Qʲ`0V0B0 0 02ꖹ͹ӹO-dMP 0p $[@Pu ` 0Pm @`   RG:0p$p`lP(,Z A8 4 <4 <Pⴰ Y.*PDZ{ H0@ <XP, 0A HPp`vcZ(0 A,```pP,(00(0,PB,`q PvU@F`dЍP  u0@  000( AQ-y RD ,p尐 F @Pr0@wT G0@p  0NP P P,Q PP0( D01@PH RD0S LP| (  0P!Q#*$pyQ:n00 R pqTrPAw @@0 `P\X@圗$PP:Q$0(PD P\ T W(P!Q: Q0 lP, P\T ? P \T 9(P\T 4 Py0S* Q*xx x0S 0R@@@Q 0,, ,0 0"#*γ۴A-p@ P`RPEu8 pPuRPEu, p`pPuWEPll l0 0l PP P0 0r~ 44 40 0ztƲlO-MpPP$ Q *QPN  R Q  ꀠQ @ `Q< P 0PP/ pQ: Q pPf PQ: 0  RA  0PQ< V7pH | R>@p憽 qRAAp{ 0@ 0 @T9sFᴠ 8 Q8 (4@XpP ЍOЍ |0 07 XX X0 0 88 80 00ꢯrİVFO-M4PP34 $ 0`2S D @  A2s2U$ @Z @H XZ允` PY 8P` P P @-P 0, `PP@`P Y  0!Y $0?=2Qa0s `Qڻ` p`R pR  ?=2 q@"! $p @h# P$ TDp aP T R @C P+0<R !0D0 C P \ W=1 [`0/-"1p@@ ` 0tP ` pᰠ  PᲐYH 㱀I`@ Ѝ kP) `K @, %,D  1X8aZ  D B`` `(( (0 0Cک7>G-MP p|Ppx@(Q `P`@P n`S <V Ⳛ@< Y ᦚ@ / 0aa03! Q`S!Q  `*`p9 P P O1,P `P& ` V" P!$!8!| 0p@`P  +Q  PQ"4 0@Ѝ `PHH 5 $$ # 00 pJǧƧbߧO-MM8R`@PLp P@{śpm P, 88P嶢U Q QP   P"4"x"\ 0pP  PQ/ @QPY <Z p ؙ@< pW ˙@  / 0aq03! QpS!Q  p*qQ O QЍ؍|<lG-` P  JpAP  A  !㴌8qK-MPQ ,@$ p@P $p7`A8PP$ P 0,oPP /-"1pЍK贚 0V 0O-M`@v yڰ@p@W*Vs w V p@wqpPpwA@ATE*p@ P `V)@ಠZ  Q R@pP p@w濹Dp PP B  App@W * V"2y 0 "2 0Pp@W*Y^ w@Y ` @ Y @ t Pp@wjqpPpwAAX!* Zpᲀ  /PP& Pp@W *tPYHH!H1 0,,!,1 0ЍЍp 0 0b`|| |0 0e`` `0 0kvVtXX X0 0kr|T,eB|Tf9ΞK-@P`pPV% W Q! Qp  RpQ R  P0 `U Gp Q: P00 ,P  BABX*q PV㲀 UU 8@8(( (0 0 `O-Mp (R B@pP U `" `ተP ЮP$ 0㒗P p 0 P<@@`FpP UV ᮮP ЍЍЍp@- @P0P`a P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0P4`PbQ 0P%PV 张`Ა# 0S 0p[0G ) R-$p q(9 ᲀ᱐R 0㼠P/  Hp 0,pp% P pQ 0pۖP  (P$p q$pЍO-M`p @ Q P@Q'PP@P GP> [+ (P  P0㛖P . P$ $ 0PᇖP   0PP@P P  %- Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P  @P. 0  0P% 0P#@P 0 0P P  @@ ЍO-M@P 0 `p  @<刏p P0pP  RQ 0S R Q Q  0ȕPTpPOY 0@00``VI0s0 `08v@ 0NY` @*@岐P:฀ ᴐ@?R4*pᴐᲠ`P pḀ<`QpЍ 0f 0 0 0hh h0} 0vHH H0 0kꀔ  \,>A-MP`pQ @@!P VY,\\,\\\/H!R*PD 赵0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍBP " @@W 0"P ! 9G 0P Ѝ V Vp$p   0IЍO-$M\BP@p wQ Ჴp  p  U U  P 3 o`PW @pU Up `L P  pJ   PA w`Q*  0pH A`P@.`)p@W2*pV*@ Ӵ1 C 0q @ô "   վ`h@@ P$Ѝ#v  Ǿ$$ $0 0b`݌/k5kH-4QPx `LH-<Q $Pw hw H-tQ\P PP  R 4  sH0w ،/O-MMll10 RIN``P[ 0 @0 gp, `Z):ԐĀ`p @0ppRT@``![*tP P XL P <00PЍۍau뫪Ц0--A-0S  ppp2  P@`p@`p@ R *PU U<,0@-M @O#A#'#Ѝ@-MlP ЍXX@  @ 0 p P Ѝ/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/)2*/=/*/,*/)*/"&*/#*/ */*/*/////^*/*/ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/|a */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@@*/*/*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20250718191113Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %s%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.15 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.15 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.15 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.15 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.15 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.15 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.15 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.15xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist