08Pg'&<  'g[P''`'(. (.g'&P@@<@T 08Pg'&<  'g[P''`'(. (.g'&P@@<@TU g`'(.yAgggQ$f gggRAgggFAgggGAgggAgggAgggAgggAgggAgggmK%gggX`hpx$@ggg (08@S$\gggHPX`hpxP$tgggCQ$ggg (DJAgggCgggAgggAgggmwggg08@HPX`hpx[$ggg$ggg$>ggg$ggg$sggg$gggAgggm ggg$ggg $gggAgggAgggAgggAggg$h`ggg (0$ggg$ggg$ggg$ggg$ggg$ggg$gggAgggAgggAgggAgggAgggAggg0}I^[;ܲO} cs=;0 /=_k 7h5)@' uv>%@Ab1s1= w!UN=WDv4)j#դ 7a14|c*u=8lHO\MPGx(. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4%4 (ZZ@"@"kk5$e2e2x TTT,,5$e2e2Ptd(QtdNetBSDpmAPaXU|SR ffffUSWVP[-t$$u,jPjjjpj0F4 $u& Q/tu4u;s9rD$t PY PJ ;s9rP $06v P;USWVP[Ê-A A  1frw  :tff1$ 9sσtu+A$څ,$tntiG4(11~ttu9sA<*t<ul^_[]XUSWV[K-d;s'~*u.UE9r^_[]SWV[- ;0s09r^_[f$SWö-5u1ƃ5,tЃt$l_[SWf-4uYƃ4t|$<$;l`t0?t<$l tЃ_[WVD$0tP>tKj/Vt@Ƹ@"]&PV t&uVhL@"h4@"hL63[ ^_`SWVhL@"hW@"hL635  1۸@"]&P耤CPrFhL63j whD%hL63  uhL63j gjD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5=3 u$1^_[VhB"VhC"f 5=3hHC"j<wVh(C"jUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S`&tutD$D$$D$% D$t$@N D$l$3<>3D"1G|$1NEEF<ҋ|$8s#|$u,CVQSc ED$Єuf>h>3h{$(D$ @l$0tD$Ph b$j D$  |$\$4t$,s$L$)L >QPh&E" D$  L$s()@L$L bQPhGE"L$ D$  s D t 4`&hjE"iL$ D dtPhxE"OD$(@9XU^\$D$T$T$9tt$N9BD$4`&5=3hD" 1h^_[]t$|hXD"%WS$hD"hD"jEUԼ5=3hD"jZt$|hC"5=3hC"3$hsD"jhc 5=3 u15=3hE"jSWVPD$Hw#t$>`&W/t ub`&$hB"W t N1AQhc5=31 u 1^_[5=3hE"joUSWVP|$t$7+(hB"WVl fu <=3u /3)u =3uhB"@B"t =3hjQ[ =3u 5=3hB"Ihu3$(`&SUt uUhB"jahB"j腈$NPVS`& PVVL63PhE"V VjjhE"賲`&`&hF"hL63 uj5=3[WVοV8`&=tuVhUC"j複<`&^_VPΉj PQ x $9u^VhoC"jkWVοV`&tuVhC"j=t`&^_USWV\$$1>3 >3H?3 D?3sVj=P}x<$h)jjha&U >3H F H >3VP3u>3t;#=t%{ >3##=uthF"| >3tttut!tcu>3ȥ d?3^_[] >3Vh4F"W WhtF"4$haF"4$hF"j赅hF"hF"D$L$011PjPjt$hH$\t>3>3H?3D?31PjPjt$hRG",tt?3p?3hiG"j11hjPPt$h~G"sl?3h?3 tj1PjPPt$hG"s,2tZj>3u$1PjPjt$hG"sH?3D?3ËD$P?3hG"j臄1hjPPt$hG"Ns\?3X?3hG"jS>3u$1PjPjt$hG"s>3>3ËD$>3hG"j1hjPPt$hH"r>3>31hjPPt$hH"r>3>3fSWVx?3t/ @?38F u0?3>34?3 8?3 >3>3;>3 >3r*jZ>30?3>3 >3 8?34?3^_[á8?3 4?3 t >3>3hb&h{$jhb&h{$jhb&h{$jՂhb&h{$jĂUSWVt$|$6!OA#SjSVW u=/3PMP?3u,P?3J$T?3`?3(b&Ah)H"jE`?3(b&1QQPAU T?3y 5P?3,?3 ,?3 =,2rL?3uhH"롡>3u#>3>3 I">3(b&1>3H>3(b& hQPT >3yJ1>3H >3 hP5>3Q >3 >3y 5>3>3>3>3utS1V D?3t?3p?39H?3r_ ,?3t= p?3 >3E >3t# ,?3) D?3I >3" ,?3ujl>3 0?3>3X?3 \?3t >3 >3t >3h`u;5>3 >3=>3 >35>3VP5>3W >31Vh ?3hjhj5>35>35>3>3hX?-,2e=>3l?3 h?3 t>3>3>3>39ss$0?3 D?3tQj QjP# `?35D?350?35T?3P$ xd5H?3-D?31‰1 3>34?3 8?3>3 P?3xPh{$u+L?3u6`?3j5H?35D?35T?3P  t5P?3h{$u>3 H?3D?3 @?334?3 8?3>3C>3s @?334?3 8?3>3u@s)t?3 ?3H 0?3PQQI 3 >3j18?34?31@?33>3 >3t;>39щ5>3s))Rj5>3 >3 >3>3 >3 u\5>3=>3 tJ5>3j5>3] >3 >3>3 >3>3ʉ>3)Ɖ=>35>3 t jY=>3u>3jPu 8u*>35>3Pt^_h>#j.|hI"USWV>3|$,t>3>3(p‰D$l$|$,u >3 xT$ >3>3 t!>3jQP5>3R !ƒ~t$VSh>3 $~ D$ `18D$ Z >3>3 ʋ-?3?3t>5>35>3QPq?3?3>3>31>3>3T$<$t$ ?3-?3l$13L$ >3>3D$11 >3t,>3u#>35>3hwH"T$>3L$ AD$)ʋ$tЃ|1@|p9@|5>3>3*>31 >3T$1 uK>3>3I$T$ >3>3)ѣ>3 >35>3->39>3>3$ t >3)PQ5>3v >31>3>3 >3>3 t(>3>35>35>3QPVRL tjhu%jJ$^_[]5>3hH"5>3hAH"5>3heH"jx5>3h{$jxUSWVt$(|$,\$$Uh>3jJ C4WVs(P( 8jUjrJ 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hH"j`xV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒuK8u F ́Ĵ^v$h{$jwVPm9v V葙VPQ賞 t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV>3 >3t/jh"#jG >3 >3tjh"#jG 1t$PV0FȺMb׋ (?3-։+ ?3D$H $?3iى tL$ 1FD$|$ 5>35>35>35>35>35>35>35>3hI"jdWl,W蓅PWjF ?3?3 t?ƒ ʺix%tt#RQPh@I"jd|$4WWCPWjF ?3?3 t?ƒ ʺix%tt#RQPhYI"jd|$4WWPWj7F t$ ?3?3 t?ƒ ʺix%tt#RQPhlI"jd|$4WxW蟄PWjE ?3D$=?3jPt$ t$V3ÉiL$it$V)QPjRPVSt$WhI"jdt$@V$VPVj]E e^_[]EVt$;V]FjfUSWVL?35X?3=D?311C`?3W5,?35T?3P$ Mtg>3u5P?3h{$ej`?3W5,?35T?3P$ ݅~L?3t )u=D?3N{T,2rOH,2d5X?3 D?3=`?3 \?35H?3jVP5T?3W !ƒt^_[]hI"jr5P?3h{$jrWV>3uD5>3 >3=>3 >35>3jVP5>3W !ƒuuJ>3 >3ti11>35>35>35>3P$ ~J;5>3>3r,f >3H >3Phm5>3Q xw^_xof@ >3Phm5>3Q tD;5>3>3s5>35>3h>3 3>33 >3 t5>3h{$jSqfUSWVX $p $l 7hOA#jFhI"WS3| H-$Tb&?3?3?3@?3?3?3?3?3?3?3?3u?3i?3?3S?3G?3;?3?3?3?3|?3?3?3=?3-<E=?3u =M=?3ui $Xm0讨Phi#hL63 h_N"'D0腨Phi#hL63z hIN"N^_[0PPhi#hL63E h&hN lA3uáA3u tjwGjFUSWVj9Ƌ|$11K< @u=?3t?jj5@3$ 5@3~?3?3?35@3UjWA A)߉n?3 ?3N F5B3q0B3B3-?3F ?3辴0Phi#hL63 h&MrhuN"]1H?3?3|0车Phi#hL63 hN"'S0蔦Phi#hL63 hIN"LV(1^_[]Vt$5B3q0FB3B3^WVL$ lA35@39})=B379}>?3829~vRO9G9~-82?3~Z?3΋Nu#82)Ou9~82RN982 @3u A3uu82^_É1jDjDVT$?3t=?31?36?3t@9uхt?3uh %hK1^SWV1PA3B3j?tmh"pN"tWQkt|8/uWhN"WhN"h@3 @3tLPIt$hN"Pd@31ۅu@W.5@3h{$QN"jQN"PJVl^_[V@3tAPWxG@3@3t!P5@3辌@31?3?3?3;5@3莱0ϣPVh]S&hL63hN"I^Vt$@3t3P踦@3t!P5@3-@3VEjhC3h53dk "x ?3?3?31 @3@=ujuSVL$D$ T$t$ A3 @35 A3 @3~A2 @3BI^[fV1A3A3A3A3P;PPKuK(A3Fu^SWV5A395A3t$A3Vjjh(A3eut=,A3(A3(A3jjPPqFthGO"h{$[H A300A3@uA3=A3VqtVPsG~*hvO"5/A3r0hRO"h{$G1N1NyhO"h{$G5A3~A3H A3(A31H^_[Ë A3u!T$7A3A31A3xD$QA3(A31HSVփuU A300A3@u(A3jjPP-EthGO"h{$G(A3 ,A3 A3A3aˍ(A3)Qh A3PQ /A3 A300A3@u(A3jjPPDthGO"h{$FVjjh(A3^[Vt$ A3uA3A31A3x 1H^USWVhO"8Ɗtx<0uFD uh$O"h{$$EGuȿ|w WjP 1T L ш @u0A3hjV莨 Ps11Fth lA3uA3utj8O"j&7WV B3 B3 B3B3 B3;t,uQB39;uB3빋 B3| B3B3t9tB31Ƀ USWVP<=3B3DJ@t t@B3@DJ@t uHH B3~Ã=w$c&=B3!hQ"  !=B3" B3A1Qptntl  Ӊ B3A˃=B3FP”^ U B3@߈\$ ̀1ۈL$QuH B3H1KDB@,AǡB3 B3  Pj  5B3j$1  ˣB3@̃=B3t=xA3y=B36DB@jLǡB3@1Hptntl   ˣB3@̃=B3DB@8!hQ"=B31Hptntl  ˣB3@̋ B31PptntlN  ӣB3@̡B3HQPN"B3@1Hptntl%  ˣB3@̍H B3 B3 p1Pptntl   ӣB3@̡B3PPv B3A1Qptntl  Љ B3AˡB3PPH-B3B3=B3=B3 9=B3 -B3B39 9w hQ" B3PP B3A1Qptntl  Љ B3AˡB3PPl@ B3A1Qptntl  Љ B3ADB@;heQ" 1ЍrЃ sOj hB35B3b) B3wˈ8"%B3 B3:o t!gc ptrP  A B3< b=B3Ho1B3PP9 B3-B3 =B3=B3 9=B3B3-B3B3@1Hptntl  ˣB3@̃=B3F1Hptntl  ˣB3@̃=B3hRQ" 1@B3 B3AQP2 B3<j hB35B3|' @28"h'Q"N@2 B3x w =B3B3tB30h%n B3x A =B3u;.5B3O1@B3 B3AQP@ B3jPP>B3x  1q1ۃ=xA3Ƀ=B3 ˃h % B3x  =B3u-5B35B3 5B3g B3x ? =B3uL-5B35B3: B3@;B3?7B3-B3x =B3u , B3IQ TB3x =B3u,B3 B39QPnB3x QVP B3y F( B3y 1 B3y P5B35B3g B3A1Qptnt lu  Љ B3Aω B3y  B3B3=@29|PRQ 1=B3u B3B3 ǡB3@1Hptntl  ˣB3@̉B3z !B3SPhAB3x  1@+hA3hA3uF%B3x <u<2=B3t1B3B3x =C3hC3hi#hL63 B3x }*x1Hptntlu  ˣB3@УB3x 'dA3G1B3B3B3@Hptnt lu  ˣB3УB3x =A3A3u#|$Wt9"5B35B3QP';B3B3B3x ==B3uJ)=A3A3u5B3Q5;B3)B3hQ"hQ"h'Q"B3h %B31< *5 B3y qtB3@PB3@P =xA3h%+B3x )5B3j 6'(Y$i*tEEp $A8GMi B391B3)@أB3=B3t W6UB31 lA3u A3u u^_[]jjSWV=A3uj貽L$ɸ!A3B3Pjh9"hOR"Hy|h#,tkPl'=Yà P)9tGWP跂|3/tf/V1'ed.hDhup5B3jh9"Vj=A3ujL$ɸ!A3jhB3USWVPl$5B3'Ƌ=B3B3-B39ʼn) u)E1u1$lA3E@lA3V}tzP蘹t_B3PPj DžtOB3lA3HlA3u A3u[uE6MB3@Pi1,$l& lA3u A3ut j1^_[]jUSWV$pA3 |A3th R"ckjP~B3L$F$ C39} C3VlA3C39|BVPA5 C3C3 lA3u A3! B3 u1C1E҃!%=A3hA3P$Ɖ$ C39VlA39V5C3%A5 C3C3 lA3" A37 09L$]9lA39|WP@= C3C3 lA3]9~[lA39V5C3c@/5 C3C3 lA3u A3yt vC3 B3 (E B3QB39\u=QB3I ( C3G (E,$s B3L$A B3 B3y C3)9~_lA39VP}?I5 C3C3 lA3u A3 C3C3| B3A(EAB3C39r B3L$A B37 A33/ B3QB3 ( B3݀ (5C39}B3RlA3B39|KVP>t]5C3B3 lA3u A3S5C3PB B3C3D$1!Ph0ZPhi#hL63 h& lA3 A3u!u#^_[]hQ"qhO"gj'jVj2tL$Qq p PIH1h0VZPhi#hL63K h&n1^VC3t.L$19 C3u C3HC3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hC3賃XWV B3 td< uhO"1 QB3I t;8t7P1ǡD3t?=B3u6PSD395D3hVR"R5D3j?1D3tVB35tA3WP[ D3t.h'hC3QP,*5D3sAD33/Vf0XPhi#hL63茆 h&^_USWV=B3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-D39}=D3MlA3D39|KUP;tYlj-D3D3 lA3uA3uyS5B3WO? 5B3=B3tsj jSWme4e0uWPhi#hL63j h&1 lA3u*A3u(tjhD$hjR"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17uB3 uD3E#tB3 uE1^_[]8uPB3HЉʀπwRcj hB35B3? 1wc8"uh'Q"1gu@B3ErUSWVB3H B3H%u,8Xu'B3D3hQ"t18u=D39 D3L1}5D39~[lA39V5D3F8#5D3D3 lA3u A3\t YD3 B3QB3 u (\t u^B38uTB3H B3 D31< u0=B3u't B3| t %53ىB38lA3D39|NWPW7t8=D3D3 lA3u A3uuuw5D30D3M1Ia0SPhi#hL63ہ h&1 lA3u A3uu^_[]HB3,j'jUSWVPL$B3B319B3}%B3ȃ EhR"Kl$ B3PUVPt$$KǸ1$B3PPD3lA31S̪áB3tP芬EPPjM Ņtl9u lA3l$ uA3ue$B3B3+B39}yFB3@B3P%Ut$ Pt$$hDž+9 lA3u1A3uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=B3tj jvS肮vލD$jPjSuxt1t$ED$$D$1E $A9T$ 4D39Ɖ $T$~clA3t$ 9V5D3%4\5D3D3 lA3t$ T$uA3=B3tjj RS藭T$=D3RSWC8 4$D$D$ D3 $9~bt$ lA3$9V5D3r35D3D3 lA3t$ uA3=B3tjj t$(S=D3t$SW7 Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuv&D$)D$D39~VlA3 D39SQg2D3D3 lA3uA3|$~#D$$ D$ ud$thR"$=B3\$tjj SV賫D3SVPb6 D3f |$%C=D3D3 lA3T$uA3ml9}C D31F9u,$y^=D39}D3_lA39|W5D3/=D3D3 lA3tT$ A3T$M 0E+D3;D35D39}D3JlA3D39|KVP/t)5D3D3 lA3u A3u^u`IsY0KPhi#hL63y h& lA3u A3uu؃^_[]jjfWVD3 D39|ld D3j QhD3m tJP(KPhi#hL63y h&@5D331D3D3kD3L$t$T$ =D3@Q葤 D3D3RDVuD35D3@LF5D3D3^_SWVD3D3r9 D3@<u|L19tWW29uD3B3H2B3L2^_[USWV=H2=L2=D3t B3B3$B3D$j荣lA3D3 D3ÍS4R4nr@44v\1L1 [ D3\1l1sRt6,lmL)1 D3t)|?wt)LI1 D3t~l)}L1 D3,u44vL1Y D3l1}w4R4Ӆ HA9~RD34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=B3t׫H2B3$H2L2B3D$L21 lA3u) A3u&tj\hR"$^_[]jlUSWVL\$d3hR"=R"tNjt$`hR"SV  fttu=<߃u /3r|$L$ D$1f&FS"D$P ƋO9rPSt$  tu;_Յuͅu t$hR"-|$dD$ Du$$1Fl$?uSt$ hR"jL$j QP $;Fl$|1ƋD$8u&1zPUy!Uh{$jD$ thR"jNjC=m@!sHQPW xs{QPWf x4$Uh S"q =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W y?60Ph"S"ӍL$fqQhmW 3Uhe#D$ukD$Phx"hS"p T$ͳ"hjT"T$S"hT"53H 53~53H 53 PhS"kh53j Mvt$8t$8t$8t$8t$4hS"]t53H 53>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hT" thT"PAuD3hT" thT"PAu hT"y~jhT"hT"2 Pu hT"j0D$ u h U"jt$,)݉\$D$$D$11D$$hU"SU c7~+Hr߃8tlH w&$h&<$뼃4t6맃dtket/1@D$=<umWt$@Xh U"5<KD$71@D$$+L$ /3 /3T$uA/3$T$uȋ$D$,jj@R l$L$ $tL$ $L$,1ۋD$PCEu S6)St$PʼnD$$ U<l$$T$DtIL$ىL$$U$E L$)QPRq 4$EuED$ush U"h$Ku]hJU"bh$U"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$VhD3t$ t$,QPR3t$ x'yja=D3y heU"|$$tQt$(jVjhS6y h|U"jVjh5D3^6y hU"h U"Jǽt$(1CUVSwD$P6UVSw5D3 6t$,1L$XAAA @D$HPQS =D3u'l$hD$h7jUh&^J ul$u)Džy h~#1O~fVS5D3d3 VSt$VU3 |$h5D3Yl$0fE<u1Ju@hWj  uJ8J18tƉjjU tD$68ZtlJ8tEVSt$W x )bBJ8#Thzb%|$l$8fE=D3ul$0fE9EjD$LPjP |$@f9fGfGD3G$jVU  tQf|$<tٺtf|$4t?D3L$0u+fD$<=D3ufD$4 bI8t$>Nf|$Dt1BuNfD$Dh|$u%j t$hU"jt$hj.^hY#yGhU"PhU"hL63*ij^PD$L$jQ5D3 XUSWVA1K8uSt<։HhU7 ~WUVj ~)u1TH1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSFƅu]jjVtqƉx jPS~ ǀ;t$8u1A8Љ4DAtt;L5rShW"j4 10hV"WV|$x$t,WDWLDWDW8Dx uW$jtw\wXT2=29}5PBt852WVhW"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W* $>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RP`L$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPh$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$PhmZ",hQZ""|$PQt$t$RhZ"j#C$t&8$\T$XT$H|$RQt$t$Vh+["jM#$L$l$8ht["hd["hhY" *USWV u|$W@1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h`W"jy"NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hvRj,PSD$HPhi& |$0hvRj,6SitND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhW"j} ^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPhW" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ E3E3E3E3(E35,E3D$D$TH Qq T$T$ t$t$QSh\"j 11KL$0t.%SPhJY"jV5tE3[StE34tE3t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h=ljP88H H;1D$8<9`E38D$D$ tD$tD$E3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPs]"PD$tD$t$t$8WSPs]"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPh]"D$8PhxE3Vt$,V'~GD$D$8D$HD$L$PD$LPhxE3VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L E3$E3tt94 S.8E3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph]""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh^"D$8PhxE3St$,V~D$@s, D$¹tt;<FG;D$ L$?-VhZ]" Qh\"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPԾ;D$DT$@D$(4t$8t$t$t$0|$(WVh\" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qh\"je1gD$4$DŽ$߬$D$D$D$@$߬$ ,i&a111CƋD$|$8D$|$H|$LjD$LPhxE3VL$HL$8t/xE3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh6^"b11ҋt$  t<=(E3,E3$T$p$1߬$$$߬$E3E3E3E3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPλ31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=pE3$t1J8D$<D$ۋL$؋xE3k,L$1T$9|L$$)щL$ Ɖ$D$HPWhf^"W $PhD$(i& yNL$ L$tL$WPhiY"j( t$05tE3>L$8]:u*t$ tD$Ph_"j ,uh_"j uh_"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PgD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP胟3D$ t(Gdt;<r61@hHt 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWҞNJ1 t1t$|$ 9|1t$$"]t$FL$|9 |$t$T$$u Bhu:4$BBRt RPE4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vha"jT$$BRt RP蝝RPVWjt$$Vha"t$$k,PeD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Pha"j D$,|$D$T|$XD$TPhi& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$E3 E3 29|[5E3tFNu E35E3t5FNHNFy F4VPVE3@E31@j@P誹U1@P蛹F ~4D$F(^$F0^,n#2^8E3 E3t q4E3^G FtH 7~ F^_[]É E3=huc"hnc"hhc"hnc"hh!c"_Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP E3HE3N^,H E3E3E3H@E3P E3 E3HE3H4IE3H89t;tprpE340E3t4F E3H^hc"hc"h4h!c"USWV}]uuu W@t E31@E31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g(i&s$i&G4$O,52w0VPww D$0^_[]USWVPt$ff(i&s$i&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j讵8p E3HtƒQ E3@ E3^_WVt$ E3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd$Fhjv< v^_USWVPT$|$:%4E3\$ E3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4U31ہ=E3| t PtU3E31t 98t@^_[]Ã^_[]`V15E35U3hVhE3 5E3^ft$ t$ ïj SWVt$frLN4F,=2~0WPvv 1(i&t\fv4V1AN4F,=2~0WPvv 1$i&1;NuN^_[h_"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR蕇׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PSÆ$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h g"hf"h hY"9USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP轂3T$3D$M u1^_[]USWV(t$FFF ]F F$|$0tfhjljPLtLXt uB\I\$$|$ C$|$4Nh$h".=<1ɺPt`tLtt l$,\$(|$0uej趧ttP莧ttPdA 芇t u_4u_4_HoL_HoLUS6jjW'hޛW>q$ 1=2lj2l$1 UPQSWVhjË}Pw S P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj:Njl$hu P P E1PUtA|$4t hg":SW1^_[]u C4CHKL1}Mt|$4t7hg"K:t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhg":$  $ V 19tQRhZg" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhd"ܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthd"qh53D$(u KHKpStURQPt$DljT$t hZh" 8u CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhd"^ U3VRh9e"G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhe"D$L$9tQP$$he"݋t$Ht$nL$tI9ȋt$ tPQ$$hf"衋1t$ \^_[]h~e"hpe"hhd"ah~e"hpe"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$af"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttp|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$f"nu0|$ r]@hD$D$D$,$D$ 蜺,[D$ p D$D$D$,$D$ n,LD4@hD$D$D$,$D$ ?,@o M|$@ t"D$D$D$$D$$f"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$af",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$DU3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWKbƋD$0T$UW/bƋD$0 u$$$UWaljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPaERPwa$GW #RPbaERPRa$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaf"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaf"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaf" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW]Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP\t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP[T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPI[|$FV D$t RP,[|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPZ t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPY|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPX$ D$TBL$?ttXLT$BtJ J T$$T$ QPXL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPWي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVqUD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv 蚽 t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hf" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hf"hg"h h g"hf"h h g"hg"h"hY"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p ;{A L$H SjQ ^_[]USWVL$T$ BU3ulF1Gj&Uhj#M,$53H 53~53H 53 h53j u q1^_[]V蓺L63PPhm"VAVjjhn"`h"@j&Ph#hL63 j&ujUSWV׉΋*h`h"U肭i&tCt[PUhjhhU3s 5U3膉Y3t2U3U3WVS5Y37^_[]UhB"jc5U3h{$jcUSWV$:$D$VuPo 9$j uPn 襺1ɉ\$QSus Ƌ8|8"u11F9Ή$<$<1ɉQSu L ËD$8Չ8"u !t$$Vhyd5Y3 tbVhi"^_[]jhi"7jh7i".uhii"$hi"hi"$p hi"hi"ja$05U3he#jaUSWV}E ph}%VFhHj"Vhf$VSD$(P5Y3苛Z#D$0= M$L$A1yyy D$Phwd5Y3Ǡ D$tG\$ D$ L$|$j ܂ljL$ NjL$IuɉNjD$ D$|$uhjTD$v1111O w+Ow?u$L$A1AAA D$Phwd5Y3ݟ  \$tmt$ NL$,D$(U3D$FD$FD$ FD$$~D$(P*PWt$,t$t$t$hj"  KuD$1D$|$Ynhxd 5Y36R5U31111VQRP5U3hj"hxd 5Y3 U3LQhj"qww ww5U3hj"Hw_G|$9w  jPQ5Y3葞!¡U3tNSVPhk"Wt$ 5Y3=1 $9t"Qh53ISVPhj"gUكT$;r ZƉ[|$?e^_[]jj'^5U3hj"lh"hqj"hNj"hL63 jQh9j"WV$u>$jvWRi s'Wh{dЀ5Y3I t^_jhk"jU]65U3he#jq]VPPhtd@5Y3 $t%t5U3hak"u$yk"uJk"5U3QSU3$$k"k"sOA#QPhk") U3$$ k"sOA#QPhk" U3$$k"sOA#QPhk" U3$$k"sOA#QPhl" U3$$sOA#VPh>l"^5U3h=k"jC\WV$u^Vhzd@5Y3辛 tH$D$PWVh}l">$PwwwwVhl"^_%5U3hll"j[USWV}D$Phd@5Y31 tzD$Phd@5Y3 u5U3hl"VRU3$|$\$ t$jVSW VRPSWt$hl"_e^_[]f5U3hl"jZSWVP|$uX|$_h@#S0ƅthh"Su+1Qhwd5Y3I t ^_[75U3he#jZUSWV|$0t$,1@</3$1ۉ؉D$hl"WVje qt\$te+$95/31|$7wWh|d5Y3蟙 D$ ;D$t-i9l$sUt$衆ƉD$l$묅hhPVzU3L$ OA#t#RQPh]m"|$ t\ư1P`VvvvvQPhnm"| G;|$ ru5U3hCm"V$t1^_[]W5U3hl"jX5U3hm"jXjeP|$u1Phd@5Y3Z U3tQhm"XD$ 0Qhe#jXSWVP|$t$^h"S訡tDh^#S薡t@h9"S脡ttT$da3 D$dD$ tTj/S{tF1;tٍT$d#3D$dD$,t>\$:t$1\$(Xq&q&hon" u1\^_[]hn"hn"z/3=Y3uj=Y3Y3Y3Y3Y3 Y3Yhxn"5<hSn"Phn"jPY3=Y3u thn"0"Y3 Y3t uh.o"t=2uhKo")ǃ|u D2j=Z3|$\G1PPL$lQPjW[t2t$dArt"1PPD$lPVjW[t52=Z3u4$P52%u#$=uZ3Y3 Y3 Y3 Y3=$z3 ɡ2=Z3t&jQP" 2u[52h:#jhh43QPu2y"ئ8h43h\"p243=Z3u'L$dQPM52h"h0}3hrdAP豎 52hɍ"Eh0}3hedA52} 52hۍ"h43hy"E$$t(hQP52h"$$ƒ l}3>s1@![Vs ) ȣd}3`}3X}3\}3? l}3 |3|3d}3(3`}3,35X}352=\}3=03?w|3|3=|3L[V|3?|3) |3>r$r$|3 (}3,}3$z3u 22]u1hQP  2u25$z3h{$D52 2jq52|Vn(z3u Vhro"8 11h,z3t1A1A1ۉL$@1h,|3|3 |3h|3=Y3u# Z3|3Z3|3Z3|3 t$\F|$LSSWSjVWt$Lm$}3n 1QQWPjVcWy5$}36~$}352j/V衍t@=Z3|3 |3ȉ Z3Z3={3u%|3=|3|sZ3]{3 {3uM Z39w>UUUU)ʹ3333!!сisZ31{3t!tt{3*|3cԋ{3 |3}31{3‰ }3}3}31 }31AhQh|3* i-|3= }3 / |3ً}3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ{3yt{3t  u }31I $L$9 |311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uhf"$D$Nj l}31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$|3-|3=|3}3D$|3t T$$T$Y3=Y3uu 2; }37=Y3lY3_h""E$}381uhՐ"$}3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQR:PSt$@t$,t$4t$~31K1Kޅ`1PPPPPP =28h"1{38LFu=Y3uRh"%tajh$"1P"WjWWWP+ha"t҉*|3u {3=Y3uY3u Y31g=Y3$}3D$tD$|D$hߑ"P{31N=t 蹵@ 1"WhVVWP+9tigfff։f5{3 }3L$ȃjP-kD$ u hn`"jw?h"1HL$ Ajh"蒴1۾{3D$.|3tB?t=kWUhQ"^ 2|3L$ DD 3$ D$tD$D$ u{3 }31|3|(.tq<(tk{PWhQ" }3|3|3t (BD$,T(2D$ TL 3$3L$ щtT$ }3T$D$,F9u߃|$~O1l$GVWh "V T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$Rp{3=ue{3$@D$ $#D$u D$ q&1$L$19;ta $Ȣ{3=Y3uY3uY3u Y3=Y3t8,|3~ ho"|3~lhp"]h"=Y3u1I8|3 |3t hg"ho"t,|3o|3e$jt1 {3{3t {3t3$ D$ {3 u= }35|3}3|31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ {3|$E9u KD |3D|3D|3DL /(}3 ,}3WQD$lPl D-Z31ۉl$(-D$D$DY3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$}3 |35 }3Z3D$t$%t$t$PWt$L|$WD$)$T$)ʼnl$H|$͉l$L9|D$LD$H|$ T$0D$$ }3L$M5|3 }3L$@ |3L$T19tt~tnD$$|$TT$@Յt Ճ9D$$D$<D$9؉|$$D$4l$NJT$4T$u T$$T$߀|$<t*T$0|$݉A9L$oF9D$$T$0|$}8D$X1D$111ҋL$ l$0ɉ$tjt$ VSPajt$ VSP Z3t'u"=Y3P91|^_[]|$ jt$ Vt$ SыT$4rP.|3tG׋2|39T$$D$D$9ÉՄu|$|$t|$׉uV16|39T$$ڋ|$}؋l$<$0jt$ Vt$ SL$ te|$ t$( D$|$Pt"}35|3Z31ڋ$1 ˡ|3D$ D$1|$D $ D$ ؋|$0u1L$A AAL$ =u!D$81ɉƄ|$ 5"ډt$W" |3 4t$ 4ƾt$5|3tt ֋D$L$A؉)Qy |3 |3ˉ1։19|؋T$JBۍ@?! J/H-|3 |31։19|F?! t$NFVt$ tL$ fǁᵋT$,NL$ =T$,t8=Y3uh"/ t1AL$ =T$,uD$8L$XRQPU =Y3DY37hL" "|$GwG$?|3H1p"UPUUUUá|3H"$UPUUUUf$1@"U5|3UPUUF_ $O?! È_GwG$?|3H"UPUUUUá|3H"$UPUUUU$"t$ U5|3U1@PUU_ $O?! È_1EQY3D5 }36|3~ €<0u O |3O݉+l$<$ st$HT$L 9l$|$u׉|$$1P5Z3t$V|$W衣-Z311 1 t э #t$t$ 1VVPt$8D$T$t$XV|$0Wh"h͈"th53jdh~3` txO~3h~39l$0|u@T$,ƀ~3tUH~3 t9~CWSh"  VUh"h͈"h53jdS uh"Rh~3VR L$ T$t$D$$%h"h9=}3u85|3Z1}3}3 }3}3}3}3|3|3Ƈ{31E Ph{$j'Ph{$j'USWVPtDΠY3=Y3suVh́" 95 }3sh="=Y3u hG"11=Y3uVh$#辜,z3WWFuҀ=Y3u)"=}3um"= }3%Pu= }31Y31ۨuShK"M|3 :5}3|3tD:փ1VPPY3<tX=Y3|OhQ"|3 :-}3|3$t D:$1BjUt$VP Y3C; }3OXuVh"蚛1,z3P'|3 =}3|3tDփ1WP Y3u, {3uhX"4{3uhz"Mtgh\#{3=t$ 蹵@ Rhy"ޚ hf"Ϛhu%=Y3uB1{39x @uuhX"Ph"耚=Y3t{3PPh"^^_[]á2=Y3uxPh"=5|35|35035,35(3h"5,}35(}35|35|35|3h"5 }3h"ԙPh"řh",3 03525|35|3RQP5(3h"耙 hˑ"s|3 |35,}35(}3RQP5|3hh"A5Z35Z3h"( USWVPˁˀ |3 |3 |31{3{3~t=u{3t 9r u֋ }3~:|3”>u~t:t  IuY3 щ $ Y3t&=u{3օ4$u {3GY3ti z3Ȩuh"h[f% z3tj[3=u[3Ѕ$tN}3=Y3u"Ph…"蝨0h"莨Ph"t  z3 = z3uQM$$tF%tF%1 z3ti[3х $t4$P5}3hK"=Y3u5}3h"1t"1{3=u [3{3^_[]VPD$ L$ $QP3h6"Ӗ53H 53~53H 530h53oƉ t9tD53H 53~53H 53h53Aoƒ1Y^h"j USWV1=Z3˃y CS t |35|311 uY1ɉNVt11@5C Cg"tm"Ph"Y hԏ"Z1He^_[]SWVP$2;2u+Z3u"QhmdP_ y h#11h,z3<= }3u;5 z3|- Z31Puh"V= }3~e1|3111 |3}3Pt,|38C; }3|hÎ"@Sh"0$2;2u+Z3u"QhmdP^ y h#^_[USWVP։9v1ɉQPU 1O}t#Ë$8uv8"u r1^_[]USWVP։ϋl$=Y3T+|3 ,z3túOA#t$76PSRh"T$q7St$h"XD$7UPS\$ Sh$"37PUSh8"77PUShK"7PUSh\"ݒ7?PUShn"’77PUSh"蜒7PUSh"脒7?PUSh"i'1PPPUt$(SRh"@^_[]USWVˉ1u=Y3h+"T$$8$43|$͉)uhOA#Wh{"9 |$Z)uhOA#Wh" D$|${3:{3{3 {3l$M?>{3{3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$"tD$ƈ"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4hb"舉 |3|3D$HL$LVSQP[D$T$D$PVSUP[D$|$ D$@VSPW[ljӸ1=2ƉT$ L$@PVt$QRy[PSW|$LWVUl$lt$,t$,t$(t$@h0"趈,h53jdh~3袙 |hR#h~3ع~3\$ $t < uC{ - <=3DAu<-j D$$Ph~3: D$$\$ hU&S1K|$(@D$Ph"S  $ϋT$ t։t=t$hY &S}  t't$h"Sg  ct$ |$@D$1=2ы5Z3jVWRYD$ՋD$D$D$D$D$$t$t$D$$  T$Z3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$ThR#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh"聆~3Vt(n9Չػ}n9l$\$QAuƉ{3tt  $tt ^{3 |311 }3t$ - }3t$|$$|$}|3] ʀ|(tP |3t( ;L$T$|L( (9Ή} =Y3{|$(t ;|3KC }3|3"1$t=t |3 }3S߉"=Y3|$(5}35|3@1}3}3 }3}3}3}3|3Ɔ{3t$ |$(P{39}3u85|3?1}3}3 }3}3}3}3|3|31Ƀ|$(T$3\$1 5 }3n |3|+D$Nu |3[\$j5Z3|3)؋ |3P|$(t$ hhj7|3VfǀU}3L$ }3D$|3ƋD$$ȉ5}3}3 }311 }3u|3=Y3h"?"uW"ĉ"=Y31|$(9 }3u85|3=1}3}3 }3}3}3}3|3|3Ju UPQ }31|$(tD$|3D$}35}3=}3^_[]hn`"j WV|3t^ tڋt֋|҉tΡ|34 }3 QPV }3ƀ^_USWV T$L$ }3@hPh|36  }3|3~C}3|3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR+ |3;UjPf] fDŽ;UtZF , M ;M;MU;; |3 Z3T$)ʉUL$  Z31 EE=|3 |3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M }3 ^_[]h"jtWV1=Y3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5<=3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$G!1Kl$ 22uhUPzQ5(z3P ;2u[jVW52F!1Kt?D$H5(z3#$SUP 8 52V52 ;2tÉ؃ ^_[]h"jhUSWV$0$,1@D$l$D$D$ $1h4"WVp suM]j U5< á<8=L$90j]8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-/3)1<$L$jhQP4+h<3hedAPD =ƃ3A19l$| 41@fƃ3UjDž\$ t|53H 53~53H 53 h53j jh<3h53 53H 53~53H 53 h53j <$ D$ttOA#t"Ph"yD$fă3<3Wafă3gdWPVC xnu)D$PhwdVC h"h"8V1^_[]Ph;"25<hd"j4 hג"h"Lj0pYPh"hL63;{ jpUSWV\T$d3< $S=%D$9d$ՉjRPt$ VB11 Sl$UV 9 1U\$tL$j@PQ/4 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4q&hN"wT$l$ ƃ31ɺ܃31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$Ѓ3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf ƃ3ŅtMaQ4q&h "vT$ t tuf f111Ѓ3|$ ԃ3؃3T$܃3݃3fރ3l$E<$g\$ttXaQ4q&h~"v ;B Q4q&h"u <$\$t4q&hݓ"u<$l$!F1D4 =Ԅ3L$"M0%@PWt$h"j8Ԅ3{<|$\$W4$(Wh"h"S&4$u h U"jF j/Put|4$4$L(jmbUSWV\$ l$|$t$1EЄ3H<&Ԅ3؄3hӘ"WV h~n3itVnԄ3Ѓa~.btCd܄3봃otBs3띃NuS<Є331=؄3؄3mjSht&5<qtHP$EuA/3)ރu4t$$V41ut$(t^_[]h"jJPh3"hL63h j@]WVPt$jWVR 9u9t x^_Vt$h"jVt$V t@^h"V^Vt$Vt@^h$V|^WVPt$jWV 9t9u x^_Vh"jWVt$|$ VWJt$?/tWh"uVh"u^_Wh"j{fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QwD$ T$M⿪t׋E4D$T9\$E0D$Ds h "q-1VWt$ t$P:1@PPVVu4u0u1OËPhhPw&P }D@u hhh|& hhh~&Sv }D@PE,CEhc@%VB7\$thc@%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5PhS"+%t9\$t hq"+\$pD$p\$D$D$ 9\$~\$~tSh"+\$9|1} t h˚"s+hW53h"r}4xME0;E4ru0h+"(+},u,D$D E4t hN"LrD$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh"(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh"((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"L63P"` |$)Wh"L63P` D$ $L$t$}D@tCW&1@9tWh"&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$utL$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$L8Pttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Wh""hL63Y ;$uhL63jjHhW"p $$D$tD$|0Wh" $tt$SWh"hL63^YuDt$ vhC"V ~$r-D$ t$$$0h_"Vj U}D@uh"耋h"sD$ttt$$DŽ$߬$$ڌ$ 4i&|$D$ \$$}" VF T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttP^Fx HIt$41VRtRRP*t$ tPhaf"AQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$S VjW$ t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjhf"}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8q%WP1HPWW2D$PT$L<H$WP1HPWh3Vh"hѢ"&u=/3؃rKVh"h"j诼D$t t @@u|$$h:"Ћ45 3j/Vum$3Vhf"h`"hSc0$DPSu"5 3hf"hcE%hh$3+0 3$3 Ph"Ku =3hjS |$4tg$y\hh5 3Ȏ D$xD=3~1hSP&D$ F;53|1QQQPkD$ u D$y05 30/PVu he#E 1HD$j5 3<Åy'5 30PVu he# $DPS.y'5 3l0PVu he# $L%=ta= uD3u D3L$t$QRPS5 3ul5 3h&5 3hl"NDŽ$$lfsD$tjV$$#$ $L$ Z$ $ u4h"L$ u.$$lfst!$$Phc@%4h"L$|$u$=2|$Tt313ɉ\$Hu03tL;$$ s5$$ %DŽ$$lfs3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s hҡ" h">L$8J#$L= j|$W$($(5D$8T$ t$VN|$(O11VSh$Pt$XCxHW膯D$(+D$L$,L$ ʃ|*5 3hK".>1D$(+D$L$,L$QPVSD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$&D$\D$8L$\ 8i&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$X5x>WxFD$(+D$L$,L$ ʃ{1QPWV諭th}"j1F\$D1VPSh"',D$XWVPS%|$$u1Ʌ|$t1ɉAw1@|$Ph"+D$tt$5 35353t$\t$dt$<5353Q535352PWt$L@ƃ|$4tV"USWVӉ $t |$j W\$ S=8 Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h4" QPWUt$t$hd" t$t$hѢ"jvUSWVL631F/WVUh"WVjh"WVj!h"WVjh" WVSh3"WVj+h@"WVj;hl"WVj$h"}WVUhͤ"mWVjh"\WVjh"Kh."W}+WVj hI",WVShj"V3 fD$t1B9| 2I 21L3Iu顴2Pd3 2~ t1@d3@9uUSWVD$921A9|G2SƉ<$~ SjVr 2D$~Q1ɡd3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5d35d3$2^_[]V$43 83D$D$ 0i&T$ t$ 25<3t$T$L$D$\$ $b"9'$^Vt$FtN H N tNHNfr v "V 03^VD$`sH) @3D3 H3HtP4BPQ@@1ҋP3v9tT3d3rh c"jtp4F@P3^USWVD$T$#25d3tC=0311-<39| n-<39t%9P4uH$3L$X(3\$ t Fu1^_[]h_c"hXc"hh!c"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>03 H3 29|[5\3tFNu `35T3t5FNHNFy F4VPV03@031@j@PU1@PF ~4D$F(^$F0^,n#2^8d3 d3t q4d3^G FtH 7~ F^_[]É X3=huc"hnc"hhc"hnc"hh!c"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP X3HX3N^,H @3D3H3H@P3P P3 `3H`3H4Id3H89t;tprpd340d3t4F d3H^hc"hc"h4h!c"NUSWV}]uuu W@t 431@831HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$gd&s`&G4$O,52w0VPww D$0^_[]USWVPt$ffd&s`&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j"8p h3HtƒQ h3@ h3^_WVt$ l3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv vj^_`USWVPT$|$:%4p3\$ p3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4p31ہ=l3| t Ptt3h31t 98t@^_[]Ã^_[]`V15l35x3hVhp3 5h3^ft$ t$ 7j]SWVt$frLN4F,=2~0WPvv 1d&t\fv4V1AN4F,=2~0WPvv 1`&1;NuN^_[h_"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS7$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h g"hf"h hY"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP13T$3D$M u1^_[]USWV(t$F(|F}|F |F F$|$0tfhjXljPLtLXt uB\I\$$|$ C$|$4Nh$h"H<1ɺPt`tLtt l$,\$(|$0uej*ttPttPزA 芇t u_4u_4_HoL_HoLUS6jjW'hjW>q$ 1=2lj2l$1 UPQSWVhj_Ë}Pw S( P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj讱Njl$hu Pw P E1PUtA|$4t hg".FSJW21^_[]u C4CHKL1}Mt|$4t7hg"Et$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhg":$  $ Vx19tQRhZg" 1@^USWV |$,\$$t$ tCPPt Ttt4RQhd"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthd"h53hD$(u KHKpStURQPt$DljT$t hZh"Cu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRhd" |3VRh9e" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhe"D$L$9tQP$$he"t$Ht$L$tI9ȋt$ tPQ$$hf"X1t$耹\^_[]h~e"hpe"hhd"h~e"hpe"hPD$L$ $QPjĐ2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$af"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt9||$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$f"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$f"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$af",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D|3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWmƋD$0T$UWmƋD$0 u$$$UWhmljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPlERPl$GW #RPlERPl$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhaf"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhaf"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPhaf" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW{hNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPgt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPpgT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RPf|$FV D$t RPf|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP(f t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPd|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPd$ D$TBL$?ttXLT$BtJ J T$$T$ QPcL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRPbي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV`D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0hf" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hf"hg"h h g"hf"h h g"hg"h"hY"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 识A L$H SjQu ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QP51 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDƉ t,U̓Ftf^81FFH1|$<΋t$  3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPU s$K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ 3{3 3\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(3y 33Py`PD$@3 3C9݋|$4U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ 33uPt7 \$t$`tL//W|1}ottP  t1h SVPƻSWp n ^ hjS V聎^_[]h"h"hhw"3fUSWV l$4E}0I\$8u tȉFSt T$$'F V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt2/ڋLt$t$\$L$ T$D$D$$踎L$4tI(D$L$$f"#\$8u;l$L$4A(I,WhT$L$$D$ | l$u L$4A(I,T$L$$D$ | \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$ | @M A CtE4,$P:l$4E 3 tr\$<u tȉFSt T$$%F(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$ %F0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tW9ƅuWh"j?9$$<$4D$Phd@Uc tg1OVhedAUx F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh %t$81 Sh("U|g CPh9"Ui C PhE"Ui CPhW"Uh CPhk"Uh $@D$t P謩1-Uhzd@$<Ww t1 VhedAWw hjU蘋 D$ P$4d D$, 9L$cL$9u0$S11:8tx$0hϧ"y.b$11҉ $ƅ*ŰPQOj PUB ^_[]$0h"j6USWV01ۍD$,ShPSu]\1NtAljSPSWuWg uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS h^#Uat.P|$ "V(t!Uh"JUh~"1OUhѨ"l$D$QUPhX%WttPUhX%WvtiD$$Ca2=ouV5\$W&V{V$( ]hh["W@ ƃaT$W"V1u\$ىjW$( h`" V蛽T$>"V$$ h<"ͺV脁  ^_[]1ىj=ߊ< t< uGjh#W3 k2$( aj2WP? EKu$( 8~y$( 1\$ىj(Sh$PB u$PUh"۹ "j2PWJ? E2$( ;(|VR\$c"V$( @VT$J"Vg$$ h"h"GuD$ $PUh"SquUC<Shh" $( aPWh"Uhi"$( x?$( Z1ىjPySh$P@ uSUhB"y j2PW= E2$( ;h||$jt\hë"@PUWjc $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"WipL$\\L$\\ $\]u^E <&Yt8u1҄tʋ$( t?r QVR V}q}8uUh"Ih"Ph?"4USWVՉt$hR 1I t uFjh#V30 u<^Ft t u^F t tW@PWV/ tt$hU衶 u1I1ɉ^_[]WV׉RhQx t6< ~< t<#t< t >t< u6AWhVD űD$ 1GtPh{$^_V?1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىhZ"+C< t< t< uh^#SdƍD$$VhPg L$T$\$PQRSD$0PD$Ph"D$@Pm t$$$ىhB"rC< t< t< uS>=$<rLjSho"Sh"n%Sh"kh"Yt$<L$D$D$L$ oPOtXljo 1tX L@uH~vCtTjhh" Vz$^_[]Vz )UjS5 D$ D$ CD$CD$C D$C$Cl$UhQA#VuD u D$CVz)1$<;obD$D$PShͭ" =USWV$0xjWXƅ~F$0h$1jUXX~4$hP9 C9uЋ$4h^#S蟤Ǎ$ىh}"$0SU<t| uƄ$ $0ph"QUD$$0qh"QP˟ىD$PU;PUSF+ u׋$0EED$1ɍ$D$ $PhSDZ D$PD$PD$PD$PhX%SjD$L$ T$ ыD$E L$ T$ D $A9L$D$uPwh+"h"!}Sh+"h=" Sh+"h]"! $02t$t$h"$@t$Ph!"蹰 |$Wlw}~14\G;}|V\1^_[]USWVD$(}~;$ ~VE pS5 $PjVWjSOD$11D$D$D$D$$D$ D$hg"u Vu4 H5$,&D$>j 5<P+5 Cr3밋<$PCrj h@#V 1 ىVvS:1PuE$ ~S4V0 $PhjSPt$VLuVh" ,WhT"j%ÍD$LPS_u $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BVc 1{8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQL $Ph"Phr<rr hְ"jhr +rryt$$$PVWU>ލ$P|$xh_"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPK $Ph"Phry"tx"PShJ"藕 .1$P;$h"Shrt$VWϷ"9;$PVh"D|$$Vh"+h"jhr t$j=3:$h&"Whrt$K"?c.\$jRh&"WhrS$d|1$XAA$Pj2PQ=I $Ph"Phr9rh"N$`>ߋN8-)&w&PVh"" `Ouet$$P\$ ZSh"h)"$P\$;$PPh"’ Vԑhp"Sh*rt$  09rh"|h&"o$\>$Th^8%T Vkh8">$X~:$\1j h$V[ "tQC`;$X|j ~-h]"$`>V`Ouj ߐ$X1~$1:t @`9u9u$\Ph"聑1@\D$,\$H|$PS$hjVo L$,9F Vhʴ"VhrW hD"F0Ph"F0Pv,v(v$h$"j hQ"$Th1"跐Ph""h"Fh9$VdD$0L$4$PND$8Fh|"Vh(r WO  FtsSh"I$PtPhj%0h"#$Tt*Mbi)QRhó" j $XqPShг"ď ]hu"$X~n$1Wȃw,"$&L$7б"!߱""-)& c""PRh"G F`;$X|ۋt$~G$`>G8tu #P-)&w &QWh" `Kut$h"VhrP>"t"Pt$1 E$`$d $jj h.$QPjVyjhm/$V$ V$`t$Vh="G$XMbi)QR$\Vho"$|$|$|$|$|$|Vh"֍ $\uM#1whɼ"L$!rK"$PPV葍t$h"!11҉4hӀB9uOA#t#QPt$h޲"8=3~S$h1h8"1PQh" C uߍ_ j  rt$h"Vh&r@t$~ #;$Ptq"y"tx"RPt$h;"苌t$ USWV`p׉͋$tph"Sm`,$tS-Ãr t1C1|L$PVQ)H Ou vu hu Z$1hoVW5j owt1$0 j2t W" F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh["W8! Ƈ$L$h\"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhG%S" tVjh"S" tBjh!#S" t.jh#"S" jh@#S" u$D$D$h("PhrWhA"PhrW=3t?|$"t"PVhT"i |$u$4&Vho"J ^_[$oWViƿL63Ph"W芋 VhJ"W{ Vh"Wl Vh"W] Vh"WN Vhݹ"W? Vh"W0 Vh!"W! VhB"W VhY"W Vhz"W Vh"W Vh"W֊ Vh"WNJ Vh"W踊 Vh"W詊 Vh*"W蚊 VhK"W苊 Vhl"W| Vh"Wm Vh"W^ Vh"WO Vhջ"W@ jVRhQ  t^Vh{$j1WVPΉ1WPhPPj PQ u^_Vh"QjUSWV։ωl$PU\$hjSe E9C Shʴ"ShrW Vhs" ssss h"ss3hõ"܆{""t"t$(Ph"赆 t$4t$4t$4h"蜆$t$Ht$Ht$HhF"|D$8Phy"i$t"Vh"L$4&h".$h"Ę^_[]t$ t$ t$ ^P tt$h"jUSWVӉύD$(jPf1t$`FFF FFD$hOA#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP|D$HD$PD$P #$Pp  t$tȠ3$$8t 3ah$PU#  }hL63jjh"hL63jjh"hL63jjh"*D$tt?D$lD$p$)h4U  L$puD$lVd$H$,&$WPh+%WZ  U{ ׉ u ܙ3=Ԑ2$tP s$h9WUP#?D $WkPh5"W p =3XhL63jjh;")3f$WPh!&Ws  Uz ,RP3$ $P$P-j$WPh$#W   U5 @ h:p pUa($WMPh"W R j^-=3t%ؙ3I$W Phl*#WV h"h"h"h"hm"hN"h("h"h"h"h"hi"h"hG"h'"h "h"h"h"hL63uP$W] Ph$W bU*yŃ=3u#T3MIрK=ę3u }8$V+ƹV])uV+W$VVY+DžD$u hP"Xul$Vhj#hL63t VhyI%h$ PpW(yl$`t$Xt$T1ҋ\$މT$̓=3uT3MIрs6=ę3uA}t']hu%SEth#SEuWH(Ņu{D$TƄ ML$XE|&hP$ Phi"hL63 sD$+hP$ S ىV1 D$@W'$W Ph~$Wm $'hL63jjh"1%$W Ph'"W j)$W Ph"W =ę3tVhL63jjh"$ę3$W1 Ph0"W 6WKThL63jjh"Z$ę33hL63jjhO"9$3ꍬ$U$P GV )1;$v7$5<P{3$P_ $$1EhhL63jjh="#l$WK(_D$h9jUPL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$#$WPh$WX tB$Phb"hL63jl Uh"鍄$Phi#ڍ$Phx"ˁĸ^_[]USWV|$W!1tv=ę3u8t(=3u*T3Y*r W 뻋 333Hf ž3AQPhŞ3J ^_[]WVt$ !1Ht[=3u5T3J4>s5=ę3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$hu%S<t jh#S t ;/u f. Gf./W4S)9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS7tH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 5А2 T3H $s-t$$tHfHxt P2)1^USWV=ę3th53jjh"jj9#tvƃ=ę3th53jjh"X31GNIIˋ^s T3 tVfV(X3ޅud3=`31WS"ơX3Krk=3tV$Ph"h53fd ~uV7dV'%V`v v"Ȥ3F$5Ȥ3vu;`3d3K^_[]USWVPl$T3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph)"h53#c W_1l$$ttF9u t G9t$Ȇ&Qt$hͤ3h"hL63b<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hL63,bEuFufFFV!|$WP`WV&N=31ۈФ3̤3|NIL̤3h̤3 Ԥ3ǀ̤3|NAMǀФ3EFNDt$hͤ3h"h53xa1N1@=31ۈФ3̤3|NIL̤3̤3WǀФ3FNDǀ̤3|INOWxԤ3ǀ̤3|NAMǀФ3EFNDVdPt$hͤ3hM"h53`C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$hZ"hL63F`1t$hͤ3h+"]a >W\Ut$$t$$|$$WX ƃ*Vh"V%]1@KGufGfG1@=3$ WbPt$hͤ3hM"h53_Ut$$t$$|$$WƀH1@=3ىV_bPWhͤ3h" |$u V[v vYȤ3F$5Ȥ3Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWhͤ3hM"h53^؃^_[]S1Ф3̤3|NIL̤3t!h̤3ǀФ3APEǀ̤3|ONTt!h̤3ǀФ3FNDǀ̤3|INOt(h̤3pǀ̤3|NAMǀФ3EFNDƀԤ3t(h̤3Cǀ̤3|MODǀФ3ECHGƀԤ3[SWV=ę3th53jjhF"dd3=`31VWftmxtg T3W sJX tCf{u7=3tSPh`"h53$] S\S [빃;=`3d3k5Ȥ3tc~ tWuLfth~"W Z=3tWRPh`"h53\ Wy\W9 륋v$^_[SWV=ę3th53jj h" Ȥ3tSȤ31{ t$C$Su[SFuՅu5Ȥ3th"VKYv$^_[USWV=ԙ3Rę3utDh53jj"h",th53jjh"w5ؙ3t$G!jj#^ơ3;`3 3d3,׋-ؙ3WV]Ɖ׋ 339sAWV2ÅuWVh"p\ SPh"hL63[ c렉1‰1 u`WVÅu hP"%\Cuhf"SXCt SZcSSPCcQPWVh/"hL63Z:Kؙ39tPt$ ZU-ؙ33;`3 3d3^_[]USWV=ę3th53jjh~" f3jY9T jj\ʼnT$d3 `3PQ\D$5 353J\Ɖt$U9\ʼn$St$p\Él$9$\$ 3 39ˉs6f3j8DTk D$;3 3rM\$ -ؙ39sI 3953s9-ؙ3tS ؙ3E9u 3 39\$  3 39ΉsZWVÅu h"YSCPh"hL63X cWV[Ɖס 3 3911 uU9t$D$ rIWV<Åu h"|YSPKAc9-ؙ3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5 353fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=ę3th53jjh"7 FtVPXfvu݃=ę3th53jj h" d3=`31ҹ$RL$QtMƋhtDEt9VP|$ WJ1ۀ~UiCSPW+W em븋L$$; `3d3r^_[]SWV=ę3th53jjh"- d3=`3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;`3d3r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"hL63tU 1^_[]fUSWV`=ę3th53jjh:"5l35h353hY"hhސ2@Qԙ3 t=t3uFFF%)Fu9rV9=ę3tJh53jjh"F ę3t(t$h53jjh"yF ę31V9vtRPh"h53O ę3th53j _$ 9̓>t9߁^_[]á3tPjt$t$uùޔ2WVIAfF=3|C3)f353jQh3vu53F13PVQ0 =3F3^_ùސ2QhZ" .8u"h"h"53h~"hL638NjCWVjhސ2P1t)h <t 8@ W^_V3  3t7#3=@u%o>3  3t3!=@t^USWV$$$ $jhWV,3tE1M1 tmjWVS$8jWVS$8t$ShyI%hV@IVg$ 3U Rh53DžtGhu%PmtSh,"hL63L 53DžtGh#P/tShT"hL63xL 53[Nj531jPP6`+^^$DOGrhPD$Ph}"hL63 L:hPt$V $(j7V@ 3u D53Nj53j1PP6+^^X^_[]SWV׉1jPP1+FF9tX\$)yWh"hL63QK %؉jQP6E~tF hP6 F^_[USWV|$_ OtGhS7٥ GO9}vDty)9|n4 ȉG.uFhf%PA;-`3d3rv=3tUh"hL63fJ \GP1=3t:Ph"hL637J %1=3thL63jjh"1^_[]USWVD$$P=D$x/@thf%Q\Q1ƀ81Mbi)3H1ًP1 t 3P RV53At\G9uGSVP t53Džu*hf%D$PPtƀ8MbE^_[]USWVt$!M1 tFjhRW,3t(E1M1 tm`ƋU R^_[]ËD$0|USWVX=ę3th53jj&h"ԙ3 ߉^_[]USWV|$u h!">W3u`Ɖˋ-3UDžuh+"z>-3)ً39w؉9vlj<3|$3WS0^_[]USWV։ϋ\$ t;=`3d3rVWh"= -33QPVW{s LK$\=3t%[$tC1K 1 uh "S9^_[]SWVt$f~th"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>W333F$53^_[ËAP 9ttЋR9uIHËIH h/"Qt8Vt$V33^SWV|$t$Åuh"V,8;^ty^C Fs j/WGS3 3W WFV86P 1ɅF fN^_[USWVd=ę3th53jjhF"=Й3td|$xh9"W:ƅu00 Ph`"hL639 Wha";t$ f d3`31؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6Dvuݡd3$`3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(Wd[ud3$5`3L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSG39|͋ d3 $5`3T$|L$<q$Q Ai33QA h3l3QA3A$t$ Vjj(QF @t3a0 Ph"hL637 t$xh"8V h^_[]USWV$=ę3th53jjh"e1PPUc Džy00 Pha"hL63 7 Uh"88D$,PWOy00Ph"hL636 Uh)"7$jSƅu hK"7SVWx xD$j(PWd y00YPh"hL63N6 Uhs"{7WGԙ3RrD$l$3=3,$1Չ1 9$hL63jjh"jj5d35`3裴3jP3u h"6PjPhu%HĨ^_[]f3D$L$ 33D$L$ l3h3=3u t$(6t$pPh"S6D$ L$$ d3`3L$T$ 3<)3؅~ڋt=ę3tPWhh"h53 =3 33hQV 33^_[]t3 PUhh"k s-3hh3U貜 0Ph"hL63 j USWVEP3f3$3 3D$?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ=Й3uhVax=ę3t.u Ft##"j3SWV t$t$4h"jV@Y#jfƅ~'|$01ۍ)QP53P ~9߉ ^_[jUSWV t$4|$8\$Wh"jS-3SPSU4O WV53$O 1Bzb% ^_[]SWV Ӊύt$sKt$ tVWhe#0 |$Wz@01HFu3h#W-t9h+<%Wt'\$j SWq $ 9uy6h*"U$~h#Wt@h+<%Wt.\$j SWBq D$ 9uyvh="jyD$PhU53Ƹ u ^_[2hM"jySWV |$t$ >h#W5t9h+<%W#t'\$j SWp $ 9uy6h*"U$~h#Wt@h+<%Wt.\$j SWJp D$ 9uyvh="jxD$PhU53η u ^_[:hY"jxUSWVhݙ$(1hWD$ Pw |$ |$ D$~P1ۈD$$,,jUhg"$w tjUhb"w tG99ufD$u\$ tR$,4jVhix%v EjVhh"v 4jVhm"v 5\$ D$7f@jh0uht$Vj P53D$^ރ9tD$j@hv"P ߉tD$P襆DaryDpriml$t?tD$PzD andfD D$P^DgrowfDnt$V@D defDectsDuVjh"PH V53535353h"Et2tR}jh"V AH}j1h^"Væ #}jIh"V螦 Xt6Wh@"wSh{$iUփOut$s h"B^_[]1hC"jtUSWV}\$j S53O D$t"NuD$Hj@PjSPh"jAt$j$Vjj53rF=tPh"zD$D$ D$$fD$t$j VE 0 9 1L$81qAQQ a A j QV53-D$t$ *jh"E ps  D$ @L$jhtjPjQ53h"h53D$t$H1D$`D$L'Ƅ$0VhQ`53譲 $j D$tPS3 |$'y9D$(ȋL$;&|"@D$Phh"h53sj i0D$$<JD$ D$ L$jhtjPjQ53~e^_[]ÄtH<t<u'53h" 53h4"hL63 P53hG"hL63hp"=h "jqE 0h"`USWV $ ~($ 1j4h"+q ?C9u1CCJt$LUPV CJjh'UVjS53~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P53535353h"- vL$D$$jh'hVjS53Ffȁw$VhU VhU ƅtL$D$jh'h$PjS53]$f1Ɂw$PUhWh";Whh#-vL$D$jh'h$PjS53$f1Ɂwh"t$ t$ 1؃;D$ D$4ƜF>|$Ń P&h&&hcE%c ~y)L$$|FMCh"# ZUSWV@L$XT$T1wtZwd|$`t$\$|&W4&Vn @J R WV,J R j@UU4&h]e%WV+@^_[]Àz rJyˀw$&BPhf"BPh}"WV뫸D"@t8"Ru RPhO"xQRPh%"WVhWVt$D$ 8؏&u8ُ&t#u@u+t'Qh"VPS)V܏&Pl RQh"VP(^_SWV|$t$t$h"i~t1DPh"NCF9rj [FY(WPV ^_[fUSWV`$l$xT$1\$|rSUR _w$G $G$GX0WhQ`t$| t-D$[u`^_[]<t$<t-<uCjW53.h "j-`53h# 53h#hL63 P53h#hL63jvUSWV\$$|$(t$,1EEVPW` E \$ ]Ejh'VWjUt$4$^_[]SVL$T$D$ \$F^Fjh'PRjVQt$^[USWVt$|$ \$$1EESPWȲ E]jh'SWjUV,$^_[]USWVt$ l$tIl$L$߉<r uBGu".Ko13Ār< uF9ul$E^_[])1l$: rx\u@tfE\\7tE\: 0E:$ 0E:$ 0EIt]EG9ufUSWV } 7]h#WS#i Hw$&<3փDu3333333333v3j1FVPh#V1]uO5/39}E3 3=3uuu 3=3u3th!#  Ȩt&G&=3uL[&Ph@#sD$PShL#S133D$L$3 3D*h#PΥ|333)h53PW G?t 3rx9u3 3\$)<+<=3T$JDHUBRk<3D$ 3L$D$1ɸ3T$ωD$ \$SkƋD$)D$tGD$ D$H 1ۋL$|$3VQPX 333ۉu\$ <=3DQu+<:wSkeKC CCCCuhP#=D$PHD$\$Sj $D&D$KL$  S J#GBD$ @h3gj33 3uh#xh3iPh`#[>3ukPzm/$t 31jPPl =3u'Otu/ht#蘢jB=lj jhY" MPh#jKAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ* 33!уu+D$T$33hS#j9XTPh|#hL63 jUSWVP=3531,9|1C=3539}`sp&H-`&E9ƉMm|)t6jju uL$螟L$9ȃ}  $Qv1F,MUۉu1;}E|u<E EmubWV#Vl?Wj̫WjWj趫Wj諫hhV) x`j"h#PR( h3% jPV6( jh$V&( 3WfPWV ( Vd*^_SWV։ϡ3H 3uhh3pX3h#h#hS/h9"StZÉ $#tOA#h353Ph#SY|@h37 Ph+#S y˫h#Ph#j豟<|.i< OA#t#QPhH#S; t Sjj!hl# Sjjh#3tSPjh3h3Su;h\V輩jBcS1W.cWV蔩^_[WVP#=3u%3<u#3u#uY"h353Wh#j菞jmh#=3uh#=3u6hhh #5' xjh#P% V'P3Wh,#jQV3h#LjrfV8jh4#" 3u3ujj&#u##u#$=3u D$@#D$=3u #=3u #=3u 0"=3u e#=3u F#X$ 3uH18h#$WPVw& O8Vh#jȜ 88Vh#Ij=3u h#j4jh3hh#fUSWVa΀-% plj\$ Cut$BT$ҋ $)|$41ɉQD$PS苺 D$ D$ 938*8\$ L$ D$D$W|$h+"S肃DhU&Sl;h/&SV7h#S@3hN#S*'hS#SD$t$ |$@1ɉQD$PSh D$D$ 9؋t$8Ð8|$襐1ɉQD$PSu L$ 99։D$rL$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh34t2hQ#v 1<==3 ڍt$81 D$ \$phjSh3PVT$R8$1BD$L4JD4`L$p$QRSRPV4C3 3u1$Pm/$w <&Qh3h#譬 31<=4 j=V`9=3 j=V`T$81 D$ t$ hjVh3PRW6\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPB$h3h8#D$49t 8Vhx#S1JD$ $$Qh%#,=3D$t$=3$D$D$,D$\$(VEGC@D$p9Vh# 0LPt$h#|$oQhA#=3D$WSt$h-#VD$ 81ҸD$ |$\$ Cj"$PVÍD$pWVPSt$ $P[@\$ E $3jt$tS7 $3jWV# -07~Ph3h# B3 3$Ph3h]S&菩D$ $u1@t$2|$ Qh#(11G|$1\$ tpupth#QADD$ t$D$t1@L$ ɉ%t#PQ^Q|$t ڊ8t1j t$ e4$`St$hx#FQt$h#7.l2m2L$ L$ ف$K{8P|$WtD$ t@j QSu> D$ ;$|$8tQtUL$4 T$hjRh3QWt$2 l2T$ gL$4D$ 31ɍAD$4tT8`T$ Q$QRQPW=c3 3T$Jm/$w<&Pt$h#t$L$ $d$ r $3 $tu¸#tS#PQh#|$D$u |$u |$TF1@]%t#Pt$h #$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0QhZ#,0mzPt$hu#|$L$lj% L$St$h#{D$$&过1ɉQD$PS菲 L$ 9t 9St$h"#,D$ D$ D$D$0L$0RPQt$,t$$Pw;tBD$tUtsD$ |$3jVPM D$h|$t811FD$&|$3VVP  D$'$D$8|$3jVP D$p3jVP UD$1=3D$44$Vt$h# Ph#=3he^_[]4$h#ًt$D$t$$t$S>@9s Vt$ha# S>@D$t$|輅1ɉQD$PSl T$tD$pD$ 9t8u菅8 St$h#Qh#g1ɉQD$PS7 ƋD$ 9t8t}St$hC#St$hZ#D$t$։D$L$8`OGL$0d$ rxL$D$nT$迄L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$h # jj- vPh3h # h #h#h#h3h#SWVPD$t$|$L$ $QP67貟9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS71Ht$L$ltT$d;WuT$h;W(u Q8M ŃtD$ppPU\ D$DGXHr P]oXd^_[]USWV$l2383t 3/3Sh3GTtW3މ)ˉESQ|$ W\ DW3VP V:fǀ3/SUSu3Uh3 ,^_[]USWVhT$D$l#&1Ch3E:D$ CL$;rjt$V|v ufD$jD$Pjh3Vt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPDWt$hL#|$$j@WVPDWt$h\#j;)WVPt$=h2IPh"W 3t53Ph #5h2ڠD$$PV5h23 3^_V΅tOXHw;s13 3te20srPh3h #M Atʡ3 3t"0=rPh3h]S& u =3t^jUSWV=3ˋ}3 3 t u tth53jVuR}ti=3|}t j QMO؃thD$VuPY t$UtuRh"̜{5p2RhcE%賜 bD$VuPX tMD$PVh #耜 D$VuPzX t+t$ t$ Vh #N]D$ s*P? D$L$ r!QPh $ rD$rIPhQA#QPhhi$xt$h*$}u h #ܛj e^_[]Ph&USWVP=3u(ˋl$ D$$|$53 3 t u^_[]Åtth53jt$WP܅3| t j e$^_[]uCuWt$h" K4$~DN1ۅtPh"t#=3uPh2 #ך9t3C뿃u,h #蹚't+ORh"蟚nSWV贖 L$99=z  h%jƅu$ 11L$RUPQ$8@$8@!tIt =3$,@$@3 3t.1T$Ph X1Ʌ1ۅÍL$MP%$@SPUB U$@HtW3 3t$ jh V0$ P|%jPS SG@^_[]l8"tD$9t 8uVhQ #Vh@ #jh3 #h{$jUSWV \$0|$,1PPUPSWj )4$61PPUVSW< =3ut$ h"ى>rt51t ttt ttth #蛉 9uЋkT ;$tl  1L$D$Sjh"Q {t+1:LtPh #+ G,;{r܃TD$@TL$9uj #VF1A ^_[]h3h #+USWV }=3t D$ toh #W\tcj1ɉt$QVWZ T$$9t8uj8,Wuh # =3j11CL$ t$PSQVuuAtWt =31=3u?=3u6L$1J1ыT$1 u#MUPj h #1ɅRaMUPjV tK=3u-=3u$1H3$3|$ uMUjj h #MUjjP e^_[]ÉSWVt<=3q~FDx@uAFX@ut9v<=30Dr@tH^_[USWVPω11s6tUVhg #SdUh_#SS t9VC4$EuuhOA#Ɖ$t^_[]hs #hn #jhs #h #USWV\։ύD$ jPj P|d 1u0D$F|fD$Y|Uh #j D$ P芄$L$D$ L$/Ph"j D$ Pb[ $fL <=3/LA .sD$ L<u\$ S胺jPj Sc E9[|$ t D$ PYVh% #Kd^_[]WVth΋u\~8tU~4~`N4F8 I9rP#B1F0F4F8FXHr PBFX^_fUSWV\$33hS#sP\su 3>eh@"PXu 3jH3Jmx &蹶'?c.53芓h@"P-Xu 4=4^#t-#l$PKrt Pu|Qߋ<-t<+u{uNh%SWtGSM16khc#q3t8u)hj#q3Pqt 3#hq#}q3Pqt 3z#1=3tjh#~FP7֛j觛N=3u0j_`ujjB=3t!=04u=3ujh# C1FVV7=4uh#502:Vu\~jh#B jM54f:0BuK@33!Ѓt4l43Bzu=84t0譚|84jS=x4u T3=l"4~jh#u j j 6GWVt$ y53533ut[<|=4t=3t|2'V1Wu=WSBV xWV|$ W@jP7tWPv^_t$t$6tjh#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@93<3U5*4D=(3u 3(3UZ=v====,=XAf2 3i,30343F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff fy<D$,3D$L$d$ 03 43D$D$fD$ D$5*4Pj5*4? 3,^_[]VPhht@jG t1h$#ktP"$t$uչU%~83h#rkt(P# 83 832 83 83u.h/#!kt P#Tƅ~5<3h*#jtP_# <3 <3 <3 <3P^V[tP=h3t1H V{^PL$$@31Qw$X&7#M(uMf@3 x:#4=#+@#"C#F#I#L#=YÉO#/uf@3R#uf@3@3WV׉vu1=h3u WV;|^_SWVPhU#iPi1Ʌ 2hwe%ui&th3Qhh3xth3h#th3Vy T"l3k#p3n#t3-&x31"|3q#|35A"y33333333~ 4h3<%3ty<t#OA#OA#t 33#gtlj=3t#O3w#>#t 3#!#t 3=44t8=3u/湯#3&3=3u 313OA#u 3OA#Kg$3t8u33OA#!&q3=x3tt8u33OA#B#:3t8u33$湲# 3t 8t1@ 3OA#13OA##a$VWWh3h3q"F&V5353h3h3H!#%V5353h3h3Y &%V5353h3h3S#;tlj=3#m3%#OA#OA#tơ38t,<$1QQPy PWm<$W@$h#3As%=2OA#uOA#uOA#38t2<$ 83IQjPPy PWm<$W@$#S>3繢# tÉ3#OA#tƹOS"=t3uOA#t‰hOA#Ɖ53>u 3^_[ÉF$3z8{lV t<0 1=h3u Vut^USWV׋t$$\$l$;Et*+u(%OA#t D$ L$M^_[]USWVր9tMτtC132U583Wr 313U583Vr ;3|ut$3^_[]Ë 383USWVL $։ύl$ D$?h#Wlq)?SWU0 D hj VUq $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$9(xt$4hj VWVq L^_[]Ë 383V=84t =3=x4uF 38338t!38t=3u 31B3=|4u 383b=4t 383H 3=$4t!=83|1Fj 2F;583|^Ë 31B^ 31B 31B= 3ug=84t =3uN=4t 383=|4u 383=x4u 383 3Ã=3" 3Ë 31BY 383Ht$j53t 1B)=4tË 39t83 =4jË 383 31BV=43t31B53t-F=x33t31BV^Ã=x33t31B^_$3t 31B>3t 31B'3t 31B3t 31B3WVD$ #=$2 lj Ƌ 3j" 3j 3j=4ttV$ 3j53^_WV|$ 1Ʌ<+u OL$ GW -rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$̕&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th$V,BtrL$PQV t4uRL$x# $x2P #T$x #$x #w^1J#^aD$# $2  39uVD$ T$5$2! щ щ! ‰ 19^Ã=2th#Ë 31BSWV@΃=2tt3tVs@tx1Cj S*VGVjSP_GVhaS%P 3=3!Vh#j@WjWZ@^_[ËD$3WV9ę2t#֍|$RQjWj1B$5ę2^_Ãw&ÉfUSWVPt$ P!уtRPtt jh#jh#l$$\$|$Q t^tY9uE}4u ;Ճt(ˉ $19u tC ;$u~2KՃujhP#t jh#jh6#D ^_[]1ۅs IQRP踒fVt$t=ș2tjhd#5ș2^á2xy=3uE 30@#4@u.3jhy#?t *4t2P253n'3V1N= 3t9t/ 3,@wB$@(@1҉,@Ɖ^USWV=2 3@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh#1@$qQ52m 9D$} 3럃^_[]USWV- 31|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5*4( 3@9@S 31JЅt8=$3u/@u1u0@4@ l&[WV 31t[@t @4v 34@0@{!уt RPF1G)t *4t^_USWV 3t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH 39t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë 3t$@(@ ,@1HUSWV5 31H(@$@9t#H1ًP1 u,@;Hs D\4%D$z9tG1؋O1 D$ ~9 $tG#G=X4t @t̙2x9 @}lh jtH @1HGG7FGF8~FNOG Fx ~,@;GsN+X4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@/!ƒ5 3@@ș2tODș2Q@u;G  )RQ@w u& 30@4@&OD1@l$1tʼn$yjh#1=3u 2x~OUQPͿ 5 3@@o<$t0@D$4@=$3tU=\4u#L$ Qh{$ \4j2=$3t=4u q=*45 39>tOOHO 35 3wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh# 31H^_[]USWV 3ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H̙2á 3@u1I4@0@Ë9t1JQQ 9u@o 34@0@1@@(@$@,@PPP@+!ƒtjh#81PPjt$q+!1WV 30@4@!΃t@@9} 0@4@^_SV\$t$ 53({ 3h8@j 3@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV*!ƒt 3 3@P53vz 3@u@^[SV5 3@  ˀuH9tPQP Pdž @vv Hu5 3@uE u@跽5 3dž@tV?1 3P53y^[á 3t@1fWV|$t$ t=(3ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnVtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV hOA#j1h#lLh3h3h3h3\$ -uF :tjh#]jNbt'.t53bt0:wtptcu+3F&jSh3 3jSQ ,uF333333333|3333t33x3h#J1tPhj#J1F$2Vhu#Wh,3P(h~#dJVh#Wh03P ^_[h#>JPJj3/1B th#Jƅu&h#Iƅuh#Iƅt]h#V'Xu6h#VXu$h#VXuh#VWt1B#w1 <=3TA ruƀ43ƀ43ƀ43@=u=(3D$43SVt$ t3M1ۅuD3;1Cu1񺐧2(u!=,4u2 1ۅÉ^[D$43ËL$=r!=(3tP5,3j h43X'43u 4353u43ESC43Ãw@43uQh#VPt$ u T3ESCuw 43u;Vt V503B$T3xPV@,@43uPh#V5,3j hT3WT3^WVD$L$ =(3=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$<&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=(3t'~3P19wKS>~-19s2C,9r9v)CK$SUx"uF8AUv Vm o ɋl$u9tSv :"t1|$jjSOF ~.EFE0uE^_[]V3t";T2t1FVh3P/ 3p^USWV\$,=(3tV3tgفuH3J 3319*Qh3~-3531E43J331E3=3u 3 31҅; <2t҉օt1PS;H*$P&=3+"3Шu*%=tS 313]^_[]Ét$353 2y33)É 2n1|$ l9} SWh3 uԉnOA#t33VWA=3=35* 38u!e033tP~3%MD$P -3E˨ -3E3 3? ǃ3^_[]3] v3e33=3v!x ux ;|3=3w%33< t 38 t33 33B53a338r 33=3wx u 3=3\x tQ 3=3.uD$ L$PjQ课 $T$e^_]Ë 31; 3|3á3t @@@ 115[1PPUSWV=3׉΋$$L$ D$1AyōD$PU#D$=xh^#UmGUW$ShUdU 0jhl#U蜥 ShU5U D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU4T S1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=3o=82u=h2u =4P1TAPg@PjVP8WF|8QZtQL8h9"W9EÉ4$pu1ND$PVx#D$ =uhVmh_#a0tPӏƅdո(2Ex uָX2Fx uhl#hi#S#D T$Za]VUh#S:S4$VWSW V Ā^_[]SWVh#/P/tt;^_[&h#V)1ۅt+h3%VtV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%#+#Qhi#PB tWh#vB Y=82t"h#hi#vB V(2=h2t%h#hi#vB VX2^_[^_[USWVPӋl$D$ $uSPSS1tD$ t}t8^_[]StV믉h3jPN SPuSqWV38L$ Ƌ3 <39}I9u3xtWD$3$3V38t,t$<$PD$38uڃ^_SWV 33$ <3+ 3|51ۉ|$8tZO\$<3+3$9|Ӏ8t-t$|$D$|$D$$8u$3)ȣ353^V^_[V533tR3)Ɗ 0@u 253A=33"3=3 1@^À=3t833 25331@á38t AUSWVPQ$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh#O+h#@+Vh#P@ Åt^_[]jh#Wz@ t Vh#Pe@ U uh#*Vh#P:@ ÅuVh#W%@ WV9G t'փtPh#V> G?G uG^_Ð3i ËD$u5Ã<2Ph#USWVD-3ÅE\$9uz$1ۀ|tisljDDs9u>rjjx 33$t,tV#hj:} =*4TeuYÃ=*4e4΃e3~o6/=(3u #=P3 t t =^=(3;P3Ct}.CЃ jS&ed~h83 $3 3=3t 35=3u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=3i3ihDO%jjS\Fc`$&=3 %t#-l253=ES[jUY  xS3H݃t =4-3>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$& 53 h#9,393903=(3S(3C1Ƀ X3L3ῃ5(35(33/U]VsWWr!2@*=3%33743h#jjL3P3n=3 5T23 }h#3 _gh{%y1PPv41; 33 $3H$3 3/=3 3%h#1PP9,393903؉ك u. u.S莍iQ35l23%aih%{jVyL3P3 PZw 3 *L3уBЃ@*? !1҃ ƒ!D$Z=(3,9,3t 93h 903W jhJ#j#t$(V/OVrlp1BsRtM&=3=3733Щu3Mj5<2ùe=*4Iv_*-t%+q1҃¹) L3P3S\B D$t1< X3D$ D$ PD$PD$ P萪 (3tjD$D$-<{|Q<`ʃ=X3tR D$HL$@븃@L3|$ ^s 8eB3emh#1PPL!ùe9,3e93e903e e 1?PS1FP@/L3PhOA#5X35(3虤 1;5 3$3|$3 3n蔰VVA 1; 3$3  $3 3|3'M1PP53 =<4 T3 t|7ػT 1; 3$3|$3 3蛻=4 3u' $3|543503P 31QQm1; 3$3 $3 3|3|C=4u543503P1PP53A $3 31҉3P5l41; 3 $3|$3 3l4聺觮5$35 3DT5l4J3NVh#h1PP5 ùe9,3e93e903e e /йSE*re|褹ʭ<3<31<3 ,4 @3,4 4 D34h#CjjhV#$3݋5 31ɸd9 jhz#=3t>t5<3<3@3,4D34j)eD$t Pj{@eJr蘬 L$Qh{$1; 3$3|$3 3)O=4 3u' $3|543503zM 3jjP1; 3$3|$3 3跷ݫjj蟷ūD$<2D$Ph#=3jh#VR $3 3h4 $3 3h4 31ɉ $3|$3 31@Pe(ejh#e1; 3$3|Y 3$3 諶Ѫ=4u543503Ljj- $3 3ʃEݣ4c $3 34H3  H31; 33 $3|$3 3q j5<2? 315H3"5H31; 3 3$3|$3 3 j5<2RCi 31D5H3=4t543503J1=W $3i 3me53V?P/V$ 31ɉ $3|$3 31@PuGjh# 31ɉ $3|$3 31@Pk 2V_e!ֹe5l4RPyJ1A诳է $3 31҉AQPcM<3Nn<33>X`h#r1PP?ùe9,3e93e903e e S賁+̲1PP54n豲צ1PP54jP#' 3$3ؽy蟦=4t543503Gjj5 3d:0ؔ 3$3艽*Pjj5 39; eS贔D$D$Ph4#{豱ӡ 31ɉ $3|$3 31@P"etbt3tFu j11A; 3$3c#|OA#L$Qhk#11% 31ɉ $3|$3 31@P'"e11A; 3$3c#|OA#L$Qh#je53<h#Pv531=tjh+#o5l23nvh%1SVUh蠻Ag53rSPx]4 <3݉ 3 $3<39‰} 35$3)‰<33e4 <3 3 $3<33i1$3 315l4QPHFjh#H3D$Ph#d ։u=83t 3 $383e,5835 3tI~V8Jjh#bUSWVP趮ܢGVD$1Ƀɉlj щ D3@3$3=*4uH9ljD$u21xUUjn6 9-*4u;=@3D3D$t$3 *42t8teue^_[]USWVPӉơ3u31 r4$0utV4$#331ESWPO á3 3 H3tu1Fx` sKu j]j%u0SW53 á3 3 H3ujh#t 4$4$^_[]WV=2u=84t =3u袬׮t 33!ʃt]53QY3u =2uP5$4=$3$4$3u _BLE5$4=$31jPPB ^_SWVL3߾83&t#3/ V+=P3u V@t h#t u%{%P13PP^_[V蛫ơ3"~S.#V$^%=3Q3VPujhj#  tY>!t \3t P V!\3=3M\3.h^#qF<+t< t 3t Q V菛3/7E=3V蜭hd#Pt% =3V^X 3^(N5 3jF5 3jQP軯^5L3V5X35(3(37333PV3h^#hOA#r^SV 3t s73Zb3shp#i3 sh{#Q3 sh#93th##3 sh# 3fyh#31Ct$‰sSh#jVV3CuϹ"tf% s#Q3^[fD$=(3t@WV|$ Wjeƅ~WhV4 ^_USWVt$0l$(|$$t U{,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD (3H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tW t W- WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f `3 d3 h3 l3USWVi $AD$)< u?FP貛^tP萲9~#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h#htjPV/ jh#h#htjh#h#h jh(#h#htjh9#h1#h ^Vt$ t:j j tL$HΉp `3`3jh?#荞^Vt$ t:j j tL$HΉp d3d3jh_#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV 1H^_[]h# t8tMjQP[ ƅuh#t98t4jh#P/ ǍEjPW Wq iUUUSWVP1F=3jt$rP#19jVB n1PPPSK!ƒJVWSr <$S's11 ?$:81xM'x+xG1O|E(|n|dȃ|$h3tl3Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW Sq1N^_[]4$q |t|uVP11xtɉSWVhp3t$b<ƅui\$hx3e5|3PSh3I53P|h3tl3h353p^_[ËT$ `3t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=4ÃB1ۃ=4ÃCɍH9 83~Pj#|k3SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=4ÃB61ۃ=4ÃC%|$mu983~HPj#j3؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PbV0ʼnPJD$X9vpG$11Ʌu2~>9sWt$V肗 t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW謧V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQHt1=4ƃtEuG%t|Qh#hh%AVh{$6 Eu ?=u QhM#$ u 覣!ƒtVHQh+#^Ã=4t$3tPP&t53ËD$t53PF$1PUSWVu1953O3t_jP%=3tJtWg%W"=3u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =d4uID$xAPt4D$8\$Ph#FًT$WVt$j 1@t=3jWd$53t$V$t$53g$53$h353#3t$ t$ ۨ4=4111*4D$4PD$,$jUuWPhWD Uڃ,$C^_[]SVt$ h#V1Ct'h#Vth#V1ۅÉ^[WV$ VtVWVwtWt^_USWV 1=4]=3Pj\hM#1Ƌ|$ 11@L|uM@-u)Fh#W)1%tuQ%t s@AAۃ\$WVwWl؃D$jPtWVt$PW蓱 "S聱 1tXt^~u1O\$$D$jPWQ uQD$P4D$(0#^jh#4|1 ^_[]ÉOVB0;t;V001|$rɅuŋD$(#1O;PrS辰 USWV=3t^_[]j荈h #t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh #U{PljD$UV̍WS\$貍,8jUHrS\$SVUP\4$֯ Sͯ \W軯 V. V|V$R#N@ |^WV|$=d4taPWiR1=d4#D$=WŌ*jP`qWPhP2LPWRx#D$=@{WwjPqWPh@2V\ WoƉ|^_V|$PV#x D$XT$\1jPPV趻|^UWV蒊lj53# QP@Qt1GL$ T$333 31@ u,L$3 3$33 u!tL$\9|$X}e^_]øR #Vt$Vf9vHx/uAΉ^fVn 31ы531 u^ã33=4t^6~^P~SWV1ۃ=$3t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=3t3USWV-4~ON}=4~Q111SWuljӉ:}qF;54|؃=4' =41=4|=83111;54| V|ljՉ!<$=4FD$1;4á<3D$ l3D$<3D$$<31l3<3PPSUt$ ljՋD$ <3D$l3D$<39pt$j pF1M83H91Z{1@^_[]Vh 2F;54uj{ t j2^USWV\$,=3t3&|$$t$ l$83t  $9~ L4$x 9} H9$!tT=4t 4tC31҃=$3TRQPWV脘WV Ɖ1ND$(D$<$=$4t783H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=$4tzmz1@D$/1@D$=|2uu=2t h #\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 3t)!u =$4u=4u3=4t Xm39l$"83HPj-|1Ot1E1=4~1VV|{~ VVVD5 -$3t <$tw y|2j@ ^_[]USWV=3t341=3u!H4y=$4t 83'|$t$;D$||$$t D$983~ =4É!tF=4t 4t03,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=3táH4y=$4t 83ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]Åt83HPjytm=$3tPay1u11FUvUVRPVjv!уu *4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V 83~&111RP!уtF 839| 1 8319^fVt$tsVGF953u#1=2tu1Ɂ2tщ 3AF=2tH 3v 譤 v袤 ^除 ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá3USWV\$S@Nj522tv W6W |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@3VEESËnU9Ë\$sU5 SKeFW 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t PK w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=<3jjPWV^_USWV,T$Dl$@ظBӃ=4t  4t03 @1)ʉ|ЉjSUQP虊كQP4v=@4tK uu|| t u+| t u*4tt*4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+t*4ǃ݃ tkwRPW v=t4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N <3 CfN =<3=t4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$184l$t$1E1!1M,^_[]Ã=4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjh #c^_[uƉס83HPLi11 u^_[8iWV!Ӌ 83It*QRP4 83HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjh}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-93|$#>$4,$tt=t|<93|wC^w \$D$Sh$#jWf$4,$U$#f93u+93}93t93hu_G t t1"~#ut|\tt t tL@?3~|$j=W<9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEu$#OA#6$4t$ t t_G칽$#OA#$40tUP;tu %#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQV3^_[]SWV׉Ή5353h$#hS=w )WVRQ3S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^333JtGtO GO 33l2 t3u3^_[]ÍZ w6$p&tEGЃTZ$&btPeu>f3랄tGOm>"#놃>#w>&&h>%YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]33d   >3 3 333Rh$#jh3X$#3_t>OA#vVh!%# 3P+t  30b"h2%#蹻3Pt 3C%#jVL3jVL353h3h313PҎ $u3^1|$á33S313 3 33 3 3@ 3;3|1ۉ33333333333 331H33h3#h33P $u3[USWV\$0l$,1=T4uSUƉס4 4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| 3=4tU t33Z3$3<34 39}Q3Ɓ$3 <3ك=T4WV^! tt$j VRP)NVe1 4)~$3r53Ƃ$3 <3Iu܅~+1ɊT 53~=3$3<3A9uס3H 3ƀ$3 <333^_[]Ë 4t 4=T4t14@V53 39}9 3<u"30Ph3 3 3F9|Ӌ535 333^SWVt$\$u$D$0j?oPAd/=(3t&v!Ss1҅ SVqt1҃Pn1҅t$St 3~- 3Vt[u3 3LV3Zt 3t> 3VtV[t'i=(3tVs1҅ƒK1JFVY# 3#3#53#3‰^_[QY# 3#3ʉ# 3#3á 3333á3 333ËL$1wQ5 3{1SVt$ 1ۃw)V5 3{uV53{1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ\%#9u!B1@uDA;1A+u%uVt1@^ÃwV5 3zu߸ع#L$1uj jE1ɉHH{ SWV=3 u|$t$\$t-1 |15$35 3tm1@Z ug4t ,4uU=3~+,3 (3\@03335 3=$313=(3 3%=ua03P034319Rh43bmh43m435,35(3,3 (3H 033u"0343x,1WV=(3t 031At^_[ÉШu-%=tS0l3=,35(3뢋,3 (3033USWVӋl$,|$(3=`4H3uBu>%j jzC1҉PPH3333twQPl'UWS H3xt 3Ph3蔅1H33u+4t,4A\$l$͉=(31؋5 333Rk5 3UWS% 65H3 H33PV軄3@3VP诅V荄 3AVUUUЍ@@33 <39}oh3藅ơ3 <3Y$gQVlu&3 3PjVPm3$#5339| 3l$ EVjUek L$ )v %uh3蚃5H3~ H3 3; 3 53|tq=30jf j39u"_l$\$u4Шx$_l$\$u$53 _ ‰$ u*4t =,4uKuG ڃ^_[](3m_uiud1UWj3+3 t2391J$; 3} qɉы43)t _3\$ PjSi 1EL$3) 3PjS`i ǡ3 3tW4V)3~Z3t\ [5x2)Й)֋$F UWhDO% N13E1-3$_PdtUW ](3t6=`4t-QdtQd UWl $UWS t1@1^_[]SWV=03~4։143Pd VW u C;03|103)^_[Ã=3~,3 (331WV=3~,3 (3m3|$t$ =3uu 15$35 3itb=4tY3<393|333 3A<3 3H93}4 j 44jf=43tL3tBx 3 <39}; j,3P 3 <39}3ы 3 <39|L=l3tCp3„u0=`4t't4|$t- 1j1j 1j5 3953 u303^_V=`4uajm5 3JptMȺj9#Fu= 3u"Ⱥji%#Fu^SWV։ˋ= 3G 39=3 u3834D$ 3; 3~~ 3 33 3^_[SWV3 39}1T$53ׁtu Ӊ 3@9|^_[ËD$L$ $3<3VD$ L$=3u=4ttNI1҉ tK1G39~<3$3+53)΋ 3 30 ~^33USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8*4u/3H9| Qu@38GO1H^_[]cS 39t 3Mtۉ>?SUSWV-3\-jS p jSo DžtVtRU53Vu 3UPW~u Uv 53|v 53=331t WYv 1Gt VIv ^_[]USWVL$D$ʃQPO1H…t$=33D8OlV tn*4uc~3>-3u@3 (I=39rHŠIJ39s=3)\8OVà uQL$ t 3t=391H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vt 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15<31K<3|EtESSP t<3@ԋ= 39=3 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։QO@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=`4u1@$53+53~1; <3^USWV։L$|$0\$,Ѓt3!t6tC؃T$RjQPWSQ=4=31ۀ=3tw4$3 3ىȺVUUUЍ@)I3~4,IŰ31E 8Vt$0j* G;}|Cu4$SG 3tf D3@3!Ƴttt$,9} 5@3=D331ۃtQ3 3T$ 1ۅ~&L$ PjQ\ 3~3\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E3;<3uX3#3uD$,3=3=3~013 8jG;=3|h3t3;3~<$~3 3 3$3~1 ;j_G9u31;<3uD$Ph3t 3 39~~51ɋ34*1 3444A; 3|١ 3) $ 3 3 3; <3~(4 j3H3;<3؉^_[]WV|$t$ =`4u1WVP PV WVt1@1^_ÐT3H ȁ4r14T4T3X444\4 `4 \4d4h4l4p4x4t4USWVL$0D$,l$$\4$\4\4t-9Br }$r1z3|$( H\4u$$rT4t :=T4X4X4<$:rBJ jl$(jW\4tC:\4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?\4t_ )ϋ,$]}\4t\4tV+BJ NF=X4uW-\4MEu$9ˉ|-X4],$ϋ=\4t sKӋ$JHJ^_[]USWV1=T4tD|$(T$$!t3|0\4\4=\4t'9PH }=\4u11CŋE1ЋM 1 u ]u,444EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}*4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[*4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVSt4 11؉^_[]Ã=4xÃ=T4u 31T4Phi%#4V4xNH 4d|@4* 4549|jh%#z54^USWV|$ l$1Ƀ\4\4tKC9\4t41 x41 5`4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9*4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$R*4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=83~%GW8É!Ѓu O;=83|܄u<$<$US111 )ȃ^_[]USWV1PP@uejh!#2P31111ۉu WVSU1PPWV+*4u Ɖ!ЃuP3^_[]WVT$D$ =4t 541)|щƉ^_fUSWV t$ >-uF(s7h%+V+h"#+艣D$1S6]+S)S\^So SDjy WR hR#À8t>tkV聪tmSʼnD$EC$U9C $ȃ$jP'袷t$PSh%t$UԦt$Me  Sa'Ņu>tVh#A"F'UGUe jdW{ WR1FVJ]V'D$$t*P*h%#y*/j ))33t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjh%#.1N\$h9"S4h%Q)SH)h"#;)3(1S|&S[jj 臅1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS贫jh%#1KtL tGf;t=ËFHN~ ;F~à tQu VSTV1Vj 蜄1GWZWg%e1=3VZ^_[]fSWV141K4t 5u'#ar'G__ _Gt Pa GF6u^_[ËL$ 1ɅV-$t:4'W.t7^uM3414443 l44144 44t P^ 4Fu,~1S薺PW豺Fv^ ^F~ ^v;3t PNu VSWh ^_[ËL$t@;3tjh%#x)1HËA QUSWVD$T$1ɾ4=39~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J94u 44uUSWV\$SκƋ4t@PPVtu44] Dž4W] u^_[]USWV=4|$,t$0hi#W蘢 l$44!ʃtWj UQP"4u4 h#Vst4VU4Ph%#W#u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=839Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P[  $FQF^_[]V=3tjh(&#&dt$D$tt/uKV3;m?u7=2xCjh^&#뵃=2x%3Qh&#l&^jhJ&#jhy&#{Vơ3t P&[ VޣP3V[ 53蛙 ^33VD$$L$ t tC8.@L$$VhD0&Q 2>jh&#2xxPh&#j VV8||P|0tB D$0Ph&#;D$$VhD0&P >t.jh&#1l4L$Qh&#$^ãl42V2x$ 831Vh@BVPRQ_l4^VD$$L$ t tC8.@L$$Vh#Q 2>jh '#2xxPh&#j V讚V6||P|0tB D$0PhV'#;D$$Vh#P >t.jh$'#14L$Qh:'##^ã42V2x$ <31Vh@BVPRQ&4^V|$u%t$jVt0Phz'#N#^V|$u%t$jV؇t0Ph'##^SWVD$L$tP4p=3tjh'#"VP>PR Zt V踘)X!ЃtV谕5l4SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PW VӟP02VV 02Qh'#!^V|$uJt$ =4tV3-4hf%_V_h@^^WVD$t t0t$x"4l7=tDMtGhuXF 2P(4x"4Qh{$5!Emtwt su!FF2F"4F|"4F$27U V^_D$u5\46Ã|$"7VD$Hs^\jh'#7<2V)ho$&Ph'#h(#V2;2xu'h.(#hh(#h(#h(#h(#h2)#hg)#j^^WVD$t$ʃc"y$&m~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=4utjh)#$FVPMy0Ph)#^_ÉPh)#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;3~ 3A9s } uE9u9t},u E&| t23+3x2 ^_[]WVD$Pt t*$TV0PVLD$ps D$ stopD$Tab =t2|i1Gt$rV/fD,V/4 3hQA#P G;=t2|V}/D andD theDen t$VX/5x2h *#P 0Ph{$D^_à D$t t+uyL$tJQtQytWjh*#Mà$2L$%2AAD$Ph>*#!%1%2$2$2%2 $2%2 V D$t t]D$t$jh-$QVP46h#Vgt5>t 4 $484tP94#L$QhH*#O ^ËD$Hsjh`*#/Åu 3Ã|$u=4D$u =4~GT4ÃD$ u)=4| Phq*#4ÃD$ u)=4| Ph*#4D$u"=4t=3t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7Qh*#V D$,L$(t tC1ɉ 4 48,uT@L$,t$Vh#a$Ql >tejh*#Ot$5454h$jV܏0Ph+##t$D$,Vh#a$P >tjh*#9 ^ã44D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$x&d~&s wR$&s wU$P&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$QhQ+#1QZS4^[ÍD$Ph6+#҃=p4=4=4Ë h41 83+4t$4Ph,#h48 4USWVl$,H 4t&AUjQD$}ol$,7F]$&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph,#h4( 4FVEŅ8D$EH$0&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=4nAL$,9 ItIT$uWoD$,74j+o2Ph,#4V T$jV%D$,|$?+3t PI GP 3CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt W I |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh4P 4I4^_[]É|$|$ u D$Ph+# D$Ph+#͉-4ōD$8Phd+#uA0h,#j*h4轉ËI1Ph,#j*h4袉USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Ph,#=j UQ xt-u)%tt0Ph,#1H^_[]SWV9toӉQ%@jP ljtG\$=4t <\u ~t F <$t)\tPS/>t GFFuD$Qh,#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$4Ph,#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h=?#3rtP~21@USWV\$(|$$1E= 4uh4? 4*49<$l$D$l$ =\4t=P3t=4u2=D4ubPjD$P D$tD 29PaHD$=$3t=4tft$,SW  4=$3u"t14@4| j=y!d8d8#1Hpt9=*4tD4[1 4D$ D$D$$PD$Pj 9=*4t *4t, *4 4^_[]øjh4oUVVVe^]USWV\$c0V S`VU,jUVShe#UP^_[]Vt$VU uVhM?#hE4 E4^USWV D$0щL$l$ |$$t$4PWUTƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$Sj׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP!Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$SAыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVP*4t 3Z1`4WP(t>1C4$$`4u V WSCu ^_[S=h"4th"4 \$2=c"4r 2H 2d"4[V52d4t(d42VP52 9t 3^Vt$52^Ã=h"4th"4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVgOيW?#O u݃|$0xG-Wt$8r ^_[]USWV\$8T$0t$,11|$GUSRVNيW?#O u݃|$0xG-Wt$8or ^_[]SWV|$(L$$\$ 1Ѝt$FW?#NuxF-VQ"r^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P% ƃ^_[]WV t$RVQ t|$P3GuV^_9Hw @sÃtP=USWVPt$|$l"4V<$=4uԇTh=3 %#Vt$ P]Eu 348JMp;5<3| 3^_[]VWj .^_[]ËL$T$OA#PPhh?# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuh"4^_[]WVt$|$ zt!2Ph?#Ph?#OA#PPhh?# ^_WV|$t$ t%WVra7ft=<3 3 j Qu jF^_fUSWV\$l$=P4u<؉%t1U(1GWP?[PW1WPPUVd[1 jj1=31Ƀ=*4HPVWL Åt!W2 |$t8jh?#'D$ tPBD$ 01 D$ 89t V1 ^_[]Vt$tPB61 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQo ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u 1D$E ʀ[} P4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]ø)&fL$tt"u$ 8383HI 83Ip"4ʋTUSWVD$T$ 835p"4|1Gll\G9uTD^_[]SWVD$L$583p"4|F|\\|N B^_[á83~Ph5p"4O USWV 83; t"4p"4th!t 1G31K;)1G1I4:tl!GtˉP.  83jQJƣp"483t"4~PhV O !t\l^_[]USWVPL$\$As 8311H$(u831@$1p"4<#|tZp"44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$p"41H; t$z|#=83|O1;Ll |C9u^_[]USWV 83~.p"411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5p"4A1G1֋l9߻rB9u^_[]ËT$83!х1A9Hh&*x"4=4&tQ&P |"4h&"4hh&2h& 2h &$2USWV \$4*4"4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$&=T4EQ-s4C$ىË $Fw$&#Fw}$p&X!уj WRPBBtDt L=T4!153h#PA1sTu~-+$PuYQA tLу|=RP螽1 $1=*4"47f1=<3u ÊCCs|,v, l,uȡ3!ƒtظ:,u53资j W5<3QTу 8354n9|$ V5353蛅PtmƉV( +1+5Q ic+Ɖ!уRPUV*4="4H8 *4H="4wA53kP豄 !уRPaٹ 4 83VQRP<g 353,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/153Mj WP j W1P9O"@|"4OA#9 *4t "4OA# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5l4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5(41=4tȉt 2x"40A3^5$2'SWVQ\Nj*4ع*49r Ѝ*4WVS$ ;*4;^_[VQ!уu$x 83H9}FV!уtt^^Ð1*4*4*4*4WV|$ =3t5*4tZ=3ta=83|<1W!уtRP虆Ws@G83H9|vu*4覍5*4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=3=3t4$=83|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$83H9|u $u^_[]Ã^_[]鍌^_[]T*4K|$th*4m=*4t1=*4*4j jh?#"V΋At P! FVC^h*4SWVt$>t_w ! W! ߅u1F FF1H*4*4*4*4^_[h*4SWVQ1u(\$|$*4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-*4Vt;xH|p$x Hȅu^_SWV|$t$u;*4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^*4U1tHt$ !t Q9y}1I(t(t$=4tT$$1=*4uȅt^_[]h*4*4=4tUWVjW7!t"j]jRPWV je^_]Ã=*4u P4*4*4d *4Vj5<2t2*4jVx 1F=4u=*4u@11N^USWV(U ]1Nt$ t$tr:tm1*4PSi( 41 4t)1V5*4h*4 44ttxq @3*4 4t =4tj)4u=*4t*49*4J\$tP1ػ&!Ѓ1ojh?#D$Pj@t$>SD$$PL$Qt$Tt$V>*4$u:*4 *4!ƒt&9L$L$|D$;*4D$*4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d*4T$X/ t$ t$  \$(T$_CtN4$jjD$xP$Pt$4t$5*45*42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$F V= T$1H#E t0E t L$PL$THD$$e^_[]Ã=4u?h*4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ <3L$<3L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$<3}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8<33t$+ t$  }tEL$L$H1USWV8=*4*45*4*4D$$8u=*4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}*4 *4ȉT$!Ѓtsu!9t$ƄuY*45*4;t$T$$|@Ut$ 9D$ЉʋD$4$3@Eh*4h*4}!3 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># *4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=*4*4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$*4 *4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ *4D$*4D$$*4D$ *4e^_[]1JЋ4$|$9ωL$}@D$ 3 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=*4 USWVt$h*4tH>tC\$1EjU1GGGUSxL*4G=*4-5*4t~'V0 u*43^_[]W USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5*4jjSt$DPV5*45*4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9yjhP"+x*41@SWVP|$jW5*4蛺 t&Ɗ\$y jṵt^_[ÐD$1ɉHHVt$t P 1FF^ËD$@SWV\$|$OG9}7dtƉr1ɾ9rG!GjPƋtwPV~ 7 7OAG^_[ËT$T$D$D$ s1@ËL$t$t$P 1USWVt$~|$\$1/PS E9u^_[]VL$AtpqD1H^USWVt$D$Fx~1+PVE9u^_[]ËD$WVt$ D$|$tt+19׿r#"tu u x q11@^_USWVPL$$D$(t$ D$D$d$Éljd$ L$(tL$"L$t1@ L$t$0t$0V= 1^_[]SWV04$D$=`44e VjVjh*4=\tW1FVjVjh@#Cp +4P"k2=$+4TP L@2t%5H44@2PVt Oȅu +4w@# = +4$8@h^#504=Iƍ|$PhWK F<$$hU&P0u$$8 E$H $5\2WO$$hR#PA0u$8  $ $9t $9,t $9 t$ $9t $Q$ +45D44PQ$+4D$V$8tq$ $9t $9,t$ $9t $Q$ +45D44PQ$+4utD$504h"G9@#|V|$t +4P |$DI#tXa#QV@#AVDI#1V|=8441t14WPWS. ^_[V1FVt$ Vh*4Y=$+4t&|$t +4`f=2t h@#o8fV$53J 53; 63у  53Q53jPh34h@#+ t^h34hhP~ |34x;hVhA#* t9h34Xh53Q=|h34hA#7525|34V cUSWV$$$ $Fh]B#PW-t܍D$Pt$4$hhB#hV5Dž"t$[hh+4t$ % Ɖt$5l$ U8X9uD$ D$ tȀ uWxkto4$hB#ehY&#!$bh~#t$Ôt$跔9hL63jjhpB#O!hY#з4$hB#hL63l8 1^_[]ƃ+4+4A+4v9 t@+4ˡ2Q$tt$)1CSt$1t$jjVhR #WW<S0USWV$,D$D$=14V PVW* 341FVhI"514/ Vh,44514[ D$ VP514* l$jU514/ D$1Ƀ=24ˆ! uϿ1hd14WV hT+4\Uhl WD$VaD$ T$Nj 34jU514覑 =24Ӏ"\$\$34хu$4P(*t tD$HL$ uf=2tGWhPA#3\$D$)É;L2JSD$P$8輏 9thB#h34D$D$ t$D$)Ƌ$0tVPWt 9t hB#Chf=2t!j+D$ T$RPhTA# h814VjC jh,44514 t$V1WX^_[]WVjPh34h:A#% t h,+4h34HrhB#~g}u ,+40+40+4PhhP x1Ɖ5,+4hBA#hW0hNA#VW b50+4hA#1^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@34PhT+4RUSWV T$(\$$t$ 1`2PURS)ˉ<à uVh{$+1t$|$u u)u%u!1ɃtsQl2PhMB#0t Dh:C#e^_[]SWV \$ hShkA## uPthB#e ^_[zxEhShA#o# 4$юt t$j Vh'C#뙿 hl Wj52t$S jWL|$WQ[9uR1Vt$_4$DjShB#dV&WV|$ 52j/V7t@jWhR #QV6^_1@34PjÊD$53J 53; 63~{у ts 53Q53jPh34h@#" th34h^#P1t:j52P? f=2u514 h53Q4h34h{A#.USWVt$81GWhI"514蓊 1-34hn S D$hd14SD$U} Wh,44514艋 tLtFPFuf=214tjQPN P3jivt$4l$0j路D$T$1D$EHM~EHMUmڃÃ=34uf=|2u0Iڃ% tM 1f=|2@ ЈD$P D$ƒ t|f=|2Qq f=|2uf=2tT$j \$Ct,j Cu\$T$f=|2x댉\$ 넻 $f=2tD$ @D$ PhPA#k,ڃf=2345l2!jW514萉 34 34 u61=24#$ |29uj5$t hB#`jڀ tf=|2u j ttFPFuj}ÉUt$j f=2t'+\$|$f=|2TA#tA#WSP jh,44514L h814jj[(^_[]USWVP\$D$jP514 f=21=345l2jD$P514 W9=34ttػ1FU PhA#*KtMVh(+4514- =345l2=VD$P514詇 W 9=34u^_[]WVjPh34hA#% t ^_h,+4h34HrhC#^ы ,+4u 0+4Q[h^#P,tAf=20+4A#tA#PQhW (WhA#V \Wh{A#^)Lht j34USWV$53J 53; 63у  53Q53t$hVhkA# 1GWhI"514ք WSWjhd14Sj Wh,44514؅ px>jMƉ׉UI~*9u$h53Q&.Eh'C#$]11f=2tj)RPhA# jh,44514 1h814VW WVWj ^_[]j514.W耿1SjSWVVhA#b'SUSWV$53J 53; 63у  53Q53t$hVhkA# 1GWhI"514 WSWj hd14Sj Wh,44514 萦x>jmƉ׉UG~*9u$h53QF,Eh'C#D[11f=2tj)RPhA# jh,44514$ 1h814VW. WV4Wj)^_[]1W514Mj514=S菽WjWSVVhA#s%WUSWVPh4C#[Z1GWjWj95tDƅtZWF9uh:C# Z1VjOVjD ^_[]hL63Wjh# hB#Z1SjSV-2j/UVt@SQU, hL63WVh#hB#W0WVPjh$514{ f=2t%52>t=14VPVWL 1FVh"#5145 |$VW514a ?nu52hB## ^_VPjPVh.B# t=14u.5 2V_yVh4B##ht$=14VPVW7 jkj{VhVhVB# V2t$2jh.$514~ 2u2$2%2t$2t$2f=2t52t$$52f=<2}%#tFN"Pn2t$22442t$2j2t$$2f=2}%#tFN"P^WV,|$8V514hFN"Wt! $#814 $ 8148141GVW514 h814Wj8^_WV,t$8W5141hFN"VC1Ʌ#G OWj514K8^_V1Vh{t 514Q jwiVhzt 5143 ^S\$1u踬jP~[ESWV|$\$1FtCWPt1^_[fUSWVl$$1D44044/4%PhP2hD#t$4Uu1I~1L$$D$=/48O>HЃ sX 4HЉ5/4jhP2hD#t$4U ߃ufH1K$&<D44뷃EF<jh"S赩 jh#"S蝩 h"SWD$QPuV<hȻ%S'h=#Szh"S$_=/4<041@D$<$XD$44=044<j/S044k<$$YxD$ P1PhPjPP5<X /4L$ !P5<hE#QR?14`4414=<W莸*ShrT%h044ZR 1@1H1HD$1@$D$~1HD$$/3)t5|$L$(4h&%V7t50414`4414 Vj@Vj5Vj*Vj/45/4hE#j VTV4$jh53踹N"w&P_ D$tu1=/4 1A111ɣ<2 222=44t 2=14t5/4 uW6uB=14u5/4 u3^_[]xVhPE#HhE#AhE#:hE#j,5/4hE#!hD#hD#hoE# hD#hD#jhL63jj@hE#jhL63jhhF#djzfUSWV,|$@h jaW^1ۅ/4=14h/4;u.j 諳1=14ȍPULx14j}14x3=/4u?jPЮ 14teQx14Uh{$/4WŅ?1GVjw=/4t1O,^_[]ÉVQ=14uL$ @Vj514& 1Vh t 5140 Vj1@/4jh/4:fWVP=/4t 5/4t$uhH#oƅhH#Xt8/u22H# P Vh2P5 ĵ%1\&9uQPt$赸 &uڃ=/4u%h/4hN$t$ u /4%h\44h$t$ u \44=`44j:h%I#t$ 1Ʌuǡ044u'>/5044jV.044D445X4414`44=/4u /4%\44Y1ɉ `44044t=D44uD44t =04lj:h+$t$U 1Ʌ 44=14u6D44t=`44tP50441145X44j:h&t$ t 2j:h%h|44hYI#t$? u |44h44hB#t$ u 44h44h"t$ u 44 50445/4/4t%j,VtA1ɉ5044 /4^_Vh(I# Vh@I#hH#jttu$VhH# %hH#hH#$jk fSWV t$ |$6=[/4/47/4 /4h_I#P/4VW8=141h 14S 814 14%D14%814%<14fX14 d14814fV14P14h814jSf h14 h14h14ht j@ J#9/4tI#Ph{$Ȓ14 x |AEjj514p xPj514p hI#ju heI#jݜ1hyI#VW vtHЃ rt+vhI#"/4ō HЉ/4봡/3)ǃG<1<=3DHu0W蝬=r$hhI#`hB#jhSGhWh/4ߧ ?t GG?u04/45/4hI#j V WjWjWjWjzVtuhE#hE#jh53%hI#ذ2t 04 h"=14t52u,u5=1452{52hI#jPhI# WVƿL63PheJ#W VhJ#W j{=14th14htjq jSWV52t>u+t$p34t P Viƣp342h"Vts24h=#VtahX#VtShc%VtehȻ%V{t1L63VhJJ#W W24$11ɺ20 ߈p34Bu^_[ñ1WV,|$8V514WVxWV y#NF=14t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj5148^_h814jj SVPf=2tjVt$R 20utztD$=/4„u20u1f=22몈D$< t< u>jV514z f=2t|$ #tOA#PB`u 2 <2tu 2tt A8u1f=2t <=3DAt 0=3DAD$jV514 f=2D$P3 /h 14jj3 USWVt$D$ $1=14hw jD$1CSjh 14SW Vh{$ h14[-tWD$ h814jj t$jUj=14uD$ 1;$ȃ^_[]Ët$$4$53H 53~53H 53h53eȋL$ < U;t$ KD$ V1FVj 514h#@Vh14,SWVP2\$ x2t%/429u Gt+t' u9tpD$jP514 Yـƀ_r24^?t@آ2424 2424h24h{$ PW1^_[P53H 53~53H 53$53t1Ƀ=24!YXD$_r24^?<t@ 2424 242424SWVT$L$D$=24ut1<1241F9uRQP)f y8thzb%讋^_[h =x2x2/4Ft2_r24^?<t@ 2424 2424h24h)J#_r24^?<t@ 2424 2424F t*vPh24h-J#p/4~ v 7^ÐWV1F,44VW514ad VW514e ^_USWVt$jV514oe  uD$41؍oD<jV514Fe D$< t r֍,f=2tt34t P? u2D$y1D$h#Pg t34tD$y2D$nD$jP514sc^_[]1f=22USWV1GWjpWje: VWVVjK14fC14CfC 1l$jjSKd ~}D$tvjh,44514 d ~],44Bt8StGWuG1GW,44U514b WUl$514c 1f=22D$hU514c jƉ,<=24  A9rWD$Pjb f=2t34tyf=2~g|$_r5,2Pt. t34YSQ;Y~ڃ tZG9r QRF l$!y-b8u!PWjl$U]VEh@jf=2tt34t P}j3fSWV2t32^tP諤tF tFFu҉5 2hJ#hW#h^#WUtRVhW` t4=/4tWhJ#Ej WtWV%%2^_[USWV|$h+<%Wj Wj=Wt@C@uSh%Wu S6ÉXj?W蹷t0tO@t8JS;Q?!tOYt@t ytWhJ#~5=2t,2Ft = @t 2t~vuك=44~h#744^_[]SWV΋44C!w\C44؋ 53Q53; 63h53j ]44 53Q53 X44#|>W أ44NI$&WhM# 44@44N Q1f~ @4453H 53t; 63lh53j!l44v WhJ# `WhM#44@44N tEPP-44V53H 53!6h{$444#|44h#6^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!nJ#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh%S&uW 1@WMljR1^_[SWV21t8ϻ2WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$&n tWUttjPu Uw WيF tQfB t 耛thJ#"4*N 1?!9~ t~ N 9tF N^_[]hJ#fSWV,1f=2t hK#|$Q54$ D5444544hP#44tpp 0hP#f 44uG54zP#ttjP##54P#@tOA#QPhOP# 64tPhP#44uu+ 440Au*hP#N 44 P# 44P#"h44u VhP# # 54=u#554tOu544hP#7M554Ou544hQ#54tPOu554h2Q#]jU$ thO#lUSWVt[ׅtf΋X&t#\&tVPt%]uWVhS#w j44^_[]hS#hR#hhS#hR#hh!O#PPPhS#hL6344t@t h44ЃjnD$t@0hkQ#1h\Q#hQQ#hh!O#D$t@0hQ#1h\Q#hQ#hh!O#RD$t@0hQ#k1h\Q#hQ#hh!O#USWVhR#>1&&,H&QhcE%hL63P&t*tu6hL63jjhR#hL63jjhR#hL63jjhR#R#tX#FKrhL63j ^_[]USWVZ639u1Ht$Vhht@P V$PPftхu! $hX#h<%h{$hL63 &h"hL63 uhL63j &D$l$4$sf@8tD4$t$xV@SPSV2  \$$Vt$SK1D$0D$,D$(D$$d$sD$4j@HPz st$st$hX#8t$hX#'t$hX#t$ hX#t$thX#L$9&t uQhX# &hY#|$4tD$4PhY#|$ gvVD$PU褟 16D$8uT$Bg)QPRD theX#-1@^_[]USWVӉ͋t$V܏ 1Htkt$t$VSUEtGUAt$t$VWUE9uVSW \$ $ sh^#sh_#s h<_#shY_#shz_#zsh_#js h_#Zs$h_#Js(h_#:sHh`#*s,h?`#s0h]`# s4h}`#s8h`#sXf|$rL$Ia#fw &L$T$ t$"VRQPha#h^#h^#jogD$f=212hjD$$P  fD$|$<2fD$ $T$2h{$mH$&L$f|$a#ta#P1D$=ufD$L$IL$}1|$D$L$ t<=314/Drt#E9uT$ЃDPha#~|$uj}jPP/g jt$t$ V VhiWR u hvc#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$Pϸ G$0hSW貸 jl$UW wha#2h53赔Wh:it$Vr uO j.h53联jw"Wh:iV- u Cwֻ8)|$c#c#P$rkLPD$$PQ肕 $<1|$Vhb#Ot$kL4t4&hKb#)hbb#48~1D=P!G9uhn# 4 D$4!4"4#4$4%PSWRQt$hxb#4(hb#444,40k<SWPRQPhb#_4`hc#KhBc#>4\t hQc#%t hVc#ho# 4d6|$1A t$t&u/7t$t nu Qh[c#FL9Mt$ $t$qV 6P$t$RV5h2" Ph]#hL63 jUSWV։1hUS胵 jWS׋ sUPPc t'Sh9iPN tV`5Ĕ^_[]h%h^#jaUSWV׉1hVU jSUX }VPPb tAUh:iPϠ uGPhza#X1FS4Đ^_[]h%j`VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Pha#^WVhub#f>r1D~PhT&&GH9|j]^_WVhub#vf>r91D>Ph"[ 9} j:dG9|hn#*^_WV$fGjRWÉ WhiVT t Đ^_hc#j_fUSWVu }6HhOA#j荨 hc#VWxj Hw$&t64x64ԃBu|1PP5<W p64불|64646464t6464너|6464sjh53;q_|64S3=/3=64u.1L$A AAAQj j1 =x6464t646464|64531O=t64J$3tch#V@t^=64ukjjV0 ƅD$ PVΗD$(!=<\$yB  53u1PPVK0 Ɖx\$6463=t645p64PL$Q/ ƅ~E164VPS^. i)u5p64564t$x/ ƿy564h{$S64531O=\$t$9ȉQ@0L$5p64u ύD$ PSm5p64r*V~ 64Vhd#-64p64646464V/3h{$R643Vt/3hd#ˋ$B65p649fPhc#hL63 1@64J$;53t=h#W苤t1k#=64u^#PW:;? \$53\$=64 1$ӋFHN~ HVƒ =64u u u1G1=t64up=x64u< u7 =64>hOA#hd#h53 63@t>$@$Phc#h53ڃ 63@ t_  =6453H 53; 63h53j$  =64x53H 53; 63h53j^:=|64,53H 53; 63h53jMAڃ53H 53$53H 53^53H 53!; 63h53jI 53H 53I 53H 53M53H 53%; 63h53j-ڃu!53H 53-<=3DPuW53H 53; 63~ƒ t53H 53h53R ڃ53H 53"; 63h53j^ڃuv53H 53^?tЃ@Ӌ 53Q53; 63~ ȃ t 53Q53Vh53P^=F @t564h{$ N64f 63@ui53\$t V豣(53%53Wh{$M641;`h53pu64e^_[]h I"j~VhJ$fUSWV$$0%hOA#jj 11E1D$D$D$D$$׉jh 2h6d#$VxUQ~Hw@$d&ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<$ىY1ɉPXuG /3$T:-u"j9uzuI /3 u /3)t u <$u|$uM1ۋD$Ã<$D$ @tD$ $4u9>WuTWh|d#D$u5t뢍D$PW*u!Whd#MhGd#jGT$1 |$ $jSV u h &P@1u蒫8V1CHHf wy$&|$uhUÅu뼋ss 萝 PVhe# |$u.jSU!) ss Y PVhe# 1F $tCPpQ|$t KP;AmPsT$Z|$Osh{$FJ1F7h &j/SPPhd#hL63j蟿fUSWV$$61hOA#U -:4-:4-:4-:41Che#VW] e'H wu$&:4-:4-:4Ńo'fil:4뙃prv:4oa:4:4:4%:4-:4-:47:4-:4-:4:4 :4:4:4:4:4:4:4u /3)ǃ=:4:4u-tX1Ƀ=:4=:4tL$H=:4=:4=:4=:4tʉT$4[b:4jb:4Pbt$lVUhH2%\ 9rUhe#\hH2`H2 @2QT$/u>t$|9A@2A @2I2vy/th"e#hWe#jOt$ D2DhU j蕤=:4u$PhH2g%$PhH2%u@&8uT\=:4u=:4t@:4 :4t3D$ P6 %1#$=@txUhH2D$ P6Z%u6h{$jDO#D$=@u:4 :41ۉ  t1ۀ|$/uhH2he#.t9U_r|/u (IHr IH9/touɉt$P;:4USWVT$juQ PqD$1t$CHfw?$&ss ݗ PVt$ he#2 Pshe# >|$(5D2C,H2)=|5TShH2he# t$V1Ga{DuO|$u C(D$?Cj/D$ P}t L$)@L$D$h#Q踖T$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2hf#t$PVD L$@2@2=I2vx/u H@2=:4tD$PhH2"D$PhH2/"T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h#f#{ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2hIf# 1Gt$#KPqt$1BD$ $<&=:4L$ QP T$ :4 :4sHtbffM J4QJ4T$ :4t$/D$ !=@8fush}f# jSt$ V`  1G)=:4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=:4t$tjQ\J4H J4<:4tICPphH2i!4shf#'D$ PhH21u=:4thH2shm" VÅc1G1 8uV`e^_[]7h{$h &j~Ihf#hf#h6!ȠhH2hg#hg#h?hf#"fWVt$$D$(H0JH(x,z H4x8J z@t=J5u4PVu$#D$=uܔYjPVuB#D$=@tM19t<1jA ŋ9uU諩Vh{$j=PPhh#hL63訴j~USWV׉΀=J5tj}$hVSEH =w6SIt)$ PQhP%WSb9Г?A =J5u L$QVЃu#D$=@`荓Vh{$31C؍e^_[]Í\$SWu#D$=@=J5u"SWVu#D$=@=J5J5>/uD$PVsh#X$hSWG WwFt?$ VPhP%hW'D$PWh#t VQ$2D$PWÅJ5WVE/PV|t@\$L$/PW|t@L$ Q\$Su)D$ )=|\$=J5u=J5h53jWhh#hL63 53H 53~53H 53h53&É؃t9 t453H 53~53H 53h53ƒ߃Y=J5u#D$=@uWFMWu8=J5u WVJ5 PWQVQtW#1ۀ=J5$J5VPWhh#fhL63jj hh#{c9D$t$QVP:j Ƅ fDŽ$.$$PQ>\$4$9|$ t#t$WPi$ D$Ƅ fDŽ$.$PQ $3$$3$ $3$$3$  WVhh# fD$L$TTPQ7ËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP輀^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPV^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP$^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP~^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPs~^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP(~^_[]USWV |$87hOA#j} jent7D$Phht@j-t uD$tL2K5 K5K5Eu K5t$41۽hi#WVR? HσG$&K51K51K5 53J 53; 63~у t 53Q53Guh53Q)=tK5tXD>53J 53; 63~!у t 53Q53Gu7h53QșL$D$ ρÃK5T$9K5}`;L$}XD>53J 53; 63~!у t 53Q53Guh53Q253H 53; 63h53j 53H 53 1D>53J 53; 63~!у t 53Q53Guh53Q衘53H 53; 63h53j v53H 53 e^_[]SWV΃=dK5t vrhf%c1TVO^_[SWV΃=dK5t vhf%1TV^_[Ã=dK5tATPqhP%ʑ ÃTQh{$踑Í` f w5$&53H 53; 63h53j@I/53H 53; 63h53j*53H 53; 63h53j=k53H 53; 63h53j%D53H 53w; 63oh53j|!53H 53g; 63_h53j/苖1@á53H 53@53H 53=֡53H 53%á53H 53|밡53H 53/1á53H 53*USWVl$(}=HK5tE G=pK5t=PK5t(DG0K51 hK5Í4^69L2} ^_[]{E ;\2~*P5K5G tM \2K5K54FMt%$Q  Qt $ B$Iu$ L2șƉșD$$t$D$ D$|$1ۋt$=PK5t( K5 U tt$ ;4$}Z;D$}El$)š53H 53; 63h53j w53H 53 MuC;\$r53H 53~53H 53 h53j D$@D$;D$ ^_[]jLUSWVt$~=HK5tF G=pK5t=PK5t(G0K51 hK5Í,C L2-9} ^_[][Gșljș|$$.1E  E;|$|653H 53~53H 53 h53j 1V =PK5t(41;$}D$)á53H 53; 63h53j 軒53H 53 KuGm=53H 53~53H 53 h53j b^_[]USWV|$=HK5t_ C1ۃ=pK5t=PK5t(C=0K571F  F53H 53; 63h53j,̑53H 53, +N,53P53; L2} 0; 63(h53j |;~&53H 53 "53H 53 h53j A1W =PK5t(4_ŋv53H 53~53H 53 h53j ې^_[]fSWV|$@K5W%t pSPN7 t81PWV Vh{$VG ^_[hj#Whe#jUSWV$U%4(F$$1 |$1 9$)덄$PSUD$PY tXǃt-tat$[ ?tL$T$d$.?T$O$E1 $ ;:3r9vL$?T$$$^_[]SWV ΉRQS+Y 1t4u t|uHth53PjSI>t V\ lj ^_[fUSWV$$3m1hOA#W\ W%%$ D$D$ hZ&%SV| mu05< tChPŲ$WE 뼃pu D$ 뭃u /3,uk5<h|d#j#D$=@u.$VtP 9r*thj#j$|WP| ty/t AƄ/@L$M$D$S |/uH9tx/@tj/SQޅt@VL$rShj#1A $'@PVt$  ٍ$Ct1@$Mg4${WePPhk#hL63j{K5USWV։π=K5ujV1t~VW3t9gf8uR\$@SVt{SW9Wh{$1ۀ=K5VWhm" VWh{# w=K5u=jW蛉uWhj#H#D$H=@V "=K5/jVQD$@PVjW(uD$1Pt$LD$2x OA#tDO%D$1Pt$\,`1Pt$`aVPSt$D$BPhj#hL63]#D$H=u}1PPWk t$HhVO \$D$K5K5V^CVhk#(1C؍e^_[]ÉVh-g#hL63諄 53H 53~53H 53h53ZÃtH tC 53I 53~53P53h53Z 53 tuÃ߉1ۃYM@Vh{$W'$K5S. K5t$|$SPt$  Å11S5K5t$X 9x߉=K5t{\$(t$,l$( 0i&$$L$$D$ l$ |$T$ fT$l$\$l$T$K5RQPVSt$(t$(hAh#hL63$5K55K5t$  Å6|$W\$St$uVh1jSS5`2D!ƒuX\8fK5-0L55,L5 a1H 22=H5Ht)t hn#52hm#jL 1%h[n#jP52h8n#0j^_[]USWV1N=TL5=|2 2uhn#j٤K5<uK5-K5sgK5 H5SPhlP5Q@ u5$ u5L$QPhlP5\hlP5CjuhlP5[jhlP5^uH=pP5/u+-Bu"pP5PPhqP5pP5P  h53WVhlP5M<63@ubu5u5 u5 u5QP.t H5P(jh5j xsZ1e^_[]Dhu#0jՙ USWV (2x&,2kL29|׋yM1II1$u51PQÅy19}WDu=2hw#j.hh$u5OÅy1ۉ9|(2x(,2kLSh$u52y݅u=2tehw#j迗$u51E$sVh%u5$u5P( )؍$u51Eh x#ji1IkFL2H5Sh$u5#1ɉ^_[]USWV D$H5xGD$#u5$1F1$u5SQ291CH5h$u5hlP5P$ H5Qu*D$PUh$u5Q8 $u5tu=2hw#j耖t$h%u5h$u5 $W1CttUtB:x9u=2tFhnw#j,Wh$u5Q19uh%w#j1H ^_[]hKw#thlP5Q<t  u51hw#USWV1CH5PHH5P yjƉ׃=5t/52t@hv#0j4 e=h5t Rrx7t$t4H5P(jh5j lzbV1ۉ؍e^_[]Ít$\$D$u5Hw5 H5VPhlP5Q@ u5D$ u5L$ hlP5kWehlP5duy=l5tShpP5蔾t^|5 5tShpP5uhlP5UjhlP5Xt@hlP5Emu5u5 u5 u5QP=pP5/u+?<u"pP5PPhqP5pP5P 5 5tShpP5谽 5tpP5|NPWt$hlP5)6Q=|55D$L;t5D$Pt5PhpP585t5t@t=5u Pl=2t1u5Hr@tZ tUhlP5l'9D$X;t5D$\t5?uD$PhlP5$Ã|$=5ut$hlP5ÅH5VShlP5P@ =5uShlP5/!؃=5\$C=56D$P5HQPQ 5=5D$L;t5D$Pt5u5u5 u5 u5QPDy hlP5j=5\$^=5QP5HQPQ D$L;t5D$Pt5D$X;t5D$\t5OPj `5D$uu5D$ u5L$ QPpt5x525P5Uu5u5 u5 u5QPhlP5ji\$=D$L;t5D$Pt5Pj T_5USWVj/hpP5%1UhpP5 ?t>5hP5hhL5UC /tOGhhL5WUhpP5hv#jjO1N,K|/t1NuhpP5hv#jj^_[]SWV=H501F H5t9t71hu#jێmQHbH5P R=|5t i<H5x t `m#5 5t#55hu#5P5aZ 5ujhlP5^t(u5u5 u5 u5QPu1=|5thlP5hxuthlP5lyH5P(ljgSW, xa5 5t&=5t5P5hx"251G*ƃuejh5j{ ^_[USWV $H5xu d?*1FH5P,H5@0D$ jyD$T$=h5jShlP59]jhlP5Q$=|5thlP5~ghlP5+thlP52du5 w's1PP5|h5V $jhlP5Pƀ=pP5/u+4u"pP5PBPhqP5pP5Pn =5t4$hlP5Z' 5t:P5|Pt$t$hlP5s.PhpP505 u5hlP5T$t8=5=5P5HQP~dQ cH5L$Qt$lP5SPD ƉPS?&=5tc=5tZP5HQP~3Q 2Pj *Z5PhlP5%dPj Z5D$L$ʃ|QP  u5u5ʃ|QPxnhlP5*1C@TPhlP5Z%55|h5h}v#0jhlP58chlP5)t H5P4 jh5j讯 =x5tn)11Fe^_[]þlP5PV$Vb뙉PhlP5$뇃=|5t cxIxH5PHx11@USWV $$h 55S = u$ /,4ŏ4/t EƄ4/FED$P55h#D$=@`1Gxv%xmlxd=h5t exRhlP5!(ttjh5j5 Gm'155hu#j 1GĐ ^_[]355hv#0j҈55h:v#뻸 )D$ )D$$hlP5 X|5 5tV1=pP5/pP5t$PUC ;D$vhpP5h\v#jN _D$PS艱ElP5WT&W^jhlP5Kt'hlP5K`hlP5&'VShlP5NR xơ5 5tD$PhpP5I=5t5P5hpP5+5 u5=p5tEhlP5C=|55D$D;t5D$Ht5hlP5{u5Ht 1PP5|h5 $jhlP5#Pt$hlP5 WhlP5D$P;t5D$Tt57wD$ PhlP5;5tk=5tbD$D;t5D$Ht5NhlP5hlP5^^D$D;t5D$Ht5D$P;t5D$Tt5X05|h5h}v#0j蕅PlP5WWWhlP5!PhlP5=5e=5XP5HQP~ Q Pj S5 D$D;t5D$Ht5Uf(5(y5,5u H5@,5=~| h~Ph8x#thPhix#j蜃1Hã0525K5y x1<585 (5,5ʉ@5 D5(5(y5=2u=,5t4=~| h~Phx#thPhx#j1H5K5 y x(505@5D51L5H5(5(y5~205USWV=T5thx#j艂1I^_[]Ã=,5052u,51IxՋ=@5+=D5|$\$52UVSWzP)9|11UV$)݃(5|JD5 2@5~H505PD5D5;@5r֋ (5 2@5D51)ȉQPx[(5Ɖ5D5 2ȣ@5)=H5L5 051<58521h'y#jWV1N=2=2uhYy#jy1L5H5525(5Z12~9} G{u'Phy#j~ xI1=L5=H5525(5~ (5 D5H5L5 @51^_ËD$L$D5)ʉD5QPR USWVu ]1D$ D$ D$@5 D5)ȉ9؉| D5)։ 05QPVSM)ЍT$RPQ 1ID$L$ )H5 L5|~ @5D5)ЅqxUtX @5D5D$9ؿ|‰D5)ظ|D$L$ 1H1@D$D$e^_[]V1=P5525(5~# (5 D5H5 @5L5V1xC=H5t/x&5L55H5525(5~P51 T51H^VD5;(5v*5@5)QjP% 5D552^USWVt$\5 X5ƒ|]; 85<5}O1hz#W}=<5=85$-(52 ( @59)1 -(51ۡ21PUK;2tS1<585S(5 2@59)QP륉85 <5Nj-(5S5@5U^ +D52)US85<5(5 )VQS" D5H5HttT51O1^_[]É-D5USWVP\$1~cl$@5$5D5<$)"523x3ǡ@5$5D59|WUV 5D5)11H^_[]USWVPD$~Z\$ @5 $5D5ŋ<$)Dž~9@5$5D59|WVS 5D5)D$^_[]ËD$)USWV\$ l$؃|~@5D$=D5t$)#524x\ơ@5D$=D519|VQWD$ " =D5)Éظ|$1H$$^_[]USWV$  $x$|$D$|=5t7P$y#%$ hl#0j.{$|r D51N@5)ȅ52  D59غ|PQ$辠 ~|)à D5 D5ظ| uXP$$3D$8$3L$4 $ hy#jUy hx$ hy#j5y L$$ hy#0j z'$$ hl#0jy111o^_[]USWV$$x$|$$D$x-D$PQt".$4$hz#0jny L$|L$1$p0L$1@5 D5)ȅ\$^ D59|4$ST$ RT$RPQ$P~R|$ =5 D5tP;CJ D5)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=5t% u!$9$t4$h:z#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=5$4t1PWy#"hl#0jQw1HD$sD$$P$<4$t!Vhz#0jw $l$ l$\$ 525(5W̜ lj\$11ËD$ 9D$D$D$(5}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525(5$<B ljޅz11 ͉$03x$3|$ uRD$$P$8e$3D$\$3L$X $0<$\$t*Whz#<$Whz#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[] $0hz#0j8u1K<$<$W$4hdz#0j uUSWV|$7t6|>/u/1N=`5MWh{#js `5.|$tjh W֚ V $=d5d5_Sh{#VP;$]ƅE<$8$S x<Sh{#P$E;$]yw0=5t5P5$h{#Vjs15d5$n $YQhq{#0js1N^_[ÉUSWV|$?/tGj/PƳUW蓜u/Fj/VƅuhW=5t$$W jWCAy3UW%u%D$ PW)jUPWV/Fj/V]1ۅA4t*PWIt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P;yu~Wh{#0j r$tDPf[y$h{#0jq$} 1$d5^_USWVD$Et$$^߅tP蚘y.Wh{#0jpq=5t<$8$W 1 5tt)$($u7=p5ujpl5Pbp5l5!UW2 2t%1PPL$H$X$T$W$tJSWy!GSWh{#0jpWY$% 1$d5^_[]WV51uA|$ t$t$WL t(5P5JWhG}#0jp1N^_Vt$#D$ PV#t%5P5Vhe}#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=2t =2D$PV赘t Vh}#0jKo_=2u&D$DL$HL$$Mbl$L‰T$=2u'D$PL$TL$D$ Mbl$X‰T$WV]t68Nu} u&WVubVh}#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV脗t%#D$=@uVh{#jm 1HjW |^_[USWV׉L$]D$PSt6St$誖th^0wwS tՃ} tL1@_1=l5uTG3D$ 3L$ uKG3D$O 3L$ u9t$h~#jUl 1St$hN~#Vj6m1He^_[]ø#D$=@u%hu%S tS0S\V} DSh=~#0jl댋D$$u1@Ë $jPUWV}wPVŕ1@xN=l5t1A$$3L$ $3$ u*0$3L$,$3T$ uVh|#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $&55hB#2uu=5tlD$PUǔuZD$ !=uHhWU" ƄD$PW胔uD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU5Ut$趒 4$UkYL$ t uu$UFD$y)Q8=5us<$8$U xZL$ A$t$UhL|#0j3j1H=5t2<$8$U Uh{#Wji1ɡ5tt1Ƀ$ !($t($t$$55hl#/jU7xN1=5=2=2Uh|#Uhu|#j7h 1OD$PUlx=1$ ?#D$ PU1@=5u;L$ ($/t$h|#0jh$ PU1@Pt$6UK21 2t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW胑1x1K=l5t މ|^_[]ø#D$=@u5hu%W1EtXWyĉ|#$t W7Qy5P5{#XWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5(5$5 55L$T$tI AQP DUVP 9t_L$ xZjPUQҋT$0y@oEP Džt<$\$MQVPW D$8+$T$0)+|$$>h}#jJe*t$8h}#t$8h}#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjhh5S舊 y%}#}#\$lSV0je^_[Vt$ xFP襌=x5t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(͊ ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$(wxE$($\h}#hl#.h}#j%c #$(h~#0jc1N|(^_[]V=5tt5=5tt5=5t@t5=x5uh |5t01x&=x5tDyhh~#jhb1N^WV5tPX~1551Nx5t 5tqA5uj153H 53~53H 53h53QtN;42u1tB |59G= |+5xx|5 PW1t-|58j5t5h|5ۉ^F=x5t%5p!h~#j`1Hh~#5x5551^_[á5t@=t5t5=5u0=d5t'D$$u5tjP55% WV=x5tB5x5t;11G~u)uh~#jA`6hi#hL63(, vu^_USWV =5u%51N5u5}$ $ $L$P}5t#HHf w=$4&ph\##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$pŅ   5qhp#0 ph$#p j_e=x5t\@PL$QL$ Qpp p09Bx85jjt$t$t$t$ph@#p j[_ 51N1 $\&LJ$Ƅ  LJ$LJ$=x5twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G 5 VqPB  5VqP! 55hl#1u5@e^_[]fUSWVT\$tl$h=5P($辒T$L$X$1V8$UV<$OA#OA#t4$tVjQjRD$Ph#Sn( $u2@$%  RPh#Uhi#^|$x$h#S(EPD$Ph%S'$Hs Uh#u# Uhm"S' SX^_[]Sj >8USWV@L$E\$CD$PS{3j9#|#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($WVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPSeVSXGu܃^_[Ã^_[<USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V5~1F1u5h#j9W^ÐSWVL$D$t$|$<5t5tt\^_[鿪}\1KZ5teSPti:tdx:/39}j <@/3sPVW hV5:-u/5È5n55`S6h#/3=S6h'#hL630"?^_[f1Ã=5u1áH50h́#jV 5t"H 5p0h#hL63!55hB#`u_sUSWVd|$|j/75t@l$x5hB#P5B#1CL55D$ D$1D$$jh2hك#WUHЃJw$&;t$$@$&<K5묡2t 2t52r2t c2P=2#\$l5! <k,5 ,5K5t#K5`%255<R2t 22\$5tK52eL55LK52=5.h5 Pt$] * NL$ < 5$LFK52K52K52K525<5K5c$5q5<[Z 2@K 28<8-u xK5D$ =05u 5522K5#5255<WO d55s5d2U505?K51@D$ )2 L$ ƒ ʺL63t53 /3P5ƒu 9u , l$D$kL2H55 5A"1$jh82h#WU胤/~HЃJS$(&42ƍHw$&5뫅!<K525|K5c$m|5@Xp5ˀC`51K5#"h5 <@Ƀl~mtKotRpd5SatDeJ1A 5 5 2 2 2"25 2@{pe<K5SH53 < \5X51ɉ5<"]55<L$h jLjh2Q]H5bl 5<Vh"Vze245 5@5< i@5\L5d5K5`%55<9i <E ,5N545 $! < }t555< =l5@x5 2%=2P553 0akG1A11|$<$t5D$tGNutNj]]h^#SG1t[h#S3uE55j55S^ 1AL$y#$]15<$D$h#Sl$\$th^#SpDžu 531 ðt5h#Siu35Sk I 1urL$tP؅uAJjh#SR uP5D$t t P CPwىQ ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h#St W=45<$l$S|$;5,21ɺ G1Fmفt#u41A 02<1A 02!521ɺ.1!# $ 4u H52=rnFr0s9-/3D5PM/39}j4NxP/3@/32/39 1VV4b x/3@/39| QhN#j?H 1FPh#V(H V5<h8#hS#jHj5<h#hh#5<hd#jG L63Vhz#vD%52WV 52WV Vh$C5<h8#0h҂#jjG!j6mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8Uh^#We1D$h.D$1$h#U2th^#UDžu J53tkðtAh#Stjh#S  tj1ujSðuh#Ut W=45Uh#l$}$l$h#WI]tjWB\$rt D$W2|$ td^_[]áK5t8uhR"ʮK5t8uK5R"Uha#j E USWV|$f%UW?UV董NJ00ht$跩tAtZ/UV?UWQ488ht$vu9t$h#0jxE1H1^_[]á5t H 5hL63h#jWVL631FWVhh#WVhhN#WVhh%#WVhh#VUSWVPˉjPQ  փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9Q$1>tj,VbÅtj=VNtmj 谸 tdAE0H@5=5t ,5s,5uh?#j6B1O^_[]hS#h|#hS#j B4$ ɋD$L$01WV55h#hL63  t(ο#Ph"$hL63  !uءT63H T63~L63H L63 hL63j ^_SWVPωPQ4t4Ƌ$| tC$Si t'ǍCPVW DG 45 451^_[USWV$t%t_݊M\tS8uEEhm#j@EjѶ UEƃjSV5 t3l$hUVPȯWUhՈ#j\@S $EE<\t:uCCU2 $AStRC1fGt,PtStgtstp1B ы$J@u $A=85tZ<5HVVO4$) Wh#ji? 1H^_[]VV h# 85 <51V4$ Wh#USWV\$tK;tFj tLNjl$1pS3G woD$G95@5t%D5x!h##j>1Nh8#=@5=D5^_[]WV5@5t;11GFu)uhe#j^>6hi#hL63E  vu^_USWV@51 l$$=t5Kt(=d5t!9t)@tB9uKKt8<@5CSk Dž$h#j=z$uEP衒t?NjCt /C;W轡C |/uHC C$#h#j2=Ct/C1N^_[]USWV|$LJ$@5tOwCu kPUC |/uPV3萐 t2[u1=`5O=t5=`5 2$=`5tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=d5tGtlD$@1G8D$@1D$\1GEt$ h4#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVhN#j59tNjE|$tDD$@t:$t$PVh#hL63Vhq#hL63 $t+Et$h PVu 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7&P5L63WVVj辄uD$L$ L$$VjPVj蕄uD$L$ L$$Vj'VjluD$L$ L$$VjVjCuD$L$ L$$Vjՙh#H51555P 5t$,NFF FF |$WVj. y|$ujWj WVj y|$ujWj WVj y|$ujWj WVj y|$ujWj TWVj~ y|$ujWjf (D$,WVj J  WVj6 0=2t3i=)‹1@?9 tR=5t3<$/>3i=)‹1@9 tR 51QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=5ujh=ȭ 5#t\u#uGW¡ tjxGj jW Q />3i=)Ë 5,t 98t#@u $j艣 t!8h $1(Wh#j9- h#hl#j!-^_[]USWVP|$1N=5ujh=ˬ 5#t\u#uGW袛 tjxGj jW ۛ />3i=)Ë 5,t 98t#@u $j茢 t!8h $1(Wh#j<, h=#h#j$,^_[]USWVt$totij/V81tEt\N1B1߀Ѐ r&,uu A1.MCAuɉha#j+1H^_[]1j詡 ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjvS CS>tKt^?tYڃCKt6C;C C})VWh#j*S@ h#C=5t$5X Vhy#jW* 4Vh#551Wh#j** SѰ hB#}VQhƍ#j*USWVPϊۉ$ts<=311JDhu.e[YAuۉ4$聮Åt>V,FN4A1RA113W辍1J 4$$d&G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSLV!1҃ډЃ^_[]fV1=5u*jh 3 5uhy#j1(1N^USWV 51Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj誝 Ël$EP~| $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3耭 Sw Sl h#j&1NwUSWV5t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j貖 tx@ LHDh#jY 1^_[]USWV5CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj蠕 J1ɉHT$, $$$P HN HF F t$1 H;@u 5-555-5Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@5=5l$T$s}ډD$0! umщjt[5=5 tIj荔 t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Ph#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=5u*jh=蔝 5uh#j1N^WV5t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j( t^t$qtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<W) h*#jj ^_[]USWV 51Kt$/>3i=)‹/uPVDžj$蝑 tWW|ptN$$QVQ4y8~V Q(y,~VIlNF 5F5 53Whu#!Whu#j V褡 Vh^#j ^_WV5 5t~1F 5=5u~ t v6蚫2 2tWWvvvv 6踫=2t v6ά6 V 5 5u^_jhÀ=5u1WVL$T$t$ 511H<>u5Guu%P=5t511@^_V|$ |et$>t\jh@#Pom t 2=2t#hő#j|j 21H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh#j^_[]SWVh1Njh#SWu3h#WBu!2u95Džu91FWSh#Voh#h#h4#V WShb#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD Sh 5h5   Ph(5h$5  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQu 7耜 1D$ereRPQu ^_[USWV $ $Hw.$& e| Rh#{=5x1ۃd|Rh0#Q1l$ hVU $ jdPU$,t $$$Hrjtr$@ L$ D /f@ 0 wh#h#h֒#h#$F1 $F2 jdPV:t fF0 $j j0P0 5 5t5T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U諻 $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U= $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U̺ $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R޹ t$ hN#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%hk#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh@#W)d t1H^_jh#Wd u(=5u,5u,5h#jjUSWVl$hUh1N\$1h$WS蹷 K$ǃ4$Yt"Yh PQro Ǎ A/G<rH )Uh 5h5o   Ph(5h$5G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VP޷yElQQP˳ 1D$@$$$$$ȃJ-σwY$&<2ǃ$)$QgtxuH%-u~t6h^#VDžu'躬0 PVh^#jH531FUWlt5Ë$rt$Vhq#j$_Ft1N153t W谡^_[]fVjhP"'xKh9"P85t)h^#V<51u;585MV4(=h5thP"h-#j 1H1^WVPD$$|$t T5t$5 5t"=5thL63j J5L6355h"W 4$VW Wj  ^_P85t$L$T$ $RQP 585nXSWV|$1N|5<5t,\$OPWS t;j S|1t^_[SWVPD$ $|$t T5|$t$5 5t"=5th53j I5L6355h"S 4$WS ~Vt Ph b$hL63i hL63j  ^_[fUSWV} u7ThOA#j虛 \$1hx$WV~] LtPt߃95/3D$h#Wgƀ8/hI#Vush#Vua$PV_'tKD$Phu%H't4$3D$ $3L$ u$3D$$3L$ t1PPsƅu j02Vh53.63@uj۽h I"j?Q*PhM#hL63 j谽USWV$$6hOA#j 1Ɉ @5 D51Ch^#VU[ e~%q~3كrtރvt_x@5ŃV.PtrكRtwftAiL5P5뒃Wt6duqH5zT5lL5P5WX5ID5;u/39|=L5u 1Ĉ^_[] D$h8 jm$D$,$S_ I9v9/u؃@]9v8/@tj/S|t@À;.uCt<.u{t0\$u h#eC\$`5EHu]j$8u `5P觻jЈ\5a$8tӋD$t$ VW$ X5tRtD$WB#=L5u 8ts8?ti8t_Wh{$EHtj PWhe#x +D$@uDH5u;Whۖ#K`5;;=T5uWPڀ=L5utV/tD$%=@t/==D5u uWWTa L5 P5х ˉ4=X5u Ő=@5t@jPt$  u hh#7P9u荤8VNjGHHf wO$ &=L5WOwP"{jWV/" GG \=L5uWOwP:GHftIfgft9G =L5u P PW}G  Gw_L58=L5uG ?tow 胕 PUhe# c=D5uO1zuSwt)L5t 8t18?t'ߢ8ut/wh{$gB`5VWDž6=T5u =d5td5wawh &jKww 蠔 PVhe#jJҠPh#hL63 jXd5USWV΀=P5uLVhx#hL63O hL63bz53H 5353H 5301C=\5l$$#E=jRD脡8D$Pu+=D5uvVh#1Zh53Ɖt9 t453H 53~53H 53h53Ɨƒ1ۃYÉ؃^_[]ÍD$x OA#tDO%1Pu轛1PuVPWSD$Ph#hL63USWVAӉ΅:#K1jhV $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =D$W1PPPW4 D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWf D$L$D$)T$T$ 9D$t;$SV`5Vh{$>)`5Vh{$>WO1@e^_[]Wu1PPPW$ uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW_ D$L$D$)T$T$ 9D$t1W1PPPWz h j$P; KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW D$L$D$)T$ T$9D$tEW_j1PPPWɅ Th j$P芙 CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW+ ;D$t$$P$!P L$)L$L$L$ |$D$ hWWq|1PPPWۄ fCXK\D$L$ȃ|or \$9ËD$| S$PW 9D$)؋L$D$ظL$|W>1USWV\$l$UEtMƊAuA)k')<5j)UXGG SEGh5tVG t|$u G?<5w u wu W u  <5u=@5t^_WVt$ <51G&uGP5WVPo 58^|~u$PPh#~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ55^_ÊVF|uܹո ѹ Ǹ É)B$:@B&uVPQhf#NfUSWV|$,t$(S=5jLVft:xIuxNt@jLPj Ve1tE@j Pe)=55 555"1,=5uƉSϱ^_[]ùۗ#V=5)u ^5 5Qh#nWVOA#|$ |$wL2 P2 P6>t'F P6QP6N@>vuڋ7 P6QP6t躲 @뭅訲+L2@Pů56VrƉRPh{$Z# 1 ^_USWV8׉ˋ 55D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh\"jV/jVt$ % USWV Ջ\$$St$$tƉ׃=5%up1҉  ډD$$=5&uU1ۉ D$5 5ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$&  u !ڃ SQWV599 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVlƉ׉^_[߹L#]#@#wSWVP=6 56Q(Ɖ=6=2ttxt>uG&}1ۉSPVw Ɖc9u$8t*R8u+$t@& t$@u^_[ùj#%USWVPՋ\$St$gƉ׃=5uKh$5 5MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա5HwSjP ljա5uND$5 5N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH5 5N"ىWP1Eكra$"ى=5#É5݅~h5 52É׃'1H5 5NLىWP1 15 5NىWPÉ5L5 5NىWPe$É׍Eكw5|$4t;~l-5b1A1Ǎt$WSh\"jV{jV550't1I1@1l$QPh\"jUEjU6 ؉^_[]ù#T#J.#@USWV֋] $t$ơ5 5L$ D$T$uPV֋=5Ww,&8&}uPW ֋=5ȃ}tً$VPt$ ֍Gw&;E Qȉe^_[]fUSWVf2$1h#B=etujX60\$h$5VSSBUB@PJá$5)QPSc $5)١X6pQVBPS)$>jh#a#ƅu)h# >-u~u5(5u5$5$>u%t<.u 1.D8t` $5(55L2$5V5(5h# V5$5h# <5u=@5t^_[á,5t HQt/tA1A ,5UVutf>/ua$Phu%tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Shx$軺t/hx$診uX68LtjX68j75$5uj=$5522f`5$52HQPP2Q 522@u1[h#]$0eu Ph-#Ch #9SWVW!WP{u2\$V迠҂8"u6WWPItV螟$5V胠^_[Åu莂0t Phc#j$5tjPh#l h8#fUSWVD$ 2fa1Ƀ|$‰tpыLhe#Ss$th#Ssu 1t$.4NJ]taM\uNEU\rw$&\0u!11ЃwxAunjt$>2HQPP 2Q t$.PN    ȉš2HQPP 2Q<$t*2HQPP[ 2Q 52 2Hu 1^_[]ÁfHhw#jf45u|L$ 85jPLV=<5t @5K15@50ppp VPje 95P6t =2ujV}V;~^jpPT$=5u 5D$ $1APV@5<5t1It$aLVPL$T$ D$$PD$5jWVP|$t$D$$54$ WWV׉Ρ\2t P29ty u hP2C =P55ui}Ph"hd2P =T5t5T5h"hd2/ t*t$ Whd26 x4hD%hd2xVp Ph{$hd2 2HQPP 2Q hd2o ^_SWV|$t$\$ ~SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$}4$w^WVt$ |$}WY^_PT$D$ $1IP>XËT$1It$)VfT&T$ L$9upu'0fuQhl&j hD5D5@^1X5`5d5h5WV|$ |t|$wL2 P2 P6>t'F P6QP6薜N@>vuڋ7 P6QP6t j @p515J+L2@Pgơl5PV p5^_USWV\$0t$,|$W56jVi j膶=<2thƉ؃$1t7=2u.D$0t f $uQVi=X5u"Wj"=<2u11EiW賙u p5D$0u^_[]jUSWVL$,|$(206̓V$$<&Uw1ۀ=2_=X5Mjw1ۀ=21=X5$=p5jwH1ۀ=2=X5=p5uQ=6tjw1ۀ=2=X5=p5t  u8V胘1tu p51l=6t\UW_j\$0SWh a=6t0WD$,E=6tt$,WK_=6tt$,WE\$,SW=6tUW=6tUWyPh# hP2Ek=6tswww. p5@jw1=p5p5 jwa=p5t p51VVŖL$,=06t =v2t p5tu u^_[]PjUSWV@|$T545D$$w=.2tttn656P$Pqh#dGtj P52 Kȅuh.#452l$jU;th545585j<$t&4$h5#52|$p5\$X<5-45j w7D$ <5u=@5tSw<5545jB <5u=@5t]<$t&4$'h?#52@^_[]j545hUSWV\$;s3=.2{656POPh#stj V52 vh #tu h#b2HQPPZ2Q 52l$<5ttu .|tF1ۃjU|Sl$SPi~ tuQV/|p5Ju <5u=@5tjs:UsVp5 <5u=@5ttJ=.2tA{t;656PP(h#52^_[]SWV|$d5jw1=2t d55p5^_[Ë\$1X5u/? p5ut΅tSw5p5X5t"u8\5H \5KX5jw=2tru+\5H \5X51 1@65p5+USWV1=2t5p5|$0D$P`m[thUS- =X5tiD$d5,$\$4>G6=.2 6PQ Pgh]"Zw O2HQPPG2Q=u2HQPP2Q 52juw I Sw5p5=2uZX5t"u*\5H \59X5m"u\5H \5 X5 d55p5D$P ^_[]USWV|$0t$V袏@O 6jPw+ _1=X51{t'G6$pWXWuuޡX5[tZtT1=X5uI=2u@l$41; u{C6Us t=X5u =2tʋ-p5-p5V ^_[]USWV\$K1t@ <5PSwƋk1OuD$}t 1{PuV_y uR <5u=@5t~ jW1|$x4$Yjt$jux W1<$t$"mE{t Vv1 V{p5 <5u=@5tA^_[]Åx Wco0a PhG#USWV$$D$1t$ 6D$$T6D$DX6D$Ht$05x5$P5|5E6L$XIEtH1F\$Xljtw蔹uG6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG6w.tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P8$D$XtH$r4$ ȅu$1ɉL$@=2t=h5u|$ ~ $@D$@D$ )$=.2656PP$l$41dz=u)2HQPP2Q9}j=WH?Ɖt>u2HQPP2QFPpU 1Ո`1t$XtOË$t)2HQPPO2Qv É΅u$u t(PV52 مt ȋN΅uء2HQPP2Q 52W|$ +t$4~jh&W u|$$ƅuf|$" L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$6 fD$D$" f=6t*fsD$=T t= u ft$}u$D$@f%u D$<5jUqD$,ED$D$tD$L$` =~2u f|$t$Ut$4$s t@p5|$D$D$`t$d!D$,F L$<5=@5tYD$t;=x5u<5=@5t.t$`jt$hyL$D$Hs*|$" toD$ t$,;up5.u D$ 1@t$,o<5=@5  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]6D$(6x52'<NjD$ 45 D$(6=x5x5Y1PPWw O1ɅȉD$PPVd6\$pfh6D$ Hd6$l61p6<5 6L$( T5L$L6D$D$hPZ <5u=@5t$jV045D$ 545|$t&D$1f|$tH T6X6$T5h t$8nh5H h5=t$L$QPy h5<5t$9D$(6D$DT6D$HX6D$LT5hd6膚d6t$pD$ 45|$Pt j <5u=@5t=X5u 1X5\5D$@z$jW诣45D$ =45h!t$8H5x5t$Ut$8>oWt$Ut$8pD$ffD$0fD$8D$L$D$u#|22x22@L$D$5D$pSD$l45D$ 1D$T$PW詢t+85D$|$D$5=45D$$ 69t;D$=X) t=6 u)6D$(16D$TL$$PQ t$u |$ uD$0ufD$D$451f|$ˆQPW$5$X6|61@</3D$l52f`4$t$T$$L$tp5D$ 45w2P22d2|$Tt!D$(65D$tD$p5D$D$tFD$t D$f|$t$lQ<5=@5t|$" t j|D$u2F x2)N2|$@tht$Dh83& $P^_[]h\#5p5t$1=x5ȍPu =x5u"D$4thB p;ȅu~5x5t$ t$,Pt$=85uS'h#hd6d6t$p|$Pt jNt$hLD$(6D$DT6D$HX6D$LT5D$ 45jP腟pa0 <5u=@5tVS Phm#x85ux5j_p5t51_WVt$tr|$w$&j Wv M $@Fvu;Ftj WP( $jpV ыF @v 빃^_V t$t8>u3Ft,p蓨tF 6QjRp ^SWVQ t1OS jjP t6l>F1"jjP tvA^^_[USWV|$41GGG =2l$0\$S}<5AjUfjUPh uA<5=@5t 4$1CSt$WSU\$t$w$w <5u=@5tS=}^_[]h\#VPt5u1PPVPjh2tF$P`{t5t.1QQVPjh2tt5@=PATH5t5h9 t5 2 2^á|5SVhOA#ޔX68uj1^[1ۈ22蠎55thB v65X6A 6SSQPVh5áX5ËD$ X5\5PËD$@\5 X51X5\5Vt$ |$|v܉Ph#1@ d59~1Ҁ8cBX5 \51^WV15p5VȓX690t\W'{X60PjPH555`5h5@`5jw5`5JW {p5^_USWV$6$j/W.t@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVGuD$ %=`uVyjWS ƅuWh"z%Wh# Whۖ#L$`5x `5V|$|D$ p p5`55h5uu~9} ~ X5\5^11@1USWV4hOA#|$$W覞T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hƛ#52](14^_[]UWV׉΋ 5uj'9k< 511D$ T$l$ Di&D$ $,$<$\$ D$#D$v?6u0uFjha$Wj %W|80uHx.t x0@te^_]fUSWV|$7j/V+u#$jVP uaK$$WV4Y Pu 1@Ɖ$m=5ud$$UVuG.Y8t8Y8t.Y8 uPV't XVvju$P OfSƒrtt~ 57PSCPVhe#jSWVt$|$t$VW YXt MX^_[Ã|$u0xjWC6u`65V!jUSWVPD$tnt$ t%1;t <:t9tGt$,89-P2}v,; L2t,WSQL$ 1L$ |9/u 1xAA/D$PL$Qk5E9u,;E-5L$Et <:tEL$<:t1ED$(Q $+ L2AQ:t^_[]USWV$1C1D$ 1D$D$D$\$h#nHw5$&\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ X69AX693t$$1CjWtV@wM$,&|$t&|$ t4t=02x'@ |$uX6H X68u6PVD$ PW9D$ft $|$t $|$tftjWt jP:4뇉4|$ÿ5/tPEȃw?$<&|$u/|$ u&u |$tf<u t$Um묃5r52,2$@th#]1@$$$$^_[]SWVt$<55t5Hftfu9502| Pn/ 9p}Ëu̓5r <5t^_[Ã=@5t^_[USWV$G$$L&o6EjWS PqM䃼$$twh#VhH#GPh{$`<5wPQ_ <5u=@5t hR#yD$PlhX#_/th6#Lh?#?GPh{$ t*2HQPP2Q*2HQPPV2Q ^_[]ÃPWh\#SWV|$tWȊ Bu%iC)ʾ!)!53tFWPDtc6|$tT<5W PnƉf@@ WPe <5u=@5t u15^_[<55Q,  <5u =@56USWV$$$j/$T#turfEE^69tthz#Vkt $j$q1Ʌt@@t`tm$umtisD$ P$xfE$KP8P8}P$ u=02x $u  \u =02y& u $MƋ$1Mtfyu02YL$$j$P 1OD$VmG5tAPh{#{t$t-'55h#{t>/u19}-9j$$PM ƅvvD$ PV\x3D$(!D$ =u8=5$Nu$N8tN8t ND$}o$E$\$|$$t$t'52jS\P$h]S&VfEo$T$pƋ$$<5|$ÍD$ uj$HfxT$ ufBuω7 <5u=@5t ׅt"G GfEG EG fEGE fEEĜ^_[]<5T$ Éuj$fxE$ufBj <5tbiVC+L2PujVtij$t3fxu*SVm$=@5V$h#SWVP&1t8|$&L$8u%tWP>L$ t us^_[SWVP&1t3|$&L$8uWP\>L$ t us^_[V&t%&jPf@NHu^V5 02trft fuxB =5r^USWVP\$=61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh{#wt1<:CG럡02y x5021Ʌx $y $Q502^_[]SWV<55>t+fuwW% ߉?u׃5r <5t^_[Ã=@5t^_[WV|$D$ <5jP+@ft*fu vfFGF GF GF <5t^_Ã=@5t^_WV t$D$L$ <5fO 2fOPGWVU <5t ^_Ã=@5t ^_jt$itfxup%1USWV t$811G$1D$h#<ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPX6:KBX6*#$1\$ D$4$߅u U@=&t,]&&8uUP:ujU*ƃ<$t0vhi#4$X6H X6(t|h#j vxtuh#vhi#*X684$t2HQPP2Q l4$t%Uhi#Ph,#+h# ,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$\&D$j/UgjUj~%G0f9 Ph #:uhh#:YuhN#Bu hd#7t.Uhi#+6 t$|$tJHhy#t$X6H X6(ouh#n$V돡6D$ FjUD$PK P.dN<$uOA#|$t9#Ph2#Shi#t$ct$1 ^_[]h##ctOA#RVh֜#Vh#1PPt$  5L2@PbUSWV|$D$\$=2t5H 5 L2 5 P2 P61ɉ 5 05H 6SpP6tH P6~55dH 55+L2Pb8545u%Vjap 8585s45UVW85-85545x=tE450va585΅u!Id5P62V'8545t O85G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t`6t D$2 d6D$5+L2D$?~uЃtRWT$4$ D$1@D$ wy< P6H P6f5e$!PVVoT$0/>u!y@u=D$ D$5$P6H P6R5Q=5un5+ L2;L$~[xuUH5QP6H P65P6H P65$ |$D$5ЉD$$ P6H P65aT$,H 5>~=u|$ D$ RV"T$4| u6P6H P6~#5%`T$,H 5 X~`T$,H 5$9Ut$ mT$45+L2jPHPT$8 !`T$,H 5>P6H P6~5 _T$,H 58 6_T$,H 56_T$,H 5$^_T$,H 5D$$ 4|$tu^_[]USWVt$,\$(=05t`6t$D$ 2&j8\XNFd6D$ 51oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=85<5<5u(Q9PY<5NQPS5<5 <5 <5u=@5tP859t31Ʌt AuQP "u=857vA 856^_Vt$t"850v585΅u^V5 5t1<56P 5 5 <5uۃ=@5t莻105 5^USWVt$(PY5+L2PXL2Gtr}t  KvC#:t /tQ t7=2tAL$,u8 P6QP6*[O@랃tPgY^_[]Ã=P6u ZP6L28t!PF tx P!Yu$h#ljPXGËD$,tÊ&$< t< s4< w*P6H P6~5RZH 5P6H P6~5(ZH 5Gw/u}/uE-P+ USWV,D$DD$L$@9A|$$D$t1&‰T$D$D%D$ j=L$Q D$pD$$L$(<$ L$ u:|$L$D$ PQV1ڋ\$L$ 6T$)11G5+L2D$D$<$u \$H l%t$l$UPRT$LQT$L$ t,1t}y;@ڋL$ u55+L2=2\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =d6t1C L$@11ۃ9|$t$ |$Wt$T$RV; WqL$(/<$ }D$1|@uD$P6H P6~ 5ՍQ5BW5MP5EK1ۋl$$]|$ D$EÊ&$< u.P6H P6~5 VT$H 5P6H P6~5 VT$H 5]EuKl$ u% 5L2)5 P6\$\$L$ D$E< w.P6H P6~5 VT$H 5P6H P6~5 UT$H 5]Eu1L$ }D$n $Ip$&|$tP6H P6~T5R1G>L$u0L$ QV1>t55U75ۋ\$uh$U\$H 5=5+=L2t$ t$(St$ WVdu5=L25)=P6S1G5+L2t$PS  <$t[1@Ftuրut܋ 5 5̀tuŠQ1ۀ؉Hu,^_[]ÉRPhƝ#d0)Ѓ56hޝ#F׊t!#u(HL$IQWP56h#D$ƃHQWP56h#USWV55+L2D$<5 5D$ $5D$$(5D$(,5D$,05D$5-T2T2|$0WhQ+L2PjPD$ P$WWpQD$,,5D$((5D$ L$$ $5 5D$055-T2D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 <5u=@5tJhWt$跭 yk28t<5HD$EEt< uD$C낉$L$}1A9P6} nRL$ƅ~N$ P6 FK1:P6H P6Q FK1Ƀ=P6 R1ɉƋ$|$t&$< t$< s< w P6F$ P6F<5D$ x PέD$t Pb D$tPi=|5$u+L2jPt$$ 55 <5u=@5t˰^_[]USWV D$4L$@-55L2l$)hP#D$P6H P6~5PH 5=L2UEWD$ PN5+L2PM56W=ljӍD$ PNL2 55) P6 P6 iP5SWh\"jP5xt$GF9Iu|$"tjVU0 5A 5P6)P6D$ ^_[]SWVt$|$\$05t#9Xu 9p ux2j0L 05 50505Xxp ^_[WV=05t$ 95(5~?= 5<5?P = 5 <5u׃=@5t赮 505t?9p|<58P 058 <5u=@5tn 05u9q~)q$95$5~ 0505 55(5^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) #VBts9touOt`w9tY&tM9sWT$uF9t;&t-\$09s BF9saԋ$t$d[$t$ǍT$t$D$P7 tPt$P 11ɉǍD$09‹t$r \$4;t$t$|$ mb 8|$TĀ u 8Gu tMtGOGʰ[t$|$ \$0|$Tt;uCK8 1t?tG1@18^_[]SWVP|$t$@t<*tt`P6H P6~5WBH 5`62p55515^_[ÃЃ w"j PVs !8ű$<=tuw~;5d6l6bd6D$5l6ØD$D$‰؃AD$$Z|$ T$L$T$|$,&$< u*P6H P6~5AH 5P6H P6~$H $ 5Q5 @5 $Q$ P5$eØt25 $Q$ P5$eØt2H 5P6H P6~$H $ 5Q5 1>5 $Q$ P5$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-GP6PP6=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r<59tH9u f%8/t Fu%Q8D$;5<5tF/}tEEGXـxs@<$uokt$itdǀx .u.uN jWt$G t8tG@u@/UPWVh/5<5=@5tt$tWE/Q <5߀xruX@8tB@9tD$P5<5|x5<5,Ą^_[]ËD$1Ʌt AuQPFWV|$ WB@P7WP.j7p 8585^_USWV\$D$|nOʼnmIWP)|$SUÉps x 7u߅u҉3D$^_[]SWVt$(\$$W7C 5L25P2P605jsP6H P6~5k9H 55+L2P{6jVP W7^_[USWVt$FPhQA#2HQPP謥2|$Q1ۃ|11E4E9uSh_#衩2HQPPR2Q|=1C4轤2HQPP2QC9u1^_[]hA#rhA#h|5H |5~5H 5#=~u|5H |5USWVP82H |5t+u y|5H |5~xhP2Ӥhd2Ƥ 5182~PX5hSp臒 {e38t_82xL8#>WjW !Pjj  h#n82p582@1ҋ5  5@@P t 1+5|582{tXAˋ-5M 5~ @لt5أ|5=2t$55D$訢52JD$5H 50~^_[]ø|5515|5hc#USWV=82w <5^t)kU9~D(< t< u <2Hc F5F|5F 5G $9t VD  <5t^_[]Ã=@5t^_[]V |51~^Ë82r t ~6u1@1z|5 5SWV\$t$|$<5 82y tje1 82I  82A$A 5H |5H 5H XtK =55|5 <5t^_[Ã=@5t^_[WV$<5jW襏ƍD$PVuT#D$ =uD1PPPVK u2jPV u <$ELF1PPPV uZVI9t:$Ph <5u=@5tCĀ^_Wh}#蟓VŏhǞ#茓V貏Wh#xV螏Wh#dVt$<5hm V?jjV  |$ t82H~Q=82pxuh/ 82A1|5542 <5t^Ã=@5t^Z82tL$T$9PuHuá|5 82A 5A5A42Aj8/ 82@1ɉH H$H82WVt$|$ <5|$t=5W|55542 <5t^_Ã=@5t^_锑V582<5Fx PFtP ~ u82V 82H |5H 5H 5@42 <5t^Ã=@5t^ 82Vt$ 829t@5tPu^hߞ#B=82@5t-Ã|$t=82@5uH5~P#82@fWV|$ 9=5=P6@2t PډjhP"@2MP@2hq Pu5@2b5B9t jj1VjƕVj軕Vj谕賎 L69tQjq1L6P5@2脕0 hZ 59tQj5P5@2+5@2襈@21VjVjVjܔ=5@1VttV臎@2Fuh#肛2^_0 hPhe#0 h0 hPhA#蹎@2;D$u D$@2hOA# EX6SWV=5jQEƋPh{$|-1GPh,$؞G;|ۡ2HQPPz2Q 臝5@2ctJ<5V[V <5u=@5t/^_[h#菍h#腍L 0 hPhe#fVt$ hOA#C^USWVhOA#C=5X61FjPlj+5i5rO@QPh#艝 |,Ph,$cE;|ۡ2HQPP2Q WX68tH X6@(1^_[]h#;h#1USWV\$n;%u(sV8V08H#KSw8#dS8 5M55At#~i9:0#I {5#4$D$D$=5C1tQ~H$8?uEt$P%uUt$ 7t #tl#K\$ueZ*t%tS-tU+EР#D2x+;5}#55it #\$1|$ t5^_[]áD2t 5iߠ#뚽ߠ#SU2USWV5)i5rO=D29u=D2)5~9ut Ku ]t]tu`ǁTtCiu3itit0 5D2^_[]SWVt$<5~X1tttG9uމjQu19}q~5@tu ƆH <5t^_[Ã=@5t^_[+55i5rO@Phǟ#g+55i5rO@Ph#LPZ Ph#8WV11Fh)#>kt!Zu忀ރlt puԉпɁuX6tg8tbPh{$#Om=2u =2u@X6tA52jPvW:X6H X6@ujNW52 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh%W\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th6"jD$P ] 5)i5rOC-D2+9tti-;)t RPh#jl$ U蝖\$D$P;$t+,D$0hơ#jShS\$ ŋCt:tBuM ,%Phˡ#jQD,ingD,Runn}=tQP l$ ,j SP0 D$xxl$ ?Sml$ ō,@)QPhԡ#0 hf%jQ芕 ݍ,P(WD$P赐݃FD$ ݋\$GHO WH EuݍCWPj$u/1M|t؁Ph,$Wx N1MM|FGHO WzH GHOl$  WVH|1GHO W2H ~T$KW衐D$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =2$tCt>5@2踬9t%5@2詬PV肈$=5~y\$t$1=5tEt*t t.<$u u/S0=5u WE;-5| $^_[] 0a hjPhe#:USWVD$4\$,tl$0|$WUS ƃu8=06t<555D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o5D$ 5$iD$ 9T$tcu tQ=P6t 1=2uL$,uP9tPtu 2P <5u=@5t^_[]Vt$<59tP džƆ1z <5t^Ã=@5t^#WVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$h-#W5t$ntpu6D$D$D$t X68D$t(1PPS IjS!A=5u|$ 15-X6~6@ 5D$u}t!AH Et1jPƅt=u ED$u >u G t$EuX6t Dt111D$uD$5L$L$t$D$\$l$|$ 5@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$5C$jU9 L$tc|$tNuJD$1rȋi4hQA#jD$(Pfl$D$D$L$D$u UD$\$l$t0~Ot)D$5y\$l$D$tUD$tMjPSx ?jVDžtjuSW =2u V| hŃ퀉0^_[]h1#A{ShN#6{Shd#+{USWVP1$1C11hp#~1it"gu$ڃjt puЉ̉( X6t yjPƅt,1t5)i5rO@Ph#4H$t#tH~1i0 tPh%11G^_[]Ã~1i4hE#蹊2HQP~G ;| Z %PRG ;| 2Z;|lht#yh#yV1=5ujt$ Ot1+^V1=5t. 5~$A51F:uI}^V=2tO=P6tFD$t+ 5i5rOA1ɋ2u0VQh#R.^USWV=5u655~%=5Ft WN5l$5~"55HI}<5tfiPƋ-5=5iPUV ~ ;uKuU l$hnƋ=555i 1҉AJw)׉=5 <5u=@5tw<5fdž=2151B|iP <5u=@5tv^_[]SWV\$|$襔ƅtt.VSt$W\$<$D$ #^_[0 Ph#vUSWV|$ P6tW`W4~*15P6456V:V~55l$t$t%t =2ttttk0hWjWjt uumul1VrVh3%&qtOh3%h}#ukVjuV5@2.{tTWj{Wj{t*=2t!WjzWjzWjzu5^_[] 0N h|Phe#'uUSWVt$ l$|$1ۃ=P6t/t*=2t!ttSV<u5<2tEL$ji4DDt QP ^_[]WVD$t$ N 5=2u=22t=5jP=5~5>f@..@.^_WVt$ r<5NJujVj 瀾tW5@2by<u%+5i5rO9D2t ijVt=tu  ρπtt=ttu jou VG <5u=@5tr^_0 hPhe#rSVD$L$ =2t1ۅ SPjF ^[Ët$1҅tހu1=5u25u) 5~5:tzt Iuh#~51@SWVt$$1@=5|$(1@$"$ &Wh#bjvu h_%#hDO%tjjvjv 1~ h#21@^tjs%;th=#hp$jvh%1Wvh0#1Wvh5#WvhA#jvu h_%#xh*#kjvm~ t+u h_%#GhE#:jv <u h_%#hL#P#Rjvu h_%#hX#7h]"v hfA#jvhW#jvu h_%#h!5%;h]#kFp]hfA#P~tF1SwJh#.Sw 1> c#th#P uhm#hm/$vhr#v}#'1#1###1#N9tQhQA#jWWSxuF x%PhQA#jVVjv S h#51^_[h:#h:#jvUSWV fD$ 5 5l$ 1D$U$u1!" $|&]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻JQ&!$}D$##} u#$%)4$<$zT$tvӃux<&t ur>u<&_pE~FЃ r󿒡# ,$t#\$҉Ӄ9uG8,$"2D$1&<&:&$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I 55 ^_[]WVt$ tG|$t jV~t'hDO%hDO%jVvu^_USWV$t 5 =5D$P 6t x66 $=5z1jh&S$ `P>;Hx@u8/UD$PV ix D$pL$t 1D$tD$p1ɋ5955tH1 8t:tGt89=P2Z 9=P2~55L2WPVX >?#<=P6 V: fiDle cDhangD ged߉Vv2HQPPv2Q D$pL$t 55E;-51-5D$PĔ^_[]/fUSWV<1UjD$hhh UPjc 蔣蝣f9u 9È6j U8e 6j|6hOA#U h#̦2,$Uh6&t$T|$P456蠒L6P6t.fD$PVWVW(=6 Àu@{=2n$h#85ttQu 5 p5<$B=25=P6(ȃu6őL6P6\6$85uk=85u72HQPPBt2Q hd2tD$P<5=@5tg$$=6u>h#~&t1Ph#QPP[V$=2u2 6t N=6uEt$(Vh'# t8t$PBTPV$6=2t =\6tj&luD$P\6u/jM=2tFh"#rhd2Ss*1ɀ=2ˆQPi=2u=\6t4265p5_p$$#uSWVD$8t^<5jP aƅx jVK <5u=@5t&ex"1=2t=.2t.21G ^_[11=2t 21jLV3V:=2tt.2u2^_[ USWV|$(V11C=06tCn1=2u4t0j52qjhd2q2P =<2t.te=2u\1Ƀ=5 5jPi1;tW1R=2uIu=2t7=2t.h+#pEVu%$uDV#^_[]Vt$<5jV;_x1jP| <5u=@5tWcj^Vh}#ct1Ã|$|D$pPmmft$ thH#act$t$莸 thH#BcWV|$ W貛@Pz tWP^_hH# cSWV|$P29~b9<5؃P tr H2 L2P2H2 <5u=@5t 'bP2<55L2>L2)P2 <5u=@5ta^_[hH#ObD$t L2) P2L2j hU#j[ yD$ H2 L2H P2H P6H T6HT6ËD$<5H T6P <5u =@5FaVt$<5H2;t H2Pd FL2FP2F P6 <5t^Ã=@5t^`USWVP2<k<5-L25H2T6t|F9uuH2PVP  H2H2+ P2 P6L2=P2T6tG90uC H2 L2H+HH x@WSUP] 5L2=P2 <5t^_[]Ã=@5t^_[]`hH#i`D$<5L2)P2 <5u =@5_V5P2T2x'|V5L2Po N5P65L2P2P65L2^V5P2+5P6sP2)P65L2^ËD$ L2) P2 P2L2+D$ȣP6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$1ɅfVt$ |$FX6(2Ɓ62u2jX6 \6u 2 =2=2u't#j致tjyt22<u=2u 2=2u2`6=2ut 8-u2(62u 726272uހ=2\6u:u65X6H X6`6jP#`65\6 X6t/t_9tZAX6\6Qt X6`6ȣl6i68t d6Ax@uX6 d6^{h#QUSWVt$\6H X6-t+C11C<-t1Eu{-1EfPL6A#tZ%jQh#>b USWV1\$@<uPƋtPEu1ۉ]hd6h6=d65l6p6^_[]SWVP\$t$t2uh2%V>1C$"hX#^ZD%(02u*626#42RQPhp#^X#uȡ2HQPPtZ2Q (02t"62}%#tFN"QPhw#h^ u.$(02tPVMtu6#VPh#rM<$u#52t(852uƁ62u숟62h#1 _2t$]2t(852uƆ62u ^2@uă^_[V(D$ T$429tu6#RPh#FLt#52t(852uƆ62u숁62^WVt$ ~t)~tPʦ uv趦 ^_USWV jA X6t_y 8-uUD$$X61|6P  X6y8-@P1F Pơd6)<5d6=l6~-h6Ft7 h61Nl61ɋup6 <5=@5[J1F5d6P)ƅd699St<5 d6l6lj4$މt$\$)1*C/5l69rL$ 9v!\$ۋ4$ P; l6w4$ 9vQ9wp6 <5u=@5t[IWv1 ^_[]h˥#Ih#Ihf#Ihx#ISWVT$ |6tstm8u'1z:trrD8uAÀ~:u"9u X6QX6 tf 61ɉ |6D5X6>1t6?-u1t+O^X6-uta5X61^_[Ph=#HPhP#H|$u1PjPPge<5jwX68t PI <5u=@5tG1ËD$Ѓ w#j jPh up6i6ËL$~ND$tH  l6=i6u p6t6i6ht6hp6Qpph#GUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11GjhOA#h#Y J|$:uUD$8@?jPh#Y ^jUh#Y 1|$D$0)@<Ph #hd2V jh#f1?\$D$01@11T$4*l$PhQA#j UVhUh6#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph#K1L$0L$4@Uj EfVD$ <21qqA1Ʌ 50PQ<2p ]t u 1%<2<2@j* <2 u^qqh,#EPD$5/$aQXUSWV'ơ<2@tu'tƃ <2 x,$@D$t.$xj$18uWP?tG&uD$tKjD$p*t6NjpV|WPV4 E$ht<2@^_[]USWV<2@|$u <2A1p811+ǃu<Hs C)uj X@Åt"j jtMHXE pXƉōGs1Gt,u|$uq<2@@|$Fu6|$uD<2@ <2Ap8 u踭|$u<2@^_[]jjX <2ASWVƻt u j cpxʡ<2@^_[USWV<2kE1͋ <2x t*5,PqN<2@ C1Ƀ8Qs s j@<2HOH O oKy K9t?U1CSp< &Sh&P= <2HO@ G e<2!^_[]WV@t$P <2A uyWy wWh.#4&ha#j"Q WhF#j"PQWqyuL$Lx4&h#Vho#jPQWUSWV<2@1u 1=2tMtݡ<2@xuUj Y@j@ÉGpj,aC+t<2@tj(pƉ^_[]h^#<2t$p0h#?USWV<2@$ u<2@$EŃCߡ<2@$&$ <2APUj 6á<21Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjBljF j0G5jGt<2xJjG B u0<2x,u%@&t@/@&uhq#jÀ=2tjjj` <2H0+H8O U <2p0j*@ <2QPI H pGu5<2~ h=x%v蚮m|$F<2xujD$ <2Hu <2H L$ qx0j\@<2HKH K {@;u.<2x }<2x|$ T@0GjG <2@t(HS u <2@<2x\$\$jy <2HK @0Cku<2x ux,uh=x%pj@@21ɉH H <2Q0PCAHrAAtejC9t jW\G @:<2@ u<2@$EŃ!ߡ<2@E<$t!t;tj <XÉ{؃^_[]/ uS\$|$<2X0jx@ <2QPI H X t\$|$D$C <2APsVL <2jj 5jj,jj#jj jjh=x%jjjjWV<2x$G Hs<2jpW$ uq<2p(x,u~ <2At8 u @A8 @tHA~րxru\tuՀhƧ#<2p0+p8j@ <2QPI H pG .P"t<2@F <2t1^_jjVt$&9u^jVVL$1&tA1B1t A&u^uVt$j@ <2QPI H p^USWV |$$tD$ D$$D$l$E1$<2xc <2x0$t $j(ƃF <2QVI N ~ut. <2I&tAt=t A&u1c<2H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc42 <2A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j<2 $+H8N~L$NL$$N @0FEPqj/v蕇uG42 <2+A8FF<2@4 ^_[]jjjjh#L$1&tAt=t A&u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;6}X; 6~P 6I;-u{tBuG<2x0+x8j@ <2QPI H xF^_[F h#lUSWV|$42D$̛=u ?vl$$5L2P2P6G$|$ t u 菛 t19uDp $ tC9u?,$ u42<2HH }AMt9t u>u:<$ t=uY$)jWPX |$l$$uS\uNP6H P6\FÚ u%P6H P6 F42#áP6H P6ƈF tq=v42W=t h& u42<2HH P6H P6>=L2)FV<2x42+D$^_[]USWV$$1҉T$ T$$D$(542<2r0=&t1$|$ fw|$1/fFn D$j8fNL2 P2 P6=&u ƒ=P6‹nD>  $ &=&u f|>z P642Bס<2=&Xf|>LCD>fT$ 豘T!uhЃo茘0N,s05,/L>=&fu P6Bn׍MN|$ @01fD T.fTT.fTT.fTD&fD1AL$!(ljƒ(M P6FD P6BvNO|$?@81ɃfD T7fTD&DfDfD>  = P6\G'T$ t$>Hff P6T$ Bf|>D>u6t$裉 nMn P6}f|>  P6BFfL D$$D$f|>tD>t P6Bf|>u D>v P6BW P6B*Ã{t & P6}E+=L2 P6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $R nMnD.=&u P6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD&fD P6T$ B1AL$ I) NjFfL P6B) 42<2@8xt 5 5$8W Nf|F\=`4" $"}f|  P6T$ BFu6$蘆 Ft$HFu蘖D$$D$ Poſ1۹$\&D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD&fDu6t $腅 FHF P6B}= t]\t 'u t =u 42<21Ƀxɉ 5$6 P6T$ 'uF|& P6F$Ҕ&$< u P6T$ BT$ P6 c蒔,t$@  42<2xD5?&L$ <=3DAD$D$ |$}~&f|t P6 P6B\& u P6BNf|t P6B1@D$ P6 P6B݉ý {"XŃ', D$0$* nt$T$ Mn P6B1@D$t$C5$4#U 蔏` Ń< ?\uj\ 0 \$1 HЃ w&Hw ÃHÃéOu M P6vNO|$}@81BfD T7fTT7fTT7fTD&fD荑L$ uk%=I =P6 D$ wF P6P?ˀ P6@ww P6 x?ɀtw P6@ P6W?ˀul P6GXT$ W P6x ?ʀtw P6E P6O?ʀ P6Gw7 P6x?ʀtw P6E P6O ?ʀtw P6G P6A?ʀtw P6A P6H?ˀ)*66D$D$$6 1z&t.P6H P6LjGq &u\KЃ w4P6H P6}LjG; ÃЃ D$ u t P6׃Z P6H P6)=Gt/ up}tkP6J P6#@ǽh#tE%t@Ń:bD$D$$&|¸U1#,W9u袍1|$Nf|uf|t Ms@ L29T$ vNK؃|$ؾ@11fT T3fTT3|3|t3ft1BfTft|&fq fq ƋT$ |5H |5~5H 5 袉ËFD\$D$$&{Q1&)G P6x?ʀtw P6E P6O?ʀtw P6G P6A ?ʀtw P6A P6H?ʀtw P6@ P6A?ˀa2 P6AD$ ??P6H P6~2G:P6H P6~$_1cݿ:B ˿ˆB1=&nD=&G=&tf|cf|.3P6H P6Z5L2Gf|uNT$ ؃t 4$t$:ŀ>ts4$flT$ )B<2L$H,L$H $衾<2pM tΉ$y Nu<2xĨ^_[]1HE;6} ; 6~ 6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }<2h$ Ή$x Nu=tuS$#$#42 <2A0$"#u$#b$P#V$5#J$#>$#2V <2xt@@ ^Ãx t#5$@)<2@ @8 42H0|5H |5~5H 50sƃ~0:=F $& t=uG럃F~t\u^׃ 42@42 <2A0yt5 K5$S(*;|u0d|<2@=t*蒆4$D$D$&Kuۡ<2@1v u42<2HH @1@Q&<2@-<2@<2@&tQ;ub<2@ 軅<2@蠅<2@<2@ o<2@u\u? u642<2@81Ƀxɉ 5P& jjhP" 颁Vȋ <2y8~0 P6QP6謹@ <2Q8rq8^USWV\ӉΡ<2@D$ 1,$45D$&+L2D$$UP<5$~Sʼn$S5L2Ps l$|$tD$$45 <5u=@5tw42D$-L2P2P6<2x t*5PL%<2@ hǃ[~!\u9Wǃ[C tJ$Q u"42<2HH s`un=ub\tX`tS42 <2QQ NDt""u$P6H P6~E\E \@ŋ P6AP6ȷ@P6H P6襷EL2@|$t~P贴t$jPU D$pŋȅut$ j艴E<2xtH@1D$42D$jNǡ42D$Kt5 <2At$ D$AEx<2@t$ Ex P29ًl$脵 P29~=L2P6t1SUWzp )P6<5Uxq $ <5t\$=@5\$t  <2T$ Q45Nf|u%Du P6QP6@Vt$+t$ P6QP6ܵ@~.FP6BP6ȅ踵AJ։ȃՃ\^_[]á<2L$H0hl#WF<$t 4$yp /<2@D$45jP]jj#jjVtQ1p N^V <2OA#ytA55t7t u(66542P55#^USWVt$,|$0l$UDz5P2̱1BW;L2u(V1MG69w&6WVSTn U覲^_[]Áw: t9v$P56i tã6$6랾#뤾Ϩ#USWVT$L$ -45蚂Ɗ.2P5D$1|$0<2D$|$ljWltJD$<2.2VQ-45D$P585OA#jUk\$t$l$=451F5P5D$0<2$V\$S zVh&P <2A |$t|$t=2u #@݅u:T$1rIJ$JB .2VVRM -L2=<2D$.2t$OD$45D$P5؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 61t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 6tu(Mxju PQ.Ex PUl uF^_[]USWVl$ t$\$|$t|h@VSO VSODžt9u 9t S 9u95H2}5H2^_[]Åy0] PVSh#9W_ WVSh##USWVt$ |$\$l$j茭MEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!j8@ 6$6M|$];6}; 6~ 6Eu9] u6tX9X56t-pt 9^t6SLF9t SH  61tF9Yt? 6tHt 9Y jjS  PkD$($@t 9XjS_ 1x<56  b6 69|AQjS!  ǃt;=H2~=H2x jjW  j詫$JBXxp <5|$u=@5tu6t$(WUN mC蓎1O ntuK56jSh  DžDV8t L8ujjS=  Dž+0l PShL#I\$t 2x2|$t 2x2^_[]j + PShI#ύ0 61tT$9Qt uÉVt$56j V  u 6|Qj V{  u8FPj Vg  u$j j VU  ujj VC  t;H2~H2^hS#V WV|$ t;G;6|.GPSƋG9tVPWwC w^_WV L2 A L21F |71FPWW y w;H2~H2Pgfff  6^_USWV$$$~<5 8k$&n  6t9i V 6tQt 9j b Y<(O8=2tNnjU ƍD$PV!n#D$ =nhh]n$SUoƅtjV!SjV $/nhh nhh UU ƅV;5H2~5H2|'u" 29uu-jjW 9t1jPWV <5uQ=@5tH A1jPWUy v 70x| PWVPW <5t Ā^_[]Ã=@5tĀ^_[] hh j &| PWUh# ɉ0 | PWhƩ# >1F55蠉V0S PUh^# 脉8Vt85cj0 PUh# USWVP Hxa|$\$;H2~H2oUA= VUS 1jSS t!t$B$^_[]h\#4$"1EUjUjمUUυUjąSj 蹅Vwt$ g S VD$56<5PV]6VMc  <5t^Ã=@5t^1=6SWV56t4|$t^tCx PVjV6u^_[SWV|$ H29|ȋt$|9}9| H29tVjjVW 9u^_[胇WSy PVh:#WV6 |;6| p6t$ Pj V8 y2,8t "8u>6 jjV ;H2~=H29t VE^_Vj 苣tL$ T$5606PH^á6tT$69Pt uPa USWV$|$<\$81D$ $D$1F5<5/3h{#WS9 !1C9rWUV- t+ u)CL$ ЋL$ !h%j4ƅ|$<\$l$ftL$e /3$D$)uN= 61NF1jt$;5 6|dۋL$D$?41ɈL$ D$ L$L$щD$%D$@L$SǰNJ<0u ]EuU<;=6| ;= 6|$t1Bt$ t$1B6ËD$ Ds1d$sЀu tPjW  D$#D$9tPjW <$t1BRR52 21AthЪ#1@$^_[]Vh#QUh#Fh#<09u PWh#Vh# ҂0u PWh#USWVƋ\$|$tWh$#52 OA#t{% %H&ut&PWhcE%52E!u,u 17t3Ph,#52 u1}th%52E uttVhP#52q h"#52^^_[]SWV|$1\$t$tFHN V@H&>tbg%Vq tV1 1^Vt$t)Vau!VhQA#j h6(6׫#^WVt$ |$t FHN V& H 1GWPh{$V ?t uVh"#  FHN V H G@u^_USWVl$ \$ut&h%up>hX$Wph#Wpuo1<6tE<546Y 6t jV <5u=@5tF@u6>hF#WpthL"Wpt D$1p@|MD$K}h%Wot8D$D$h׫# j521CKD$D$u}h# v11 t=t8<6u.u hܫ#v VaPhD%  GF@uh"#A F@uu=6tk1uu莩ND$E11P@É|$t<6tW46hi#Ah#<6t46 h#{SfPhP# Eluh#52 Cu|$tE1F-<5D$t P贘1<6D$t46V D$6t jS< <5u=@5t2Et h"#11<6t:68u.u h#aVLPhD%   GF@uh"#/F@ut h"#1<6t?68t3h#46VPhP#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=6t61B=P6tbu^1Ƀ~7t@tuH1=24 6t1Ҁ9ƒ (u1=2B1ɉσu1B61t)9t`tbփub1^։PjSux $u=2d1@ָ PSMvt^u6u jSʿ1D$ D$D$$K?r x 1@ jPj ^_[À=2u=\6u =2=21@V<56>t8t6YS 6r6 <5t^Ã=@5t^SWVt$u 61ۃÿ6t668t+<5SP <5u=@5t6=6ru^_[,^_[V1=6u#61A:t2>u 6r^WV|$ _w06u"t$=<5tg=,6u^@5WuS =6tӃ<6t>68t2t-0606=2tu=<5uv0^_WV|$t$ 6uWVj6<rjVsuƆ6^_á86=6t1Åt8uUSWV,61G06<06u@@uu06=6u΋46tã46ST-p5VjPVP !t<$tS--p5m ,6^_[]ù@rA<,6tøWVt$ 9586t)1Wj;Wj0Wj%586^_ËD$<6@6USWVhD$=<6u@6)=,6t46t D$D$p5@6p5=06tt$,jV訲u 545et$,jV芲u4545=6u%=6t?t16PWt<5jVAu545Bjc|$wfs 5@6r1ۍD$X XXPj|/SWRq\$\$ \$\$O?r t1@ DD$jPj> VPuf52t$WVt$|$ ?t*FHN V>Qu952u V^_52t$WVt$ NfuD6FNtF t0fu^~<5 ?NQPޏF N)N<5v衏F FF <5u=@5t V N^_Vt$F t-)t'VfxQPR yNFN F^52t$USWVP|$t$j'VaDt~th#V)%<k>t!h&VL1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=2uUWMGHO W]H"WVGHO W3H"^_[]WVh&Q萿j'VcBt)19<>^_hP2ohd2bUSWVD$~@|$l$1SWU t o8tF r)~1H^_[]ËD$)D$<5\2tPJ 1\2T2 <5u =@5>PD$L$ T$$RQP XVPt$t$Vz tt$ P4$1J ^h#QPD$L$ $QP52 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+6+T6Pqq h$#jh66SWVP\6$&C PVw u,$$wCGσCGCuh6VhE#8 u*$ 6666^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')<$6t>7t9^ uSUv t61^_[]ËD$t8SV 6Ƌ6`u6$H 6P#tI#$#tZ%T6㟉6t$D$$# ^[WV<5451$|$PW]t $D$PL$LT$H=45PQR 545$<^_USWVL$T$tHtA|$9t91&Írjt/9t+1&tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t Uk$VcƋ $A$~ C@ $Q$f=t @UPWVp ^_[]SVhW#WV<545P5$|$jWu"D$LL$H=45P5PQ545$P5<^_USWVD$ èu|$=^2uÍD$PQW Ƌ@<5Nt$݁ uF @SPуF`u viE F~tuF1Ɏ! s%t É^~6tp6u6t jK~ <5uk=@5tb[r2jXxL$H @ $  $#`uWD `u WD fy^_[]vv ho# D$@!|$$~L$( t 9-uD$@-=d6u0@=\6tc@=5tf@=2ti@=2tl@=6tp@=2ts@jPh#,WVt$|$ <5tw蝅VP? <5t^_Ã=@5t^_CWVt$ t|$Wv 6u^_USWVP\$<5jƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFR賄SP}j=S9S苄UPu< ؉G@582582hX2PAA ~ F1gjt$6uQG L$<=u5X6HT62UjS $81F FFT66~656 <5u=@5tw^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ 5t8Q12<08uF=u =ut j=R48F^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV$61tr:1҃Љu6r׍P节ƻ$6Nj+t7Mȃu%EttUЃuEmŃ6r^_[]SWV$6>tLGu% uw? Gu#W? @tw詁Gg;u6r^_[2SWV|$tfh#WjW9uWh{$V't*tUj'W_6t8)WPh# h# Gh#WhM%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh($tUh($>=uD2HQP~ j( P 2j)n~=uGuth+#EU2HQPP2Q ^_[]USWVP6u6 h6T$ t$\$$61<$?tIOt !T$ ttуt݋ 69|QPYT$(6%6)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP=I1>?f u%PV1u%#L$1PV:1t1Ʌȃ|^_1@Ow$&1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$t t$519{USWVӉϋu6fx@$ &$PW1ۅD$PVr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PWy1ۅBD$PVa,$3D$ $3L$ $$3L$3D$1 dVWI1ۅTVWI1ۅfVWIVWI1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]SQ9-u1tQyt8ytBÄth#QHl&t1h) jjhT&Qh) jjhd&h) jj h &RlËD$L$  )VL$D$ 2)u AJ)^USWVP?Vj PV lj"V8t"Vځ8"u 11E9s:$9t( <=3@DQ@uuN9t ڃ^_[]Vh#Vh#USWV׉ot 9Fup  ^^Q19uM1PPo1~ōP rPUH1~ LH;NuS30 #~^_[]ÐUSWVt$(hOA#jF D$,^H $x?-Ok-u)sstdluu~xwGWwÅu"<=3DHt'1Ʌ S覚كh#h<=3DH\ƃ~ƀtV)tV{VhϮ#jރ $hG&SE1Ʌt:Suu+$891V52V|-$K$8ʉT$h%W-E1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.%|" $4Ph% 1@D$l$t jWXRj D$PU; ljӋD$9t-ف8ur1u AR8tQ"xOA#UPh/# 1@D$\$ $4h #1@D$F \$ t$|Phi#jg5PPPPhh#522jDWVPΉj WQ!: 9u=у|=}^_Vh#jhQhF#j52jWV@5\5X55hZ=>t)j=W#thW>uPhQA#j@VPmjVh># Vh2hr" $VWh6# j#tZ%VQh# j,hC#hK#q VWh#bL^_L=85t 1|55?<26166696tj=6u2P22d22tP* 2Vjҵ15p5><25595X2t`2@8@u jR<5jD,6uƀ,6@u <5u=@5t^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$&$&Vw vVw d_ t"Vst Vw?wN@F1Vw q#w N@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u&E$&Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t& Ã|$& USWVPu }662f`|j%vm O1@ 06D$,6|$@t$(q%v>%L$ ht#V}<*u C hD#S\1N .u{*u{ 1HD$ChD#S(1HD$  t$CD$'C`L$&~QF0 $D&. D$׋L$ jj D$tfL$tjWt$QPh6TFu$(&6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph6J6L$ Q0q|$6H 6T$ l$=6uM|$L$ jL D$tbL$l$tf|$ L$D$$6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$6L$\$L$$X8G606E ƋL$ cjl |$D$VPt$w66661  6 6Wt$*|$$6 \$$P6 6t P" VPX  6҉D$xF\$wZ$&a=&t1"u@"*\\t#'u0'btnv fre\qFuZ<=3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~VP66T$t P! T$66t P! T$15656Љ\$H\tF56X])P0tXM\$u/^t-u#F56벸^tic\$>T$ j56F56{ <=31:DYt 7GuF56\$DF56ȋ\$+1L$ jlD$t1L$t5WQgP6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h6 PRQt$QP  6FPN 6 VjxP@ 7s6T$t t$L$ t PVRQh6MT$L$ t1PRQh6.VWh61PQ*t$P PQh6ϖ t66T$z \trB<]*<0tu$& ?$&."'#Eu uSh# 6 4$<=3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#l6\),ҋ4$u|$ uWhְ#<6 ^_[]WVP60tp6y?1ɉQPVg Nj <=3g#DQt$c#r& 6+ 6VQP 61^_SVˡ6H 6 u:2Prp~r0 P{2Q 밅u6)2HQPPD2Q^[SWVP60t"6<'t<"u1B^_[11fE>1ɉQPV& lj+t:<-t6 <=3DAu)6+6VPh.# 6 $ڃ^_[SWVӉQ|ǃArVh#A6GPVh6 D$ 66Ƈ6^_[USWVP׉1PPP袋 ,>U@PUQ膋 x$tG9tC6+6VPhB#調6+6VPh7#L 6$^_[]WV9t"΀:t96+69t\VPhB#Z6+6Phر#/D<8"uD=6+=6j". PVWh#RPh# 6^_USWV\$$8l$}hVE j jhX&URƅu!hVE j jh<&UeRƅH h]#uFj PV{J !8u$8u؃^_[Vh{$jnWVh1#j0USWVa fd-6t6 \-6ƒ \-6x6 \-6€ш \-6|6H `-666h2M#t h#t8ƿ'#PVtG uVh#jW $$1ɉh̷#SU P6$&6kj j5< I ƃu} 8"5t66v <f|6Wj j5<H ƃ _%6j j5<oH ƃu8"G5x66661A5<O5<h~ #VKtch#V9K66B66/|6#8"tD56  9u6rCjhH#5<h-##Vh#5<h# 5<h#ju hf# 6t 1ҁ‰6\-6փ95|6u<9x6u2d-69t6u#`-69 2t 266=6u\1ɅQ2h# /3=6t)ͅt=6ut 1jhh6P4 $yh6h{$j=6u1D$(Pt$u#D$0=u 661N1$& $$h"N"t$h#QhP%hV)9V[th9"P$Ph{$6D 6 $=D 6=6p 6B=h^#t<t1@$$Phmdt$ hh#h|tWWh# $=< 6u < 6 =@ 6u @ 6 4$h 6 T6 $$1 uWhPh 6 1 6 6 6 6tjVh 6f h 6\ $RhSԙ 6h6VW0 56VWF5 Wl$t$D$ 1ɉHHD$UD$ Pj虔 Džy#&8#Bj膀x߉DžVjYx9ujUjE 1|$nh^#$P~:<hjh 6 ^ Wt $h#M7h5353H 53~53H 538h53ljt9 t453H 53~53H 53h53ƒ߃NyjUj1 h~#d1 653h6VW4. 56VWj3 h 6dtd($Ph{$$PW1@Py-jUj蟒 wP豕YP3hj##tǍ$PWh%VjD$uh U"Z$PVQ$jPhR #QQ薾ƃu W" V,WVθ#&PVx t uVh#jۿG |6x6Gt6G6O1L-6t^_^_WV΃=L-6 P-6t>6t49t0##9t~ #9t~ #QPh#E 56L-6P-6^_SWVX#8''VSh_#hL636/ #uj+VPjj"P thº#E1Q1&$ =uh} jj"t$ 1$4hF"u4$ 1@^WVκ u1H3 r1P^_V΀=6u6=|6t񺗁 t41t)Ph 60h 6hedAV xk^Ã=|6u񺗁 Jt=6t76t.h 6hedAVp th 6hrdAVY t=D 6uj&*h#j芽h#jNUSWVPύAPjh#h535Gw4'h#Ph#h534 53w(h#V4 w,h#V4 w0h#V4 w8h#V4 w4h#V4 W4O<W8#9tQh#h#h53c4OA#OHtQPh%#h53>4OA#OJtQPh/#h534OA#OLtQPh9#h533OA#ONtQPhC#h533OA#OPtQPhM#h533OA#OTtQPhV#h533<$f$1۽a53Pjjh#wVh_#53P<3wVhg#53P%3GtmÈJ9|6{u;[tVPWhݹ#:?D$(ffL$(D$ 1ۉa)D$u!)tPt$h!#>L$4 <)ǘ΋I<9vt$hN#>$N<.”T$9vt$ht#>$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#+> D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( < 6@ 6t$(L$QhV=  D$ 1h#VtG<$hR#V^4(1>tYj:WD$AL$\$hR#S],1tD$h&&WZtkh $WHh#W2\D$Ph6#W D$q;6ef: 6ujh&l$!U l$'1tUP QFH'r܉1hD$ Pj <$Wh#3<D$ D$t$ <$}trÉD$hi"U: t:ht"U( t/hy"U t$UWh#; F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh#G;D$ D$ 6FʼnD$uf5 6l$u D$l$l$h$W0hE%Whb#Wh#Wh#W h#Wh$"WTh#Wh#Wh#WjUh"WTkh#W>h#W(h#Wh#W<w ~W|$Wh#9 T1<$ 6jD$<$rt$Wh#]9 D$f 6@<$WhE#@96f: 6jUh 6jUh 6 <$t$ht$0V+9 J21jD$ Pj< D$ 6뜉1jD$ Pj D$ 6q1jD$ Pj uuD$ 6J1jD$ Pj uND$ 6#1jD$ Pj u'D$ 61jD$ Pj^ tt$W|$Who#7D$ 61hD$ Pj uD$f 61hD$ Pj uD$f 6a1hD$ Pj ^D$f 611hD$ Pj .D$f 61jD$ Pjc D$ 61jD$ Pj8 D$ 6; 6sr"jW|$WhB#W|$Wh"#΍L$$ t$D 6|$X-6L$$ L$H 6t$X-6rhR#VVl$}}&1ۋ>t.WLt t uPUWc Á&r D$<=3MDHu D$"91hD$ Pj t4$h#}5D$ \$"r)Ut$h{#^5 h#Q5D$1ۋD$P 6ND$P 6W(4(t$|t%hR#VU L$1Ҁ<tʉT$D$< w'<$$&L$ L$L 6<$tL$$L$ L$L 6|$X-6cL$$t D$|$X-6L$L 616FL$<$C fF|$X-6L$! L$L 6|$X-6t8L$$ D$|$X-6tL$L 611A<$D$ h 61D$ ȁ(^_[]4$hc#3D$ WVPθWEV 64 6f8 6h 6 f8 6=6u=6u#$}h 6hgdV 1h 6hfdV yO8t E8uv$=6u(PhmdVn xX52hq} 1=6u$h 6hgdV2 y ڽ#1G^_ùɽ#h#5 뙃=2tt$ t$ t$  1HVD$ t$= 6thPh 6W ^D$L$01;V?t,uVh#-t"uVh2#Vh{$詢Vh#Vh#1^hT-6hmd52& USWV8 $RPh hH 6Q/H-6 6v|Pt$hJ#51 lj D$T$1D$ XƉ 11 ‹l$6 H-6H 69H 6hWD$P $;D$OA#=D 6t =}t=}uЉD$$r#=6tȋ 6=WEVuT$tf96rD$Pftt=6%4$t$Uh#0 D$t=VEW=6$t=VEW4$t$UVh{#/=6|4$t$UVh#/=D 6$D$PSt$Ut$Vh#=6u $h6S53V 56SVI SGSt$VhVW= D 6D$ L$D$11t4$h##谟8^_[]USWV T$ $11F1Ń=6|Uh#. QPWD$Pt$/9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=6tUPh#- Ɖ ^_[]Ã=6tUh#脞=6tUh#~-ċL$T$tPh 611@Ph/#ht"j QP' uy8"t1Hx61Yh?#jPh^#t"j QP& u08"t1Ht61Yhn#j豦SWV։ϋ\$+6tItEu61tGtBH 66H-69w1H 6 1tth 6QA1@^_[Vh#jL$1=|6T$ PG1ɅɉWVH-6~( WRPhH 6Qv} H-69u ^_h8#uQVh^#j蜥PQVh#j]USWVPӉ΋l$|$uj WVM% Eu"9"t:M";L$ w,O>t" t9t<=3DJ@t1^_[]WV1t>΀9t7hR#VC<t#ƍFhR#PgK1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Whc#*1۹X-6؃^_[]ËL$9/up 6D$\$A/jPU u$D$ 6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#)X-6!Whc#)X-61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uhm#DMD$$Th#Sut]"'WղPWS: '> uۀ$U-$T14'D$XP' tpC"uD$TPh#$T$끹#'j" $eFMu SQЃ {Sh#h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h#脔/$PQh #R~$ $u ~ˍ|$@WV9t"b&J~PH k$'1OJH w@$' Hi&B(D$ D$$l$ CtGtngtbcB8D$D$l$cHi&ɋB(D$(D$,l$(BHi&ɋB(D$8D$<l$8Hi&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=l-6uHr8jVSWQD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#eh#X~USWV|$t$t$h="V  Gw4'hm"PhD"V  GPShO"Vg GPSh["VT Vjjh&GXtVjj hh"GXtVjjhs"мGXtVjjhx"跼Vj |w(h"V  w,h"V  w0h"V  w8h"V  w4hѕ"V  wu 1<1A71Au01<  $jj@PD$P@D$ Ph{$RC9u<$u453H 53~53H 53 h53j 1^_[]h#j趉fUSWV $ $ D$-@1p-6t-6p-6x-6|-6x-6$-6-6-6t$ h#USk c~!P$' -6˃PtdT]=<?1AJ5<L-6뒹 .<-6hOA#n -6b -6D$-6T$:@=p-6l<D$ Tnt uBxou D$ 1Ɉ -6h%Vtp-6hOA#`ء<$j:W胱C-x-6tWu?tmx-6S c$ \W-6t-6t -6/39$ 1ɉL$tVh$P菕 tj/U<u Uhf"hcE%h$ UVuDžuVtDž7h$P ƋohZ#W!t(hm"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tUslj?,$u1QhD$PQV跫 h-6hzd@P tq$ PhedAW WY|$ WD8$9",'uWKYH.6,$h h 5-6P Ġ ^_[]hM#j$Ph{$j2Vh#jhLK"hI"ʍD$ Phc# D$ Pht#jD$ Ph#롍D$ Ph#땍L$ Q4'h#USWV։ϋl$j Va UV CCCOK G^_[]qh 'Ph#hL63jUSWVP׉΋tAS]WR4$4(VS Wh:$Vt$ P W輘 É^_[]USWV|$1_hZ#S+t$hm"Sth#Su\p-6toU3t[u=-6t .=-6t%-6toU3t [u^_[]USWV$D$|$x-6OA#tW3lt CÅush$t$ IuD$+?%D$ -6t L$ mt L$ ^$D$ D$hח $$ t$hA;%hVf$0|$D$4$L$h%Q1G@΍K9|,SP Ŋt><-u(GD$tj=Vzt>FD$ GDJ#th%D$Pu|$1F1B,$֋$$$,$D-6tPOA#th"P$h# xF1Ë$4hD%C9uj 胗t2ƅ|$t t$y 4$n tA710h#w|$t t$D 4$9 ^_[]ÍD$jPV+ x!L$ȃtuuhk#w묁tlP* PUhe#g 끉 -6utD$P$uW$P$guvjBSVh;#&v j,D$L$ h.6l.6áh.6áp.6VPD$ L$ $L63QPV Vj j]USWVt$ 8l.6ut5h.6h"l.6l$\$=t.6t!u5h.6h1#t.6US輏yW Ph b$l.6ttj l.6tu^_[]Ë5h.6PVh?#6 j|PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j USWVup.6$Phf%R$|hWVO t Ƅ|D$PVR1ۋD$ !=`= بtLV"#tX#Pv vvh#hL63 6pc$SWV։ϋY Wss ss҃ 36t~j 1Wss ssԅuA 36^_[ÐWV1t$|$ ɉ @4u^ȉXȉX\ȉ\ȉM^-^ ^ PQ40]40<8]<8D@]D@LHy]LHTPY]TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40\40<8\<8D@\D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7\Vw w[V Fww[VFww[VF^_USWV\$l$EffEffCEffCEffCu ux[S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuZSCuuZSCu$u ZS$C EDȉCDu,u(iZS,C(E@ȉC@u4u0MZS4C0EHȉCHud G h 5`46536!d 5l46536=46t36PP53636u$1;C$C(@C؁^_[]Ph#ʦUSWV Ρ`46X4Y AIX46tbSQP ţX46~,=56tiF(1~$V,9l$MDу=46 $T$fn,A=46n,fn,F(~$|9}}Uo1>dh#VŋFNX46tbSQP X46x 56~,=46tffOfGG@ Չn,~$N()ǃ~$N(=569<$D$hP-56>N,ș)N,)n$F(teh#V$FNX46tbSQP X46HT$<L=46tAf=46t4f.<$ ^_[]p3656F,)F$N($fOt@ p36븋D$L$t$ QPQPUSWV$$$ $$$(h($SV\1j D$SVWUhP@؃r_569556rPSV Pt7=46tf%"=@t_=#WQhH%d Wh3#T^_[]USWVP|$\$s s@=46tf9uR46t=36t=46tj:D$1PPPs sQs s6O363C 363K u 2&=46tf%"=@t_=#QhB#胣s s/)SUhP# 36u =46t:yj hg#36th# =36uh}#u=4646t7t;f5p36D$46jh<#S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=46tf=46tGf"@t_=#Ph#/SVz.=36t)1=46L L h# h#{$p$l tRQf@ 3636 1VW 2L$@D$DD$ t$|$ 46pt9546tʋ 46546T$Htt tɉL$LL$QPh#=36uh#5152PPPj3636  52RPjjt:46=36h#& D$L$ 3636536=36 tYjj=46H46tt,fI=46tftfI=46tfIfHVW513636936t-j  3636 djjQP 3636 AQP=46tf%=@5365368,$t$R=5656 t# Fjj WST9ݹÉrFND$P9|$P$d닔$hjj RSS )ˀ0^N9wh#訞h#Jtf53636152WWWj3636 CRP52jj_h#h #1p361P^_[]Ë$d#36 36$tҍt$PtV$lSUQP4$SU fH1G@u536536h#SUu.$l#$pth#536536SUq536536H=4646fA=46fh#p36h-#h"#jj536536D$DD$3L t$\$ VS@@PD$PQVSf@536536tfA=46tfA$l$p!fHG536536mf@536536SU5SUhU# t$p$phl# =36j USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ`46@4 1WjPQWWRS 9=46f2 56ff2=46twf2 56ff2=46tjf22f 2=46t2ȃ=46t]D$ Yf2 56f2f2 56f2f22f 2=46t27D$ G UV=46l$$tApQt=46tRPCA(=46t1ҋ `46I4-X46teQRP X46xtt$V/11jWpU =56=46tf=56f2`46;x4})}jh2W`U =56E `46A49rE =46t<$fGj \$l$u6_=46tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=46tfUVfXW|$$Wf@t$$W=46H46tt,fA=46tftfA=46tfAfH ^_[]UUSWV$$1Q 56569;$$߃9։$PU$T$L1 B(B $BjZr1B$J$=46pt$ =46t ɋ=4646L$xtt tɋ=465461L$|1ɅDT t$t RP@556UVRP tE{[|$t}SW?ljUVSWܕ)SW?lj_{[ |$t]SW?ljUVSW藕)SWu?lj?UVSWm)Ӌ$xX#UVSWH)Ӌ$xX D$4PS $$W$VWVhPWV 461ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =46t SW> `46L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =46<$\$T$|$(t$,DpLtL|Dx=46RS=TtDp`46D$0X0vv=RPq=VFvv]= RSL=VFt|tx|$82=D$T$Rl$$D(D,=46tFB\pTt`46B0FN FNDxD$L|׉L$L$؉D(MU =46t]RQ< `46I0VP<U EMhɡ`46@0 ȃ=46t3ȃ=46EhD,t($`46@0MU EhEhD,=46L$ tL$D$D$=`46,$\$ 1QOP\$  t19}#8@#pLp0l$$ X46ɋD$taVt$P9 X46x4ƍ$556pS `46@0fPt$t$ X46x556Sp豁 56=46tf؋56f2`46B09}+^jh2SlM 56`46B0N9rF =46tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL X46taPt$t$$ X46x=46t$,|$(DxL|DpLt1҉TxT|FN=`46<$0946QP:)RP9VF^vv9 )RP9L$(D,D(D,EM =46\$QP9 `46I0)RP9U EEhhȋ5`46N0 )ȃ=46t^ȋ5`46T)FN^FV )S\$L$4$*5`46V0)EM Ehh )ЋL$Ev8QS p361Ą^_[]Éjh2p.K $Ph#k=36th #h#ۻF & `46@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fw ^nFD$hF$D$pFD$lF46pt =46tɡ46=46L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=46tf)9F=46\$tAf)=46t4f=46t'fL$=46fVT$Rt)f~T$JR>>fD>=46tq1@1$CD$ƈCCEUL$ q/G9<$u1A=36=46\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=36t Vt$t$Ut$h#"1Ƀȃ^_[]1A=36t1=46<$\$ HfUSWV $8$4}tE1ɉM4M019 46‹DT 9 46tRP=3M$U(E$f M$E$U( u ^_[]%=uLI`46(9‰|ǃ=|36t<|u=46tFNFh1 t46tD$hVPx |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =46t RP?2 `46I0VQRP=։D$D$ ЉT$t `46=46Q8k=46L$$tL$D$ =46t QP1 `46#8t@DQL!!IT u‹$8U t#DT tE=46t!RPZ1D t(=46t1҉EU}@U=}@|$p36EM QPQPh$3WWh#聇h9##uQ{u u `46y0ƃ=4646t:tMPW0?UUlCD$T$NQt PWO0~V ~V h #46\46@ 뛋5`46F8E -46T$$tT$D$ =46t RP/v0 I)؉$ʉT$t*DT tZ=46t RP/$8D t6=46tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wp36E$8I QPQPh$3UUh#薅h9#8$<t7`46Ht)$|$-46Cq qƃ=46t0FV=46|$$tJRPe.)RPW.4FV =46|$$t&RP5.)RP'.)FV )FV h #b46\46@ USWV|$ \$t56956a$36 36 ‹-`46t9ˉrux9ˉ\$؉jL$QWP 9ց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס\46t`v0WUH \46`46pxjV|$(WS谂)Љ 36$36=46jVPS舂 \46A^_[]WSh#\46@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$`46p0vv[ $G `46y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP719rÃ=46$t$ \$ti=46t,ۉ~A1_t4+T\$F9uۉ~1O ɋW @9uG W546茲t$ D$x, `46;Xt|$#=46t JًL B tmt$v vh#hWgWVt=46t$$B1ɉL p36t$ $$Bt$ B C`46;Xt`R546贱T$\$1ۃ=46t%JًT tN=46t#RP)Bt/=46t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbp36L$AI QPQPh$7WYWh#h9#xT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=46t+FV=46tGRP(+D$RP(1FV =46t*RPw(+D$RPg(+D$ډFV +D$ډFV h #46\46@ 1@$5USWV\$41F~3|$0l$,|!46 469|)S9у} ȃ^_[]Éދ`46K89}=36tOI.A!1‰9)=36l$,|$0t!t$4PWUhG#α`46PVWUINj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=36!$l$|$ T|$0tN# $ND$T$RPWUho#貰 `46<$\Ttq!qIVPt$ Sh#a$@l$19=36tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#`46t$Sh#ԯ1Al$,|$0USWVD$,\$( 436036փσ5036=43611 J <3698366 D36@36(369H36@D$ H36=`46\$jD$ PL$QT$R[0ց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =L36P36tX368T36T$t\36‹D$ȉ@36D36`36WUS5`36546谬=46l$$-@36+l$(=46|$`5`361VV=46tf%=tjvdv`H#VdF`vlvh4#VlFht4#TCut4"TCuG9a=|36t< `46(1`36SS=46tf%=u1=46u(x$CS =46t RPa"9Ƹs& ɉ @u ɉ @uG9wt$t$t$5`36546衬`361Ƀ=46 (36^_[]PSh#awUSWVl$|$`46jVUWw 1ƒ 836<36$36 36=036-436=@36-D36H369`368#{H1ۃ=46(=X36-\361L36T36ډP36t@L36 -T36=P36Wh蹁 `36t^_[]UWh(#TvhM#Jv`36t P(h `36USWV l$ =461ɅDT =46t RPe  `46Y0މD$ʃQSRV3} wÉD$4t,PW 1ơ|46$46QPt$0t$0u$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 46; 46u3P546` =46t-4646d 4646Q464 ^_[]ht#\tSWV|$t$|4646QPWVttH 1P1 t^_[WVh# tV|46tR 46~%4646e ;546s|46Pe 546e 146|46^SWV\$t$s sǃuG=46tfL$%"=@t_=#RQh%t s s=36tfh,#5656{@t1H1PPQQsHsDs sq SW=46t6hh56Wc -h#荠u7=36{놹 (56s s\46H p36^_[WV|$t$ WVh#3 C5695560WVh#=36t7=46pt=46tPR t 0h($'=46pt=46tPh&&芦=46tfPh#i=36tqPh"M1Ƀ=46DT =46t RPRPh# =46tF(F=46tjP|tPh#^_SWVD$H8=46t3P PP0p4u'11C9}QBRQp=46RMT$=46HRP? 9L$0ơ`46@0 T$D$=46D$0T$T$4=46t$$t RP Mt$t$$=46tȋMD(`46@0T$,‹t$(΃=4646t+tMVRx uVFt$t$ _ 7KVRI MQ AD$:MQqD$T$AQ!EL$DT=46t1ҋ `46q0RP| ƋL$ jWSQfӃ=46D$ t7~SPt$t$$fNjT=46t RP |$)~SPt$t$$xf=46tȋ|$1҉\$$ t/f `46q0RPُ xËD$L$ L$0|á`46@0 T$ʋL$ȃ=46L$0T$D$t!D$4=46t)PQD$ T$8=46t@ɉL$ D$ =36t h#X=46t h#Xh#X/=36u h#WX=36u h8#W3=36u hY#W6=36u h~#W<=46t=36u h#WT `46|$Y8֋T$  SP556556556556h#Wd,$kdы`46@DWSQP]D$T$iщډWSUR\jj RPRPt$t$t$t$t$VD$Ph#$=36 `46+56 5656 5656 56 tQPh#赉 =36-`46KC)s, 56-56Ջs4HS8\$ ډD$$+46$T$46 $ $ډ Љ 5656tRQh$# =p46t8h9#5p46tvvh`#ʈ 6j ܇=x46t8hg#覈5x46tvvh#艈 6j 蛇15x465p465t469546tmj@  `4640536h QV9 5l46Vƍ=46t36PPҞ536z36=46t p36j `46y,t+461TtRD 46 `46F;q,r46PD 46=46t =46th#SX;61=46=36u h#S=46t h#SGRtgD$Phf%bu1D$t)L$ jQPhf%h+?%%t-=36u h#S  ^_[]1USWVh46D$45`46~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B 46l$9؉|5`46|$0G;~,$LHN4H~KT$މ)1@ 469׋T$9|5`461҉t$L1F, 565656569S,SދD$4HxL$HD$81ۋjV `46ׁ\Tډ\$tQ!QЃQ SPh46A`465,46|$D$Xt1NPSWUMʼnFظ|߃\$ <$w4F46<$t LX FuWBsT$ 5656$@=46tfL$fAf|$l$$j ' hX x46x46T$ =36t| $=46t RPRPh#l=36gq$ʋT=46t RPkWURPVhN#y($DX=46tPhv#yp36h#Eh_#brT$ '|$@@u' T$t$SUt$A  56t$D$, F=46=46$@=46tffu$@=46tfft}SU{$@=46t?f=46t/ȃ=46 $ApfAAt$f=46t $ApfAA $AtfA1ɉ 66 66 66 66l$T\$X46pt4$9 46t ʡ46 46$tt4$tʡ46 461ɉ$dtX$t $D$LPt$衹=46=46t=36u,$$@\=46tȅSUh#C h#(p~SUؾ19 46t1ɉH\H`HdHhHl$f!B=46,$(E\=46tȅƄ$E\=46tȋ `46I0H111҉,$L$ D$t ߋ `46Y8Om\=46t͋ `46#8߉@DYL!!ÊIT u,$\$lD`Td t<=46t RPD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9`46H4 D$|$׉D$|$=46t݋AQ=46t-RP!Eh=46tȋt$|$1҉11 ˉl$$WVRPSUh#uA=36th_#h#m|$t;SU蕼ƃ=46D$|t1$=46t RPSFVp36=46tȉFhܽ$|$jj$$$$SU z $A`Id=46tEQP $plph1$D=46tWUPVh(#  $AhQl D\$C5`46;^,T$$L$ 6666׃ƃ=66566 `469˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-46t$| ؋T$(tu3D$1 Kl$@؃,Ut$H{* ƋD$9\$(s+l$ Uh#>jiSWUt$@h#h#m=jWsUSWV |$ ow@u Xw VUp D$t|VUh#w w66 66ʃǃ66=66|$ |:w whE#= =36h_#mjG $D$|$tjVU¾ 46<)1CVUhm#D$,p p*66 66ʃǃ66=66 j O hp t46tHt46 p469tDy1Y1 t 9u,5656$|$ ,t46p46Q1I1 ы|$ tt46$G0W4L$Aڃ]D$ p phh#J< =36t)hS#Ҥ1C+p36h#;h_#h1Ct ؃ ^_[]p36jpjffUSWVP$T$1B@B)0 p4666`46x,11=$56t>Q:`46x,$kd1PWSQhl#hL63nq$56`461ۃVU聶tzljl$ t$46pt=46tʡ46 461ɉT$HtttȉD$LVUz8tD$PWbu(C`46;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$66ŅtTM1ًU1 u3VShm#w w66HPUMpX66 t469tmu1 t46ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $'h#F9h#eh#ejj聴=4646f@=46fh#8h#aeU1hPVPVҜ1Bh#8h##et21VWhVWVW莜1 tah#+7p36h_#du<tf@=46tf @f=46tjjxfh\: j546546ZT$1B@Bo: -4646  $$56$Wt>E6+546=46kdPWVQh#hL63]m$56uF$h6#vv 躑 56A1ڍF$h#cvv 6ǃ=46F$ 46&jP1 56I F NQPQPhSt=46F$ 56t%QjPSh#hJ#>6#p36QjPSh#hJ#36=36th#軞=361F$56 I1)щN$uh}#b-vv *ǃ=46F$ 46$Wt jP1҉GW1҉GW }hjD$\PvG =4646D$tt7fD$T@jv$-fD$T@jv$mfD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=46$tD$\=46tL$Lu$D$PD$PD$XPy$56;,$/p36$W=46v46546;4$]|$T{$AhjWVE -46=46tt0fD$T@js$n&tPfD$T@js$TFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=46$|$TtD$\=46tD$L$|$TtD$\D$PD$PW٧;4$=46;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#$^t~s sqf@fNCKK CQPh#ss oOCK =36thp#ss QPCKh#QPss fN p36;<$=46464~^1ۋ/uu p]]8u9rۋ=46/CK tS  StQP HKX9rjj轄`^_[]p36j"ej?[Ph#/L$D$@, +A,USWV $0 n8$=46ui=46t`E=46tȅtNE=46t$;5656s&E=46tjPo@E$F0N4 utEhu%P/7)$0 F=46tȍL$A=46AAhhu%Q$ 46 46tD$D$L$L$D$h#v v薉 E=46tfM9v%}EPh#.#h#0[4/E=46f)=46f=46fEtf=46t΋$0 AI 1 h#QP辈 h#Z$0 F=46tȉE$#PlZEL$fAWQUf $)fEPUVD =46tfD$fXWPU$ $0 G0W4w wmfH$Xp36$0 =46t>}t8h#v v贇 h#Yu EBp36F0N411G9 v vGD$@=46tȍL$A=46AAhh#Q{ 46 46 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=46t2f)=46t%ffD$=46ff46 )fD$1fM$0 A0Q4MT$ tjQkfHD$=46tfPjU= D$fEutEh#P3l$L$Aq $0 JR ωtljh>#RQUW݅l$EMك9v%}EPhZ#*#hK#mWD$$0 T$ 3F0V4=36hc#.ڃD$=46t΋D$p@ =46X}$0 ~h&#v vڄ Eh#VJp36BK#$0 1GPVtXD$T$ F0V4=36hc#`ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPAifH1G9$0 .1L$AA EL$fARQU $EtMw\}.uVV4~0|Juh# } .u8h#v v% Eh#U4$F0V4=46tȋ 56956s5h#juv v݂h#T4$=46E=46tȃu}uE=46tȃtb}u\FN U=46tʋ4$h#jRQPX=46t}Eh#T1 46EtjP|gC$0 A4y0#$0 t=36#=46JR u=46tPjVRQ菁h#_SƋE=46tjP1Ƀ=46t f461ہ@€@t f 46fGp364$Crv $0 A4y0AI U=46tʋ4$h#jRQP褀h#tRp36zE=46tjP)Ë@ C$0 A4y0AI $QPQPhRcE=46l$\$tȋM=46t1퍜$UQUPhScSh#$"Ph# %9-36thX#薍l$\$ h#vQƃl$\$$0 A4y0| AI KC=46taEO9tU$0 AI U=46th-#jRQP%GEh#Pu $ p36fO4$E  ^_[]ËM PSh<#"ȃ=46tUSWVT 4646,=$56t>)"=46kdPWVQhr#hL63Y$56}ww cO W $T$ WGO ƀÄ:1=36t4=46t+=46t"uGO 1F9ƺw1 tbQPc8uS= 56xJ1v6KNj@ $GD$wOG tQPb8u E;- 56|E;- 56=4$h#b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ d D$TD$D46pt =46t ɡ46-46L$Ltt tȉ݉D$PD$PRmu h#!D$TPv6t$t$~tyD$ ? v6ΜL$QPt4t$t$af@jw wt$t$~t 36361JQPBafp469)T^_[]fUSWVT1ۍT$1B3L `46x,@=$56t;`46p,kd1PVSQh#hL63V$56`46 46<\$11ۃVU衛VUi`$t$l$ 46pt<=46tϋ 46461҉|$Ltt<8tϋ 46461҉|$PdtX 8Džtɋ$L$HQ$ 'xtCVUztV=36VUh #^1=46L L tOjhi#sx46tuQ1y1 t6 u_VUUdtl=36tHVUh5#R7jh]#$PxyQ x46P jh<#D$P C46L$;JWD$ P3646tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$53636`46h#h# ud`46ǀh P536v 5l46536,=46t36PP >53636`46@ <:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhf%mUQ=d=6uR<sJd=61\$|11 ʍT$ ٰBPVQ{ D>/|)Ot$L$6d=62d=6$!D$h8Jd=6$ D$tB?JL$h)PRQ{SWVD$t$ 569556r==46 `46jSPVt)޹294v t^_[PVh#GWV|$ wu$ '1XD$@uPw w Ph{$.=36th#'h#t ^_Ph#躽$56USWV$\TM@$ 5uh`̞h`VP!z =36t h#&=461ۃL뀃=46t\,L$UPQʭ DPP~$\, 46L$L$UPQ蘭 |$u $PPD1LDffLD@9u=46t8PP\46L$UQP> t"PP\L$UQP  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h#,USWV\$t$=46!ߋ,t9Xt6@u|$t&j^t1ɉH HHXh1^_[]h#ĺVD$ L$546#p9tыR9u @^USWVt$|$VW/`46!t7^Fu+11 33 1u{ 46tqt$0|$,\$(l$$T$h=6t9PtjRQ h=6(Xxp L$ l=6t9HtjQ546 l=6(Xxp ^_[]WV `461!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$8 '$1Aȋ$sY9U '< 'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$ '4  <Qh#h#船D$P`wZL$ D$$ '1B(ɀ!1Rh#h#SD$H`wPD$T$ $ '1C%   [Qh #h#襸SD$H`wND$T$ $ '1C%  [Qh#h#:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWutƅuWh"js$$<$4D$Phd@U$ tg1OVhedAUU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh %t$ 1 Sh("U CPh9"U誣 C PhE"U蘣 CPhW"U膣 CPhk"Ut $@D$t P< 1-Uhzd@$<W\ t1 VhedAWA hjU( D$ P$4GD$, 9L$< L$9u0$S11:8tx$0hϧ" ib$11҉ $ƅ*ŰP j PU5} ^_[]$0h"jqUSWV01ۍD$,ShPSu 1NtAljSPSWuWD uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSF$1NHD$ D$(%=@= j/S臲xr)ك$0PSQh##hRAD$jPRSǻ\$$0PS~: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS]E1@$D$hh SB ƅ%D$ PV謩D$3D$ 3|$$  D$uH$0PS $8$P$TRPV  VB D$4@D$1$Vh9#jSVjSA ƅxc1GD$ PhFVr  "8u;VwB Wh9#jSjjSyA Gy D$t P٠<$t t$1Ox VB e^_[]D$(%= tn=@u$0Sh+#hPSEƉ\$1@$D$:\$ D$ PSTCB$D$jS@ }tSjntN$PhF|@V x4D$t PΟU$$JhF Vج$USWVP1hUU= ƉRP*9-46t1@fC}+PUUS'G `46;A0u $ytWVD^_[]Ë\$-46546SUqRPX$@ ``46ؔؐh P536i 5l465367=46t36PPC536J36[USWVt$(~Ohol46tUQVՉ 1=46L$$t| tWVVƉt$$H$á`46@0546QPWVsUC cMhml=46tUQ8VՋt$( }`46@0ˉ9Éʉ\$4$rQPUt$LPDTGlOh|$ wL$,=46tȋ|$`461ɉShg#(=36th#h#t$" `46QP%$T$1RQQD$PaAá`46;X0t$~~1Ƀ=46T$DT =46|$t RPQL$ pL$QSRP6]ǍPvp=6$|$1D$D$t1)ÉعF@jPD`r9w<$r$l$T1C @<$9uG<$;|$}`46X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡ`46@0)ȃ`T$1ۡp=6ـ#h#蒦=36th#h# ع`֋,$L$t1ɉȉD$ օt$ tH `46i0T$,RQUt$> `46;A0l$,} $L$l$l$,`46@0D$Mt$ |1TT1PD$T$ ʃ=46t RPNL$(ωQM D$H 9tet$C9\$t$$h#D p364$F4$;t$SD$`1p360^_[]ËL$ ʋ `46f9u ShI#ԤD$`,t$$hy#蜤j `46Ph#sUSWVT$L$D$0(D$ X=46tSUMʼnӉ OD$$`46@09ʼn} t$t$5D$PSUt$< `46;A0 t$~QPSUI~t$4SUWt$T$LtL$A L$ Q546t9RPt$ƉT$ Lt$1ӋT$1 t<$G RQLD11 u5\$$9t ;D$t`GPD$ GPWTt RPvL$<$G L$;L$t9ta щʼn$;D$t`1hM#^_[]USWV 46$`46x0UWt$0t$0WƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PREW p=6T$4$1B srl$,$ ȈU1wX=46t 46!9GX=46tȋL$,1Phz#ʡ p=6L$ $  hd#詡=36th#1 h#t$D$OPWTP1GTGP^_[]p361USWV|$,;#t@#461@$`46sll$46t46 L$ =ƍD$1PQQV{9 `46;A0-T$zu D$`1]l$z$Ń1EGpD$h2 D$ Pt$ u&xMt(T$h2 D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh#=36th#h#qt3s ss3st$Vn[E;,$up36$t"Phy#`j^USWV0\$T|$HOX=46t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG46҉L$D$td$PQ,HÉ׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQrC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"h[#Ph#O4$VIVh#h#h h# h\#hI#h h?#h.#hWVt$ F,t@u=6th{#+F,PD1~,>d9~8uv0&^_h#h#h h#股D$x,u@Pt Ph#h#h h#JWV΋I01t*N8~2IN8tPQP P蝂N0G;~4vɃ~8u^_h#hp#h, h#h#hp#h2 USWVEH1BT$x,1hq1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vS趁e^_[]h#h#hF h# USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h #hK#hK h#USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h#h#h` h#h#ha h#bUSWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h#h#hq h#h#hs h#舝USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h #h#h~ h#ߜfUSWV\$$|$ l$t$u=6t546SWUh# USWV54671^_[]USWV\$$|$ l$t$u=6t546SWUh#USWV546C1^_[]V=36th#2j5x=6Gtah*#赌h_#WtSx=6xL~61 t=6 s"@Pt4hJ#, t=6x=6F;pL|^5x=6vjOx=6t'x,tPx=6Px=6áx=6t x,tt$t$t$t$P1WVt$|$ VWJ=46dtX=46ts,`46`uau33 u1@1^_WV 36t1 t=6 `461!`u/aʀs2hlpx1Phw#Ph#h_#蓷Jh#`46 ǀdƀah P536cF 5l46536=46t36PP53636`46!1111QWRPjhx=6hh#h_#赶lh# `46 ǀdh P536E 5l46536=46t36PP 536'36 `46dPs+aʀu Ph#Ph#)h_#˵h#!`46ǀdƀah P536D 5l46536-=46t36PP9536@36^_j萳USWV1L$ AL$HAL$@AL$<L$  'L$A 'A'A']u }hb#SVQ ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uht 'jƉe^_[]Ãu95/3ujh'D$Pu u1PPD$Pje95/3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQ:RPt$8t$@t$8t$@W1u2h#R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$PhQA#hV^D$@w ww7VPh>#S 1h#+h#WfUSWV1L$(AL$$t$@L$ D$ }] h#WSM aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9/3u~]#D1غ$Phzd@U tN|$$tOh 'j[t$ st$@s1Oe^_[]h 'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$SeQjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q `U H @AQ@A$Q @QHALh`$S'Vh$h$USWVP\$|$tus$g" $m"$jOtQ1@PVSjPt$8t$8W E1u>4$h$W VUSh$W4$h$W 1H^_[]UWV} uOʃ<|RQPh$VJPR.x& $T$W1ٹ|$5<h$ 5<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh'V 1OujV5<>uW?,VQ>~Ih$Q1$VQ7 t1Ph$Qx 1O^_SWVP|$1N?u;j S5<Q 8u1u5<h"t$ ^_[WV|$1N?t5<!1t^_h$t$USWV 1O1;B։ˍD$ j P5<  уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5<,x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,bhjh't$$ tjVt$m$ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh$VIz1t^_[]1;BB  Fjh'P 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0h.$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Ph8$Q 1HUSWVt$|$ t)l$\$$jWUS tWUShu$1ha$V*l$(\$$jWUS趖 tWUSh$V1H^_[]Ã|jWUS 11USWV\$1s3h%5< t^1W$'etuWh$t$ 1N,'(' Ch%jV Džu^_[]WV|$ 0'$'Wh$u^_USWV t$@\$tPL$0)ىT$44$pHL$8P T$WPh $V; G t0ƅ uh $t,uLjj2h $V1M^_[]Ät +Ai UPtσ tu'SWtjjtjV+1u1UjUUV\ t|jUUVtu1hUPD$ S $fǀUUSWP41@Pt$jUPUUV PVt'h $Vh#h3#hE#VUSWV΃tuwm"g"g"m"jp Rp pt$,t$,V Et1PV&t*SWh $VN1(RhP $VWhb $Wh} $V 1H^_[]USWV Ӊt$$t$$RQT1Ot, D$m"$g"! D$g"$m"8$s p ՉT$/ Eh @EMKM$E OEHMLEu UED$0Vt+t$t$h $V1%ShP $V 4$h $V 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0#h/ $SU tPVW4 u9-/3ujh+VWLh'j'4^_[]ËD$ 'H 'H 'H 'fUSWVX1L$ AL$A\$HCL$ u} D$hx $VW  bt(t?qt0PSD$PD$,Pu\ulD$PuD$9=/3uHD$|$|YuKtJL$T$xupt 81ϋX1 t$@uh'jƉe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WbtCD$@PWOjh'D$LPH tXj$t$t$ tCD$0T$,WWL$T$4t9_t0uh $uZShA$WF \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQtL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh $P%1D$Bh $ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh $u1fUSWVPM(,|$8O] D$1h $uS sujsWVVuutqD$9/31t$% V1f h # Vf hX$WD$0$D$)$v6 \$Sev v Se53H 53; 63h53j k53H 53 \$'53H 53; 63h53j Ak53H 53 FtHPh7$)eN1v6v C 53H 53~a53H 53 ]h5"dN1v6v  53H 53 53H 53 h53j j^ Sh{$P|$3W \$ShQA#P$ S SW\8uhh&W Wh=$'d~u(h=6hQA#hSe Shh$c)Shh$cD$PhQA#hS, }Sh$ch$c$f~ jj hOA#RPj|$7W xWh{$qc"$f~ RPhd"Mc 53H 53~53H 53 h53j i|$G8jm$Sj$P蟴Sh$bh$bG0O4 tQPh$PPhS$诗}qh53j hFHsF 8-uJF $1҉QQ$$PhQA#hSSh$9bvG1#$h->% Vb h # Va hX$WpD$0$D$tD$)$1ot$w7] Vaw w Va53H 53; 63h53j Xg53H 53 \$53H 53; 63h53j g53H 53 GtPh%$a h7"`53H 53; 63h53j f53H 53 53H 53; 63h53j |f53H 53 Ow7w  53H 53~53H 53 h53j fhF D$Sh$ `$1۹$v6SJ $|$$v vS, \$'Wh{$PS$WhQA#PVVS3uhh&S VSh $m_ GPhQA#hVVh$H_G8$jmVj$PҰVh $"_h5$_G0O4 t#$QPhRP\$ RhS$ٓUSWVӋ$$$$D'hB$" Ft hI$^h$x^F ~1ɋӉ13$ 6@uh$hY$hh$)^l8|$VhQA#hWaWuQh$]Ę> t hI$]h#] 1A AAt$QhQA#hVVhS$hw$h$o]Ĕh$Z]|$uhusuqVh$oh.#2]uuulh$$tOA#PRhi=%\Ĝ;8jmWj$VzVhQA#hWWhT$\Đ^_[]USWV΋\$$|$ ʉl$͍L$jj hOA#UPjQ yD$SWVh$O\|$tUh b$:\j P[ ^_[]USWVDt$`l$\\$XT$1 'A 'A'A'B0$` h$VU k)Hw]r$uStJPSu7HsutPD$PS uh|'jD^_[]1Hu߅tjh'D$P薼 t9-/3uPh7CD$PS벃luh&&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uh$SW a~bt)iuRt7D$PV"uUt$D$PVtD$PV8uh'jռe^_[]Ãluh&&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=/3d1t$t$PPt$VUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H >6H >6@>6 >6h >61>6F>6F>6F >6F^Vt$|$uD$ h>60(>6FD$>6F@ >6F<>6F8^fUSWV$ $$#ht"WV ou-<95/3Vi 1O$ Qh$D$P $2ƋFHt$ $8'h ^ hSh%PD$ |þ1${h Wh$P} Phh"V# CPh$V CPh$V xCPh$V ]CPh&&V BCPh$V 'CPh$V  CPh$Vf CPh $VK C Ph.$V0 C Ph=$V CPhJ$V <$u脒 $oVt$o ZGU $ɿt$ D$tQh$P D$Ph#t$ ut~ f whh$PQ jG8PhQA#h$SgShq$V, 5GP[Ph#Vz Vh$ D$f D$$$Fm~ 1B$e KƋ $Qh$V "WhQA#h$SSh&&VS WhQA#h$SYShq$V wwh->%VR wwh$V6 w$w hk"V g(jmD$Pj$W|$tD$Ph$V 0Vt$n $B$$L$ AA H9t$h$t$ t$h$t$} t$ v5t$ur t$H h#U h9"UkOPV53tlS#ahX'j֮ VdH hX$$1OSt$?H 1Ot$0H 6h53V3V 1*Uh#$ u Vt$G ^_[]ÅtVG h$h-$h h$h$hh$hv$hh_$'fUSWV]} #D$D$ h$SW iu5<tFumD$ D$9=/3uUj]$,(ǃD$T$ЃD$,jS5t%D$t6h$hl'j*jS D$ tjStD$t hl $w@h#Vg$tQcs "h$P[f )j$P2\ h$V,f hh$D$ Pf jhP\ D$0Ph#t$ D$0$L$ 11t$ L$ D$Phq$t$D bD$\Pt$ tpt$hO$S 1O1PLV>E 0h$h$S躥VE h4$S螥t$D ֋D$+D$ L$,D$D$@L$$L$%Vz D$HPh$V_ D$TL$ 9L$PD$LL$9L$HD$$4$K =4$K D$ @M$P$t1PPPE!ƒE$|$ 1]Qt$1 ;$F;t$ ukhX$S襣1Oe^_[]h$uc-t$hO$uu h$hr$uY1O1t$b]D$L$$jQP!ƒBD$;D$w6E$t$Pt$]X ;$F;t$vh#t$Db h%P,b P} hPt$ h$Va Pj D$(vt$(I ËD$1AL$D$D$4|L$L$4|D$D$lPh$Su P|$l$Phh"S ($Ph$S $Ph$S $Ph$S $48Vh&&S $Ph$Sf $Ph$SE `$Ph$S$ ?$Ph $S3 $Ph.$S >u$L$4fL$fB$Ph=$S $PhJ$S t$(G Åt$(G $fǀU1PPPE !ƒ[u$t$N ;$4t$8Ɖ D$t$.G fËt$01 |$lD$Ph&&S D$lPt$SD$Phq$S| D$|Pt$$Ph->%S `$Ph$S B$Phk"S $D$Ph$S tj$$Pt$ 藔 D$DPh$S D$D9M$ $ȃhL$pQP t$E Åt$E U$61QQP !ƒ~t$ M$$VPY 9U]$|$$D$jRP !ƒ=M$$VP 9E$1SP|$W GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$6h(`V!V!4>6h2VZ!<>6h2WG!Vn!We!^_h$j hL63jjZh$5USWV< $P ÍD$P{jt$ SKW D$t$s$;\$vSDn }71ۀ=C6jU ED$E\$S1QQhWPUd thhOA#W} Wh$=jU ~11ɋ\$luAu꺀UtPBD$ 1ۉs KuT$ )ڃt rKu\$t| It11ҋ\$Rh"]"<F$;td~jW Ƅ$;t$1QQh$KQPW$W] thhOA#Wv Wh $<jvh$h$LUUh^$;D$tPhh$;jL ZjNh jl$ U jvU\ F QPD$0P Uhji W tpD$4 D$,L$0 L$( $;j*ljh$);T$0L$4 tH)Љ|M1K%8/$; 81$;tyhv$蕼jh$:Phݪ%:h$:L$(D$, t )|1h$:Whݪ%p:$;|$tv vSj j96D$1P}@ ^_[]h$h$ ht+$h%j USWV $Sh'U Ǿ'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHX2qL1ATAPAXkiA\$A`i Ad$Ah!i Al$ApFeQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph"V |$V V ](C 1Љً](L$I$1 sD$PFvD$D$ t2t$ ^ {uWvI u{u C $ USWVQ u'|$\$l$jGEU3^_[]hY$j USWV$$j-It[ō\$h jSf jvS |$v ShIi U; t!$#D$$^_[]h$h$h$jf fht2=USWV$(x ōD$PIsjt$UN |$ZÍ$l$ D$wU9 %G x1Ҁ=C6=C6T$R1RRhVQPthhOA#V Vh$4ou1۸w) 4PjQ VUD$P T$ʅҍ$t(» t)1M։9$uSh"]"44G\$t@GS1RRhVQP-thhOA#VF Vh $3l$ yT_31w) 4PjQ VSD$P D$Ph!$3$\$Gt@GS1RRhVQPthhOA#V Vh.$F3jwh<$h\$ SJSh^$3\$tw wjLj 2?D$1Pv^_[]h$h$ht+$j~ USWVD$X$\$l$@EM}M UMUMT$ U M$U(M,T$0U0M4}8E<@E@MD1҉UHULUPUTEXi@E\i$E`iEdu$Eh!iEl$UpQRPd 1USVP^_[]ËL$1B L$SWV։ωhjS jwSw G PKSHK@ CjDt%Sh'iP t#t$Đ^_[h$h$h$j fUSWV l$4UttQ"DGU@Ë|$\$uoh$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,h$ MHtU4uL9rRQP t$|$t%u@uhV tIm81tSul|$tDEM9rQWP2 u@u`Vs u@yu@u`V] teEptUt$8ЃtEu8uXV3 t, ^_[]h$h$Ah$h$5h$h$)u\u\h%$udSh$j wlh{$j/ fUSWVt$F 1tvt$+H t[Sl1 tCP=R Vt$^J tPUWK uW") Si1 1S\1 WsF ^_[]USWVu]Ph$S& t$f1j?1Nt}ǍD$ Phj$S] td\$ t\hjD$P  jS\$S ShiW t$E L$Uf jQh$P je^_[]PPhj$t$ u1$YVPt$ t$t$V tPhj$V u1$^USWVt$t$G t Nj\$ Pb 9v ? 1N*Ƌl$Wb VPUZ )SjU  ^_[]USWVt$t$OG t?Nj\$ P b 9s9Ƌl$W)b VPU )SjU>    ?1N^_[]UPh%u. t$ 1H]USWV@uPh,$V ] h$VzF tPma |$ P\$$ShiV\@ |$ jS_ Ph$u `H V& ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPZ_ t!Ph$SH V% 1He^_[]h>%h$hh5$WV|$$h$WzE t;P;` u1V]` jPV/ VhiWQ? t^_h$h$jVh5$h$j蠳 VD>6h2V V L>6huV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh$hVa>tVh"$.(VFߋD$t$j7QPh$hV>tVh7$'VF߁^UVuPh?$$VB t3$L$ AQhiV= u hF$$C1e^]h>%h:$$hh$UVuPh|$$V t3$L$ AQhiVe= u h$$Ҩ1e^]h>%hw$$hh$UWV}W#ƉPhnl$WW tZt4$P<tW@PVD\ tGPh $$u D t>V1e^_]h>%h$$hh$h#$h$$h$$ h$$h$$j h%$$t$KB tPh $$t$uD Hh&h$$hh$WVPt$|$D$PVW t2D$t H^_h $$h$j衪 h&h $$hh$hSWV\$,h["$S; t`PV GW<t\WPh["$STtL@xpPhiS5 t5Vx1g1H^_[h$$h$$j贩 hX $jة USWV8}D$Ph$W u \$Sc1OtjL$D$ x L$, D$0!1҉ƒt$u !L$,T$ !D$0j SCT t$Phq!$V< D$S |$Oe^_[]h>%hK#$hfh$USWVuPh $V tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]h>%h/$$h0h$>UVuPh$V t,jt$V 4 1u"h#$h{$ k1He^]WVPt$V't&ǍD$Pt$V> u Whr $j§ PED$L$AËD$L$AËD$L$AËD$L$AËD$ 221ËD$ 221ËD$ 221ËD$ 221ËD$H@2 21SV\$ Sh2]uCЃ r"CrCr 01H^[h2轶H?r  ؈21ыL$t C61ÍAЃ r)Aw AwÉ1HUSWV1t$ D$hVP 2xC6t8u^C6ǁC6C6C6C6C6C6C6C6C6C6C6C6C6@wh2R&uh"$0h29&uh#$hx2 &u h/#$j< $52tvh2%61C6C6C62tx2$h2$U ƃV B~>CNC6F v/FwD$, 'C6Au"hT$*$'C6xu>Wu4D$P1VhVVj V5< C69t$:*ƀC6l `C Lvms22u(2C6C6rC6C6D$P1VhVVj V5< C69t$taYC6>C6OC6CatTl5(2+wtz29t22$ÿ2؉$2/3 C6$u =C6uB=C6=C6=C6u|t =C6u =C6uftu^C6uS$ttH)ŋ$L$ T$ RQL$QWPU%u. u&hY"he$,5<h%j趡 t$PD$P & u h$D$t,DtVPyDžuhY"h$JW WtS)uhY"h$WuhY"h$2t H9t@hY"h$$@ uh$hY"h*h$VWЃ Wj\ USWVl- uh?%$he$j觠 Ƹ2jmPOA#OA#t%$jL2Pt%$USWhE%$hL632t VSm#%$uOA#WWWWWQWh%$hL63$Vh j V 21tT$q9t Iu^WVΉhjW_ D$Ph\$$V tZh$V 1 tQPK L$PyRPQ WhiV* u hg$$NĔ^_h&hT$$hh$ WV hq!$Q0 t;PHK  u1WjK j PW< Whui V^* t ^_hU#$hH#$hih$hw#$j語 h! $H1ÃD$ 1ɉJJJ JJ BRhiP) t1hX $jQ $1ɉJJRhiP) u 1Đhe $j Qh2wUSWV΅t Rx, * * 0($D$PP!\$D$1t$$tsVsD$tVPVhj$W trC=C6D$uCt\=C6uCuM=C6uCt>=C6uLhj$V VhiWn( t!$uۋt$$4u=C6t ~ j h53s Wt& 2ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPh $h$VUVUh9!$& jl$U$V߯ Vhit$] t$,$t!PhW!$VhF!$茒,$jt$V芯 Vh~it$ t$tPhb!$j ꍄ$P$$ j:QPhx!$h$PM$t'$Uh!$UժE}uj:$$hx!$h$P$t'$Uh"$UzE}u-24$tVWUmuj|$W$V< $$ DŽ$@Vhit$V u$ h"$(1@Pl$U%jWl$0U׭ 1@D$81D$ļ^_[]P:h$$h'$h$h U"h'$ h'$h'$j葏 VjmuC6hVV2^h?($jX hL63jjHh)$赹UVuU OPh($V t!#C6 $ C61e^]h>%h($hhm($USWV(ӉQtoh($U& tC6H1 Rh8i(U u 8uIjh($S t)D$C6t(^_[]h$Vh )$j h($h($h'$j( SWVt$T$;h$V{ t\ƋC6Pf: V+: PW!t+Ɖ߁PW艖t2 ÉC611H^_[h8%h)$hhm($oh%)$WV֋|$ Q胓VWPh-)$j1 WVPt$T$thd($V tkP9 Vj9 PW`t>ƉPV5C68 ǣC6V]1u C6$h#Z1H^_h8%hE)$hhm($WVPt$T$h'$V  tbP8 V8 PW踌tIƉPV5C6萕 ǣC6V赾1u! C6$h#1H^_USWVt$T$1hT)$Vq thƋ-C6P\8 V!8 PWt6ƉPWt>V ݉-C611H^_[]h8%hQ)$h2hm($Yh5#fSWV|$ t1H>t$|$\$j@ PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V5 tE$$PwCt/$F ~G F1  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r U8"t$8tC1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1 USWVuD$ tV} ]CtP7 tEC tP7 u/D$ Ph%7ַ u$D$1$N1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V\t|$,$h%WD$G&tD$1{tj/t$4tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$+D$4D$4D$ PD$8Pt$ t$ ÅuD$ x1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr$1X \$TfD$t7|$0j WPw~ t9t1ۉD$=r"11HD$$P¸|$1OL$L$D$L$T$PQRh)$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P^NjD$fVSP諶 sD$ t P4$W*0 W蔷<4$uM S]s {te|$t^t$Vt$t_@PW/ W$tNVsE0Z ߉Vu ۉt3EF ^C F1Vt$h)$h)$h)$h$$ h)$h$$jM WVt$tVMr1H^_V t3t$L$|$ Pwt΋D$F ~G F1? USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t P 1GG GG1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7- t+{0t>-uUst>Vst)u 1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$+'4v6 !6 P;6  v6l tMtk $t$ 4$UQ*$ 1N^_[]hN*$ h*$h*$jZy WVC6h 2VVD6hϯVD6h WVW^_USWV, $@ 1 8C6t1ۈ$+$*|$hjW WhKiVb l$(EPƀ}u jU$ $GL$$*SjQhRPUu jW $L$ $+SjQhUPW費1f|$0t,L$f|$ 0t,D$ tm/$L$ T$QUR$6QPh*$A, ^_[]hL63jj7h*$PjhIit$  t1h/*$jw WVt$ L29tEtt%h0$hNh/$h0$jm VPt$ D$Ph{%VU t!D$ Pt 1^h>%h0$h4h/$脾h0$jm VPt$ D$Ph1$V t!D$IPxt 1^h>%h0$hAh/$!h0$j5m WV$t$0j!jW D$j Phr%V袶t$WhiV t1$^_h40$h"0$jl h>0$jl UWV uPh91$V{ t<|$WhiV t=$D$WhiV t)1e^_]h>%h41$hh/$/h/$h0$j$t^h1$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhq/$jj 1Hx^_[]h0$h0$jkj WV0t$<|$jWh,$V萴t8W t7HfJBRhiV t!10^_h`0$hM0$Whk0$ji h,$jj SWV,D6h2VS4D6h2W@VgW^ t2D$*=) Ph1$=C6t h1$1Shi8U |$Dh1$1tPDL@uShi8U t$HuM1|TuD@uD$L|C<=3L$P9Dzty:t|$jQh1$t uVh1$11t j,DLxPtT h1$v<u h#j $PhiU tDh1$r$t$h1$T h}%#Ej [PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR! Ph1$$=tPh1$j $=tPh1$^_[]PhH1$je hL63jhh2$苏ÃD$1ɉJJ JJ fBRhiPm t1h,$jd 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hq/$jd USWV,$@$PhiV tr$A jjj"e xgljj2 xi$-hSW6 xB$/uE$0uf$Ciu.h,$Z1H h,$Zh-$ZWm7 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'h-$hge%h|-$hw-$h5/$h,$h-$QL$4QhN-$(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q TD6t TD6EUD6tIAtcAtCAtPA tSA@tBAyAAT$hTD6UWt$PVt$D$VPRRh-$,l$ }"E!Ê<)\<$ -'=C6`Cs|$[VPWl$Ph-$h-$<#<*<0<2=C6<$-$<t-$sQh{$#1L;OA#y.$QRPhn #G%9u<]K%C=Ph-$h{$t=C6S<$CPh.$RKPh#.$<K s k t?L$D$F*.$PWhcE% N{%܋L$D$(Mu} L$D$D$F/.$PtPtPum.$@.$ `.$"QPhcE%s N{%D$ŋL$D$(ȉ</=C6%<C<$T-'/$=C6CPh-$=C6CKSRQPh-$h.$C~@sFNuQPh.$ IRQPh .$yMuj>l$ L=C6?CPh-$A(sh-$h{$&=C6<$CPh.$KPh#.$Ck tAt$D$x*.$\PVhcE% O{%܋D$t$)E}twt$D$p/.$ttum.$@.$ `.$"QPhcE%> N{%D$<t$)ƃl$ rPh4.$j><$€.$$@-'.$rQ=PuJC<u;h-$h{$=C6yCKQPhw.$v ]=C6Pȹ-$6<"<f/$.$ .$/$/$ /$(/$0/$:/$?/$H/$Q/$X/$h-$h{$=C6<$CPh.$1D3 OA#t.$T3 ׃l3 URWPQ1'h.$Muj>[l$ ^_[]ø w1'ø"øSw1'ø"VPt$ D$Ph/$V tD$P^h>%h/$hh/$蠨VPt$ D$Ph1$Vʃ tD$P^h>%h/$hh/$SWVt$(|$WhiV tND$Ph0$Vb tCD$D$WhiV 1uh0$N1H^_h/$jV h>%h0$hh/$迧fUSWV8`i y h2$MhG%; y h2$Mjh2$t\KL$jQPK D$tPh4$LMjh2$M H21 VPh  VPUSWQRPh`$1EVRQUh/BVWh:. 1H\$(C CCVWPPUPP P P PPPPS8VSj& |$www wwVWj{ VWjo V( S( W( D$ @ )T$VVQRWPL`1I9u 8tމ5tD6 H2tщ1@8^_[]h4$Kj 葪jjHj h4$[j u84$jVgt4$jhcc$h4$Vh#A"hQ$ j 5j .USWV`~ZD$=tD6tIt@ƍD$H@ L$1jQRRjPN_ut$VhR4$< 1t$HFFF FF1G>\$SVj l$ UVWީ HƅZH21OjUj* t:9uB$=h3$jV/&  c8uh H29tttn1VSj? VD$$Pj/ H2vh3$@jjj 1VSj VU6h3$1=H2u$=|$ u'1VSjè VWj跨 `^_[]Ét҃t̓ u1Ht$8F FFV# Ph3$u12$WV t2$D$8x xx8WPV# "A"{jh3$hݘ#= Q$SWO Wh`3$jVV荧SWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP蓧 $H $u˃^_[áxD6H xD6t$Vt$V趚Ph2$ijVH2VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjn ?XWV1N=tD6tED$@ L$1҉RRQWjP[t4$ h-4$^_VQ$ jh1'" jV" tPmUt^Vh4$>j辥Vh4$)j詥PD$L$ $QPj茙 ]XPD$L$ $QPjm >j& XÐUSWV$$D$D$D$,1H$11D$h5$WSZ f~/P w`1A$2'5< D$u[FtR=5<D$,D$낃g<8#u(@j L$ QPMF $D$8L<Ph@$)<8#u)@j L$ QPE D$D$8<L$QP' j D$ P5<E D$D$8c1Fj D$ P5<E $D$85<h05$8/3<=|D6u-D6~q5|D61ۋtVP胖uJVh{$aFtPh6$KFtPh6$5j K-D6C 9|?,u)É\$(k <D$j^ D$P^ Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0B1ɉQD$ P4 D4D$8u 8tz`Xt$7|D6u |D6-D6CPV”t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPP j\ |$tt$ VUW^  UW 8C|$$8D$@PWc tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW7t!t$ VUW^ #|$$tS9u$UWH RW! $D$utSPW uWh5$@1ļ^_[]Ë <=3DQu VSh{$j> $ 4h7$hD$ዄ$ 4h8$뻍$PShc#sh7$SWVP΋9tRWh:$STWp RR^_[&PPPh:$hL63Եj說USWV11C:nu~ou 1@$1$QRh%D$P5 t<18nuxot,$VPth%j ut$o^_[]USWVPωjPk 1~:Ë,$WP蠆tWP茆t Ku^_[]USWVӉ͋$$,WV+ t2\$$$ $t(Xu%D$ =Vh%8$3/&h["S蓮1ɅL$ $|$ u f$,/u $K0&E$D$$jP=  Él$|$$jh38$V; ōjZD$ P$4Pj; u-t L$PVQA;  Ku$,l$$t !#t Z#t ắm"ẠH%4'$, PWٽ th$ dhD$D$ ắm"1ۃ=D6yhR8$Pj t$Wh:8$T.4'jj@+PD$|$ tjh38$U : t9$ٺJ"pt D$(Uhn8$ D$(UhYr$hPED$0ffsD$,t_puD$(moun$D$L$(D$D$$(h%PW1G@F9NjD$|,6VPO ɉD$t3o-uj=S8ct6CD$J#h%$,PָÅu 1G 1GD$D$D$L$ D$$,LD$D=D6$u D6tBhv8$d|&1G1D$4hD%>F9uj OtD$PO u h%#/.$,ƅ$t Pkt$ju |$ $Htu$(t$ jj ތWSt$ ~1)h~#)/$t P~jt$rjD$ u|$ jWt$ 탼$u$(h53P:#$(jPV t"$(؃tTu*uChk#.1C؁^_[]ÁttP"PUhe#_ 1ۃ$u=D6t$, PUǹ t$, Uh8$J=D6uj$t7t$ 1FV Vt$L u h|8$-%2'$(\$(SPhP%hWnt$W4 ٍ8tUWh;#h- u跍8uD$(PUPh8$A-jGUSWV ˁD$Pj VL$ Qh8$B#+t$12'Gt6t =D6t#o$tX#FwPhcE% G!Ņt G d4'rt4o$tX#UOA#t#FUQPh8$訪1tKo$tX#FPh8$~Ut 0h{$ hQA#P=D6o$tX#FstspPh8$ =D6o$tX#Ph{$sds`sTsPh9$ީslshs\sXh9$ũ=D6|Ut$ 1|$$hVPPh["Pt$5u(|$ t!j V]tVWh=9$g h%Z"#t#Ph{$9^_[]fWVt$t-t|$ PW}tu\E64 1\E6^_WVD$ 18nuxou \E6PH4t_1,tu@AP/UtCƉ8j,W\1Gt@Gj,P\'h7&*h U")WUe1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3WhMA"nF uWVhw"jh2 D$@t.D$t$QPh6'hVWVvj輞USWV$$$1hWS蟅 8D$$81G=<=/3D$ C|D$D$1D$h(;$UV< T~H wV$4' $׃Gt!M5<L$ 뱀L$5<-$Ax|$뎃UL$5<($At|$_ $V $M5<L$|$0P$h,5'5<;=&P< $/3)ƃ|$|$t L$T$ ttL$ T$|$u 1AL$t$St$V$r$$Ap\$t t|$uSD$PVrt\uD$0$AtuD$4$Ax|$u#D$ L$ L$Ĕ^_[]h"j/ Vh~$qPhp;$hL63! jfWVPt$jWV2' 9u9t x^_Vt$h"j. Vt$VIt@^h"V^Vt$VNt@^h$V|^WVPt$jWV& 9t9u x^_Vh"jt. WVt$|$ VWÉ t$?/tWh"茴Vh"~^_Wh"j[. fWVt$ |$7 WVSWV$D$\$VPWS$,$,njS7Vh+?%A u$Ltu!D$"t$͗"jV"0[wPVt$ h"jn- USWV\$ l$|$t$1E1@</3ht"WV8 ou%jSh7'5<9tEPr9ǃuA/3)ރu4t$$V4Nut$(t;^_[]h"j, ݂Phl"hL63荤 jcfWVt$|$ VW t$?/tWh"踲Vh"課^_Wh"j, fWVt$ |$7C WVUSWV $$l$WVSU$ $ hU3Whv6%@ uWVhw"j, D$@tY$$QPhl:'hV'hV1LD$tS\$O$oj j ShWt$ PjtP zPhZ=$蛬t$ SWhj=$趛t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h=$x81p^_[]WVhw"j& j裒SWV\$D$@u+t$&t;SP t7VDX1 `E6C`E6C^_[h7&j% j7USWVPL$$T$ l$\$1$12֍zhw<$US0 @~7M$:'OӃ23=E6E6먀'룋 <DF@N@늋 <IF(NnOe <R 2KF ?$20O' <aF8N E6O <g\PcSD$ p4t$ N @OPt$(h;'5<t0Ƌ$t E6t'tOt@tO t=E6E6 s=E6E6g@tOy $2sg st1A T$ J sh"V:.E6$fyh`%V.L$ A$I$sh<$V-L$ A I$sh<$V-L$ A$I$sh<$V-L$ A$h>$h>$hy>$hC>$Ph)>$hL63; jWVt$|$ VW{ t$?/tWh"hVh"Z^_Wh"j7 fD$Htu L$fHQh?$j SWVP\$$CxP Cjjp(! 1Ox\ƉC@HtuMKfHjPjjVOappV. ujt$ t$ V lj^_[Qh?$j, WVt$F1GyiD$ PWQ 9ujt$ t$ v=P 1H^_fUSWVl$\$|$USW 1IL$$fG1AAAAAAAAAE6BE6ʉQċT$0Aȋt$,AˉYЋD$(͉iԋ\$ ˉY؃č^<RSh PQhWt5v%NɅuNɅt(Qh;?$h+?$h uH1I^_[])V$o$$$ɉȉFFF D$pjPjVjjhR w2t08gPhD?$he#轒 tH1HD$pȁ^USWVt$\$l$ |$$tWUSVt$$1N|I; E6u=OɃu3_˅t( Zt8St0Shp?$hP?$!Ɖ^_[]VD$L$ T$r؉1Jf^USWV D$jlj1111ɉD$ظ $}`|$Ӌ$$Pt$t$@t$@t$0T$Ds8jj|$ $ىNjD$)щ|$뎸9D$,,$Pt$,t$(T$0 t$||u3j)9}hN݃D$,|%L$,9QPh?$hx?$輐r<1H ^_[]fUSWVd$xj[Vh8F6& j@VDt4$Fj:V ]A $$|1D$hhhhh hh(K H|$WPhn$VntP0nPVh?$ #CD$D$ @4$D$ UhD$PX D$,$Uj$lSm V?*9rȉ$`WVS^K jD$PW$lPjt$hD$(P t.2,$AuU=E6uLD$D$ 1@D$p $t)ɋ,$t;|$ h?$~1E6$E6,$ E6D$ @tL$L$fQP$|BD8F6D$ HJ@BBE6uE6ȉBB B b1Ed^_[]fUSWVUE1ɉHHH1F0HHH HD$ 5<5/3\$ \$(0i&\$$} ]D$,D$D$D$D$ D$h?$WSL# H$?'P5<($ 3$L$T$,JjuhX?'5<E$P#뇉=<jh@$W* t5jh@$W tZPW# $T$D$0PW D$0t 8D$ D$(JD$0PWw D$0t 8D$ vD$$c50i&$T$$MA QD$5<D$o5<D$1@D$Q5<tD$ 1@D$35/3)h4u! }WtD$0PW|$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5<h?$h" 5<h @$j Wh@$PWh@$Wh}A$ PWhOA$jD Wh:@$WkPhA$hL63 j݁SWV$t$$$$\$VPWS$H$HTj S7VhfA"( D$@t$hW@$$t$t$hd@$ t$ t$ ht@$ t$B5t0h@$ۉjt$h@$Ɖ t$/t0h@$觉jt$ h@$蒉 t$ h@$聉1$^_[VhK@$j% WVt$ |$7 WV1^_U0E\$D$,1ɍT$ QQPRh)A$$ uUD$ L$$L$D$l$i&\$ D$L$ |$D$ fD$l$|$l$D$T$]h6A$jl WVPt$jWV:  9u9t x^_Vt$h"j Vt$V-t@^h"V^Vt$V2t@^h$V|^WVPt$jWV  9t9u x^_Vh"j| WVt$|$ VWm t$?/tWh"蔘Vh"膘^_Wh"jc fWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ} PQ40I40<8)<8D@ D@LHLHTPTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40/40<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7uVw wbV FwwNVFww:VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuu SCu$u S$C EDȉCDu,u(S,C(E@ȉC@u4u0S4C0EHȉCHuhrB$.=F6<$=<hj$WMuF6G=<1#PPjPPh21@D$$<1"PPjPPjF6m<1CH$PPhPh<F6P9<1B$PPhPjF6 =<=F6j:W,Aj/W,.?yF6<D$l$0UU݋\$UW|$Pv F6F6s<=3DH,WD$h$WLh8#&WLF6W F6N1hI$PPhPj p2,F6 <=3DHWiD$<$F6hbC$/3=h2_=F6tVhC$z5<hTC$j5<hB$ZhC$Ph"j Wh>C$9Wh8K$.D$ =F6u1=F6@F6$1󫍄$,BF6Al$$+D$ -F6t1$ 1D$$$MljL$$ PW8?t$h#D$F6l$Ul$RQPOF $׉ȉ F6=F61| hD$$t/$$T$9‰sQt$t$WPhD$tFtA F6WPUH u5F65F6t$hAE$|$(F=$PUx uRt$h\E$ A#$=`hF6hKD$1=F6 $VhHu VhpE$al$VjD$PP F6-F6-F6݃=F6~VUWt$hE$r|>9|Pt$t$ )̓ }4$.\$l$ F6F6ɋ|$  F6=F6 F65F6σ|,@σ|1ҿ9  F69|щ F6|$ D=F6EjjhF6 .hF6hpD$F6=F6tF6F6t&hQhE$a F6F6t=|hPh"F$8 =F6u1=F61@F6=F6u F6F6=l2,=F6t#jhF$hqF$hfF$ՀF6=F6u=h2F6F6t$t$ t$4Ut$$Vt$t 9t V) t U =F69$Pt~ErtƃhB$Bj fJPhF$jd$8Pm} j j j hf% J6$F6F6ApQtF6@jxQP$PhB$u gP0eVhF$jd$8P8m$T $|$8jU$P{ $,PSbBu/jZ$P$\Pt u$4mfsjWV賣 9uD$8%PKBP$PhF$hE$|$D$D$4jPo $u/hF6hD$$Ph8$jXB hk#j 6 /dev3F6 F6/ D$ F6tD$ F6<$~~l$4 $jWhf"g u ƃrl$Wl$$UAMGWUA:l$ ʼn\$4Ë$H$|$F6\$L$ u DF6$T$J6-h jP%F hh3>K6g-}] hjPE K6=K6h2t>dž,<tx(=F6dž dž,dž(Ɔ p2t2u(jhK$f=F6-5J6u"jhK$f=F6,5J6 F6N0F6F4Qt$Qh L$f=F6w,5J6F4Ht$Ph6L$hf=F6S,5J6F4 F69}"QPhbL$9f =F6+,5J6F0=)hPhL$ f =F6+5J6F0=|)hPhL$e =F6+5J6F0N49}QPhL$e =F6+F6J6;F6|QUUUU)ʹ3333!!сis{09\~\{0\\5F6sXș9}%CX=F6~Qh!M$dJ6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h9M$d=F6**J6{4$=F611F9tA uPhO$jS $Kd=F65F6 u։<8=h2[ WVhzM$dc =F6)J6<$C4$8=F6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQP4Njs8ƒPVRWf)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVhM$a=F6'F6tm J6yxH1҉$q1ҋ8$$)$<$$1C$I8$ F6=J6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W21C1 t׉Ë$$QPV$$V 9s($$$V'2É׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQP[/Ë$Ë$ʃQPRSaa)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ-j$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQhM$zZ =F6 J6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=h2$_|HL!ʉG41SSjhjPSm K6N J6I4QSP6 J6H K6 K6 K6P44Q5K6щ K6`@#HL 9| Hh l2H< F6HX F6H\ F6PTXH fǀ$`|%=J6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=h25O _(HLJ$F6$$$t!LJ^F=F6$$߬$$ڌ$4i&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$M$U J6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$2N$T=J6O0 9| IУ K6$K6=F6u\Tu))У$K61VVjhjPV0(K6u K69$K6$K65$K6jP}2 =F6GF6 F61ظ|(RQhlN$S =F6F6 F65(K65F6~ ș)dہ|4(C'GuȹC=F6tL1$PP$$5F6V1=F6VhZN F61u;1$VhjVu  =(K65J6h`VW =F6tWV5J6x\(K6hhP0 1@$=F6hO$J=F6|o5J6N,I\Tt~!NȃN׊Nd1 t1WPh $RRyP$639u1H$Whht@P  PPftu!ѡF6t $ Q$=F6u$|&J6H,$$DŽ$%$ J6I,$1$ DŽ$1h53} J6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hP$趄=F6Y J6j5K6- 5K6FU $F +$^J6$~J`^p=h2uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=F6uFh$ NlK`ڍOȃ$ډFd;v&hO$=F6J65K6F $11ہ~U uv`щSAJ6$~!ـ1@ K6Il J65K6F=h2Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5K6N uҋJ6B8H!tk)D4J6B8)Nj5K6$9sE)ȉـ1B~U uv`5K6F$CHu͋J6B8$؋N9ȉ$J`~U uv`щSJ6$~!ـ1@ K6Il J65K6F=h2Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45K6;Vs2р1@~U uv`5K6F$BɋJ6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$K6H K6V$P V PV~x; K6up=F6tK6s4PP J6K6@K6Kd15K6s4K6K6 J6q4jP& J65K6{0 9 (K6PVQ =F6t(K65J6P5K6g J6y0(K6$ryxtG$\ll%TuCl$AP$ J6Ou$ց\TtQ!QЃyId t15(K65 K63 5J6\TG~8^xN`1?9'$K6+$~0lj$Ɖ$)ى$=(K6$Yk%Gl(K6$K69wߋ$9w$J6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=F6} $H$$$~A=F62$=|j.aD扄$OA#tDO% J6ׁ\TtQ!QЃYId t1RP$VhN$D$$;$$|W=F69J6H,t =F6 $$ DŽ$j cCDŽ$CJ6;X,/$~ j 5C=F6 $hjPQ" h2 F6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A?$hl$lh2fDŽ$2tx2$_ lj$DŽ$J6H4$ $ H5J6D@VL!! $`Nd8?fAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$x2@ lj$DŽ$ J6H4$ $l$h  5J6D@~L!! $߉$Nd t1$Sv4$j2J6@0p9w Au1H$$DŽ$1$$tC= ǡF6J6@05F6V$SQP$h$l F6ɉ$$$t RPB$CPKT$l$hߍ$󥃼$$tA$ȃ=F6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$&$pthj$P J6\T$$i$$ $$$$DŽ$H0$$_$ J6@$D$@L!! $`:$hw $l$  J6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h J6@$D$ @L!! $$9$W $$h$lJ6Hd t1$S6j$$V J6$ȔȐG$11F$t =F6$$=J640=h20w4w+_1(K6$`SWP> $PjSu =F6t$W\=F6t(K6ǀ\8 J6=(K6x\hhP F6QP.WV=F6t K6 J6q4PP׸ 5J6HLNd t15 K6v4t5K695K6vG=F6tJ6p4VVx 5K6K6@K6=J6Od1Vw45$K65(K6*J6@4P5 K6e^_[]ÿWjV 1=F6VW\h#p:BhO$^oj&1j%1j(1J6j 1j~1j'w1jp1hN$LhN$BjU1jN1jG1j@1j91j21j+1j$1j1j1j 1USWV=F6ua΋\$=F6tF6J6St$P 4׋ F6UPSt$$5K6ț 9u^_[]g0 PWVhfO$09j$v0USWV"=F6΅ ,K6uJ6H4H K6 ,K6 =F6;F6F6J6;}FWh 8C'1I!;HtG#P;Pt;H uV9R_1ڍ_5(K6P=F6Wh De^_[]USWV΋L$l$=F6t=F6teUjQ/p׋ F6SPUt$$5K6@ 9t?0 PWVh@O$}7j".F6J6UPQm ^_[]SI`wD$$B'1C:QhN$hL639 .  [SWV1ۃ=F6։ SjQ( =h2@fF F)f ^_[USWV Ӊϋ5J6F Nd t15K6G=F6tK65J6PP跳 K6yU +y/\$|$y1U =J61=U L$D$uq`|$ G`Ӊ $u щw*l$$C'р4l$skPhN$hL637 =J6K6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}AhP$ h_P$hP$i11҉ ^_[]ÉՁ|$U u L$I` L$w$C'ʉـ1@BPhN$hL636 8ʍ 6ʍ   1$5J6$~3%)1@ K6Il 5J6K6K= K6Od$sC=h2CNdЋT$ t1҉t$VQPR{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPR7L$|$ щT$ՉD$ȋL$D$VW|$RPV7ыt$ʋL$Vt$QRP$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45J6;F8|$}X1Bσ) K6yU uI`1@5J6;F8|$|=F6tK6VPP 5J6F Nd t15K6USWV$΋=J6G Od t15K6=F6tK65J6PP胮 K6xU t)hP$e=F6(K6xU ‹l$(H $t@\$=F6tK65J6PP =J6G Od t15K6wJ6 K6HC, $9r%UQhO$/ =F6VJ6 $\D$jT$RPQD$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5(K6WJ6\Tud(K6jpxt$0t$ $<=F6WV1L(ɉL(@ u1LXɉLX@ul$(K6jpxt$0t$  $,;=F6trUV胪1tttpԣTtDpC u1讣Cu) R% $D l$hVU R% $D9Pl$J6T$5(K6p0^_[]j$j $WV։σ=h2ȃ@PQRq =F6t'ȉGffF=h2u GffF^_fUSWV$8tW- ƅuWh"j臷 $$<$4D$Phd@U tg1OVhedAU  F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uh %t$H 1 Sh("U CPh9"Ub C PhE"UP CPhW"U> CPhk"U, $@D$t P' 1-Uhzd@$<W t1 VhedAW hjU  D$ P$4謋D$, 9L$L$9u0$S11:7 8tx$0hϧ"b$11҉ $ƅ*ŰPj PU ^_[]$0h"j: USWV01ۍD$,ShPSu1NtAljSPSWuW诈 uMU D$t$$$Q1e^_[]fWVt$|$ VW t$?/tWh":Vh":^_Wh"js fUSWV|$$\$(SWt$(t$(I )jj`SWѪ~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPמE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVV 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj $u VhpE$ DK6TK6%PK6ʼn߃=9|Pt$t$S{ )σ}4$1 4K6-0K6uU-4K6uY5TK6=PK6DK6@19lj| 19ǃ| 4K6u 0K6͋5TK6=PK6DK6ˉjURP=LK6l$ HK6uA@19lj$ $t$u hXK6hD$jPVWv|$wext23$2fs3$ Wh"hXK6hC'VhXK6hD$} 19ǃ} hE$ LK6t$VUt$  U{ t 9t V{ jUSWVӉ $]|$j W\$ S&* Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ 8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h4" QPWUt$t$hd" t$t$hѢ"j_ WVxL63Ph4Q$V' 1GVWjh"VhD'őWUSWVu} D$8jP =XO65\O654K6%UUUU)3333!!щ%i0K6BDK69922T$u tv|$΍QxO6|O65dU6 hU6VT$ pU6tU6ډlU6P…Ƅ!) xU61f1ҁ‰t$$r=TK6PK6\$9D$ U6T$tO61t$$ËT$ u׍؉)9H1D$ 1LK6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣLK65dO6`O62t$ƺQ=|U6D$U6D$ U6hO6D$O6O61 O65O6D$8O6O6O6SO6O6O6N5O6O6O6O6[O6fO6 fO6O6 2fO6\$H$SW8s 93rWhO6rp 58K6|$t"V;YjVhO6袭 1O6`S6,P6(P6O6D$O6 dO6+ tO6 1҃r1I15O6~σRVPW.5dU6H19w+5U6|$OL$)9r΅u O6f5.P654K65U6VU6YVjP GD$AD$ 11L$\$O6tO6tnO6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& U6@O6t .P6 U6@ U61HU6L2 U6D1\$;|$tO6)áU6f\0 U6D1 O6u\$fT1 U6T1fD1L$ G;|$tD$ O6|$11t$lO6pO6=hV$H=Y$KPW8 LW8@L$H U7@fP\$1ҀڈP@ U7P U7P ; jhU7j j5U7ݿ hY$<=31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQha$PM HơW7 W79}1Ҋ\1A xVWhV7hNa$ hGa$nhL63萧W81B 8X8W8@W8xW8W8|W8W8W8W8W8 W8 uCءW8H`8|W8D`8 xW8 @`8W8 W8W8 ؉+xW8|W8D$HT$Ll$HW8+W8D$8D$85Li&v?|$ D$ fD$l$\$4l$ D$4Ӊ W8W8i&whU7 ha8la8 W8W8pa8W8ʚ; W8W86eĉW811ۋla8ha8D$T$ ؋pa8|W8D$xW8D$W8D$5W8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05Li&i&t$v W8W85W8=pa8|$(t$(|$D$ fD$ l$ \$,l$|$,=W8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5W8 W8=W8U7t 1AU7y7W7 W79}(da8i-@=B'dW7@9uda8e^_[]h a$h>Y$j$t USWVhW8jI U7Pi&\$Du{'-W8W8D$hD$h5Li&\$Dݜ$݄$hxW8j u{(-xW8W8D$dD$d5Li&݄$\$DW8;U7D$DW8 W8 t]+ xW8|W8$$߬$W8+W8D$\D$\5Li&i&s=W8uZU7tQW8 W8 t5+ xW8|W8L$xD$|l$xW8+W8D$XD$X5Li&wD$DD$DW8U7 Ti&w١|W8 xW8 t>+ W8W8$$߬$W8+W8D$`D$`5Li&D$Dw\$8U7$fDŽ$jhTW8jTC D$8 Xi&|$&D$& fD$Bl$B\$Tl$&t$Tj$P D SD$lD$lPD$,Pj5W75W75U7oC <hxW8j6 W7D$8<BC97)؉D$D$8 T$G'\$A9 W8I؉L$A W8Iff9uW8W8X8|W8 X8xW8X8X8 X8uW8 X8|W8X8xW8X8W8U7 1D$188 #8l1A h$Z$fhL63AU7<1A t$, PVhHZ$ ΍T$(jt$>Ph,`$pD$ U7t$؉T$΍T$(jt$F$H'h\$΍T$(jt$Jhv^$΍T$(jt$bF$H'h^$΍T$(jt$$Fft$NfQPh_$> ΍T$(jt$؉t$h1_$΍T$(jt$^؉t$hI_$v΍T$(jt$z0FT_hb_$G΍T$(jt$9FPh_$΍T$(jt$ ؉t$h_$΍T$(jt$؉t$h_$΍T$(jt$d؉t$h_$΍T$(jt$9؉t$hZ%T΍T$(jt$X؉t$h`$)΍T$(jt$-؉t$h`$_hx_$KPh_$7L$lL$AQ D$iPh^$h^$ h^$h^$NhL`8h_$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظi[$L$dT$C;W8u#PhW8QD$XiAL$$ D$LW8PQhW8 T$Ҹi[$u1Gj[$T$PL$r |$ rI53H 53~53H 53 h53j n(  }T$A{^N2D$ˀ) ho[$uPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPht[$hS[$9 |$ sS53H 53~53H 53 h53j )  }KF߉Ήs(T$h[[$L$T$؅t%53H 53~53H 53 1I h53j h53!ءW8;U7*؅tءU7!^L$AQ T$Q= X8 X8 t+)|$L$p|$tl$pX8)ЉD$PD$P5Li&(X8(X80X80X82v2W8vW8\$CfK%8X8f!t8`8 W8T$ .KfKf8X8D$ PW8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$JPW8@)t2(uK <`8U7t1 <`8hmZ$ <`8 U7 PVhZ$l PhQ^$h\$h\$h]$AfPh:]$h_]$hs]$h]$h]$h]$h]$h]$h]$h ^$wh%^$mh?^$c <`8hZ$1BD$D$pf2@)f~\U7tSωL$!ȹT$V!RPt$ hZ$<T$ D$,U7t1RT$D$fxf52U7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41BW7C9D$=U7 ؉T$5W7|$7dW7)RQP: GD$9L$~D$8:dW7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E5W7)dW7t$>RQPh[$W7;W7}0u hU$Ph6#}Cы\$1B\$D$\$D$T$jh-Z$jb 1AhU"WV>8W8~bW8W8 53Q53; 63h53j.W8 53Q53.H W8by`)W8W8 53Q53; 63h53jkW8 53Q53H W8|tN=W8t453H 53~53H 53 h53j W8W8h53胑hL63vxW8W8|W8W8W8W88^_jj1A1=W8PUSWV׉E\$1AMU7]E uWVh[$Pt h[$?Sh[$1U7t5@D$ Xi&\$D$$[$U7fyuhL63je^_[]UVh1AtD$V7$[$W8D$$[$W8D$$[$w8`8tD$$\$^W8t9+ W8} $ \$!L$LD$L 0i&D$Ht$H\$$C\$$ 0 W8U7 8`8L$DD$D=(X8@|-0X8Xi& 2 W8\$,D$(\$ D$\$D$\$D$$V\$[U7 X8 X8 t5+ X8X8L$XD$\l$XX8+ X8D$@D$@5Li&W8 W8 t7+ @`8D`8L$PD$Tl$PW8+H`8D$`$ ^_[]SWVyYU7t%<t^t3U7D>L> QPhQ`$lU7tkD>L> QPhr`$F|>uGD>U7ufPh`$"L> ffPQh`$ ^_[WVU7u8jjVv t'86覽 PWh`$hhL`8="6聽 Ph{$hhL`8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hb$$t$t$ t$SPh`$ UPh`$ t$t$t$ h`$t$袼 Ph`$t$ 舼 Ph($r0G9s'GPh"d| KG9r߃$^_[]fUSWVƀ8-uFh#V9u ta8h#V1u xa8T$,11CD$D$hc$Rt$0d Hw؉$PH'\$̃duE뻁뱀=ta8t\랉\$떁댁낃u1 /31;L$(ujz1L$ 1ɉT$Љ $PhL$Au $APzD$t2ڋL$ PW49 Whf uމ$DuY|$uj<< Džui Pxm/$t8=ta8uIj Vh# Whc$T1FV薡Ph{$VW SU- h#=xa8Mj Vh#茡 Wh%c$V腡 \$OA#Y"Yc$VWS+ jjVWS\$u( 1GWWWj۫WjЫWjūWV趫Wj 諫VW1* u h[c$jV jj* uGhc$8j u' j j j) t)qtOQh j j) uݭ~c$8t1Aj jh#C ukWhJc$jhc$Ut$Ux+ c$Q*M肭0WW9) c$tOA#V詟PShcE%WU SWh7c$j˟AVG&=ta8uOA#貫VPhc$hL63aj7fD$tPhd$yhJ'Phd$hL63$jUSWVPu } hJ'WVc` cR~5StET a8͍Hw4$H'a8벃La8a8둃ftTdL a8ta8ea8Va8Ga88a8) /3Ua8=a8tjjh3%(' a8ND$ jjj"yU a8jL$$Qh@hP躕 u h%Ja8i )ލ<S H $H'=a8t1Aj D$<1CPS-D$D$ PSD$D$$PS~D$D$(PS~D$ D$,PS~D$D$0PS~D$D$4PS~D$8|$ |$z |$o |$ d |$Y |$N F a8D$8gtj5a8Q' rD$ D$OA#D$D$OA#_;-a8SXt.H$1ۃ=a8uWh1j$hj$h]e% >hG&SHg =a8uhj$hi$h]e% 1Ca8FLCSS H3 VT$W$H' \$@1ɍP$I'a81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12a8#a8L$L$# 1AD$ PD$@PD$ D$<+a8R D$ Pj$a82a82a82 a8a8׋t$#D$ Pja8d$zT$ ED$ L$TL$@JL$Ca8"2-L$#d$d$d$L$׋t$a8:b8@.b8"a8b8 b8\$ (b8a8a8 t a8t a81SSPF L$Y\=a8j$)/jD$D$ D$OA#D$OA#a8L$9a|$u qa8 a8ta|$  ‰4 D$=a8T$tD$1@D$ Ф1ۉD$0hxSh0b8 atgcuL$3b8 8b82b8d8@d8Db8a8 SUD$Po j.hd8D$ Pj9UPh{$j.hd8<d8PhD%艳F 53H 53~53H 53 h53j ;h53m0^_[]USWVD׋T$\l$Xa8ua82 a8A $T$w $dJ'2-t gr^rr r r2^h2%W譆$"t$1۽uj/W  tōt$$^^^^^ FF\$SVhG&W D$$tE/SVhG&W軐 n1\1ۋ$t.t) a8t$jtVWP  L$PjVӏ t$F11$< w<w© <wKɉ$w'$1E$J' $F$1EF11Gщ;t$r.t벃뭅ul$$l$ Ej/WdV<$L=a8W躂  E/1ۋt$~~jv|$Wdl V詎 jWY |$$u|1ۃ<$uoFr%1C uW1D$ D$D$D$F Fu=&h %Vt# a8T$v1FD$)1C؃D^_[]ET$LW% t$ȉt$V3CىD^_[]/t$VW t<$ul=a8tcW\ ŃuhWVth uTWD$$L$ D$$HT$JHp 1V6 '.U 1ۃ<$ T$t$e1C~ ~~~G&Whj$hj$|Whj$j8 USWVP։Q$ ý a8t a89t;~11 F@Ft 1JʋFP\كF@FF1҉PPP P|FWhPL$ L$ tND919^_[]Whj$Phj$j7 VD$ a8tw:114w "w w7ɉJ@ΉpfP ɀ:u r9‰w@^Áw뛁w렁vw닁wHfW1ցlSVYtt:uOq( PVhpk$1D$hPQjPVhk$QE PVh~k$ Q>PSVhk$۫h53^f^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjVA+D$  P X1PPWSjVA|$dt$ \$hl$) D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy92tE2P{y$L$t hl$h-e$QQh%PPhk$h C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP#PPhl$踩 53H 53~53H 53 h53j tT$h9t$f hl$[ L^_[]hzg$ jhk$j3 D$t'T$tt hl$h-e$QQh%PPhk$ ËD$t%u'l$%tul$Ph1l$l$!l$Phj#螨USWV|$<\$8D$4t$0~u/jUQ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhM"Ph{$PWh#ۧ ^_[]USWV|$4t$0=d8uMd8hhd8b4t d8'j.hd8[t@hPhd8= t"^tCt0Wv`rhh2%he8~= ^_[]1w)ȉPjQ] SVUc fEu jU P WUu&Vhf8ShOl$hhe8He8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhf8Shxl$hhe8ؤe8[SWV$L$4D$1GLM't$"tZ@:t9rD$PhGl$,^_[SWV|$t^D$uFD$jjPt t1Nj0j.VYt@hd8Pyu7ut$s 2%hVhe8; e8^_[VD$L$ 1Ҁ0QRRhhe8VPLs thhM%he8Y e8^Au yuyt$Qtu ȃP Q APhl$hhe8Ve8SWVD$f8Q4l$Rf84l$Rf8ƄRf8.r|I1AFL$ tWWVWhN' u;D$ D$ PDWWVD$PhN'x tt$}TĨ ^_[]hDO%t$ \ tԉ1|$l$Vh$PVSdGHt$t$Wh|dD$PPa \$tN1D$;D$ 2i9t$sVt$LNt!ʼnD$t$Wh|dt$` ul$$WhedAP` f$a$>ukSt$hf"h%h$WהƄ$tg85?n$ kn$tv$QPW $Kà9Éu|$$PE 1hDO%j Å~A1ۉh:z"PiujVhf"hcE%h$WƄ$|$tg8\?n$ kn$tu$QPW C;\$ mU"R|$l$|$$PUSWV n ujD$$D$<$shn$Vhth7%Vh3hU_- Ƅ$h7%s_hut s h7%Vtt s hn$Vʐt Pz, g8D$ hn$V衐tHág8th#Pg(j,SGtZ S,,PD$PUxD$!=`ÉUh{$ SDž?tG<$tSWUhn$h%h$V豑VX tEUhn$ƣZhn$责?Uhn$h%h$P_15g8tD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hXr$h$S6\$ =h8uD$]X$D$ P$P輍 h8\$t$Phbr$ h8PUU uUh{$1@$~#Qh>r$͖1@$\$$$Ĕ ^_[]$Ph{$j kfPhmr$hL63 j|USWV L$h8$T$t-h8*jhh82 h8šh8$T$1i E$48t!u6$t$P"YT$ uF$t$PYT$ tEM<ǃ hD$1 ^_[]ËD$ t 0h8$4$݋D$ t 0h8$$ؾ h8Phh h8j uh h8h{$j" fVD$t.})zhJ!9hr$5<8訆 $9T轴DO%%N'PQhcE%5<8s=#u5<8h $ $9^ËD$ H^WVθ%N'PVWt)uVhS}$5<8 $9SGt8tPwhr$x whr$fuj whJ!9 Gl!9p!9^_WVD$ t;5p!9D$=8 L8u 8N';pt8@uVhr$jf @u=!9th!9Phr$À Phr$賀u5p!9=8^_Ã|$t r$$9Ã|$t %$9Ã|$t r$rϲ$9Ã|$uh!9hr$5<8 螲$9Ã|$uh!9h s$5<8N m$9Ã|$uht!9h0s$5<8 <$9SWV$$DŽ$HH$p)Ƌ$ ƒtS!=9ws$trs$ms$atσ=9 = 9 PSj $;rtr1Auu($$hVs$PQJ te$P$$has$PQ t8$(1;BQPVWEVu=ְ$9^_[USWVx֋$$t{tp11@=<=3D_t1z\t r9΅t<΄t45<=3AҀ|Vy54=3TVP5<=3@u΋$ $t`1Hh:9trʄt<$1ۊ(9t8tCu 9s99B+$=FFu4$D$|$ 1 J9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ J9<$؉D$J9$to\[$uvz$\$-<=3BDEJ<0HB,t ]tVрy$t[<=3BDC$G)=~"B $tG)=BJB5A<=3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5<8hf}$ <$?uhVW x^_[]USWV0$Du%$H$Dh|s$PQ y1E-8*9h&jUhl8 t$H4$=l8I1VV$PH Í|$0;=8=8*9$H5 95959s =9ws$trs$9ƒ=̋8RPSQUy=8*9uE=88t<̋8̋8$Hct8*9̋8 8*9VV$PO Å 4$j8*9x$90^_[]Ã$D|Ã=8t=ȋ8;1 T$󫋄$HRjh4d |$D$=8ʉǃ=8*9$H[L$05 959j =9ws$trs$9Ã=̋8VPRQw=8*9u9=88t05̋8̋8$H1t8*95̋8G=8-=8*9$H$HL$05 959j ƃ=9ws$trs$$H9=̋8PVRQv=8*9u_=88tV=̋8̋8$H1t8*9=̋8$$H4hs$^D$P E;$Dnj=88t#<8@=u1Hjh"#PX jhl8Y WV=8*9t@=88t75̋8=8̋8815̋8=8u 8*9^_USWV1@=̋8S=8Fϻ}$ͅtUSh}$5<8x5<8 1t$PhVh53xd4=3L$DH?uzP#t5ċ8RPhnu$Qm8#5<8jj6h7u$I 81$9^_hu$hȋ8t$t$ $9hu$h܋8t$t$$9WVD$ tZ}UuZt$~hFN"W>tOh}%#W>tBWy7vhu$5<8l 1H_1=L81@1L8 H81Ҿ}%#tFN" щ H8PVhu$5<8tl1=L8$9^_ËD$uD$L$hu$PQ[ tvD$ph&v$gu<=$9u0=8t5<8hu$ D$ph%v$tgu+"90&90*9֙$9VD$ L$$9t u]H |8HQtsP t8 =0"9<8t5h0"9h>v$P7k $9(^KVh-v$gPjj$hWv$V%^ËD$tIDuD$L$has$PQ t$D$ph|v$Ufu"9Ș$9SWVD$-uD$L$hs$PQ  1G=8*9h&jlWhl8謇 t D$1VVt$ ǀ?tx=8*9tyD$thWh|v$eu "9=8*9uB=88t9=̋8̋8D$bt8*9=̋8 8*9VVt$Q DžaSj致8*9|$9^_[ËD$uD$L$hv$PQL tmD$_D$L$hv$PQ( tI|$BD$phv${du8D$phv$bdu"9ÃtЖ$9USWVt$ |$.E1ۈ$5<8jj,hv$% u v1.L$9^_[]$9USWV D$ #D$$L$ hs$PQ L$ ȃ#D$$L$ hVs$PQ D$ L$$|<$Dh#t$8t3$8|t+4$$H$v$ 3D$$hv$07D$1E-8*9h&j7Uhl8w t D$$\t$=8*91D$ H9=89"t#v$9t$t#T$$VVP4t$Q8*9u?=88t6̋8̋8D$$" 8*9tA 8*9̋8E_t$jV8*9$9t4$9$9 ^_[]SWV$tKjjgtK~S 9uWjد1uhw$Ò1H$9^_[þV Fujj苯hR# Q$tj/V. t@hQW =L8t85<8V <8HQP~ Q Pj mg|j59hR #WVh  jWVh Vhw$$9jXSWVPD$D$t&D$t$h=w$PV製 r莑$9^_[ËD$phFw$^u|$hNw$ tD$x|$WhYw$^WSPjW> uP|$haw$ t D$x |$Whkw$I^WPjW> 1ۃuM|$ Àu*D$p Vhkw$^VPjVD> 85<8hsw$ D$$97=0*9t =0&9u=0&9t#h0&9hw$5<8a $95<8jj%hw$wËD$$9ŏ=0"9uD=0"9t#h0"9hw$5<8pa $95<8jj$hWv$ËD$uD$L$hw$PQH teD$ph x$\u<=$9u0=8t5<8hw$ D$ph x$a\u"9Ԏ$9ËD$uD$L$hw$PQ螺 teD$ph?x$[u<=$9u0=8t5<8hx$ D$ph>x$[u"9*$9ËD$t8uD$L$hFx$PQ tD$L$QPhOA# ڍ$9USWVh$Vh $|F$$h1Gh4V 9}hhDO%V G9$uVh{$Zu jLT"9^_[]ËD$t8uD$L$h[x$PQ tD$L$QPhux$ $9ËD$thuD$L$h5#PQ輸 tHD$:D$L$has$PQ蘸 t$|$D$pph{x$Y Ãte$9VD$t$588u hx$Y%($9D$ phx$Y58^VD$Hr$9>588uhx$8YD$ phx$"Y58^VD$t$588u hx$X%p$9D$ phx$X58^Ã|$u|$t5$9Ã=8t 1PP)j=8t 1PP jQ|$u|$t܊$9Ã=8thx$3X7V1VVcVYQVPD$ D$t}uD$p*{$9h |$Wt+ht%Wt h|$Wu: 1Cv荼tu&6h|$5<8L z1H$9^_[t`8ud8d8P5`8h5|$5<8L1VD$ L$$9ʃuCuD42tK<2VOA#tQPj h`|$5<8=Lu^Rzjpp $9^WV|$ WtQƋ|$@tPFWdF=8t3|$t,P6h|$5<8KWhi|$5<8K ^_WV|$D$ $9uIw_tAƋ@tPF6h|$5<8?K $9^_Rywhi|$5<8K ^_V|$t.= "9t6588h|$F58(x$95<8jj,h|$u^VD$Hrx$9`="9t$588u(h}$F-5<8jj,h|$D$ ph }$E58^VD$u5= "9t=T$ 588Ju:Qh@}$E;x$905<8jj,h}$rQhH}$RE 58^ÐUSWV@$(@u$,@tw~!$,@$(@h({$PQ菣 tӋ=8~+$,@X1<*9j US t F9u19u2$,@ph$5<8I $9@^_[]ÍD$h@h̘8P H*9D$@1ɽ $L$99` <=3OGGDA@u̘8ȃ$t \u_GGY <=3WDQuViuAG;$(@}/$,@8)Q4V! $,@41@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@8)QtV $,@tH,80舆tƃu5<8hx$'5<8hx$~ t;=8u25<8hy$ $9D$@9G=8t<5<8h̘8ߺ <8HQP~ Q Pj vJj 6\$S ,8,8058V =8t'~t!<8HQP;H~EQh@D$Ph̘8b 8$(@,8$,@PjI븃<$JE1A;$(@t4fUSWV1$D$jh8c t%=8t 1PP1<$~KD$@$Ahjh&j <$t(=8t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:48tm8=D8u D8D$ Y$-8t+h#Ut}|tU8<$~D$@$D$<$d-SWV։jh$Q jh$W tlh$W>tjh$W uYt F t8t4h$t8tjh$W t ^_[(11VPP ^_[)WSh$jI USWV$\$@t$<|$j h$W |$D$ 1D$D$SyƉ$P>D0h,$P(t$Dh6$$t$ $t|$@t$t$@ЃD$;8t|$tt$UD$L$d).$`.$Y.$tM.|$Htt$H D$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=8t;P=D$HL$H+8tD$Ej/t$L t@Pt$Dh]$t$HD$t$8L$D|$D$819999$$98t1$Pt$u$\$` 99|$py9€$h^#t$LƸD$|$t$u$QPu5$8$<$$$\$` 999 9t+t$j5959P)Y=8tPt$Hh$5<8< 99 tQPh$5<8<5<8h"#x 1O$=d8Kd8 1O$*|$pu D$TQh$Jm8ht$hW =$"9|$Lu:|$LD$puuh$t$Hh#*uh$c~D$L9$|$LD$L8|$dD$t$h$ ~8P&$$W$<h%VB1A$<$ǀ?tvj:W t=@j $QPQC ~޻t?$9u3;$u*WV9$<r$)PWR t/h%VWBDžm1Ft$Hhɀ$1$t PE$$u |$p$$9 9t$Lt Vh$t$d蔯t|$dj%Wt Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1hf%WA tVhȃ$G$(2W*DŽ$t$D$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB (8JBB D$(PRW$8 t ]Y0 RtD$(Z$$PN-j j WhSvv t%h"PS j "PW =8t+D$(xt!~$t$WSP5<87v jv Åx`=8u~PvvSvx)$P$P$PhOA#裈ykS蚓 1KW$Ph $迶 Nȉޅɍ$P  PW$4h$Eh1N=Ћ8tJ$t$uP莚$$t$uPi$8~R<*9Whcc$WtNu1h@hN$h̘8t %u,8058ދ$tPDŽ$$t4WPjW) $tPDŽ$$t4WfPjW $tPDŽ$D$(t P |$D$$hj$T8<tQohs$$辰D$$\t$ vj:T8tV&=8tWhI$5<85 t$$tI=8D$tPt$hhn$hr$5<841@t$ht$hh0$f |$dwh$V #h$Vh$Vӭ@8tph7J#V跭 ȅu9 95<8hn$ 5959hĄ$Vq5959hل$5<841F&1t$lh~$V7 $`#=P8t"D$$$t$QP|$h-$ tPh:$Wج hKt$h@t$hK$W辬D$$0$|$Pt1$tn$tX#tD=8$tPh_$5<83 FWh$$8WM $$0t-=8tPht$5<82 FSh$W t=8t5<8h#` h#t$ ۫t$t1V`}\$D$Lt$P52Ɖ$$ىD$6{$< u$, $ $X$V52Vj $Pt$09 99k$8D$D$\D$ D$X$ًT$ D$t$|$hL9V#m|$^D$(8*T$ @ً\$ 1T$(1 $RVDŽ$8$Pe$$t$(NjD$D$\D$ D$XًT$ D$t$P$$D$`]j $QP8 х$Ɖ$$$8-@D$(j $QPK8 Ӊ9 $$$$$D$(8/t$HL$(x*\$u4$j $PQ7 ƉӅ$$D$(8$$9 9\$|$\T$X$$$$JNjD$PtPD$PWFD$PD$D$\D$ D$XًT$ D$t$\$߉$(Ɖ$ ˋD$X$D$\$$X$$P52-$$$$($$$ $$$g$$D$8$D$4$ D$0$D$,$(1@$΋$  \$ۋ|$$7 ;. m8H m8 h$ \$D$ D$8L$4D$ D$0D$D$,T$1@t$|$$L$<$$D$,$D$0$D$4$D$8$t$t Wst Vfߋ$$$$$$$t,%t$ht$hhЂ$8 $$ˋ$$H8;D$M|$@hbj'u$hju$d8n ;m8v+ m8tQwd8m8PDm818858$t$jtDŽ$jVlމ|$`$t$5m85m8脧 $jD$,P5m82 \$(;m8W8"NF؊ u@;ut tH@D$(h#PF-$$u 1É.1ˉ$$8$4=8t/j$P}8։щ ыm8um81ى߉$$|$`t<$;$$|$$$$$$5ʋ$$4$8;$$Ɖ$|$$t$Pj5m8C$L$T$P88$)$$m8T$@R1Ot1$VSW蘀 $u*#tu'VSWn t߉$ȉ)u$$P9=9=8$T$L8$9=8}#Ή5<8X$Pq<8HQP;H~-Q#8Ρ89=8}Pj#\)Ћ$$L$T $|$`t)։>ډ׋$$|$m8‹$4$8$ 8ˉƉ$D$@1S$Pd$+$$$$+$ى|g@By)QѮj$P$+$$$$+$ΉЃ||$`t$@$Dt$M$|$`tCt$5m85m8臢 h#5m8M|$`=$@$Dt$hWY#&|h#t$cD$8|jj n$D$@h9"P(X D$@|$@DŽ$H9 9 m!ڃt9}M#$H599$$!;$$=8t5<8jj hm$D$T}D$@53=9=88 8ƒ89}%<8HQP ;HQ#<8HQP<Q 8tB$ڋ$!t 9591ϋ$H1 D$h#P h9"t$F"D$@|$@tDŽ$u t$D$@Phw$h$Vh$O<"m8)PSh%$àh7$%Pt$Hh{$jBlh\$h~$/bh̆$/L$D$ D$8t$4D$ D$0D$D$,T$1@މPj v$t$ӛth$)jct$@$=u $#$1V$W貵$$$$$$t$@Ѓt$@Wt$~ u.5<8$PPRPh$V  8=8| jjk9x& 9 898; 9u188D1\$  9 9PL$T$ T$8t$4\$0r\$ 81tt$h$5<88 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh<$(-D$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#"7tt$h*$5<8o T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$,D$L$ L$8t$4\$0hW$[,D$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$hȅ$$+$D$8$D$4$D$0t$,$$1@މjhX$H+D$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h$hց$hh$USWVD1D$ D$D$D$fD$D$0D$8D$4jh$QL t}D$VƉD$j@Pt%L$L$4D8@PPƉD$j:Vr@P*D$ t$D$0|$ă$jPW4 D$4t 8D$t{8tvD$ t8tj;Pl th$Ph$Wh$WVWh$5) Vh$%)1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhf%V, @L$ǃuC=ȋ8taD$t$uI$t>th $V蓲1Ʌ $t}th $Uq1ɉL$<=D8=8t 1PPӼ=D8|$DhPW[ |$L$D$L$D$ tD$ D$$=Ћ8Ћ8L$QPq=Ћ88t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPh$' "D$Pj詓<$l$,|$u'j/V:tG1|$t>tFhh!&l$LU" l$t$1l$ -"9D$Pj«9-"9*x1l$,1Kd}Z<$t3$DSVW豫 Shf%WR SUWG <$hhJp%t$LVw t$l$D$ D$<4uT5̋8̋8=8~$ts$hP|$LW' |$D$Pj5̋88uj/UU t@ʼnD$ D$$=8tAD$Pj?>uP=$9uDhL63jhhb$)1D$PjV8$91ۃcÍL$%L$0d؁D^_[]1Eh$$PhX$h;$j\ USWV օ\$ |$$jh$Q< l$t=jh$U$ t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U.$t9lj)CSyS\$$UP& { uG<$WxC Uxj@V|$$tZ{ u D8w@P}xƋ_j:St@P\xG_Ot[uUnj]Ua$tYÊ@t<:uL)SUV  Vɉ,$}:1j:VtEt$t$Vh&$1ۋ\$ t3tHj PU@ }t $9ut=s fCt$t$Uhk$8"CC tWt_uk8KUVh$" t$t$VhF$!\$ n1HJ38(uOA#UvC{u{ f%tf%PvC1 ^_[]h$j? WV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*5<=3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=88t|jj KMD$~h^#W6 D$|$n8D$ D$538u NjhHt82 t$jLD$=h88xP] 8|$tt$D$j$98=8jLh^#VD$|$t~D$ u D$fxtD$xD$(PWFux.#D$0=u$$ 99u h'$5<8 Whw$Vh#$9D$tt$jKD$tt$j kK8xPI\ 8|$ t|$t D$ t$Ѓ|$t t$!D$$819988e^_[]Ë=9 99" t^L$ hws$VQthms$V?9"u3p!9HD$fxL$ D$@щυtSVh% Vh{$"9WD$|$Y`8;@t8v+ Dt8tQ蠹`8@t8PmcDt8jAD$ujj ID$=9tD8=8t 9!ȉ'D$ !jWPt$ C1p!9HspL$1HfytL$IT$fztD$PV5 85@t85Dt8IE aPhmV#9}NED$HQPD$~ Q P!à tWti8 8;L$D$|T<8HQP;H~0Q#5<8t8L$D$L$Pj#͋D$@ @D$HQP;H~bQ 88D$HQP;H~(˃ tًz888PS+Pj 1HjWQPЅx,5959h>$ s$u hɀ${tc8 8;L$D$}%<8HQP ;HQ#<8HQP~ Q Pj ^D$@ @tu hmV#{D$@ @t$b8 t h$z1H88j>|$ tD$ t$ЃD$t$1t$V8=8 Pj#%h$hx$h+hH$@SWV |$$D$hs$Wt D$s$=9ws$trs$D$l!9ƅu=("9=,"9 4F95p!9t jVthȋ$j$=895p!9t jVth@p8hݎ$t$ jhp8 jhHt8w hjEp8hs$Wx l8|t1@v5<8h$gm M5<8hŎ$Om j#$9!hjjD$ 99 tQPh>$ \$$SWh% j5? j%#D$ 99 tQPh>$ Vt$h%j p81WW"W4$jCj"=p8SVh$5<8n4$jCjo" ^_[Åu1t PU"=h8t j  |$1=l8P"=h8t j  |$1=l8P!=h8tV |?91j $,y h$v=8t $9jYVV=l8t ju!jk!=8t $94$jQBVt$h% t)Vt$h% u=h8 j =h8{jklWVd81VA58*95o89rt suY%$$dWPVT WhM$V <8Iu1IPVQO jhHt8 Ph+$jI~ USWVD$=ԋ8pt8o8t8jjP 8H8tL$jQjhP軿 t8<<=8w=8j=8=L8u 8h$Ɖ=8~&t =8u!h|;9hi#5<84 =8tC$9=$ 5<8h$h ht$8t1A =8= 8=8=L8u 8h$>Ɖ=8~&t =8u%h|;9hi#5<8n =8y$9=tT$ wJ5<8h$g ?$tg8hȋ$=8 ȋ$3$t2 8h͋$~=8͋$PASV3Q LPSV3Q QEPSV3I1  $$9=t$$ <$$T$$$VRQPWh$h@p8= $$:$:$:$t8o8D$fft8k=؋858N 8ԋ8=t81t8o8u ft88t PnN t8jjP{ 8=t8u(QT$ RQhP 8 t8Qht8P6 H8tjD$ Pjh58ɻ D$1t8t8t8t8t8t8t8D$Pht858D OD$t8j58jy h$p=t8" t8$t#/=8=8=8= 81)L$ ׾t8󥀼$u DŽ$$j j $Qh$QPRD =8=L8u 8$P$Pt$hÍ$Ɖ=8~&t =8u.h|;9hi#5<8  =8+8 t8tPVt8 t8t85t8=t8t8SWVRQPhӍ$Ht8$t8$t8D$|t8D$xt8D$tt8D$pt8D$lt8D$ht8D$dt8D$`t8D$\-t8t8=t85t8t8 t8t8PQjRVWSUt$|$$$$$$$$$$jjh$/X=8[=t8Nt81ۉht$m1A#hV$hu$u t81ɀ=t8D$jD$ Pjj58 1Ƀ5<8hҋ$a 1E=t8$9=$ w5<8h$h,$l58I 81AJt8;$9=t+$ w!5<8h$W5<8Q` 뗠t8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Phތ$h@p8ճ , |$ |$|$1-t8-t8-t8-t8-t8-t8-t8ft8D$L$  ȋL$$ D$( ȣt8D$ $ fD$ L$$T$(t$\$VWRQPSh$h@p8 1-t8-t8-t8-t8-t8-t8-t8ft8D$L$  ȋL$$ D$( ȣt8D$ $ ft8f t8;o8t8jPht858`1ɀ=t8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$h@p8蝱 \|$ |$|$1t8t8t8t8t8t8t8ft8Lt8@uD$ $ ff t8jho8ht8H 5<8hs$5<8h$5<8h=$5<8h$5<8hs$=؋8USWVX=ԋ88tuP)jjPE ƃPj58D t$8D$fD$D$jP<~T8<D$T$ |$ Mbt$1PW ~T$L$+T$ +L$(x@Biy1PjV>a u:8t08#th.$uhO$ o8t$4\$8VS58pD ǃu+8t 8#uoVS58ED t׉58D =8t$jWC ut:|$9uD$0jPjjW± V58Ehr$f58C 81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ 8|$ t<$t D$ 4$Ѓ|$t t$萷D$88D$4܋8188e^_[]h#u ڳE 8|j/u T 8t8 zt ;u t"E "} f%tu%jP.f%jP/].=9u+M8 uhu A =9t"8 Q|$ p!9tEl!99t jP[jSI99$9A=6t jjk[ jhHt8] t~jhHt8J u(hj+=h8t$M $98=8j+u h$_{|$t) 99 tQPh>$ Ut;tSuh% uh{$ h^#mD$|$}t1uu F$<$t{D$ u u h$;h#u CtbE 8|ujj *D$E @h9"P $<$18܋8D$ (u h#^T$5318܋8$fxt$xD$`PWkt#D$h=t 18܋8d8;t8v+ t8tQwd8t8PDCt8j!=9t8=8t 9!1ǡp!9Hs:|$> 99 )$fz$R|$0|$9 91PPPt$ "K9=9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q P t u\$,ى;=99|1jPPt$ !\$0D$HQPD$~ Q P艳 " t ]Pj pti8 8;L$D$|T<8HQP;H~0Q#5<8Ô8L$D$L$Pj#̓88D$HQPD$~ Q9 P趲ǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 88gPQ ۋ] 8 8;L$D$}%<8HQP ;HzQ#<8HQPQ 1JjQPR4x~L$1HfytL$I$fzt$PW585t85t8Vp8 t h֊$Z1H88vu hɀ$YE @Phw$4Pj D$@ @t$8 t h֊$Y1H88$@ @tu hWY#|Yj|$ tD$ 4$Ѓ$t$1t$V9t$t*t$h$5<8 5<8h$}M 8 8|$| j%=܋8D$ =u jSwBT$DD$@!уk։1\$HPSmns{ 1CSu fs 75<8} D$@PבP6DPWhI$VPj#^h$hʊ$h3hH$USWV\$j/S t"f%9tjP/f%tu%jPDžxx8hSh80l ƀ8.ue8G1dMt[G09tÉ؉jh8rx.0uO.u1GOtSh$2W1^_[]5<8h3$K SWVd|$t1F58j"jdh|$Sxk <8Iu1IPSQ(1 W9VhHt8! SWV?9 f$D$@=u1H$jjSP`t h|$\Vhh$5?9 5?9 |?9j Dž,y h|$V=8t $9j9t+t&1ONthSPg1 ju=$9(u jju'hZ$ =8t $9j8^_[V軵08j o8蚵0^USWVPo8hj |$ l8te$t8,~81@K$,~8t81l88E8 $"9CthQP=i E$"9 <o8o8<o8o8|?9<<|?9?9@@?9l!9DDl!9p!9HHp!9h8LLh89PP99TT99XX99\\9`;(9VQPh VW(9Pg q;99VQPg VW99Pg 9 9;J9VQPg VWJ9Pg J9VPSmg VUJ9P[g 4$Vj=o8to8jփ^_[]8j&=88t#<8@=u1Hjh"#P, 818*9o8jhp8 WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR1K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5<8h$E $9Q |?911j1xt5V9 |?91Vh$@Q$9jR4^5<8h$E fUSWV(q1hOA#S$@0 88"%8"%ċ8h$n $t ċ81@ȋ8̋8Ћ8ԋ8؋8܋88888888858858 858888 8$8(8)8h$(n tVPh)8sd 9 I,8h"m N"t 08hԐ$m h,$PtFht%VԡtJh2k$V¡t5<8hȐ87 K=̔8th̔8h($5<8 5<8|jh@h̘8h53'tEt W=8k,80t&ƅu'x$$5<8P=7 /x$~ ty$=8t8j 6W&W ,88,8058V =8t'~t!<8HQP;H~Q~ : Pj`hj h&j ^_Ã=88t<8HQP~Q fPj eV5Đ8u<42t!82h1#PtFuh$j_J 5Đ8y$tPhhȐ83 Ȑ8^SWV|$1t*42t!42WP蘓t Cuމ^_[V5Ȕ8u<42t!82h$PYtFuhԒ$jI 5Ȕ8OA#tPhh̔8P3 ̔8^V8̘89819 ,8A85P5,8O:t8^USWV1|$-2t}D$2111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,h?%$D$Pt uu ^_[]c;9ơ<8=l8#tE$Qh$P 2t72 l8ttPl#PV8 l8uV-jV D$E3Vxtǃu&Vt$hM$ Vt$hi$5<8bE|$tw7j h`|$5<8?"j 7t$V S t$D$PjW Mr^_[]USWVP 89$t!uL9t.u=9A89!229 9A t tu 99tu$91B9 9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF59 8;$9 81tu 999^_[]WVt$ t842t<2VPtuVh$jwE G^_h$f=2u  2<8@=u1HP" 1;2USWV}uCjh?9R?9?9?9?9?9?99 9 ?9?9|$(jWQ98 9 8w+?95?9G1;?9)ʉT$t$?99?9s?D$0?9D$(L$, ?9?9?9=?9D$T8D$"T8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSW"W ;{{{ {{|$$PS\$j&U$1ۉ___ __$PWj 1@G ____SW|$ S\$V =8fDŽ$ 9t$Ph{$hQ1F9 9ƒ\$x|$|l$xi&ݜ$݄$ 0i&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Whϕ$QP[99|ӡ9tPL$ \RL$ )΅~DQ4))hOA#ShDP'Rh֕$QP޵Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4,Q'QPh$SWcL$(+ ?9T$,?9\$0+?9x@BD$ډL$hT$ll$h|$@8 81G؃D$@5@i&vqL$`\$dl$`i&ݜ$ܼ$\i&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4,Q'RSt$Dh$QP 99ȃ88D$u݄$|9s0;T$ D$r$|$\$|?؍<)h$؍<)h$QPO N+9 9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRVeP $^Ã0D$4L$8T$ 1ɉJJJ JJQRPd x$1H0VK0j:0^USWVh=8u=8u }t$XjVI+?9~=?9N+ ?9y@BD$HT$Ll$HL$$D$$5@i&8 8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ иOA#t#|$d59PRQh*$hW蝯|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQOA#r#+|$QRh=$Pt$$ų i)s<$*<$Hrr޸t1@D$))kd΍ ?9HQP~ Q PʍHr̃t"1?9HQP~ Q P\t"u5?9HQP~ QPj?9Gdu?91G ?9HQP~ Q P[~#\uE?9HQP~%Q'H wr? t:,u3P~t%?9Gdzh$蠶 1N?9=?9i2%`Q'h?9Pytu :v2USWVՉh?9Q}ytDj.VY1ۅt6UP\yu&)Wh?9V= u1ۀ?91C^_[]SWVD$=8t5$"9hڗ$5<8R nD$t$hKa$PV` uA 88tċ8t$~Vt. 489PQ$9^_[Pvt=8t"=8t548h"$5<8虦 1G=8 Sh%hJ!9X: =l!9=p!9ShI$h!99: =!9Sh;&h!9 : =!9ShO"ht!9: =!9Sh&h!99 "9=Ћ81PPv h$j- WVPh̘8'>ơ<8?snt$hB$P覥 Ɔ̘8 ͘8?)PRQh535 x?t$|$ 81; ,8 ^_Ph&$ ^hH$t$h$5<8 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=D8tDt Wc_h=$.$t VF_h$PD$D$ L$PQRSm:4$uu|$l$ 8<8tQSh$P+Sh$P D$WjPUh53tU58sƉ$t=8t`V+<S <<WFWt$P7 Wh#8$V"8 WSV8 $t P,^4$VhFw$uD$uqhNw$ t66h#t$h$5<8$9kt$VD$VV;PjV~ D$PhYw$vƋ|$W);PjW~ u{D$ u?haw$s tt$VD$ V:PjVe~ D$ 8Phkw$Ƌ|$ W:PjW/~ 1ۃD$  ˀuPhkw$贝u_4$4*91F=l8uR8,=8<*9Shcc$esOuh$ 1$tPH\$|$t.W9PjW_} D$tP\D$|$ t&W9PjW)} D$ t P[d^_[]h@hN$h̘84 ,8058EWhh0"9 u0"90&90*9V58=L8u 8hz$1t>hS$h;93 r1ɀ;9.)h;9PhX$5<8Hjhu$h;9t6 tfjh.7$h;9\6 tN=l8("9t,"9j hz$h|;9 uh5<8h$ S=l8("9t,"9l!9j hr$hJ!9s3 thJ!9hr$5<8w 1H "9"9"9"9"9 "9$8h|$ݚ1Ƀu 1A$"9u ǀ$"9u "9$858^Vt$t<=3DH@tNFuhl$VxptQjh}$V4 tDhq$VRpt9h[%V@pt.h}$V.pu' "9"9"9 "9"9^á?9t Pgs1?98("9,"9=D8u D888 84*9t PX4*9=l8t88j=88t#<8@=u1Hjh"#PI jh8J WV3}0jk=8tp?9t1@=u1HjP_ 5?9ar?98x#jP3 58% 88|$ j =8tD?9t1@=u1HjP 5?9q?981 9P8u 5|0^_WhӘ$j$ D$tP%t h$jq$ hB$j$ USWVt$ \$l$|$WSU蹪 tU|4| u;HDO 1 t$ tۛ$fO gK9uX 53I 53~53P53h53r 53 tuÅt$g t^_[]Vt$VEt^Vh$j# hh0"9{ t0"9USWV=8*9ȋ8t`=8tW$twD9Phh@9r j h@9L@9tJD91PoD9D9tNjwtD9D9t$h508V!. |0/thhf%V. hhR$V. V蛸5$$P  8L$89$-8198$ t1=l8PGt*9"1SSQPVhv$#u8$9d$$r t|;9$ t1=l8PND$8$9-8h^#VD9VqD9t2$75D9mD9Vh`$ h$ 1^_[]USWV,=ȋ8t8l$@11 SjhU tUhs$輦 ",^_[]<$tދD$0S ,^_[]WVP58=L8u 8|$="9tft$hΙ$艓uqj h|;9I@j WPP  =<=3LO@1 5<8jj(h$7Jru=$9u="9u "91HtJ=L8uA5<8h|;9 <8HQP~ Q Pj 胚1H‰58^_USWV458=L8u 8\$L=$9="9!t$Hh$H+j h;9RHt|$j.h;98Hth;9.;94$uY;9519 ;91f u>h;9h $5<8$ f;920h;9hG$5<8 ;9t$1 UF.VhZ$U5 D$(VV!у $ 85<8jj(h֙$;Hu=$9u="9u "9tj=L8ua5<8h|;9 <8HQP~ Q 0Pj 艘# L8tUhg$5<8 4$|$58=$91Hƒ4^_[]t$h$j2hD9AtD9h$j USWV\$l$jWeh#WeUhǚ$S4 Džu&Uh$Sm4 DžuUh$SX4 Vje^_[]SWV0*958=L8u 8=$9h#艏0&9u_j h|;9EtL8tGx"uAHt.1Ҁ"ux"u"@0&9ZHt@r1Ӎ0&958=$9^_[SWV$h$V*' V& hu%Pd1Fta\$SWv t?|$/uH$Va+PVS 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhG&Pf ƅu 4$If 1$^USWVHuI\$ $Cj j ShWuu U t "hVW j VS x8]t/M I9Nt vuvvSI jjSS ƃPjS9 \$fD$=T8~%|$@jWT8O$Cuu S( VjP 1D$ PWh@" D$ PWh 0$h%$?h81\$@jPPhSvvuT thh"S Vh8Sh$-D$ PWhR$,h8$\$=T8~N1PD$PT$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,g8tg8#tj}udg8AuZku<FD$ t:D$L$ PQhhuQ t\$ ۋEu Y )gD$ PWh0$ 1He^_[]d t$aB WV|$h$WXt.hG&WXt!t$?tt$ h$R1F1^_, thҜ$j+ Vt$ Vt$ 茉 t^Vh$j USWVHE ML$8t$QPVr DUt$F|$v>V>1^USWV0]u =T8~|$jW!T8OEދu~ t#9rWvP_= )~ ~)E 81m<$SL$Q6 ƃrGt\)L$<$u c8u}b8#}1D$11BtfT$ <$=T8~M1PD$$P*T$D$+T$ +D$(хy@BMbiy1ebVjD$PI uEb8w7b8#iMtuL$E5<8`5T8Ph$VHa<< aMA(1e^_[]ËE@,$aG(a8<$ta19#u‹F9~sWP6tF~WuP\; ~ FUSWVP|$ Guh+GG1(,O _91G G1Fl$WVVU'tY\$GOQWG;Gu!,EUw,6tGo1F u$` G(1@1(u8,t<_tGO T$t$)9|JSPVI: _ ^_[]\USWVPt$$\$ l$|$WSU tU| u2HDeO,1t$tۛ$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWV^hA"P[Qt+hA"VIQthA"V7QuTD9PD9u }h$VW Hσ s У2߃c u1TD9σdt ltntFPD9뵈XD9PD9맃t Vu% /39u=PD9D4$9-u yt$$PQ1ۅtz<$uaPD9tXP^8uNWƃP(MVWP8 3.gz$PS*߉ޅu4$h:$^$%=t0=@VhI$=PD9G5`D9=PD9jV DžND$PW"@$$P Vhx$D$Vh[$!t$$t S8NvB11BW%jVm $=TD9$uXht$VhcE%PW2y9r DŽ$.gz=TD9uhh W ) $D$D$P D$ T$4$ =TD9u@D$ #D$Vh"$Vh" t$V u hǠ$RV蛚D$ !=t D$D$pD$5`D9hVW WG|<ǍWht$kMtI=TD9uCXD9u:Vh$H$Whw$h53PjD$P|$WW t $Vh$b1PPPWDC=TD9$uL=XD9uLhh W3 ƒu 1@P D$ 1@P T$=XD9u:4$T$WjVVhP$F$P t$ $T$ V1PPPGD$T$4$x t h$uD$ tPU t hǠ$RL$#L$TD9tGujjWA tV$PQL$U<tNWh$4$:u W>Vhݠ$aWh"jWh$ $l$pT$ 3T$ϋD$1 u V4$} $Qt$Pt$h=$4$O $Wh U" $1B1P 5\D9mhQ'hi#hL63x jmVL63hQ'hi#Vx WPh$Vx jmUWVD$Pj:x2=XD9t0#D$1=uT$l1h$jKh"<|$VWj7 tt)u1)tu4hƝ$6e^_]ÍD$t$1B1h$PjVhם$PD$L$ $QP =\D9u \D9XUSWV׉ˀ=dD9u hǡ$) t$dD9jjjS?!ƒt7jPSZ tuh$ql$h$11PUVWh$t؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph $jVrL0L0D0.Vh'$h53uv WhP#s^_[]PD$L$ $QP| =\D9u \D9XUSWVpT$hL$lhM }h6 D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$Q'1@ɽ9jD$0PjvŃ|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $R'Cىt KDP@uD$ <=3|$1 ,,C t ^DH@ujGt-Ê <=3DA@CCu 1OD$" 8<=3L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _EV9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$pN9$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt<=3DH@tKCu$ D$VVD$PVo4z Ǎ$$ D$ VVD$PVI4T 94$ =:31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$pN9L$ QhP pN911 |$ 1 $R3t1BuڋD$8L$ Qj P2 Ǎ$Pj t$2 ^ŃuuD$ L$ }D$HPQ4xWt$ PH $(4$hUt$P& L$l$ ȉD$<9 ɽ|$X<=3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't <=3DQ@tVFu$$  Qσ s[-Cj $( PSk C8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A <=3CDP@t Cu;|kw<=3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V'E =V9 hh V EKCDH@uٺr$yG=V9 GKoCDH@uٺ|$KfCDH@uٺ$ GQC t _DH@uE%ƋD$pW@1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,pL9t!9}uEpVt1*mj pL9xt$p@ pL9>GWVZt$F1EjhhlD92 Å1|$څ,5V95V9h$|$t5V95V9h$hD9 hD9115V95V9h$(5V95V9h;$Q5V95V9h$5V95V9h˥$5V95V9h$jjI 5V95V9h$5V95V9h$5V95V9h($5V95V9hV$n5V95V9h$X5V95V9h$B5V95V9h$,$P5V95V9h$Sh{$95V95V9hh$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u_9_NSFJ1s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S, uC9,_9s,_9؃^_[]Ë5V9=V9SP PWVh]$j@ USWVP׉΋$1m~ w]$DR' 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x 22>u)jH1҉P52 25ojnH@28 2>u j5hD9h53u(u V9P!Hh I"j p1PPh$hL63SjGUSWV\$|$t$ V91EtB5V9WVra V9V95V9'1V9V9Ht8h^#pRV9 V9I V9Kph%#jhV9{NrfV9"V9 ...V9V9V9@V9 V9 =V9uV98#uxnu V9  V9W1 t,E-V9@J}V9V9R)ʉ1ɉV99‹\$kV91m1 V9QV9u>#u~nu V9tV91B C1ɾ8f V9@V91ɋ\$uV9\$t1A ^_[]É,Qh{$j USWV|V9uN V919u:=xV9uV95353V9J$V953V9 I"V91NHQPP&V9=53P%=V9tCV9SXnS5V9ɭ thV95V92 oV9=Z9tMV9t=53tP$VV95V9hZ9ܬ Z9V9=V9tV9V9 V9@V9V9=xV9QPWrf|$xV98t0W5V9V9V W5xV9VR =<W5V9$V W5V9$Ui V U PWVh$WhZ9J9hZ9lV9޻t=53t P>#h9"hZ9|NV9rH9tt$t$P責 V9H9tȋL$!QP謬 V9Z9=|V9uV9V9V953V9 I"h^#PMV95V9h{$ V9V9$@1Q5V9Pr 5V9hV9hV9j ƅttbV9|0 uNt$@ $@ $QV5V9PV91@|^_[]5V9h{$j 5V9he#hv$h`$5V9hV$jo hD$hD$ =Z9uhM$v hZ9jj@h $벡V9@ u:HQP~ QPN"t5V9PJq 1=xV9t |V9t SWVV9X1t^h^#3Kt&Nj@HOW!uWz [뾋HWPp WX 1F^_[Vt$VSt^Vh$$j[ Vt$ D$tVPuVh0$j3 V^WV|$t$ WVt^_WVh=$j SWVP\$|$^9t PID$jPSW PL^9VPSW ^9^_[USWVV9jh^991FD$^9hD9 _9JBtOz T$R uW|$+;A ^9^94_9ыR L$y th|$ V9)щ;HT$7D$t{T$A ^9^9+4_9. V9;H@ ^9^9|$to4_9u1ۉV91;AV91;AT$t1~T$ 4_9=0_91ۉ__ WjWSQPA|$t4JT$B8 V9;H` _9T$4_950_91~>~ VjVWQPA1FT$14_9=0_91ۉ__ WjWSQP@T$t tCsBtt$u V9;Hr _9xt$tV91BtȉÅQJA7$T'=^95^9$=^9FPj W @) ^9QPW= hD9Ҿ5=(_9 (_9R҉Y = 5V9hE"5V98F u 1Pjh"#^9S1P5_95_9)1Pjh"#_9S1P5^95^9S%1Pjh"#^9S1PS =^9 T$^9=^9GPj SQ ƅ ^9D$4)أ^9^9 5_9_99a_9j5_95_9h^9j5^95^9h_9 4 5V9r蝸  T$^9^9D$<=V953=211 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;52r5V9jjhLM%5V9j$T 5V9j T 1-RL$ tKQ{D$ ;2r5V9jjhLM%y15V9WjSet$ tsQ!tejPhU'Z tQF;2r5V9jjhLM%1U')$Ph$5V9*C Z;2r5V9jjhLM%1t$ D$13Ph$5V9B F9ut$ t$L$)42F9r5V9jjhLM%V5V9j$S 5V9j S V9@ @9  ֡V9 ^9u55V95^9j5^9=^9t5V9j R n jh^9Y ^95 =^9( 5V95^9j5^9=^9t5V9j =R 볋5_9_99_9+^9T$JQ4_9T$ut Q;P ^9T$I4_9D=^9yBu%hh rF F 5^95^9P衚 ;^9 jh"#r聚  _ T$=_9ujjhOA#h_9 ^9D$0^9D$,^9D$(^9^9^9^9_9^9L$(t$, _95_9L$0 _9_9$_9 _9=^9_ ^9QZ=:39^9 @ ^9 ^99r _9֍_9@PQ_95_9 F@+6vFt P uF6^_ËFp vh{$j. USWV ՉL$<_98_9щT$Љ$ <=30_9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B L_99r7 L_9P5H_9H_98_9<_9$0_90D$SPt$V蚹 it}ŋ4$L$]\4$L$t&uE\L_99r+L_9P5H_9ƣH_98_95<_9F1C4$<_9<_9\$D$ L_99ȋ$r+ L_9Q5H_9;H_98_9<_9 ^_[]USWV`}$111D$h$u Wj uu5<>ut0Gtg<;u<$8u /3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1h%S9 t+8ttDGh$j* 1E L$32 thu%0 u3h{$j tD$PW[ uh˩$ۃ|$ tt$̎ uhթ$뼅tt$@ uhW$렋Cu/hR# Q$tjhܩ$VVԷ VeSP6 QVhߩ$ YPh$hL63 1 j%UVQt@t $e^]Vh$jݸ WVP։a1ɉQPW胔 V?t$8t91H^_%8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pV7 Cf{~a11C403t?L$qPdt+{|7u!47_3L$1qP D7EC9|^_[]Vt$FtKPF tvPֿv zF vvzF^USWVP1k<R3~4R3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ùm mUSWVPk<R3R3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)ohL63jjChK$?jU"V1=h_9 JQ9t*jjj  Vg V|5(y<谡l_95(y<轡p_9j5(y<@t_9jPx_9t#1ɺ@3A<.uh_91 1@^USWV D$0f 9t_9Z x_9,I fEE!f ufE(Mt!U1f~ t @9ufE,$Tt<E,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? <=3DAhL63j8 W@$$V'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$4V'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEu L>O=m$ 5$y<5$y<.1QQPS萰~t$V5$y<莶5(y<`]1U)19}1ۋ$p$)ŊEt9}1< ˊEE5(y<Ah$1VV5(y<~UVj5(y<~Vj5(y< 5(y<詸5(y<,= 4=3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hL63j5 bxu+=l_9 l_9σqt$V[VoVo5(y<IhL63j'5 ,$,$fUuE 9|)BfUhL63j4 ,$T$4xut EfEuGza|1x(| E9}ED ufMhL63jl4 !}Eu)u"E t uPuTf;}]D; jtLD; tt$4UЃF4; ~ttt$4WZuE tuPbu 7nE u襶unEx_9,Et)u%E t uPuWEtPLEEf~3M1tR"MEGЃ9|׋E4t t$4UЃuhmEE tPQmE ^_[]Jt$5p_9t$t$h-$hL63!ZJ$@ t$St$t$ t$UPh]$'YJ $A It$U5l_9t$SQPhǬ$hL63!$jcUSWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$pytS;tNt$Cj S)؃ QSVWD$pKyt G}uo $ $l$Atl$|$q KL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCA G΋<$9Ƌt$ufth$VSwx|$Gu1PPw|$ GL$G)VQw+ wб ^_[]D$L$x_9 fAËL$1x9 t_9~x_9USWVl$0.t_99}=x_9DP5x_9rǍ PjQ$ =x_9ۉt_9t @tFj-_9E<=3\Jك@to@uwt uDZ@t< ty< =_9u =_9tI5|_9ntj 5|_9=_9uj 5|_9g_9_9_9_9?=_9u"5|_9|ntj 5|_9j 5|_91_9_9_9_9_9 _9f)_91ۈD$u_9C5|_9mt$L$4 5|_9\n9Ƌt$|25|_9FnVUUU9}j 5|_9T|$uCj 5|_9:KVW5|_94U E߃ @ Ȣ_9_9=_9uW5|_92mt7j 5|_9%5_95|_9P_9_9_9_95|_9請 ^_[]t$Ph{$VPt$D$ L$ $PVPW1A4$^hOA#t$t$t$t$USWVP|$ \$$l$(t$5|_9d_9_9D$,$VpUP1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW誡j5|_9膵1ɉV,$E|$@t[D$@8tRD$u:h#&%5|_9Nt$@5|_9Nho#5|_9NWt$Dt$Њ hD%5|_9N4$25|_9jD$ 5|_9j5|_9`k‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US5|_9N5|_9jth{%US5|_9N/)PS5|_9 5|_9谈5|_9Ã~0L$ZD$  荑 L$X1)<(x1 <=3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQPGz QtRD$(υ~] $9I\$)RPQy KOuLuH|$@tAt$t$D|$W WzhL63j D$z19Dzf tN;L$$} <=3DXuhL63jK  $9A)RPQAy $8GED$t+)j Pt$5|_9 L$_9_9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P 4$ȭ0^_[]hOA#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(5|_9g5|_9Og$tKۋ|$,;Sۊ|$0L$Dȃ19AD$LD$Ut$HP?1t$PQQ. Źt3;|$,t.D$DE9}S`Ń1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j PKtC@j P5uL$$)݃} 9WUQS5|_9ƅ|$ MVexƅtV5$y<P4$5|_9OPWS5|_9DPWA1PPW^ WŃD$E|$ GWUPS5|_9cPŋ=|_9VPW=|_9VDPW@5|_9訷_9_9#WUt$ Sh%%5|_9ޥ1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV%4$tWVV:WRUP:W:^_[]hOA#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP.1B4$SWV]^_[]hOA#t$t$t$t$USWVP|$ \$$l$(t$5|_95_9_9D$,$VAUP14$SWt$(^_[]hOA#t$VPt$D$ L$ $PVP]1ɉ4$ ^V5|_9]b5|_9b^fUSWV $$$ 0915x9599v6%59W 9WVP 8W'Ft(=9tvvP臁 vh9B>vuɸ9и9t999hwe%؊ $|$ hS&%SU覀 e~o~1pMrtoCIDԹ9붃fi5<h^#VN PhWU \$hR#W D jPh#t t \$Sh|$W u4 m'%8W'W跄PWV*K t }u몋}tED$thR#S <=u̍4@hR#P Fhp*%V~ 0t$VW F49h9h9h^&%5<躲 `S$$$ Dm<$.61Whu*%"Iu#D$=uD$h|$d}Yh*%#R t41W{ t@ < uFrWJ W{J jh$h$跭 ZB5(y<\_ǃ5(y<i_1FVVPWtܺ9rt5959K5ܺ9hm cVjVjhj5(y<E!|hhh9HD$D$@VljD$ VD$1Åj9Pr $t|$ o u*t$ u%n ut$ (%n j|rjU0tc1L$ <:B R@9u1PPPPPjPPj jUVP4t(j t$WJW^11V脣|$ t$~14k4`C9uWRVIjtPjjVh#I Z09j9j"ع9$uٸ=49t j jjp._91 ^_[]Ét$ hh1GQWP Phi#hL63 VeW =hL63jj,h&&%Oje hL63Vjhd&%.VE V1FhL63VhEh(% V# UWVVf h#裄 PZ 6|[=9t>V葙Ph0*%W 59599=9t>VIPhB*%W 59讞59蠻9=_9uhL63jjhY*%e^_]Ã=9tá|9tt$P} j j h#蔃 tPG t hf%6 ZjhBw h,j"USWVB L$QL  Pv Ń j h(%UDD ~ uF t$|$ W W}fD/UW$N Wjŋ>7P蚶tn,$n ;nu:FUWt^FPvݙtFljFn ~D$Pm4$mUV St ŅSC ^_[]ËD$L$I41@fUSWV1t$49j9V“t$t$ t$t$4$j~VP;=49P覝t$Vj >hj]jYj߄{jVfʁV2Vjj^4?1549`+v9VPX~Bjhy9jPWyjhx=Թ9V/Vbu%9ǀ$jhxup賩~u9Ph{$jX jtO9)tTPCu2PKu#PuajhxP迚^_[]Ë$l$ D$jPtщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uV}fVofSWV1t$t$t$ t$t$4$549jV$jr4PVf8 9$*tKuKt!Pуt9$P9L$$Q4 tXD$t$VSVx)VOu*%u*%t*VC^_[À)ujhasu Vt5$y<ir1WW5(y< 5(y<虦5(y<;rSj 聲9;xhj_jZjC]jVkJ*%*%!}E'USWVο$WQSr Wh*%S#s WSUfr WhoP%Us S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQVq Sh*%Vur SVWq ShoP%WYr Wit VW^_[WV1t$t$t$ t$t$4$549jVtkjo4PV[5xG9*tD$$tL$PQ_t$ViLtV諕^_ÉWj M?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QtD$l$1@$4Vt9D$pPt$Vc Z$DaD$|$ $%t um<=3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5<=3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u<=3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PVJ \$ 9tOL(tu(D, $ $ rt04m Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWX 59t@WPh0*%VK 59]59O9sh#h*% 9t*W蛋Ph*%V 59.5ܺ9耸0tPh|&#hcE%j[1e^_]Ph*%hL63 jj UWVVW =9t>V1PhB*%V݄ 59f59X59wh9"hr+% 9t81h+%W莄V蚊Ph+%Wv 59$腷0ƩPh+%hcE%j[$1e^_]V1hhPhPjjPj jjh3h4xjPѪV^hL63jjh*% 9tPjjh*%j SWVD$x1|$9t9P1; PqPVhe#W藌^_[USWV$$$L$$QPhV $h^#V $D$W莀1K4$w 1G9r6|$  WU)ŋ$(\5F4$hw ÃugD$ PV3uH|$dh^#V+ $t:|$G=9tVh;+%h$+%P 1KS1D5$$t 4$D 4$ju9tVh;+%hC+%P) 1ۉ؁Ĉ^_[]UƏ$$$1KA USWVu ED$l|$(PVW  ED$8D$1ۉΊ<'t  j Fj'VGu Vlljt$ t$PS{ D$ t$ )VPh"L$Q h+%Vr t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W tW: É@/ W: É|$PD$kSc ND$+D$D$ .t Vt$W[ tSc Džu]D$T$L$;ȉD$Pt$ #SD$L$Wt$t$ h+%P+ 뒋D$L$T$;t RtSF2 |$\$$hDO%S G|$\$1\$L$9},8D$hP1#8@^|$u9Mx{;5(y<tV7@jP詴|$ۋ|$t h"#"h+P"^53H 53~53#h53ܡ9Nj|$tM^jv ;5(y<t Vp|$ t E%u15(y<聒5(y<Cj5(y<O]t$(觅twP蕅uW胅D$td$8u-e^_[]D$t$ h+%jR VhV+%Pi 1S& 1FV& Sjh3%% VS{h t$Z& $ D$pL$|PSt$( t$ X9t*t$h,%P 59 99t*t$hi#P 59؞9h!&D$ 0;u.h+,%D$ p#ut$vm t$e s h9REtt8tjP( u%t$V6 6h@,%dH jj3L$1Ph.,%DH USWV։5(y<<1@P5(y<M5(y<[h41PSU  4hP5hPS1CS  U4Wh{$*}4h$XFPU~[5(y<7<@)VUPRQ5(y<VtcjP|Ҡt05(y<3PV95(y<PV1PPV VZ^_[]hL63Sj+h+%?zSV fUSWV-1@=_9$h1%Pjq h^qD$1D$ $ $?$V^_9%VWY PWt$ 7 VWjY G|$ 2%Y'<=3D$W_PWt$ gN uD$L$DAu >uD$ |$O 4$ ))ht$PZ FD$ |$$ ))Ƅt$谀$血8 }? jSy ƃ $NfFx6Ju1ҹhtRRRRQRRQjSD$DPju4D$D$D$ D$ jtgD$ Pt$袘D$ p _9 )) hPh_9X 14Y'jVh_9L t1GuD$(Vh2%j@$S 1PPD$0PD$XPS7+ t|$Lub4Y'h_9hcE%h,jSj"D$L1QD$PPQQS* Sh2%s1=_9su=_9lu<=3 _9DH$D$$Phf% u5$nfsu( $D$1@D$ |$$tD$$D$$i jv~h1Wt$TVB j!W|$0W2 iW&]hh3%QChg9PPj}=g9 hi9PPhh#hg4%1 Ph3%j+o h3%Wohd3%Woh3%Woh3%Wnhg9h3%Wn =i9t!hi9h3%Wn $9h4%Wnh4%Wnh 4%WnWh[/%jtnh_9h#4%h DŽ$hd9VVj~/j h.%V{  d9defa1ȋ d9ult1 j h4%hd9>  d9manu1ȋ d9ual1 d91 d9none1 d9 tlf=d9 tb=d9t`hd9h_9h4%jtCh_9h4%Sj~$$K{d9`9hh4%HOh!Ifh_9h4%h4%hL [ 8 `9h,%D$ Pj3 ~ht$ h`9S t$zj h`9qth,%D$ Pj ~ht$ h9yS t$Bzj h9>qt=9t `9h}-%D$ Pj ~ht$ ha9S t$y=a9u:h-%D$ Pj@ ~ht$ ha9R t$yj ha9pt=a9t `9hhb9Iu=b9t `9D$1@$" hg9S$WPR Vb9PPjxVa9PPjw SW؏t%`9|$$|$ t |$ujc9PPjyy|$t jc9PPjz^hc9D =c9u=.%=r!ƒ.%t๗.%=ujQhc9nQ jc9PPj{h`9PPj}`9u4D$D$Pj訐|$uh9PPj|=9;,$;,$t9=d9.%td9=c9tc9|$ti=c9;,$;,$tc9=c9;,$tc9=`9t`9SVWQRh_9Phb9ha9h"h,$L=c9;,$;,$tc9=`9t`9WVQRh_9Phb9ha9h"h(jjjE xP# e9.%Ph{$hv ha}<h_9h84%hS S"jrjQ$H1WWV$Ph*2%" t( ;$P$Tsh<2%jPbt^DŽ$ 1WWV$Ph[2%! ? ;$0$4&ho2%jPh`uq591H t$1t$Zu1t$t$;uh.%j<$t$jr_91@$F=9h9"h.%螺 h.%jft$(V9 VlPh$/%h/%Wtf=a9tha9hA/%WXf =9th9hL/%W~ VS ulD$PDhPhd9I WEt;Ƹ4($d9SPUJ SVUwJ WEƸ%uցļ^_[]VPh_9h2%Pj"#Vt$E Vj: tfjh3%VD= u;h'3%V误 u&h13%V蝯 ujh<3%V = u"h"#j ƅu4$o^Ét t t@hVhe9H SWVt$hV?uT|$tMƄ$j.Vmft#GSVhb9oH SWha9 hVhb9SH ^_[SWVb9SLha9LhShg9H =a9tO)~!b9.ub9Pha9谅t(g9Vhu%W{H Vha9WlH ^_[ËD$wY'øOA#USWV$Vh"%<u $1퍌$Uh@0%W :HUUW f@$|$$jhG0%P 9tx/uG/$N~/vt$jhG0%Pa OA#wY'1҅‰)ˍL$$QSRPhO0%hUˮ ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<91ɀ=9/9QPhP%hh9 1^ËL$1Bh9WVt$=_9u jG7Wj DŽu1@l95t9o1ɀ=9/9P%QPVWh9G =1ɀ=9/9QPVWhԸ9 1^_Vt$V dЉhX9$^WV D$Ph9蛻 u:$nfsu-Vh9h9bD Vh9hԸ9OD tWj 轃1F?t[h9h9h\0%jPu>90%h9VWh9= h9VWhԸ9) 1 ^_SWV=_9hU`9u(hu%Q\u9hg9h0%U=9t h.%˵=g9t hg4%赵|$h_9h0%hWx h9"WƅVWPh0%j[h#V[=d9thd9h0%Vy[ h[/%jj[`9uGWPh0%jK[=d9tDhd9hc9hc9h0%V%[=`9tCh41%Th_9h@1%hc9hc9h0%VZh[/%jZh#h0%XPh0%jZ 3%SWZhd3%WZSWZ=a9tha9h3%WcZ hc9h3%WPZ =a9tPhg9h($W/Z hb9hi#WZ W誂h[/%jZh1%Zuh`9h!1%nS=g9thW1%XSh_9hk1%FSt VCj9e^_[USWV։ϸjPP6 tCËl$hjWˈ ojh_9W@ WVSt S 1H^_[]USWV$΋$Ph"%~u tWOA#V ^l$PSU 9<$u9PVUWhM3%hC1Ʌȁ^_[]ÿI3%fT$L$t$fA"u/ÁtuB$Ãt6u8h6h/u uhM%!wZ'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhZ'?t{4$ZU1ۅtjSSWPjhZ'>tEhDO%V t&|$\$PS׃thDO%j uV|e Voe1ۉ؃^_[USWV(5%Z'\$|$jSP-" ƅt Eu$wS7M> wh#7> G^_[]WVZ'|$uZ't%|$ jWQ! t u1^_ËL$34USWV1td։σS:BPSW1 t u6P1PhPPj D$PU D$t΀8uɃ<$uð1^_[]ËL$3w4USWVl$\$1}$hlW6StOD$SWPHDWWRt.ljFt(V$'E45%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ較 $V1VP訃 9549D$40$X@h P@tt$45(y<b:h53HG 5(y<9r 49ɉt$ =1MD$Ni8D$$11t=i8,49tǍXUSxN݉|$|$l$$99ƀyH1ۉLPTXVUQh: 9" .hQPN: VUh89?: ,9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP9$()1HD,048Ƃ(1 49<59^W9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً 49ɋD$L$ӾV WOA#QSPSl$GUU 9$H@ VWOA#RPQSD$BP# 9t% 9QUHDRh5%P =9$0Tơ9$p:L$*QUPVWjj:WD$ D$D$ PjvD$ t.-49L$QP59 u<59h^R$Pdž$l$9()8 9 9VL9VjP~ L$ D$@D$9 49yuƇy$u4P4 44S$똋D$9$H@HD48D$L$$<uujj7mi$t+D$xfDŽ$DŽ$x6D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4x6El$L$),$|4xfDŽ4DŽ4x6T4E,$DB8t$ 9zt$D$tj$DxYfDŽDŽx6D4B=QD$BP4D$ .D$D$$|$y+DxWfDŽDŽx6D4B1ɸhQQQQPQQPjR$Pj蠁4$1K|$$8h{$jh D$Wt$KsD$tvl4u^u3h1QQQQPQQPjt$,$Pj4ÃtCD$WSrD$lxS1H$^_[]1M4$́$<t4u/h転hPh32 931@멃=49yu4949s19dL$w BsÁt1USWVD$$9*t1G.$ )$Ph5%hVx +?%jt(heMVh5%h" j$ ff%W赢9$PhrT%hV WVh6%虥 ]hf%Vjj\Q1PP3Ah jl1qF$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S3t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$Y'h6%D$P 6%D$6%X3|$0tPh5%hWB Wh5%D$PO +?%D$6%zhj6%D$P v6%D$|6%i3|$0tPh6%hW D3t#Ph6%j\$S褗 S\$Wf D3t#Ph6%j\$Sy S\$W; L3"t$j$tWRh%6%D$ PX D3@6%t>6%D$+?%D3|$0tL3tQhK6%hW WhQ6%D$P c@%D$d6%Q|36%t6%PD$P 6%D$6%!h6%D$P 6%D$6%D3 $t!t$PQh%h4t)$j4$TtQTd3U$ 7=49t$ $QD3$t<|$t4øSWS$PW[$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRh;;%Ua EtjP_ t4$S؁ ^_[]Ê$ h+?%Wnj$D$jVù D$jQQPSS 9uU$d=Tt=Tu@$x6D$8;$du)Vl$UhU;%SPVUhi;%S@$ Pu1Vt$hI;%P4$R$ l$ShQA#U hKUWVjPK1PQG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQh^_[9rwًz89y8rw19HUSWV 91G*ZƄ$h6%輛h9"h#茞Ph6%jSC 59t 9QPh 7%V袖 5hC7%SC9)\$J$WPZx$L$@PQ $d$ PV D$@Ph7%SB D$0PV]Y"D$0L$8L$D$h:z"Pygw\$D$H$194$h:z"WFgFuށǐW$WT S0P;t$$ *ho9tPjjh'7%G1PP.+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7T#tOA#$7%\$t7ȉL$7 T$wXv6%D$ +?%D$$Y'OA#$uht$$P ( 7%Pt$h7%t=uD7L7qQPh8%um/$$T#d#DT#t $D$ c@% $T$hf%RSeT$ D$L$ 1@D$h68%OT$6%D$L$ hf%ReuD7T#t$$D7OA#@te8%OA#yj8%OA#tr8%T$(OA#ty8%T$ |$$OA#t8%L$,OA#t8%OA#t8% OA#t8%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h=8%t$D?@غRPh7%t$>ClE;F{Pp\$CPW SLt$0|$4hg赕L$0QjP4. P7WLtVh7%t$v> SL=9u#D$@9@@hPfh8%\$ S->h8%S>h8%S>=9th9h8%S= $ 1|$@VVPWh.;% ;wOA#r#t#Qh9%S= h@9%֕hF9%ɕhL9%輕=9t hU9%覕h\9%處1h[/%WI=SeWHe^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ Z'he9%U> Ubuh6%he9%U U;FjV D1Ktljt$f"ht9%GK$G+?%G swf"Gh9%G K${$+?%C(s4C8Z'h9%C<{@+?%CDsP$sTZ'She9%UL UptlSh9%U0 f"UaFK$F^ sFSh9%U FZ'U,F K$F$^(sF48ih6%he9%U Utl6%Wh9%U f"UFK$F~ ^Wh9%Ub FZ'UF K$F$~(^48+4$iƷm۶|$9Rh9h6%讙tzh#肙tiD$h#Pj裘 SWl$UVt$t$|H6mHOu4$\H9Ph{$h 1PPx#9)t5PhrT%hU聉 鋔$ 1$ 91APuDFl9Ɖr:9Ph{$hJ 1PP"999ƻsRAklT421GWWjjhUt8RVx L$ $ g|$8jhah%:%h:%hh9%meL$T$jt$oËL$T$jt$XWV׉κ+?%jujWZhOA#Vh]#蘔 ^_Vj91ɾ 9r^^VD$j9tU@8xtlIuAH1FVVjjhhj90QRx tjhj9j% tj9^À=j9tjhj9j% j9USWV 1WWj% &iP/5SPj g% t$ 1#á<=3D$1/dev4$D$iƋ1N/ u1FSt$$Pa/dev uDL$DAt|tER|$$t.jVj$ t <=3L$Nj4$D$/devG4$D$M[1O4$1O1VD ^_[]USWVPD$tPpP11OFtFhf%PM[t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|TK:%wX:%Ph~"hP%V艻 ^_[]Vt$D$QPbLt(D$t%t!hhPQk2D$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$59.@ujP0<D$1҅D$t 9tL$BuT$ЋT$P]1hPPhhjjAPjQQh3w 6i4WP[w \BM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP:D$1҅ӅtwU Xt\P,40Ut5L${|$P=$tL$ST$Dځ8Nut/$E t$@Ёl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W8ŅjW8{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ ,D$$@$;E tL$ A;L$tI1۸hSSh,Shj t$pT$,ȉ04jj hOA#RPjV肷 VSh`$ht$w }G8@É؍e^_[]n9=}t'fy"6n9 7n9NuEt FuXt1€1ɾ9n9( Ӏu A'w'8n9 ' Àu A&r  uȃsƄ\$,04t$jj hOA#RPjVd $PVSh;%ht$yD$L$a!jPD$T$AjP{D$d$jP`t$,04ڍ\$jj hOA#RPjS轵 W$ePSVh;%ht$ u -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hk8%qr Y|$hf%u JDžtohZ'6ItkDŽ$v/rDŽ$/dev,$$VuP D$/devf@/VuP Q踃낋E\tu xt@@AED$59$ttt$PуuN9덬$WPU t$/devfF/9WPV [S\asa9aO$CQPU {PWV9$t(tt$Pуt Nj59,$1D$0$h@h P5tt$G9PUHtTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jWÅT$-t WVS $WD$pV+ l$ Uh%V@ ǰD$hm"WFh#WFtyhZ#WFtghn$W{FtUh7%WiFtChbv"WWFt1%D$tw;%tD$VPS VWS Uh%jB? DžED$4$v PS} t"vh{$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=09SWt$t$C$1PWt$t$C|$u1@G91s9P%VPWSh9k wsVPWShԸ9kk 1^_[USWV |$ faa@D$$1COA#=9th>%j9VrPWhcE%hNvD$PUBD$h959h&A%j訙x9rW!9u9QWh9Vt$D$PWhDA%SR$'D$D$ =mdt2Vh9h9 Vh9hԸ9 1$hVSH t$t$t$D$ Xp9jVVv ~;Ƹ PV_ D$i jQPv e9]D$|$h+ZWw&o ~#u4hXp9h9_ 21ji p9ލ$hp9Hf@x6tJu1SSSSSjSSjjUVjl M4jmoPV>VMktXp9Ph93_ u`~*=9t!h>%jU19Pjn)D$Wj|>\$tt21ۅ1C؁ļ^_[]hA%hoA%h'h@%DUSWV|1ۀ=9t}h9hA%jŕ ue9>A%P%9h9VWSUf h9VWShԸ9f VU*#N@1 É؃|^_[]ËD$L$I1@Ã=9th>%j(9Vt$ D$t PnVjH=m5ܺ9^USWVPWj=1F?tih89h9hp<%j讔uL99>A%<%h9VWSUh9e h9VWSUhԸ9ye 1^_[]SWVPVj<>u1@;9<%h9VWSh9(e h9VWShԸ9e 1^_[ù1@t %p9It1ùtAp9t 1ùD$p9Aup9ËD$p9SWVhzlhy1$hWV.D x3WSChWWh`9Wj65Lp9WjWPVWI4SP^;VrJİ^_[USWV|$1i/t\1tWp9tI1r rr2%]0u&1q1ur1ۃ0݃p]r @뜃|$tB ^BB1^^_[]USWV|$D$L$BJ 0uQ=Hp91۾&-@p9B0t#1urFp9tuHp99u'Cϸ@p99t0p9tV\$S8V V$|$);\$u ^_[]h@%h@%h h@%S;SV5|31/t.T$ x39u9t p9t q/u^[V1ɍt$QQPVh$=%c y1t1^USWV|$(1$PPWVh$=% $D$(1PPWVh$=% Z$LF1d$Pj%s4$>$Z'h|e$U3eh}BhhA%eh~(hUeW5ܺ9D$h茄jU5ܺ9I B['PPqhVjU5ܺ9 Vt PVW xWD$ PSt$5ܺ9zI 5ܺ9<%5ܺ9SjhB% j D$ PU脹 Uۻhu%c D$(SSWVh$=%; $j蕥 hu%fMuQ1AtCjVb u4VhB%"1ɉtjVb uVhB%j) D$(SSWVh$=% u$~h8=%jTȁĐ^_[]1USWVhh>A%貼9tPjjhS=%G1<9894909,9(9|3/u D$8x3ڃ9tp9u@(9Q/uD$/u.89(919hbj x31@|$>Zp9M ,9L$ 49L$j5$y<^5(y<5(y<=9th>%j聈9<9896P5(9hg=%jaa9Wj 0D$ttRN1ҋ0t1t /u oBrgp9uƃp9<91p9uAuVD$u,D$ ,9D$491@p9<9^/ 49F(989QR5,95<9509Phn=%h` jj/_5ܺ9]1p9tvh{=%hu>h+_t$FVj/~th=%j軆h=%j謆h>%j蝆1Gp9p9th3>%jfhf%_L$QPu{hL>%_$QPuYD$3$L$3$ t?hQ>%hp>%Mft!hz>%jޅhp>%h>%a迪1=9th>%j訅9]$1L$VVPQh$=% }t|$ th8=%jTGjS"e^_[]1F]VD$FVjX-F^SWVPD$$h#h?%{at@Ƌ|$]1Ph?%S9 4$WV V.h[/%S^_[USWV-3ta1F3t&U7Jd1tUh{$h] 111Fo u1tjh1@1^_[]VhK?%]t$hPV hhw9V襳 x(w9ƀw9h^?%QS j/Pl @Z?%D9^SWVhg?%&]x9hPVM Vy9K5D9l y9y9PVhcE%hW]T jWhP# h&JV4jv,06PVWhg@%hL63)M @%^_WVt$ 0PpPGt$>FFVj< F^_SWV=|3/t/t$3GtPVHt /u?É^_[USWVj$t$ 81ۅtKƉ|$\$FUShSSj WV@ $Vtu;D$ rj$Vƅu1؃^_[]VPT$ D$t$4$ǤVP ^USWVӉϋl$jUtMƅtPt$Ve SFOVUP tP׃SQVH^_[]VPT$ D$t$4$VPv ^À=z9uaz9@" 9A%L9A%$9$H9|$@9@"P9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlWA$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWU uD5<w |5L Ku1PPD$P )ƍD$Phd@V  |$D$|PhedAV  V藡f$1 GaD$P$,hA%t$V 1PPV> $C]su PUhhz9t$t.z9CD001 z91 u=z9tZF9|4$訠ja$,h%K%$0uI EPP)8 jOhz9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$t$$,h%K%u EVPh`$P EtE @E w-G$9@  V诟؁^_[]1D$L$I@Pp9wʀup9Aup9 p91USWV$$1$hWV E jShWWh`9Wh5Lp9Wj jPVWL$4SP)V=%1Ĭ^_[]ËD$1ɋ0t1urp9A1ËD$1ɋ0t1urp9A1USWV ։D$ $E1$  D$$ ,$D$ B% $F'B%uCB%D$$B%6B%ukB%F\$$H95 \$\$$&HD$\$$)|$=89=9=H9$ <$D$D$B%<$/q|$4$D$ H9D$P% |$D$ 89D$9D$B%=_9u$AyD$1Ƀ p3\$T3C|$D$$$$D\$$({|$!<$D$H9D$T3z=p3OA#|$l$ D$D$vB%$kljl$4$3 K=_9u $exD$|$D$$.$$C\$$'|$u1=9=9=H9$ <$D$D$B%<$at|$4$D$ H9D$P% |$D$ 9D$9D$B%$juLl$ t$<$D$3E%i$ \$<$D$nE%i$ l$4$y2 > ^_[]Á=Q3ftp]I3%=o3PFSWV|$tyy9GO4VStRV_ t{S5y9y9Vhx95y9h+%hS6: jShP# fGP3~"P8ptVtV1^_[ËD$ y9Ɓx9 9fH 9fH1SWVt$y9x9V~)S4:Q@ F9F9F1^_[ËD$L$01ÐSWV1ۉShPS$ tD$$P t V8Vטo81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW(3Vy 81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=091SWt$ t$L$ T$ D$T$SWt$ t$ D$ ׋ع9t$ t$(2C%L$\PSWt$t$,t$RPPQF6 $091WSt$t$$ D$T$WSVt$ É֋=ع9t$Ht$H迍$PWVSt$t$C%PPPQ5 $VD$`Pjhr1@USWV u C(D$|$8hjWE wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@ǾX['|$D$u$['B ['B['B['QP׾['B@ tu Ǿ['pЋ$+L$L$8L$9Ǿ\'HQQQQRPRPjD$ tj<=31҉tDH@tӉOGڄu܅tEۋl$0t/t)h#SD$ L$ tEH/uj#EH@EH`L1^_[]/EHjSP EHHLSWV t$ vDh&WS, 1WSSPPjjh= SFDNHA`1 ^_[ËL$Ahh1USWVL$Ay$ h+VjP P5959hC%sVbn+~V|$jPWRUvPQd@( m4 +WP59hC%s)T1hh*P5959hC%sh^_[]Ës=9h*PWUhC%VҋFHP5У9UUSWVP $1jlv D$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F59me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPw}GX FPvWt~C $i)ىQRP諪 1D7D77pfD7 D7 4$~Efn'  V)RQP[ fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jP@L$ A$W t׉\$ A /gOu\$ 9fA |$tApfAA 1AA tAfAA3 A AtfAA) 91jEVVhh hrjJVjVQPh94C(OL$<@C,SP{,BD$$4D$+{tR[L11HD$Cu5{t/t*Chf%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0&ƋEp&PVjWPUCƃu4UtU&ƃuEtDjUуƃu:C(C,SPs{,1s$C$10s$C$s(JC(1ۅÉ؃^_[]hKC%h6C%hlhB%USWVt$ kFllPvNj\$FFi )tkllklPRQ ,$kl11CPs:Nj$ /L$s)RQt$ 胦 1/D/D/D/ /g{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh-- WP1^_USWV9t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$ t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$1K&L$t$ 1L$t$ Q|VM؍e^_[]ËD$@,1@USWV$u}t(M01B1 tǀ9s BltNf~N( $ L$VWOA#VOA#RPPQ,V EHemL$ U UWRPVQU tD$8h^L$8jPPQ褭 $l$P tR/L$8jPPQ% Y0ƋpǸOA#<$u hL$8T$ RUQPWVSjjA$$jB`$ L$+5ع9PWVQD jCL$5ع9PWVQ$ j-tL$5ع9PWVQ jDThEVŃw-9Wã9~$Uj-Pg ň$E Eۉ4$~Sj-P< +@$9PhZD%jPSX -959j.SPWVt$UD$)PD$:PD$KPhD%hh9 0h$F)^_[]USWVUu @(D$=9uj%9]zklD0 t|8twF9r=D80 $ |$ WPQRLUL$  ;9D$0BD0 Cfd0 j509t4LdI9LhD$$r1CExhIPSt$t$hD%WgMA99D0 tfMCfL0 L$ D$$091RSD$PL$QtD$T$t$,|$(1PSVWVD$T$ t!|$ t$jSVW5T$ D$1L$0]D$ uuut$@t$@ij2j3j4CNj $Ut$TBDL|$D$uCD$0 ttt$ VhC%D$DP> D$8D$ D$8t$XjVt$(1IQjFj QPg D$89D$ t PV$P |$YtZVW MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV$ )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ09}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP!| $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋091щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSXD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h $jV C `L$rL$DPhC%uL$DPhC%jQ D$D---D$D$sع9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhC%PD9 SVhC%P29 VWS|09D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h $j$Pd t"?tt$ WhC%D$LPd8 D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P$PWe{{ t|$uuxD$tF ~,1t\tW \' D {u6H L> HL>@D> >jhEV> wE%rhD $uR1jPPPhݠhPj jjj%VjMo4x!t$PEWYV腼1@^_[]hC%hC%hhB%WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ x\'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; \'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh_#jS t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBFhVjPC Phi#hL63 9tVhi#P V詴j WVt$ |$h9tOA#WQ PVh.E%j$^_tËD$PPUSWV$h9h9tOA#$VQ$UPV( TtOA#SWt|$UPW WVht#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t= 9t@u.1}h[ju tEx F%rtF%tF%M u@=Uu,>t'D$ L$9;\M`|ˀuK(Ѓt tu tPjbjWDƍD$(PV襫$1 $$QPVD $VE9$ul$`=u]tP$PSZ $5fǃU'VDWh{$hF% uRe^_[]SWV0\$@1҉1 F FFF =9tjP4D$VjRRS/<^_[USWV9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hF%jkt1e^]USWV8=9EM 0~klP10ËE E8؃lklQSPl ߾$]'9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@Cxt;D$ L$ u&@3D$Pj輦t D$<3h3j*肷9Ph{$ho =3 tjhf%hG% hf%hG%Dž9t1)t$VYƅt#tV.Pl V*D$@H41C|$DSSjjSWp8QRx 3$D534]'h$G%SWD VD$HPWh8G%1@PV覝u11Oh]G%j:e^_[]fWVt$|$ tZD$tRjPVWβ09"t(5 t@ u$ #!Qع9^_USWVt$h9Vt'|$\$l$ j(Vh9v UWSU ^_[]Ð_9jt21WVt$|$ QԈD9O A1^_WVt$|$ GPjGphG%h tG@U1^_WVhjTt2t$|$ hG%h] O 7tUQ1^_USWV1\$ hVS Vt 1$ S9D$$Uj7|$=и9uhH%j h9h9V, VhEH%h uhS9h{H%hVH%}p hH%hu |$ tShH%h[ jhL2v:;$I A1^_[]USWV$C2C H%C1;-tǃt/hQ賅ujSyǃt˽:1FL$,D$(@h^_[]USWV $$$ GXS61WT"t#9Jh?%h^#P ʼn$|$t$PhV tWl$$hR#V ,S0wPSUf u |==l$UhV1 uU贳 t$V|$WhH%蓄 9VWhH%P` 59rh?%0'PVhcE%j[1PPtvVgvD0$ t$t$VhH%hW t$ 9tWhI%P 59͕Wh{$h?%m 1 ^_[]SWVt$|$FpL1V'I%tI%9J9tSh?I%P5 59GSheI%hRI%!m WV1^_[WV1|$hVW׸ hWVhb?t[hc豂9$jj 9G%tG%WPQhWhH%h 1^_z1hjhG%hXUSWVH$\|$HhjW  t [1 3D$D$tt;un؂D9 3+txhI%D$ Pj <9t PYhI%h<9j FPF8}vPShI%D$Pje9t#D$$P{sPt$hJ%S \$S[s$S褕<$s < 3<0< 37$Ph}I%h<9j<9( 3E9h9h9hS9& 131Ctu 0|xt"L$o oo/C G FL$5$y<9m1WW5(y<w 5(y<i5(y< mD$HhJWWhJh<j&jFWjWVPWM4ƍD$PV&V:H^_[]49h4"jP1xVHumhISWV|$D$L$pƋSVPh3J%W^_[ÐL$1SWVPӉh?J%h9"Pl tǃuOWjj1hJ%M=9th?J%sPhwJ%W h?J%WPhwJ%W *Wjj(hJ%PVhJ%W W蘭 th?J%hYJ%Pj|h?J%PhOJ%Qjih?J%P 9t 4$VhiJ%P 594$jhT"V_ 1ۅV茒؃^_[ËL$1BfT9"Vt$=L9u!w vD91;5T9s X9k4ȃ(^Vt$=L9ueN1w_'P^ËL$1WVt$|$L$ ȉ1<ɉ^_WVPt$j Wt$, 9tthsn1^_1B^_M=L9u9ËL$USWV|$=L9u1t$USWV D$ =L9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSf F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hK%huK%heh*K%USWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]h\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$\9u j\9D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$]'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uthzm1Ot1L$D1 L$8ɋT$]t"9tjQPb T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(\9u h\9D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$]'t$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nhz11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQ` |$ƄE C ^_[]WVt$ hjPW ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9utK%1^_[]Ãt ux(tth}ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV] >uD$ D$iousD$fictO4uQG4 t51ҋ5<=3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDR l$(PhL%UM h9"Uu [Ɖ$UhL%jqu D$PhL%V^u wXw\w`hM%VGuPwdh3M%V)uwThDM%Vu f1ۍ{aE4^'WuWuWhOM%Vt E< t<uEMPWQWhgM%Vt$<ILM%9|"#PVtC9z1h[/%WltV D$PD$Pt$\$4ShM%hvM%WS 1(^_[]hPL%h8L%hBhhL%h8L%h1hL%h8L%h hL%h8L%hhL%h8L%hh*K%eUSWVhj{{1O1ۍD$ShPS$4t9+ōF,PhedAU轎 l$$4$0$($<$8у|1҉$$O F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$ıt98t4 .jPL$QuY D 9D$ u D$4$P,$F n$9Љ} 1F$F )ЃF n$,$G9t$5!$$hM%jP& r=t31>t9>u 9>t0uk9uVjVbOVZU 1@19$,|;ЃVt$l ؁^_[]USWV@D$1PuRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d^'uL FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[hPL%hM%jg6hhL%hM%jh(hL%hM%jihL%hM%jj hL%hM%jkh*K%:D$T$ L$DrRQPU ËD$Djt$ P t USWVl$j/U 1NtbNj\$)CDWPUmI uHD/t(t+t!u GF "u^_[USWVPӉ΃=L9ui"sv|$4L$0Rt$`VQWU ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=\9u 6V\9~V19|(1@@89|~@w1A^_[USWVP=d9|$(L$111=^'"\$uӀt0t u@tӋ;^'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h^'t$(t$(t$(PPt$0^' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWV]nhh^'hܩ9Rs ܩ9j911KjcƃwDݸ_'DtGCuޅtH=`9Pcd9t)1ɀ<t ʹ_'AuVs^_[1V `9t(d91t ҡd9 `9F9rd9Ps^fUSWVPt$L1h;4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hcE%jQQWRjjhM%T,1^_[]USWVhu}WWPHD$T$9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv9@u ǀ@>1t$(F F>D$,Vt$}|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP3|$4r!1FD$0P2F;t$4rD$0=0ԷD$p÷D$6起D$v覷D$  OA#1ۺL$#PWVSh0RQt$kPWOA#PShPV9VL$'Qt$t$t$ t$PPhyg$h$9$0$9$pضFt$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCffC C CfCC=`9rC fC*C,G1ۍD$(htSSSSSSSjjWPh48Pē@,Ppt$VW賅WǔFuQ1K59lt Plt$肔59l1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]hN%hN%hyhM%讂USWV$(E]0ƋEpجljl$E@ t P迬OA#PWVSjh]1U509|$ ww(yD%t$R5ع9RPSQV U509w$w xl$45ع9RPSPUޤ G\$skhSjPD PV'cd9j!hO%Va V@hϫ%L$5ع9PRUQU h被$5ع9P%PUS* hwPSD$Ph/O%hhĪ9 1҃9Qd9A \߉$4-PWh$$j$W躣 hWhĪ9< Nw@EƆd9 Ft3N$t.1@Ƅd9-H9s Nr,d9$EBL$ ;QUĪ9VhAO%W; Vhd9W; h$Rİ^_[]USWVX] E81hOA#PPPPhFO%PP٢ 9_ vSL$QSWPL t@D$ tWD$8uN ԫ9uh ԫ9D$9H*hOA#Vh%$Ep[+D$8u RPt QPVW҃091VSt$t$vD$$VSt$t$vL$8QRPt$ t$hFO%Ep{[D$V9p1h$YQVu WPTtY$UtOwGD$VP=)vVQj PG W@ )Q$YQP9 H LCF;puD$VPh{$EpZ e^_[]USWVLt$`T$d\$1*kvs0C41GPjhD!3  9u vEL$QVUPL 1hPPhyhqhj6Pjjt$(SP4ōt$ VPwUƆS^~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59^|$.9L$`ʉAfAD$ 1Ƀx fJ1O S\^1L^_[]USWVpU t$01^F4jjRW1AǾ_'D$ǃ@,`'SPHD$ $9L1OًP|T$|$`1 |$0jP4D$DD$ 09|$ 9ϋ$|$1HPPVt$t$WRQjD$9P4;9~9hī9P3;9~9hȫ9P3;9~9hƞ̫9P3;9~9h螞Ы9Pf3 99~9x$t911@(4cP03 99~9E ;h$r˃ 9$F89~.wy$_'C 99v-v*)NjVl$hURWv4PQd[=9@( I4踝UPWhC%SO{9-ī9j509vv{9-ȫ9j509vv i5ع9RPU<{9FF NN5̫9j509QPi5ع9RPVShC%W8ODC 9Ы9~?u 9F u97#VRQhC%PN^_[]USWV$$x+~8P(TjsNVUl$URWv4QPd@(1ɺRUUQQjj4讥 UWv4PQpu Wv4QPh 1^_[]SWV\$P,ǃjP\Lƃt Iu1PPPh PhjPj j WVPy4ǃtSWkC=WzVR1H^_[USWV8] C4t VPQRL u s ss3r SCt$t$PQ| $t$+Ks;K C}K s1e^_[]USWV8] C4t VPQRL u s ss sst$t$3'SC 1e^_[]ËD$p 1USWV$@t$ HPQ0ƅtw1@^_[]ËGtL$hpQ* D$\$1hSSVVjjpw ;tUSP@u54$1hSSVVjjp7 |$u^WVD$ t$tL$ HPQ0vtpvhhyPh{$VK ^WVPt$$F4t'WPQ u 4$fF<1^_ËD$@<1fUSWV hP%1jx$P%xtD$PV H$#P%KtD$PW 1yoh#P%螙hPW( D$PW, 1u!h5P%nPWh)P%jϿ1EWh?P%j.A hW hP%W͘$hPSS( D$PS u"hIP%W藘PSh)P%jY1EhRP%טhPW( WhE%j* 0l$ShRP%h\P%j t D$P%PV$SPW' hhP%V)P%1PWQU豾hP%VЗSPWa' htP%V跗PW)P%PUyP%PV藗PhP%U[ ah6%VrPhP%j5 ;hP%讗hPW& hP%V0PWh)P%jhP%khPW& hP%V1BP$hP%VΖPhP%j葽 hP% hPW6& hP%V茖ƻ$!3WhP%hUP 1tVUh)P%juŃ|$tjh*'$Ą ^_[]USWV ։Q 1Ht L$ L$$W " $f} r= jhP%U0 u&UShP%D$P uh}# W! Ņu>L$4t&t u$Ut$ t$ hP%j t$KWn $ ^_[]USWVՉfD$/D$jhu%D$5Ĕt&軔8t豔SPhP%hU行 VSU?$ 991j/UZ t5ÍD$9tK9vH8/t@PZ. CߍD$ PWQ D$%= h$PW FƄ$/u&Г$QPhcE%hU蹋 /h$PUN# hhu%U6# e=@uW- x*|$VW$P# 9r>n?n0|$W_ Wn01Ĉ^_[]hUu t}/u }$$tcD$U&W&Ɓ`|$tVhf%U" 9=VWU" 9%|$W x(W97m>1F1Sm0jh)#jł SWVύD$ PQ 1xVD$)tOjWx@ljj PW W u $=rɁ uƉĜ^_[USWV hڐljPhW@j,U \$hjSi jhP%@D$ƍD$ PhW@VT t$1hUSh ,$T`'tWPX^u-ث9D$C E,$ !u1L$PPPPhjPPjjj!Qhm4t$t%jit$VW_Wn6V@ ^_[]VD$@t(L$ 4@L`'VhW1S Fܫ91@^ËD$ ث9fH ܫ9tPPQQQhP%j϶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj ^>D$48T$y:D$ػ˺ J$L$~D$<P t3OA#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$OA#t$DRQPh;S%jV蘅 D$ T$Bj509QPrYOA#t{%t$DQRPh;S%jVT D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5ع9t$hcE%jt$hVD$XP1WWjjj0ߕ,09|$4D$09L$QW<W,D$DPVs~ljӍD$DPVZ|$߉څu D$$H؋Pٸ"D$<h<%t$Y|$,] {t+[1hf%SYt Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#Pt$hcE%jt$hVD$XP1PPjjj0k,j D$DPVh D$׋D$@t<=3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW蹈 )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j509PQ|$ RPh $jW+ ;ع9CVpSjP jPPh߬9 Vt?(^_[WVt$ 5(y<L5(y<~$uFjPq8F$1O~(1h߬9QQhhhRjFj WjPv$h9e4F(x;F,VPWv(fv$>F(F$~,v$>F$1^_USWV4ˋA@Pjq$_ C{$t%K0 u G fG lJua'fG G5G*G G,],G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPd+{$4^_[]V$j)ÆNv811Fu >tlIut5t.j+j,L$PVh]e%jPQx~ 'u tEj,j+蹅L$jPPQ h"#cj*蒅L$QjPm6 h$<j-kt$R5ع9Ph`$jFV} j.Fha'PVhBS%hh9} İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j509RQcQL$RPh]V$jQU} G<(\(|(Pu#]j#艄L$>PSWhD%j&Q%j509SWQL$t$>QRPh;S%j&V| $F|(,u)|$hf)PhaS%j(W| <$1e<(Ou*?D(Ltۍt$hPWh^S%t$t(Tt(P/PWh`$j(VY| 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhmS%v5t 4$|:|$|$upd^_[]1؍L$>PWhWS%j&Q{  $L(4RttD(8tPQ҃lj$uFt(Tt(P6lj$FD(Lt&h谂t$PWh^S%j(V@{ 4$h节VjP  lj|$D(dphYPVhfS%j(Wz *USWV9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá9H1WjHDWWQZơ9$1$ 9@u <@TX uDHXT=49tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W WOA#WRPPQ1ҍD$*W QOA#QRhQP赸D$$W QOA#Q1Qh0QP荸&)ߋ90D$pL$$QL$.QL$QPt$SPW0 90NjpL$$QL$.QL$QPWSSj'[0 h$F0W|$pDG$DŽ$$T$0<$tT$@BfBB.ffJ B .BfJB.B fJ*B,.=`9r~(uB0fB:B<.@1L$0htWWWWWWWjjPQhZ\4t8P/\@,Pp$PSNS/]$X(؃u 9TXK$a'V1OD$|$\$0ىt$ t$ WD$ PhShT$0Wt$7\$|$T$L$ $F1ЋN3 $ $VT$D$D$0VP.D$0VP.VPH1I1QQSSRPSSj$PV׃,\$ \$\$\$$$L$D$$$L$ D$L$HD$DZtQRWSVT$ЋD$D$0P~ L$04$PWST$0WSt$4D$8$HD uUlHuD1HD$$|u hf%PJT$lOu1HD$AD$AD$`$PD1zAl9u5ދ$PP1ɋz܃tuI:uD|$Z\$ B|$z߉|$ZË|$ ;|$D$}D$;D$\$|~Il9u  D$0$VtPQL t5$ D$0L$8jVtPD$8LL$L 1ID$8L$L$$t$4tRًD$0kl$WL$t18PRL t#$D$0L$8jWt18PD$8L0L}t$0jV59)R t@D$4D$8GD$|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!P L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,Ohf%D$ PAt5h<%t$ Au$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$VfGT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0(9)ދ,9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S tt<1^_[USWVGD$59l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1l99ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDXx6AL$D$~@ 1ø11OT$LhtQQQQjj PWWSRh649tBƍ|$WP[(Vo7x#9}09k<4LE1UЍe^_[]USWV1l9T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=$9t*=911M<t9\@u 9DDMHEr= 9tO9D$PP1ipt$1t9 :ut$P9t:,@uލEpr=H9\9J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@9D WVu)y8u.q$t"y8uqxu Hu^h#h?U%hm hT%l$D$x8u@h#h?U%hm hT%E$V 9; 9tD9t99t‹9u€92t 9^WV΋$tRtt =9tAt*GL$xQP`tuƇy1u9y1LPTX) \9 $ف89ǀ,ǀ<j\$|SP 9"hSP 9=9t 9 9ǀ9W9WjP Ft \9rL$AE\$ 9t>yu)99tЋ9u90u1H|$59,1C1҉T TTCD k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D $kt$$t$$OƋD$&$4WVPhU%hS`7 M$4jt$t$8u"DH $4jj hOA#QPjSvSW"?D$5$4whW%P萿 w01k,Cy uC,1uSPQD$=P PhDO%D$=P 10u?x@t$5wtiD$Pt>ShX%h>T$\$ 9$DL$4L$090|]t$V-PhP%WS 9( ( PQVhX%WSt$\$ CCa59.> >,>(>$> D$)Pt>ShX%h,S$$(t$,t$(r 9t P 091`9tWWhV%CMPWhuV%hL63' 9t8WhuV%P' 91Ntjh'V%Pi' ^_[]1N=P9tt$hT%jPMR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ 9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$L$ytP-ptYWtDžtFE tWPV u WVDjVSe E t VPwVq1HPPS| ƃx090^_[]h#h?U%hm hT% USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4 f'jP8 D$$tI t1$?$J1$@( 1tiu`$A,\$ D$4hQA#US 1USSVVjjt$" Sa xL$1^_[]WV|$ 1uOG Pӭ t/1; }O"h|9x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h]t$hPVa $$$Pe'D$@{tUhDO%V̨ USV 8Ouڋ$xhKuhLSPhU%V}C(~PhQA#hV }hMHC,~PhQA#hV }hN#C0~PhU%hV }hOVPhU%W5^_[]USWV$!3u*11IhtPPPPjj PQQjh!3P4!3Nw'$Q($de'WP]1N1jWWVVjjhP lR, S0D$4hQA#QP 1PD$PPVVjjUv D$P] x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP qQkd)QhU%V] ^_USWV$h]|$hPW) $$$|e'{hU VPhU%{hVvvPhU%W[hW\1~,t[hX?1~0W[hY"ǃ4V uh]V0FT~Ph-#hW shZ[h]1~`{h[vXPhU%WF\~PhU%hW" sh\mFd~PhQA#hW sh^HFh~PhQA#hW sh_#Fl~Ph-#hW sh`WPhU%V/[ha1~pPPWhU%S^_[]USWV$@1N R$eT$e' 1jWWVVjjhb|Gl=Ol9,1۹cWS<S1,G,10G041jWWVVjjhdI 1`G`fX"g\hd ihD$4hQA#QP% 1PD$PPVVjjU D$P;Y x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@ZpQkd)QhU%V ^_[V=@9=P9 áD9th}(D9Vt$D9uh}~(D99w1 k<L9^Vt$=D9u h}K(1t*uP9 D9tL992tu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hqY%hZY%hhX% SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N FLh'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$T9uh)T9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IQ sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPWۺ .Qw$$$f'@21^_[Ã!t*Wp1@<QcWPV讔 rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$PhZ%QFx D$D$uPhZ%j_t1ۉ؁^_[]E@USWVt$ $=@9$Wh5\%jP 1t t^_[]Ë P9 ÍD$TWhG\%Pj1~jDj蒦tD$$"#Vt$X9\Vj.\D$(D$`C\$\C D$XD$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1hR#WE ƀ8tt1tCuVL$ D$ j jV` É$qj jV` t#D$Zj jV` D$T$C\$ \$D$|$u\$uthhDO%S袅 hVS蓅 \$E61ۉSt$,j SVL` É$ tbD$ ʉ $tQD$ D$tGjhw$t$}VO tOjh$VpO tdjhh$V\O te|$ush"#jZD$(krT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j hh'l$}UN hjȣ$tJ@j`PQT$菃 T$ $B0Z,D$B8D$B4D$Du0|$\t)Ѓt$XP T$uD$DЋL$Ht D$ D$,D$ T$HD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPvH薥W臥߅uvv^_[kh}\%ht\%hhX% D$ph\%j iSWV=D95L9t^s3t#$t$j(PV| 4$͢_u9hr|$0VPh`$jxW WVV &t Ĩ^_h-%hCY%hhX% USWVσ=D9u h} 1t0?t+D9t!-L9E WP tt/|$thh%Sv !hvSv u4$$$$$St$h[%j ^_[]SWVD$Qt$Rh[%Pj h"#t$KK$jhh'PXi uWh"#j"K$tAt$hR#W 8tjt$2h"#jJ$ut$ӛ1ۉ؃^_[USWVӉ΋|$|$tBh[%S萲 h[%Sz h[%Sd h[%SN h[%S8 h[%S" h\%S \$hX#S ǀ?t(_#`h'WPϱ uE F@j`WVs -j(Wx tj)Pg t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ A t pumt$8Hi't$ tLu;1ɉL$ L$L$ $1111ۉfwfWGO D$ G D$fG1^_[]Ëk'D$ k'D$k'D$k'$D$fGD$fGD$GD$ G L$ G A똋$t$T$L$ fUSWVTt$hk'D$k'D$ k'D$k'D$k'$k'k'k'k'k'PQRVUt$t$t$$t$,t$4k'h$j@\$HSh 8k'k'Sփ UT^_[]ÐUSWV t$ 9480ht=%hF\$|$USWV[x4$t$t$ht=%h,USWV t4$t$t$VЃVW%^_[]USWVD$4D$D$0D$ 90 $48DHD$,D$D$(D$jh>VU7 |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3hQA#WUz WUUjU% H>wѻPD$x0hQA#SUB SUUjUl% H=wˉ9DD$H1Ƀ|1M1҉$PVRUߩ 1Q\$ SRPͩ 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áX9tp.X9Vt$ X9u V. X919vFt=NL9wu1w 9 :^ËD$Hs-s n'.h#h]%hhG]%襱 Vt$ =X9u-(t;u2L$ rȃs$n'$tu91 ::^WVP|$t$=X9uH-j PV =v1t-h[t 9t4 9^_Ë $9u։^_-=9t9ù^-D$1ËL$T$t$ hF4.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCSh-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh?-^USWVT$,D$4L$(t$0|$<\$8]}uM EUhM,^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh{,^_USWVP} uD$PhFe,D$PhG,1\$}UM;t;Gs} ShrT%q} ~ShW%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPWc L$D$ T$VQPRt$VhY%h$P\ $L1QhPjVx`WhydP D$V/|$t;jWSg \$;MU}h]%h]%h hG]%׬ 1e^_[]RSQug Sh5%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS/x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSʚ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H 9)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV^ )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt T$;}uhsD$ $SUK @$\Cǃ1:k0hWVڕ D$4WhPW$XgD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(tÉ|$Uwc#D$0jPUQt$(R1 Ⱦu#\$,hPt$ r Ws|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P@ PʢD$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjitFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuU pt$D$l$x PGtn{ C K$;}sL$4QjSPL t_D$HtW 9)1ɉAw Puu2S"j@jP衐 fdžUSTo1ۉ؁4^_[]h!\%h`%hhG]%褍 USWV,D$D D$HhjBhƋl$P\$L|$@l'WN= F|11Kn^؃N$F Fdž?džjh>US @džPWwt%D$ D$D$D$F11,^_[]h!\%hI`%hhG]%葌 USWVhED$$11@D$|$ t&1ɀ8>@,19QzvPW8 D$vP68 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h1`%h`%hxhG]%ku USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]fUSWV0$H$D715!:5!:5!:D$D$ D$1D$ha`%WU. pu <!:e~ft$lt*zD$ƒbtCeubD$벡<D$ ChjVV5<hl`%!:!:zVhVV5<hZ$D$Vu=/39}4D$$D$l$ t%1PPU D$yUh{$IL$ tHt$(Uhw`%VU h^#6uRh`%fD$0Pt$7\ #D$8=$$ !:!:jÍt$0ShV u UPVa UjD$0a !:!:S@y h`%t$(S1|$P7y h`% y h`%vuWjt$71St$64$t$`%Sh u#PP;t1h`%t$t$64$t$5$!:5 !:(!:53|$tL63,!:63tZ63=l$u1HL$(Qhht@P ` PtL$* 0!:t$+Buh`%lʼnPa6yhKa%T^ D$ yha%@$uBL$$4jP54$t$V6i6ha%jPh j Ct j|$WUt$7 x>tq1.SPt$  yv 19u2 !:$!:)uv 8t1FVh)a%1FVSh7a%Vt$D$D$L$D$ L$ D$|$tvD$ P譵ƋT$ уƉǃtωÁtt؉D$ u v 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj r UPL$ɋD$tPΊ V(t P@. hOA#PVhWa%hL63Ǖ j蝊 V jVr jR- VP^Ð=!3u !3,!:@=u1HP41;!3USWV}uCjhH!:b* H!:X!:L!:\!:P!:`!:8!: pr r11ݜ$D$8d|$<) 4Do'RSt$Dh$QPe  !:!:ȃ||=$!: !:݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h$QPы ƃ}u 4)h"#QP請 ơ,!:@=u1H$VQP e^_[]+8!: umFOKu$t$1VQ$PpM"u%ha%Sh 8th 8#u$SjVB tGtV $1E48FB$)Ex t$7@[ha%ha%,Bh ha%ha%+h 7ha%ha%5S^_[]$Vj$q2t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPkEuhh%ha%KRÉhPKt4VhjPEuhh%ha%Q1H^_[USWVp $$$!19L$PVW1Hl$UK ƃUM VD$PWG tb$UItM$dt` $dPU t$jWB tu)$-j4'WnUŤ 1Hp^_[]Ë$j-UP D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9P#45@u`V,<jP, u hb%G,dž,shb%LGj>3 t1t3u5y$0)b$ y$1Phi%F )b$ y$1PWhi%F^_WVt$ h*"@G4r%t8t7 uhi%W㋎8 84^_j>^_USWVD\$\t$XFtt+NQT$PQhj@Ruhb%FD$n D$SPU6ZVt)ǍFxۉ,$t1j@SPy SUhc%E SUhc%E 1KNދl$Xu^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j#(ǃ,f@K(1ɉHHH HrF>rD&>C5F $P w_ǍCWt$P2 ;)QjPT hi%Cu^_[]ËFUSWV |$8t$4l$T$t uW=t W^_[]V΋ltu=RVj/lt'L$hQpP@PhJj%%>Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhRj%5> SWVt$~ t^_[ËD$|$F @PWDD( ~ t͉^_[gV6uYh}j%Q裣~PtV8At(t NLt8L#t;c%PVZ^WVt$ >~Lxw16tЄuOF$uItV@u hj%=jjAV? u hj%<^_vF$ljjVK? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph!d%;G$C$G>C>>-ك**PWQ* WthAt[ƃx t Phc%A;d%KFNtTHNUh d%;P 1OP 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh7d%:@1ۉSSDX% 1G|$ ~UVt$$z? { t S^\$ HPtQPV P;uV*US@^_[]USWV׉΋A Phj%:11BUi%tPVVUU0n 6uj?1^_[]USWV $ D$PQhh9 t$hZd%hKd%9$1Phnd%91F\$ MbihS$( EuVhd%9uN 87t N 8 uF띃tVhd%8D$$ \XPW?&Ƌt8t* SV0>uSj$( ҋ>$ 1GOtHONG Pt=3uFGGtIO9tA t3@UUD}" 4WQjjZ.>jV'tb<t$VtSt< t\=VS?= hZd%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/L 7 Vhd%he#6T$1|$`F(f9t(~ tωӍV QPRhd%d6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$Sh e%5 <PUt$WPSh&e%5T$ V>t*4$QV$ H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!hCe%hvb%5 j,^_Ã~+ajjj ̓khe%h|e%hTe%4 1m9he%he%hTe%4 <5Rhe%4@hke%hte%hTe%g4 111dh%he%hTe%H4 @+X1BWDPU hke%hde%hTe%4 11G1=h!:h!:6u PWn+h!:zhe%he%hTe%3 t0SvPhe%34WV"1PPPVCD@PjVN48@t @ sfyt ‰48WVK^_USWVP$t8D$ \$9}$w ŋD$4V9 tE9u݋D$ 9t9 uZ<$hj%W莘1PPt$$ UVW W蕔W;9t>G 1PPt$$ yWD$$ W-2D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐14G@8u^_[]USWV \$@l$8;he%Wg8 .h f%WQ8 !hf%W;8 D$$D$h*f%W 8 |$t$<t$ ǃt1Fl$<4 GF9uWJ$t$<l$UT WUD$P E t=1FߋD$@D$P Wt$U EE F9t$@Gu݋$;D$ut$St$@C t[uD$471D$D$D$471O ^_[] B |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWv3 tFt$9t$VXЃ с u VFXV{^USWV$1t$t$($|/xhGf%WR1 he%W<1 \$,hVSq; jǃ0`f%!31O$$0@4jV趺9u11@PP螺$u1Ajj~ uD$l$(D$ D$D$$drf%tqf%Uh0r'P$V0?u$duiM)4tQ6uD$ 럍Hv H w?$o'<$\w$`o'D$e%D$[D$ PxGD$we%D$2 $d 1@D$D$D$$h&5< $hD$e%D$D$e%1@D$x ˀD$D$FD$9/3t$bSp($h($$p$l/3)$艄$\$,Su1VVVS27$U$PjSB\$hk%ێ D$9/3$4$|$0WP?/31VV4W6&$$Pjl$1r/3$L$ QPUr W$`$dh%r /3$OA#OA#th% th%VQRhA%8yUp\$,1D$WhP讑u hh%xShaUj$$cuhY"ha%C$u($`r$d$d$`L$$PQS""$"$1l$,~O$4PB!t x uh%h%$4PF$$9|t$t׃z Ru$dh!i%PTS$bh;i%?h%yD$ L$$$XPTUhoTj$d$ uhY"ha% $dhDh%w$dD$ L$$$XQ辫UhoTj$d$L uhY"ha%,S$D$xhY"hi%`_hg%hY"hh%9hY"h9h%*hY"hh%hY"hh% $Dp PhOh%$`m$8l$,t01 t$VV$ uً$t$VPS VSD$$b@t SI$1t*1G{ tSwu΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@hbi%P?D$,Pg't#%@tD$,Ph/$Qj$YWD$0Pg0$01~ tVh.jj$vS[+ WVjh3%t*VPuVhj%BWΨh3%h#%^_Vt$V艬t$pApdr$Phj%CjjiVh Tjdju ^WVPt$D$uPh8k%h b% jP, tuIh8k%h8uM, ,ۧdž,>wt=D$|$ffN(ffOfujD ȉG_1_F*N>QPS< F>)^_[USWV$lt pvhp%PW躔 t=wM$lD# 8thp%h{$hH$u)hEp%hp%hh+p% $$l~>1ɀhL QSP ƍl$hUPt$ U =wfD @PUhhp%W荓udhEp%hp%htI{>tA,$fEC(ffEEK*S>RQP C>4() P1pČ^_[]ÍF PhNp%n tt {>u[[ht hp%? ~>t$fF(ffCCN*V>RQP F>4)mC Phqp% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#! 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]hq%ha%hGh+q%ha%hHhp%p D$tFL$tt 9Jt   1HBH@M1@hq%hHq%hhp%  USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$hq%hq%h hq%hq%hhq%hq%hhp%  L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]hq%h[q%h|hp%' D$t L$HH@Lhq%hrq%hhp% D$t@Lhq%h}q%hhp% 11WVD$ t!L$T$t$|$x0p4P8H<1^_hq%hq%hhp% USWV(l$<\$߾p'1|$ |$|$<$E4t.1FM0 I?r E4  G9rՉt$@Pj 1Nt91D$ D$D$D$9E4t$1E0jS4_ t G;}4r1(^_[]hq%hf%hYhp% l!:tD$ l!:Ql!:p!:WVjPj91tMƃPj t/1vN F NN F N$(F(N,FH V^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t P著NS*v@1F@FDFMF t@PtQPV P؋PtQPV$ PF uPtQPV, PF(uFN^_[jt$zUSWVu-~L =l!:t'l!:H l!:l!:N8tv|x| @t,'\$$L63SVU; Uj G %3 s SVW ^_[]PL$T$ D$$PXUSWV։ $VhU#2 SPUhe#W ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá%3ËD$%3.SWVhS$ Ϗ 1OtFƃ ||t q +D$HP&3Ph{$Q] &3^_[á%3ËD$%3@P%3SVt$ hjh!3hL63%3 s1fà U jSP< t V1H1@^[fVt$tNVVVcV{-jVVGP6^F^SVt$ V`1Kt=jhj t!jhj 1ۃۉ^[Ѽ Vt$t'PdžtPdž^D$t$t$t$ SWV$hjW C jPWi Whic 1NtF$$T$ !fD$f9t hWhi t1Đ^_[USWV$1SVU G jPU SUh~i tt$Đ^_[]ËL$A$u1ðyLutUSWVTt$h^>tv  7  V1H11ɅtS $BD<IG9uލ|$$ ^ F>L$jPWVc uF>*PWVt 1T^_[]VD$0tVjVv^USWVD$8t$\$ 1wG oHt/usOWtjURQPwVjS$IOXxuP uf@ wQjUPSVt$,Vj\$0S ?O^_[]ËL$1t$ËD$t 0p VD$0tVVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV Fj*ŋ$@VEj $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP tًv\$~;1$D$0Pt tF9u19D$$"$8ЃD$P1~11TjT$4R4_ t GP9|PX~11\jT$4R4$ t FX9|XD$ 9D$H$~11LjT$4R4Ϥ t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$XuVhr%t$p 0|$w$H;D$t$\hjdKlj$w jD$4PV- CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0 R`~/1djT$4R4Т F;`|ӰD$|$0WQf~t$\yWh-r%$_w ɺ@r <t5<(<$L$ 1@ut$h-r%$1@fG(FG>O*VTPRQ $t$6@u<$tW{tmW#G@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVhr%zW$7t)|$ jVWϼ w_ jVS軼 r~ 1N^_[]j:Ss t/@1UQhQQj QPc G8mt1 (G8GjSPE O t <=3DPu:pKCu1l$PVhVVj US G0Et=it.u1@1QVhVVj VP <$ O4G4USWVP6!D !: !: !:!:h`u%F!: !: $<  O+VQP葷 9v1 LJ\$ I;<j,je@t ǃD h8u%j,j6Ht ǃL h8u%j,jPt ǃT h8u%t$$Why'V轶 D$9rh8u%hDu%[H$|$ 7D$PWD$t$hR#D$P* ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW~D$u?\$Sn J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h8u%he# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$hR#D$P( ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$hY$U hr%U h#Uq $D1)hs%UE 1Ʌ<$t$V߷ H9t- t u!H\Ht$9u1@$D$$<jPS赖 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DSS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPd t6ʼndt$+ `Dd<t A`Nh8u%<$Dt&u"t$ $<^ 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$Uy' tu;uHUhou%y'D$uuUh#t$$t$$P y't$$^_[]USWVt$ t-tQ^  8uPE|$t-tQ# uP tt*t$1PPUb t xTuXTj卆jPW5 $@DtW,Du싾@WhHLtW,Lu싾HW6PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(/3|$$t)`#L$# $ 1CƋl$ \$18rf%sqf%Sh0r'Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\WQ Ê@tC< t< u CCu1j h!w%W- j h-w%W jh:w%W jhaw%W jhZw%W͛ jhPw%W赛 jhMw%W蝛 jhw%W腛 jhw%Wm Pjhw%WU 8j hw%W= ?L$P1T$XPfL$T$t$XVY(1Kj/V uD$|$PjP L$r L$rL$T$t$XV'1Kj/VN uD$|$P jP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;!3t PR11j|$\W6!ƉD$V蜻yjW t>th3%V V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7hu%hu%OD$Xt$P jP hr%|$Xx D$P$<6t$X<  $<PU D$PX|$X hU#|$\W{ t$1VWjWWWWP誄 L$P9>t$Xhu% |$X t$1VWhWWWWt$tB L$PA 9>t$Xh v% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/P tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t观 L$P9>t$Xh&v% L$P ЉT$jt$\# hr%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$t ,9hv%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t܀ L$P9>:t$Xhv% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP   L$j ZP< t< lGG|$Xt$P$vt$XՓ $hu%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J| 8Ut$Xhw%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hPX fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h@x%@D$X  y@Uh&x%?D$P |$X D$P D$P D$P |$Xn$6t$PvihHx%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XV@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xhou%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tVy 9]Vhx%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$tby L$P9>t$Xhuz%|$Xtut$1VWjWWWWt$t!y L$P9>t$Xhz%D|$Xt7t$1VWjWWWWt$tx L$P9>At$Xhz%Qhz% 9%P4 C t$Xhx%W à \$S训ƅ|$PPhv%SV  jvVj/t$\ AL$1|$P# KD$ɋl$t t OGuhx% N|$XoE1j:WJ l$t2At$1VUhUUUUQRw 9.Mhx% j=W  ED$(@1 t H@Whfv%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQi Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVhox%nT$P   xUhu%=D$(hu%J ht%Ɔ <hw% D$Pǀhx% 1K$dVhz%cD1DDD DD.u hu% 1D$(1he$WjhÁ%W1xh'y%Wh$Whh "WjPhp%WTJh{%W>h#W(zh%Whh"Wh%W hE%W> t$ hL%W hR%V hZ%V ha%Vm hi%VWY hh"VAZ h%V+T h%VE h$V6 h%V' h%V h>%V hx%V h%V h%V{ h#Ve Vhuy%  t KC  t KCWhx%Ɔ  xt$P1$ƀhuhx%XttC< t< Cuh0y%0ǃhu%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h}%W t-hw%W th(%W t hez%W t@Ch[&Vu thkz%Vc D$P@ tsFH t t@@1 t H@ttC< t< CuhIy%Ƈhh0z%wsF< < F1$SUj2 tUhw%1C CC"$f8l$1USjxSjSSWn $D9]$ƃWhw%AttC< t< Cuh_y%Ɔ L$P1S=flF D$PVE%  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h+ # 1F؄t  H@hy%z1K؃<^_[]ù@D$PǀǍ0PVj-/ whPz%F -{]< < Chiw%11|Kh@ ыD$* * hu% C{K< t< tC C{< < Cht$1VWjWjDWWSj L$P9>sShw%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/Sץ tIGC1L$P4 1D$PVSjr, u7tb\$1SVhVVVVWh L$P93tQUhw%tGShw%/1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Why%t$Lt$1D$( s$t %@uhy%?suhy%tF1tC< t< Cuh$Wt)WC{ Åu"=1rWhy%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP˵ t(t$Qk,1҉T(T$T T!hu%赻S讫IVD$0D$ FD$(F^ t8U* ljD$FWUPV >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$V蟈 >"u y"uIFA $Vjct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=<=3DWtCT41Fu|$ D$ |$jjD$Pn T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$Pn T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRv j=Pj ,$|$D$ V 1ۉ\$t?t9D$ 1j=S( )9uWVS'u D$\EuV4$Nv t5ƍEjPt$ 覱 4DL$hz%蛷Uhz%hz%袷 |$$t#4$u tzSbD$u莽 8Vt hB|%肨ňjjU jWU։ Gt ;D$TG9t ;D$TWUƆWV蜂ukGTL$tIѺ!! t=}%WjR3u!Ƽ 8t輼 8t h}%谧W9߅81SSV  tLWVWUS9t!g h+|%ZWSSVÈ Džu1VD$PVD$ PD^_[]t$ t$ ËT$11;T$ tэ HUSWVPՉ΋BTx tt /4u$UhtEPXt1^|$wX&td}%lG|E|GT;ETUWyGttEtuGMQPUupG8M8QPAu\Gx;Ex$UVltb@tt EtGT;ETu8M8QP1Wj&1u蚺 8t$h|}%若 1$Uj0uc 8th}%W1ۀ<$tWVW؃^_[]ËGx $;ExtUj0u 8t hm}%$=hX}%hQ}%h*h;{%S fD$t%@<t <u ø謹 /1h}%h}%j;h}% D$t%@<t <u øi /1h}%h~%jQh}%ʲ D$tBHt*t u#xÃxu x uxux /1h}%h~%j}h}%j D$t>Ht4t uxjhPy'P7 譸 /1h}%h#~%hh}% D$tEHt;tu&xÃxu x uxuxG /1h}%h1~%hh}%襱 USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^ʷ Wo1=u!GB9r1ɍ|$0+藷 /1NjB1ɉÀthAu_1ۀ=!:uD1FFFF FFGF!:SVrVW_uH!:މ^_[]Åt 1u19[:Rt1h}%h@~%hhL~%h@~%h'h}%J USWVP|$G<t<$ $ l$W)Ã|WhV褲 t(ٸF|$\$$)؃|PjVo 1=!:u+!:W9u!!: /1N^_[]hr~%hd~%hnh}%S SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQ4 ^_[h~%h~%hh~%h~%hh}%趮 USWV|$t$)Ã|UhVC t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQAGSKWVPQ ^_[CPhl$WV 1t߉h%h~%h{h~%h~%h|h}%虭 D$tL$tf Hh}%h~%hh%h~%hh}%T VD$t&L$ t/fqPp QPI H^h}%h~%hh%h~%hh}% fVY$dy'Ph~%B u^USWVD$t$V\1Ij0Vu1|$/ooo WV5o't-1C o'I?r   DE9u֋-o't/11C o'I?r 诲   DF9uWt$V脲 1ɉt$\T$\RVQ2PlVt T 81I $ȃD^_[]WVP|$D$L$ $QPW tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPu tbL$1tHhE%h!%hM8| /IG?uWG9rD$^_[]h1%h!%hh~%茪 USWVl$t$|$t1ۅu>t7NL;c%t-)&8L#tÉS1ۃ1Ct:tVVtXtShY%t؉8txt@HtPt؉CjV>t.Vt!tha%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV\L 1H^_SWVD$1t^|${t[ 1NA~0jhn%W_W uW Wg G9rh53肇 ^_[USWV |$ 7u ;l$$Ujh%UV \$C UPWh%S$t^DžtnjSW N 8th%hk#=9hs%.1HzSlt$h%he# tG11CGt0WJ ؃uhs%h%轘?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQǟPWh%h'%nKUSWVӊB D$ L$$t Wp *QPdNjD$$7@uMhݘ#j%tQh%W V Ph%We |$ t$h%W@ {D$ D$h %$U8 t$hY%U Ud |(6ha%U 1>h}j%Qڝ h8L#$U轝 5h;c%U觝 hj%U葝  h-)&U{ hd%Ue hi%UO 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I4y'h%W +7$@D$o|$L$ uMD$@tBL$qPShT`%W@T`%D$ E|$tShT`%W <$tBt88t/Sat"D$pHpDShT`%WQM|$ tSW3D$ t7t1Ph{$W D$ 0uWQ Wǀ|$ WD$(P D$ #tۀ%Ph*%W; vKLxc%t$&tRh;%W AsHhH%W 'CPPhT%W  s$hb%W S Phm%W {Pt;CQt$(stPhhV tVhv%WT {xtCxPh%W3 tr7@OǀD$(h y'Plt0ts~ t!V^t&PD$,P9uvh%h%1OĨ^_[]D$D$D$h%W t1PPt$0Vs tc1PPV s 9thDO%h{$W oET Ph{$W QjUt$0Vr Ņu1UVWU hi%$V h %Vݗ h}j%VǗ h8L#V豗 h-)&V蛗 h;c%$ tzhj%$g ۀ%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjS"uۀ%#(##D$ ##tۀ%Uh%W Vh%Wv S E%tPh%WP 3E%t= t1tVD%u vuPh%W ?@th΀%W|$"D$<uMD$@tBL$q PShpP%W:pP%D$ S|$"$<D$@LL$qPPShpP%Wl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPW1W 1tk<.tghzP#Wה tUh,$WŔ tCj h2%WJ t/tj.Wt tUW4M 1t^_[]D=|Vt$ 'Bء53H 53; 63h53j  53H 53 Fut$53H 53; 63h53j 53H 53 Fsh=%軿 Fshx%西 Fsh$菿 F sh"y FD%K%Q%Y%`% h%@uwxnz%rhg"r]%rR$ rG%r<%r1%r&f#r%ro%Q謾 F sh%薾 F sh%耾 Fthd$l Fs h%V 53H 53~53H 53 h53j  h53x ^ù%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vtg$$QPVhf%hg%hӁ%US 1N@t+9w');@MQP&At9w :)߉hf%hg%h́%US贻 ^_[]USWVD$<PH t$ $hX#V ]NjD$@HD$?1jh{%WF ujh{%WF u|$D$4Njt$0tNF tA.t;\$SPr D$P1U1HPUUUUS3 9l$u9t[,OuD$,Njt$(\$Sv  t-D$P1U1HPUUUUSP3 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ hX#V~ Dž4$x14$xr 1H^_[]4$^xQ USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQu t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$- V "1H|$0t1rЃ^_[]  7ۚ USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy<=3DHes<=3DH@O\tx<=3DH, \\$ $2f\\ $$l$T$$l$O$sZ/t uP蔙 tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1 T$$t4<$t s%|$$u1Fɘ 71N^_[]USWV Ί <=3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMElޗ 1 ^_[]ÿė 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3VsK 187 1H(D$ %t%L$QSPWV至 Ą^_[]USWVt$HD$DD$L$UjSC C@G jPSA fC $4CCD V$4Pf UShipt C O*W>RQP}f UShipt i 1N^_[]WV D$(CShir 1ۅ1K؁^_[]USWV$1\$s ss3fs$ l$hVUU jWU9> ]Uh:iD$.r ut$Ĩ^_[]USWV։ϋ$hjS jVS= kS$q Ĝ^_[]USWVHE %@T+02]|$HhjW~ G_@t$GE HtΉOG ǃ8D$ PǀGPD$TuUt$ L$ 4L$ u=M AT@fD$LD$TAXPEL$ u D$T33 ȹu ȉL$PE @| t L$PE @xtD$hD$xD$|1G$|$u ωL$TU rT1ɉL$(L$$L$ L$L$L$NfL$SRPa tKC؍u} |$} t*f D$fC1CCC CCCC jL$ T$,PQRNa L$8 yu(|$4uD$5$PRQ_ ~u~uF $uG*SVP tuu 1^_[]fD$fx(t1ËL$ D$fx(uD$u V1ËL$ D$fx(u D$_u V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS2q |$jj!IYƋ$(h@h%=ljFuJ1ۍl$Sh%j U h@UFuC}t 8tǍ\$($PhqB@W\ f<$f|$ jUSY( ShlBWZ\ txD$PhpBW<\ tZ$$VЃuBD$PhfB@v \ t(D$FP7>F u+ h %^Ft PVN1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ L FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBPZ ^USWV L$@T$*@h t$ Vh`%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@ڦËD$D$ PShCL$QPW؃8L$QPDSt$@ 9r$؃(^_[]Å,$D$ CD$V8ŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PU蚵EL$QP艵8L$QPvUt$@;$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P[sPVh4%S;1I/ދ$0$4Wj$@U t|$r $,84$GPrP$0VhE%WõSYGPVhW%W螵$0$4|$WjU $,t|$w1Ћ $ QarPVhi%$4;$4#]S/rPVh%$4 T$ }ltE$u?ClhPhhW8WVh%$4赴{,t=u8C,j@Ph@hWWVh%$4p$0t1WC,;r鋆Dt%@1WnC,;Drlth1W@C,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhVt$$@$@$L0] >}k|$`$0PDL$L$QWhPt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhSt$$@$@$L0Z E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P_8|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ V< t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$>b  1b V1(^_[]ËL$DtD$L$tPVQ; D$ƅua SWVD$ L$tT$$wa .11t$|$X+9sa "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p@v\F\^VF`t# P?v`-F`^SWVjh0jM 1NǍ\$PSPhWJtrjSjjWJt]jSh@hWJtBD$$1ɉ $L$ L$L$D$fD$DtD$jPW@ t W_^_[USWVt$+VjUAChu,$t#tVh!Pj@^  r^%s%PSh%&jPSh%I 1Bh! ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$PzL$1Bh!` SWVt$tgw]Vh!j@^ w$iPSh%H GLhO ^_[USWVhuD$D$G$D$GH t-w8GGGG G _G_1ɉO OG_T$SPwD$@tGHM%_0wF SPhp%H _0G89+\$8D$<l$8 `i&|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$gw(<PSVh%GGG0GH"% w$GgPVh)%G G0GHF%c1HG8G4 w$gPVhU%F 8\$0D$4l$0 `i&|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( ,i&|$D$ fD$l$|$Hl$D$HG4N PQhυ%tF ?G0D$ D$$l$ ,i&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Pew0PVh%E w$ew0PVh%Et$6u$HujGtGht:?4%tP;%I %GHPu褫j<c@O;Au<t 1%?u-%GH0ts]Sh!w4Q;Sh )w8P;Sh)w0Pu;C w8w4PhA%uD 1HG8G4]@uPD$u>C wiVPho%4D wwhV3 uVh%DOhD$L$u2wHSk3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;thb%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%h%hh%P SWVt$^ Sh͈%#BG0+G8PSh%A VhOj81GɀT$wȈBBV*QRPn) T$(  D$tz tA<t]<tYD$PPj0JD$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$`)]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP ǃL$D$؋L$؋T$B)Á+),PjR#B ,L$1OAhT|$ 1|$CD$PjsǃSt$ Pv G D$G D$ GGDCff_f_1ۉT$SfGEhY fGG@D$ffGSf f_ t$WhD$ p\WF Ph%/D ΃]w'6uhN"&V Vjj=&1gydA$jD$PVo$ D$D$uD$HwK*PQt$n u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>www  W6ttt9uq@苆t'Pw蹻džtP蛻dž(1^_UWV}tuPG><r 'u#r G(ftf u  s% u`hM ƍG 4$D$,$5Xi&D$\$$%q(WhBVj`e^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0js* u&h4jp@`GH}j%GP_iVjhSFtSE0x LJ  twAQ \ BjWh^jPWh%ha%3'sY EX>@P UB( A J*R>RQP  ]rts4 t*Mq @T$hRQPKPV]hS%2C>t2Mq M*T$hRPQPV]hi%% Pj61wLw 'w wL$u]rruG XixiF SPh%B% D$h$PS6NRh%%@u3EpCP t: @ NH M plYh,%$%u Vh(%%h}%r$53=u1HL$h$QP t=w:F h%Ph%$ w9 1Ƀ8tmF SPhe#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP= h%?$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6质L$ <G cSc{ ni;`CLsu$&1C &cMScq s$APVh%! M1CPSh<% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuwMEEVF $PE}t\$G$u=EH"%j7ruHW댋Et {WZtstـT$sO$tPЃ8u)ʃAr 2 N@H@USWV׉΋D$$E t @9u ;M$^ P=PShU%H EiP6辢$u!}@uHhjjWV Džt jWVjj|${$tDj%EHPV藂#8#4 u2j1Vhm jj؃^_[]ËL$hOWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hoOSWV1{\t^_[ÉjhQ裻 C\t4WhIPjpuha%ha%~q0 8u"5&3hT%{ Wha%he#: 1NcD$T$ PUSWV$$($$$$_\ftPhn%h b% ch$USV t'sPUV`t3_\t,Ct$?tF Phn%he# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh{%h b%  t `jW0覩 tD$ WV h{%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r P*8PVhЊ%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sF%n1ɋl$ T$Et*u4y%& Vh% "%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% W} /6uh%VEiP6Vhm uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S t$|.4$teSPh"Vt$Wh%t$( "ۋD$t$0$ P+.4$L$ t/PUVt$Wh%QSPh"t$Wh%t$$3 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EP8tUWP +މ^_[]SWV(΋6ulVjj/K AuA jQV_ t=Ht*ub 4$,PVhߌ% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph% v 1F FFL^L$h^WËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% ʆ%GHPVq^_[WVt$ F Ph%c OhGL^_D$ȅtȰ (1SWV\$C ro 1H4t${GPhV ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h y'D$(PrEdx t]S8YƀH|EdH #HL$|$WVhEd@ D$WPhF9VD$(PeY1VVP VVP ƍF8Pcuz3WMhVP* SW*XG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WPgFWPgF8MdQPlgXMdQPWgVD$(PXS蔭1PPD$,P toVD$(P~xF| uF|FXMdQPfVt$|9tVUVT1PPD$,PY ƅuC$t$xh y'D$P1PPV& ƍC D$~dV8aSn8U$a?1PP$ 9tC9t?UWgd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P4Pt2Njl$$L$1tFt@t0Q;Ut, u&d GT 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4VƉXEFD$(F 1ɉNON1wL$ˉF ~ u_L$( Ʌt ѹ )QPh$}%jW- ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h[%VD$t:t0t!PtQPV PV^WV|$ 1u7j&t @1H1N^_USWV $ yrV t$ $ q>YtiDD$ \$fl$Ӌl$ hQ%WU諀  8th~%hg%t$@s"j@<{Dž@7SR D> t$t$4t$4* t$t$8t$0 T$$L$ftf D$(L$ P t$XVt S$PV貐 VD$1ɨ1QSVg PQFRC F CFKN\$l$ M ! FM ! F D$(t8tjVW uʋ&u1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF oUSWVD$1tW8tQ\$l$G@tjUPu u8u@$Vu4jjFt @H hr%1^USWV0hjƅT$PL$LD$H|$D~Ӄ^TNdžu`P VLPVH@FDV@PQL5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU] n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUdtNj.PUj[ t:NXVRPh$}%j.Q @jPW t&@PFPNT#h%$V1FPFPuNT 0^_[]WVt$ 1WWV t1@WWV8 1^_USWVD$$t8tb\$(勇tK0tEFPUkt.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]SWV|$\$L$ Ƌ@t9Xu9x t)jtXx N HF 1h%1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP t&XPt$ h!%t$I1Ƀ H1ËD$1t' t!1QT(u QP uSWV|$uuu jPWO t$H:u @PPjPVWtaQPAHT1IH H$ǀUjPj791FuhY%WK1N^_[11SVt$ ^T؃ FTFPu uhF Ph%R F NXQPhU% u2 tQT s((thY%PJ^[USWV |$41G$ujjW t ^_[]ËsWt׋trNf(@_>t .o*Sh|'Ux Sh'Ux D$ 1L$A AAPj@QW1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQP5D$D$]@D$ (tE@jPSv t=m<$Xj.PSjU 1T$ JO9zPWEPt.tRD$@D$,$KU5E XUPh% 4$ f4$ 1SWVt$\$Gt!PtQPW Pl1jPW>tt2jP5%W-1VPj^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUt tKT(1tD$ @PCP|$u%CTtC KXQt$(Ph3%8CP tt#CT ut SуCT$ CT|$u2CTKTy#KtHKT$JS0t4$ 1H1^_[]SWV\${C KhQPWƋD$džtuC4PN4V8@F D$$ tc1&& É&& t$9ދ$9t1Fu4^_[]WV t$Wj- ^_USWVl$$tEID$C,9r|$t"w 7h,%l PWI,Nu^_[]SWV$j:h0jz 1N1D$ D$D$D$D$D$ D$D$jSj j)Wh|$4tb$jSj$j)WAtc$jSj%j)W%tGD$@$jSh@hWtD$j Pjj:Wt Wf$^_[ËL$t,t9JuƂQh)jjËD$t!  9Au񀹊tƁD$ H'USWVt$8\$l$G jUPh t ?u8G Od%u4L&RQPhW%YOhjV(u=t&9tO;Hut倸u܃xdt w^_[]USWV@T$8Xt_X^;4$tuxH^;{Hwat tOt t=xdt)t(X` H'n` ;H'~9~duσ~htҋ6ut$p׉K~^X0vڋ$tVH$JL$H^_[]SWV΋hjS sCh0uClCt@t9puu t؋HlO P.ouy 8t h%mĐ^_[Vt$jjV t^F Ph%VhV ^USWVD$1t;t5l$t$D$9Ctu{xtUVW0 u?1^_[]USWVD$1t08t*\$l$wxtSUV u 6?u1^_[]USWVl$E81t'\$t$9ouVu?u1^_[]SWVYx1t2׊D${ t8CuC jWP>e D$tuމ^_[USWVPl$tS}6VDžEɉ<$t%11G9iu jFمu1Q1<$ttu7@t'PcaLJ^_[]WVL$ 1@t!9Jtrxt~T8t61^_SL$t*t$\$ 9Juu tzduu1[ËD$t9 t3T$9Au$uuq`ty@u u1ðUSWVHu D$Pj*1@MD$9st$FVht%j |$0Wx CPD$(Phz%W1sXsTD$,Ph%W1t$t$D$,Ph%W[1sCtPD$(Ph%W:1Rt$S`OA#OA#y#\$OA#@t$OA# t?# tL"Q'SVP|$8Wh%uV0 \$sdWhŒ%V0Ct"1VRG,C;r拀Lt&H1VRG,C;LrKPD$xL_)L$D$@D$ $@sߋL$wHL1t9t F,9u9u*D$ 1t9t F,9u9ttT$ B D$GsVPhOQt$ D$8Pu2J j \$sxt=1FT!ȃu&~ t GFXPWD$,PhԒ%u.t6u1@u M1He^_[]WVD$L$t8T$ t$r p9v 1:T$829|$ tt$$ 9t,Ju>t^_USWVt$Ft-9t'\$l$9GuGxSVPU?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPXu t u"GPt$,h% GdD$ D$1xG O4SQPt t $tsOTtYG ~%t$OXQRPh%Wj\u! 81t 8t h %w$w gTװD$ T$9rхtȱL$D$?9$t`7G$SPw)t t $t8$C O0QPh%X OtHO\$u4$FTjPS賽 NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$e D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQj>D$ t;t$(h0%j6ha%V-e^_[]SWVt$Vjj)tj11G9quƁjmمuިt?5j6  sha%V,^_[USWV] D$@Cxt$rj.VL$0Qj: |$,wVh[%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h~%%e^_[]T$rRQPh%"ߋL$@T$ru_L$(9ujIu_yjjPPL$ tjt$,VQ8 t8D$ L$rQPhZ% RQh% \Rh=%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVPAY L$  uhj/ËD$CNC KFCF CCj.L$vQP Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RKGTD$0Pj  $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh hz%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHTGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$h %|$$HL$Xpx jP$P D$<t$h[%|$rst$h$%$p΁Vt$ hȕ%t$$$x|$D$ƀt$h9%B1|$t +D$(t$( 4XPjQ Vt$D$`PN \$Zt$hB%t$ H $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$hӖ%U|$$t$L$U@AH|$u D$&D$6D$t0t$ t$tC FPjTt.t+@JAH *RWPӥ tF F^_[h7%^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Shw%BL$jQGE u h%蘵$BHJAWhjjʫG PhG%˴WhW iSh%Yjt7UhbjP@h%ha%)h%ݴd^_[]USWV׉΋A1PUSmFVUSWt!NtHNVJFxUUt$PQt$PtQP P9vL,V#^_[]USWV8|$L_OTȃ GTGPtTk GX$PUhU% t#@uUh-%dz S0AC $1E9^t 6u(Fxt1ɋPT8t9tʋхut4$h%豲j봋4$VUhҏ%β WjEu! 81t 8t h[%L$o@G WQSRPU\tDD$GTՃGTD$ j.PUj% t'OQPh$}%j.V hn%x)h  WhSPjɨ8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW F uFTt|$tF$61^_[]USWV΋yx1t>1COTШu* uG@jPw OTt OT tY?uŋFuha%PSha%P=t-u~`?w#F0phF Ph%茰^_[]jt$ZUSWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPhȘ%h b%蕰 jSWH@ tD$ SVk hȘ%Ip^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhژ% PU^"D$C,9r|$t"w 7hژ% PW(",Nu^_[]WVt$ tqwgVhλj#1GGG G XGft^_# Vh$%he# ^_ËD$@|tHT(tuðUSWVD$1t(x|t!\$l$SUW u?u^_[]USWVD$t81t9\$l$tp|tSUV轾 u6u1^_[]1USWV$.FX|$ j.WUj}! \$wWh%%$$tXjVWa ÅFD$Pjt$ L$QƋ ulp|$NjSWڝ tL$9uPWVA t0 D$ PSh%ˬ ^_[]h%?jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh0%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Shv%覫$ WShP%7 F PSh%x t){4t#D$} t*tu Vh% Vh}%4jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E#%f'9t Qf9Au<< <\$H $'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%D D$ PD$p Vhӛ%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPhi%D$`$T$B"pF L$ QPh"% 1Br&$F  $QL$$QPhݜ%躦<$tD$x%$l$ |$$ PD$$PVh?%3D$w詻 1L$ T$t$QPR SWVPjh0j膨 1NtKljjSj hP藥t $jSjj)W{t Wy7^_[WV jh0j ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQWƾD$jPV t?jWj$j)V迤t"$jWh@hV蝤u%hڙ%>V6 hڙ%)1N ^_SWV\$|$1tD$Ȅ'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP!jjW豮 t W G Ph%WhWW軼 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh%P莡 E]1@EEE,E ]$z t(Vh6j j膙Wh)%he#^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$ 'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShljP舔hd%ha%d$1ۋ6<$tD$D$$t;F SPh%n D$$hPS6F&Chd%֠Jh}%853=u1HL$$hQP0 Ã37@$:VL$QRP% \$\$TSj!jU D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph6%T$E|$wD藏S GDtL$$SQPc _Hbh%dߋ$t|1QhQP.T$R6$\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph|%he#֞ FD$ u9H|t;APt"ftftATu y  Љe^_[]1ɉH1BPP@ H~ WhƢ%ot/[Vhij j{1Wh%he# vF Ph%*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPcE <$L$ V謠txEtptk8] 1ɉHH@H HH$7Eg%$P6'"11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t&%tPVELPu4 u<Udž6ttFtu7@t'P輏,dž ^_[]à Vh,%he#yL$1jSWV|$WhWjtxWhSޑWhiSǑWhS谑WhS虑ws^_[SWVt${Du ?~ Wh?%P芘 1@1ɉKCCS(C|S KtHT sHTit xti^_[Wh]%he# ^_[ønL$xtiBL$4SWV|$t$_u~GPux{ ur 6ugtXuG@Psmt3O WhGjP_uh %ha%?t|t$WPV>^_[D$T$J P&)USWV$1@|$D{l$Hwޭ C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1W_C,$;lrD$Vh%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1H膫 t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s  1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$'芪   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUP D$Ãx3 t 11A9r1Ë71$1 $ 'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHTu= r x t1:t,@Ptftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph5%91l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N ](H ](H ](H ](|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%賐 D$P4 uOt$ pffBfBpɋ<$tXQlR4 ڃ p7t$ffBfB<$tD$WVPR~ ڃ L$t3D$fffBt$tVWRω~ ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQP:~ |$ ߃L$I|.,$YT ry t$>APtftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUPfs D=l$_D$ fǀ<T 1fw ')h@%1R|$Qh,%j W蔵 D$l$ f9<t1}~ QWhT%Pt$sf<躘 fu.Whi%](Ex](Et](Ep](El6tjzD$0^_[]USWV΃|$$w Vh%Z1H׋# 1ۉt$$S1ItU $]h]d]`\$,Džu\$Sj貒ƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh %&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%2k(UPh%Ɓ ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vhğ%Ԁ},WVhޟ%h ^_[]V΋Qhijw1ɉHH@@ @ @$t 4^D Vh%he#ʀ ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHthj%VdP6jVjjw-wx9Dth0%Vu Vh9%^_É1jVUSWVX։ϋtu'C|t@Tu1ɀ@ƃ@L$tG uVPh%Qj}10%8WjjuD$$Pj<$w$X'8uJԠ%=ǃ8.%8u+G%8uN%8u ۠%8{`G D${|t`t$ްGTu3N`W u u1!1t9wGXPt$ h%L~ ؋?ut$u {`<$uhs`t$ h%~ 1CdC`<$ty sHsDhV7*uVh%y~|t7OTШ u( uG@jPw OTt OT t^?8|$W>704rtujape^_[]Ë<$G Ph%cx5Ch]Ph%t$v USWVd|$xw词 1HD$8L$D$ @|tHTxHTD$,D$`D$ D$D$D$,Bf9A)fftftf  $9v% t$hB%wT$BUD$PD$(Pf L$8,t (1f9Zu2;t$ t A9u19uAuD$7@u.j D$\PjD$,P Pt$ hZ%v T$Qfua1D$(D$$t$$)L$1UVT$u D$ ƀ>1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`PWt$|t$,t$,Pt$h{%dv:fD$D$D$PjUVD$0T$4)̓w!" t$hǞ%-vfjPD$DPd D$LȉD$LD$PȋL$LD$P9v)Պ t$Pt$Pt$h%ul$4D$h|tjD$@PU upmjhD$DPt$蘋ǀfD$ $BE0JM,E(EL$E(ETuET$%ETBE<JM8E4L$LM$E T$P9t MTU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%s t$h.%t|$ɋD$,u ȃd^_[]USWV|$_T؃ GTGPtG OXQPhU%s wE tu{E|1ۅt5HT(tgGPt ftftGTu tǍF Ph %rt}u^_[]8V6R*^_[]SWV΋y Wh%%r 1CCCC CC$t^_[WhK%he#r ^_[Vt$F Ph^%r1B^L$Vt$?N Qh %PJp 1B^jL$4WVt'׉΃|jt$RPt j6e^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV荇t:ǀL/艈L/f$HC;,T^_[]SWVt$Vhjg1CC C XCC~ ;u Whc%p Wh%[pt^_[Wh%he#{p ^_[ËL$Vt$Vhj gF Ph%Wp1B^hVt$?N Qh;%Pn 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPhq%h b%vo tjS0 tD$ WSV hq%o`^_[]ËL$[aVt$?N Qh%Pl Vh[jwe1^L$L$@h%P1|$L$8jQj*j)5 "<`u hx%!<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5 "<_y h%Q!<t+DŽ$j$Pj&j)5 "<_uK1ۃ|$$&3D$,tD$t3S?8"<uh%h˦%ƣ!:!:|$$tF1FFFFF  F)F.N,!:!:9rF t$ƃ|$t.t$L$Aut$h%+&3D$,|$,tF)F/&3F !<@;DŽ$jjj  y h%!< "<!<"<!<"<!<"<!<f!<'u"<!<|$tjt$ j.j)V]=&3ujh!<V yPh%UPh&3Pj)V]uY=&3tjh&3j j)V]thh%$Ph!<V3 yh%h)%hF%VXD$ &3 | h%聡$jPhh5 "<\t$8jVj$j)5 "<\y h% jVj%j)5 "<\y h% !<H H r8r &30 s~|9~ h%蘠t$jVhh5 "<\y hϧ%jVhh5 "<[h%d8 &3PQh6%N !<Ѓ1۹B<PSSQVRh!<=]B<t"QhQ% !<ЃPSSPVPh"<\t"Vt$0tWNuVjm Vjm 1<"<@"<L$?V1FhL63Vhh%C V讅 USWVX !<T"<t91ɉ !: !:1GH T"< "<d"<f !< r+rm ]1sq!:!:Y!:!: "<!:"<!:"<!:"<!: !:!: t1!: 4"<0"<!: !:f!: &3Uf!: ("<ff !:f!:=$"<u"t$@jV$ ȣ!:Fȣ!: &3!:"<!:1L$@A A!:Y !:!:Ph!:5 "<M ƅx9t&y h%2 VS5"<hb%] !<uWh&3Wa P"<x"<L"<t"<H"<p"<\"<X"< u2ءP"<`"<L"<\"<H"<X"< P؉+H"<5L"<D$8t$`$蘁 t$ wg$\'h&%L D$$f |"<L$A |"<ȉπ1@"<"<D$|"<ɀ?$'F}|$ $'h%"<"<"<"<&3v&3h"<D$vh"<ȉL$|$fD$1@L$|$("<L$ωs"< |"<L$L$ |$("<L$ǡ!<=L$|$(ݜ$ЃB<P1PPhWjRNt"t$|W|$Wh% t$hک% !<1$@$T$P$L$H$DfDŽ$@\$K $XK $HN KN SVЃB<PWWhVj$XPJMt"Vh% t$|$\$,=$"<u ݄$\$$%~ D$D$(t h%~ D$|1|$ ;|$Dw|$D|$x !:8j@9uD$ g Ȉ"<|$!<t$ЃB<P1PPhVjRaLt"VWh>`$)~ t$Ffff9fDfPh1% 1@Ph&3P:Ph,`$h3% h>% hM% h]%w h%m hk%c h%Y h%O h%jj.$Wt$|jҽuj.h"W Wh%0} j.Wt$,j蟽uj.h"W[ Wh%"hͬ%| hX#| Nf%fw 'P| !<GNju j.$Pt$ j]h%<hU%W| hX#J| Nf%fw 'P$| !<F hK%Ffff=fht%fPhD%FffQPhW%{ sFPh\%{ L$$T$ /Ftc|$ umh%h%K{ Fz$'h%t$Ɖt$ t$QRPh% { hx_$Phu%`4'h"z !<F<<%h%z !<tF%s%Ptz K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( <=3D$0LA $sC%PQx F9uEPh%x h% h̫%h%x |$ FPh%x 6Ph5%rx |$ "h%h% h\$h]$JL$$ 'j.$Pt$ j虸F$Q4ԇ'h %Th'%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"PM $@D$@|$ PhOA#hcE%Sw t$ 9|$ohA%h4%,w D$$$T$ $@WjWh b$NM&Pv Ft h%v 53H 53~53H 53 h53j | )L$|$$t1 q΃j.PL$Qjöuj.h"$Px  $PhD%v |$u"tVh,%u  h %u 53H 53~53H 53 h53j { t$GNjL$+{h%莪ihm/$u !<t$Nho$au Ntu%NM&P=u 1L$1΄u j,l USWVA SPQh%l D$L$ l$PQUjSV%D$t'8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5F<t$PV;hD$$HL$L$ 1x1PPPW3 jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$+ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$'_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$F<D$PVPX] L$@D$D$ 1 G|$<$D$=(&3$TD$j=h &|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=h &S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ "+Hj=h &P Ņt$,]VG 04$Q"DG 0D$e F<u95<=3DN@u:t#t F<|\F<F<0F<#$F<1Kc$t\u'V5F<Ƌu F<u $D΀:tDME@A @Q9 F<#F<1F<F<1KE:EE<$1t:t |tL@DD$T$$jPjW-Ãw2F<tP8 F<F<1F<F<CJQPT8 1F<F<&F<1ۈF<F<F<1F<F<؁^_[]À|\u F<nF<bUSWVPj=t$ t$ Xjd IƉ$d]Q\um_:ډـ0u`_1ɽҍ ʃЅtdSCրE0tU^u-O:6:G"a$M7þw>$'߈FHGNm&Þw$':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4@ "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H @ dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=F<u t11jNtF<1F<F<t Pip1@h^#hD%_ F<1USWV1=F<MT$ l$(L$DžD$5F<hhF<m  |$t$"j hF< D$F<h"VGfF<tUPD0 uTWV&fF<WVft7j L$QPf x#L$9uF<;D$ D$uL$us F<8 F<APQ~ PQ4  F< tuQhhF<l  |$uF<1^_[]F<J<J<1Ҋ+~,u"1t$L$t' t" t΅tAL$=M<uM< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=F<u#F<F<tP1 F<t F<1^F<F<tP1 F<VtJT$1Aj<ƃ=F<u#F<F<tPy1 F<t F<1^t F<t D$F<1@1USWV D$,L$(l$$~ )$1H$`t F<1A\$9|ωL$ tgp9tX tt$ P8- t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$F<F<tPX0 F<D$,L$$ ^_[]f11f11Ã=M<u /t(M<11hh(N<PjNtM<1,R<M<t Pk1@h^#hO% [ M<1USWVT$1=,R<+\$0L$ D$D$|$(D$5M<t$8Sh l$,D$ D$D$t$j S \$1 h"VaE|$tt$(P~+ u~"WV[aEWVNat^j L$QPa xJL$9uAE;D$ D$<u/h"V atj L$QPa x L$9t[ M<8 M<APQ~ PQ/  M< tuQt$8Sg E h#V`Eth#Vk`wh#VU`ah"V?`EHh"V&`E /h"V `E$j:t$ $ 1@|$ u,R<1^_[]WV=M<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh(N<hM<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=(R<u+,R<M<tPL$, L$M<D$$tˉ01C؃^_[,R<M<tPJ, M<PPhh(N<hM<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=(R<u+,R<M<tPL$+ L$M<D$$tˉ01C؃^_[t (R<t D$(R<1@1fUSWV\$l$t$V PVWƯ Um PUW貯 SY PSW螯 t$ VA PVW膯 ^_[]WV t$uRt>DžtA=2R<t ^_Épxj Ph U" ؀=0R<u1F1=1R<t 5 1맋5,&33 OA#QQhb%Pփp1 USWV1ۀ=@R<t ؁^_[]4 D$ |$GSSPh4R<jW u 4R< DR< HR<r1HLR<OA#1ۃt2u3hWhX%K D5t%ƍC!t2)É$)t*R<L$ R<$)PD$p xPhR<[=RR<=TR<WjD$hpj Ph U" 5,&3* OA#QQh%5,&3* OA#QQhȱ%Pփ( 111{PZDWhV ( ESWV 1L$ |$ ru\95R<s(>tGǀ=RR<u.;=R<rN;=R<rD8R< DžtVjWn' =1R<t^+ 1ހ=2R<t& ^_[À=0R<u1Ffu]pxj Ph U"襧 뺋5,&3E) OA#QQh%Pփ.' NUSWV|$4t$0Ë R<9s&|R<9 8Ս1ʅ/tR<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95R<95R<H_ŋ |R<!9r؅ XR<9s9s_HR< 8!9t.M9wI9rEpR<8! 4&3!9u!=RR<=TR<8R<Rf ʼn9rPVU  8!!ōD$p R<PVL$D$PVt$8R<Pt$jUVthŋ$L$Ai QhR<=RR<=TR<u=1R<( 1=2R<tM^_[]t$hR<O=0R<1GDu3t몍D$0xhj Ph U"n 5,&3& OA#QQh*%Pփ# 9U7)SjZP)MPjSs# :9/ $)QjZP)PjS@# tƉ111USWVˡ|R<!9ta)‹ LR<h t u9=,$)<l u=RR<OE$)ÍFu\wl'xD$X R<PWPW=RR<N VR<5R<w(' w'1É;GsG1B TGHO;Mu9}tAtDEWPC5u%E9tt9sMxt MPQ[}-E $ut=RR<tGV^_[]ÃWU VjZSf! vjZv Q! VjZS@! V t$=2R<tt ^É01ɉHHj Ph U"衡 ҋL$SWVȋ|R<!9t+)֋ LR<| u 9t%)D @A QhR<@D^_[USWV=SR<t^_[]þOA#VVVh%,&3Vh"#hz"hϲ%,&3##=PR<u#%=RR<uD0&?#=QR<uL[&RQPh۲%,&3V&=2R<u%G"=0R<u#*%=1R<u,$%=TR<u$VRQP,&3,&3$ 4R<|$gfff̉ҍ4މ劄1D#GO wһOA#"#SUWh%T$t$|$f4SUWh%,&3,&3$ lR<Ggfff̉ҍ<߉劄9D#FN whOA#h"#Vh%T$,&3$ XR<|$gfff̉ҍ4މ劄1D#GO whOA#h"#Wh%T$,&3$ xR<|$gfff̉ҍ4މ劄1D#GO wҸOA#PPWh0%T$,&3$ 0&3|$gfff̉ҍ4މ劄1D#GO wҾOA#Vh#Wh=%T$VVVhB%,&3USWV΃=R<tPt |R<3!1PLǡxR< |R<!)ȉ9r1UKR<9tEuótP-HR<!1PPjhjUPy t(R<tR<=R<=R<-R<1ۉ^_[]V΃?R< ; R<v$1uR<Ɖ R<^USWVPdR<`R<hR< 0trƃh'PpF,=DR<=`R<4$t|n011FEEh'P7ـEEC`R<(9r:5,&33 OA#QQh%Pփ=PR<8R<11dR<9s[ $,0EEh'Ps+`R<ClR<]ǡdR<`R<(9rhR<9$sj,Ѓ0EEh'P@XR< `R<s dR<)ÉE;ǡdR<`R<hR<(9r$^_[] L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡDR<D$R<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9\R<s$5HR<!։Ņ9tR<v6J Љ  ȉ  F1r{@p9XR<sBJ Љ  ȉ  FdR<`R< 8&3u%1I#5pR<!֡`R< 4&3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPUv tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=RR<t=TR<uVj1^_[]VhU{ USWV5|R<1!-R<t ER<1-R<E@;R<v@uW-R<E@R<tE3t,ÉE uUhR<=RR<t"=TR<t!R<E-R<^_[]VhVjS USWVΊ LR<T$ T$FD$t$V$D$9Btr$u$…R<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$SN~VSSD$x,t @,KZ xR<tjNjD$G GR< R<)ʉWOT1Nt TtWt$ -R<T$ LR<^_[]1USWVȋ5|R<!) LR<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡxR<94$1PPhR< Åk jSR<W SWR<R<;-R<r ;-R<1WWjhj\$SUҕ t\tV9tRSP; uE j@\$S0 -,&3b h"#Sha%PՃ=PR<1lj1xR<4$9v(R< 1QQjPjVQ4 @wg1=R<jAAŋ5|R<!Ɖ)tP AR<9tut݉<$/R<u1]4$D$x PhR<tA<$R<C 9r09$v+jSVG SV[R<R<uɉD^_[]& V4R< 8R<r!1F<u. 8R<4R<F9r^USWVP $1N=|R<1!׉) LR<D$)ot +t=QR<;R<v|u+HL)͉ll+;R<s| ullD +lD;G,$vuWVZDGWV;_s_u.G WP+=QR<u.M,t xR<-},^_[]jPR 5xR<^_[]USWV@׉9 R<95R<j?;R<u >9uP>;R<FjWV" *1ۡR<t  R<8R<H@; R<v@jR<H@ R< 3H xR<HPhR<PxR<9rWV藑 u=J j@S0 -,&3 h"#Sha%PՃ=PR<9=xR<u]R<t  R<6R<H@; R<v@u,R<H@ R<t=xR<p xPhR<@^_[]9R<u)R<R< f<&3ø<&3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á:3D$t$PAWVL$T$ ‹q~y ;q~ t 1~9 QP4 ^_D$ <=3DAD$ <=3DAD$ <=3DA%D$ <=3DAD$ <=3DAD$ <=3DAD$ <=3DAD$ <=3DA%D$ <=3DA D$ <=3DA@D$ <=3DA%D$ <=3DA%D$ <=3DA@WV1F|$ 4'Wz tF u1^_ËD$t w$'1ËL$1t9t1ҍB|uËL$1t# t|$t<=3LH1H rËD$t <=3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 4=3DAD$ 0=3DAWVD$ OA#OA#tƀ>tD%_ 0PWVh7Q&hL63. ^_Ð1|$w L$t9tøt&3f|$3#tOA#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$ڳ%9 Ē(v,=3fL$%9 j(vD03føÃD$L$L$ L$D$Vt$ t$VhL632 h/b"V't"* 0kPh b$hL63`- L63Vj =Vg ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP% td 0 [ 1$^ÐWV|$ W4X' tFu1 ^_D$ftL$Q'1USWV$п$$ u Vp  X)jL) ŁTUUrP$@@D$0jPD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#c24$(|111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$R<L$L$ tU|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFFR<R<C><% ^q{t|~F~F ;^r~uFR<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFR<F^9րրw t$rI{i9s <$=<=3]D_\,<$t~uF FR<R<Au~uF R<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A<=3IDJt"m9~~uF R<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF R<F"{u@9s <=3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup <=3DAu f'tf`uW~F=@9t8}@u~uF ~uF R<FЉL<$USWV t$ ^h.\u/;nr~uFFR<R<EMŁ'$~]$З'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFR<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFR<FωωD$$xt~uF R<.n~EFx <=3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2<=3 DJt"r 9~~uF R<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF R<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFR<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj4=3TXL$21@u"0=3TXL$1t$1ɅtT$T$1=:3E9Efl$0|$L$=щE pX D$ t8(;|$w,7"1T$39u!E HD$8uR<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 <=3LAtx 0=3u4=3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ艓 F^_[USWV1y19sC11-<=3D]t#=k)CB9u1Bt=|yuA R<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$,')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FR<FUSWV\$1=:39v1@(ϋF,@jPv(n t|F(N,QV,fH~<t}4=3Dh :31҃9v1B :30=3Dh1҃9v)1BuG R<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFR<R<R<^_Ã~uFR<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFR<F1^_[]É؉D$%`'t$t$U u U苡 t/uՃt~uFG롋$USWV 1=:39v413A8 $A,tI 4=3L$ 0=3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ_ o^_[]SWV1G9Qs7ӉjRq( tF^~uF R<F1^_[USWVP1N׉$1+t{`tswsK$x'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=:3|$ r3GtD$WT$ou]t$St |$Qo ]GtD$wt$wt$wS1 |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$45 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ S ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf <=3>|$u l$`\$\z <=3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" <=3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA <=3D$¿!DQf_֋D$ !DAf|$$_8tV|$u<=3L$ DHuf|$$_u3|$u<=3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ . ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf <=3>|$u l$`\$\z <=3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" <=3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA <=3D$¿!DQf_֋D$ !DAf|$$_8tV|$u<=3L$ DHuf|$$_u3|$u<=3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V5V @wj/Vo 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh%jPhS<XS<ø%Vt$1Ʌ1t э^fffffUSWV$[(D$1dD$V׃1diՉƃut" $4,rƃu$UVjjy8 |$09NjL$4sD$D$8T$<UVt$Dt$D;8 L$D|$ t$ 1Ҹ$|$(RPQt$ 8 |$@tjjdUVD$7 ƉRPUt$ 7 D$ T$D$L$ |$֋$)&URt$T$2WQPt$HD$HPմ$RPQt$8W轴^_[]SWV[ö$$u^Jw $OhPVxL u=uk+ W&hPV L OhPQ L t&hPQK OhPQK e&hPQK hPQK 5&hPQyK PhPQbK &hPQ>K ,hPQ'K &hPQK PhPQJ t.&hPQJ &hPQJ P:? Ą^_[USWV[HD$$L$ ttD$D$&D$UPVlǾUD$P5DžID$8t۱|$;D$ T$$75PPW E&PW  PPW΅ &PW超 t&PW袅 |$D$ tHOPWi &PWQ OPW9 i&PW! t'PW |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [u$ @$ $ ,19r 胼$ t+$ $$ FhPWD $D$ D$jD$$ xfD$4D$dz /$$ AfAfIƝQPRhWJ]t$ VPj $D$ $P!1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VYhPWZC j:W/a D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPzt Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK D$ $t1L$ L9s ዄ$ @<C<L$|I't$tjhQPR*D$4 ]qPh$PV$$9s|$$$9s$$[1 $L9s D$HL$H P 'RQt$ Ph$PW$$9sD$4]qPh$P${$_9sD$hI$/9s狄$ @]PQh$Pb$$9s獃k4t$Ph$P $$ o9sD$ tW]QPh$P袦$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ Eu$$$9sD$dL$HL$P(L$pRt$t$t$$h$PDD$L$HL$HL$HL$,HL$(HL$$H @ 'T$0PQt$,t$4t$8 -* 9u8jjs t< P 1 4 0ǃ8 Wǃƃ< t 01^_[ÐUSWV[E$01< uut!j/VQ uS< tƅu} ƍ|$ )VPQhWʛ=r9 ?h@VǍD$ jPWC ~ D$$WJtLD, L$Pjhjjj QD$(Pa Ƌ<$t'Vu D$8 t~ 8 ~ L$^_[]ÐSWV[< usP66ƃ< $tj/V0P uA| Ɖ獃 )VPQhWt=r} ?t"< VPo tEFu7hh%@V < hVP1 Q' 8 jjp t=jjje !ƒt" 8 Pq? 1u} 0} 0^_[| 8#uVt׉| ƐS[N>[ÐS[.t$[ÐUSWV[u }Z| D$<$L| t$u$$D$Put=k<T$JL$|D$x$L$x$PQU$$$Pt$_UlH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$81DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$y D$@j PW% y 8)L$@DŽ$DŽ$DŽ$F w $$1۸ t1D$$$$L$$L$у uӉD$ t$l3$ $$$L$D$hD$dD$`D$\D$XL$L$@L$L$D$L$tL$xL$l$L$pt\$$3t$ \$HD$D$LL$PD$D$TTL$ \$$D$p5L$t u31t$l$t؉‰T$`D$@PRtD$`$u D$@PjyRƉ!Ѓt0<D$pkL$t<ω|$ltvu 8t#D$;D$TuGD$ ;D$Pu=D$9D$Lu3D$$;D$Hu)D$9D$DuD$9D$@u!ЃD$u4$ u 8D$$t 8 $$#$1-7Gƒ|$ ;$|$t։\$$T$L$bt L$T$wD$ T$L$$PD$PM$D$$鋜$ȹʉ)9D$ D$$@YT$ ΋$jj VT$R(d ˁl$11 qRt$ )։$1҃u?ƃu4i)\P(\wi)\P1= ף‹$sD#9$~$s $POÉ!Ѓ1D$L$L$4D$0t$,\$($t$@VD$4PFLD$HD$ VD$,P(L\$ ؿ*4RL$H)|$(+|$0t$,t$4R)i_11\$x$ r T$q \$L$T$8>T$\$!L$몉\$ $q \$ 8u$$>$0։mq D$|D$$D$$D$$$D$ t$t$|$|$$L$PQJ|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR^ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6P jjdRPWPGLjh'v6P W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJAt!G t7t9uӾ^_[]ÐUSWV[Û^Gt@#l$#t$P@t!G t7t9uӾ^_[]ÐUSWV[+^Gt@#l$#t$P^@t!G t7t9uӾ^_[]ÐUSWV[ø]t$0t$,Ǎ&VP‰t$D$(%D$1틃<$D$l$ @tn|$$RP?tG tD/t;L$uЃt+D$ t$jb…<$D$uNt$0t><$9tR PUW >&t1<$W(^_[]fffffffUSWV[k\t$D$hEt'1PV>t'D=u狋19u$VPjD$@ 8^_[]ÐUSWV[[|$ D$hEt$1PW!>t'D5u狋9^_[]ËD$@ ,0tMK D$jPUR $D$18tXK $r!"u%%9u4C"tt$:]4UWPjу$E$WPjSV[ýZt$ v&v &V&^[ÐUSWV[xZD$,8tD$,1퐐8@uj0JƋ|$(WF$$jUF D$ D$,F>&D$Pt$O1}nu1ɀ}ouL$D$j=U$ tǃ|$D$,t1PU;tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8!8t 4$j$Va$1^_[]Í$UPjfffffffUSWV[õX$4$,I 04jPU uj:U 4jPU] tKt$}/3t$UhV( jVPU" Pt$UD$PB|$ $jjWjjVP mt$ jjWPjV t$/PD$PVǍ0JD$t$jDžjt$W uj$4$4jWtƍD$Phzd@V/ VD$(Pt$09 u5P$0>r$0VPW= FD$ GL$ $jjQPjR tqVUW RF 09$0XF 04kF 8uj/U&1Ńt$ $0UW jF 04QPW 111EF 09$0P$4Y 11,$j$4V$4WjU0PNPW~`t$t8HPQY&E 04$0P$4 1,$D$P U }E 0^_[]Í5,$UPVWa1KE (xWP$8$8aVfffffffS[ÛTD$D$ $L$T$jjPQjR yD$[fffffS[;TD$D$ >$L$T$jjPQjR yD$[ÐS[SD$D$ ?$L$T$jjPQjR1 yD$[ÐS[{S$L$.5jjPQRyD$[fffffY/ST$uÐS[Rt$XSWV[R|$Wt$t$_ 9r!C ?@5WVPj^_[ÐSWV[ÌR|$Wt$t$ 9rB ?r5WVPj^_[ÐSV[=Rt$ ƅu5Pj^[ÐSV[Qt$t$5ƅu5Pj^[ÐSWV[üQ|$W ƅtu5WPj ^_[ÐUSWV[{Ql$|$UWƅttu5UWPj^_[]ÐSWV[,Q|$Wt$ƅtu5WPj ^_[ÐUSWV[Pl$|$UWt$ tA 06UWPj^_[]ÐSWV[ÌP|$t$Waƅu=6WPj ^_[ÐSVP[LPD$L$T$$RQPʒ ƃuN6Pj^[ÐSV[Ot$t$t$聒 ƃuN6Pj^[USWVP[úOPt$0t$0t$0t$0t$0jt$4# Ɖ׋,$t1? (c6t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[:OPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1j? (6t$,t$,t$,t$,t$,t$,Pj ^_[]fXNL$"wÍ[ffffffUSWVDXND$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjjZ~D$$<$|$ D$81$|$ <,PL$4$GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$PjjR $~D$$|$ $1\$4WRD$$Pjj}R $ˋ\$4VRD$$PjjTR1Ʌl$<릋\$4WRD$$Pjj/R~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjOD$$u|$0L$$tB;L$s5T$ >#\$4:3 L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[ÎAjt$t$t$t$t$[fS[^AL$T$ Pt$t$t$[ÐUSWV[A|$$t$|$0t$(aD$ j/UJ ,$t|UPt$ WVt$8IuU 1 8uF1t$ t$Pt$t$@t$2t$t$t$t$0[ÐUSWV0[2|$Dt$Lt$LW , l$Tt$PGO $)9ŋG|$ |$uƋD$ L$|$D~94$l$RPVWlj_\|$Tl$uPt$W]+ Wu10^_[]SWV[1D$taH8|$tFH8<1@:u8t@Qj<< H8 H81^_[þD$t@:$ðfffffffSV[}08t Pt㋋QXQP)& |t.PT$<06躹^[Í17Pj5fffS[/D$ ~ L$u [ËPQ2  [ÐS[Þ/D$~ L$ u [PQt$ [ÐS[^/jt$ 0 [ÐS[./jt$t$t [ÐSV[.0t$t$V( tD$~ L$u  PQV ^[ÐSV[Ý.t$ t$t$V( tD$~ L$u  PQV ^[ÐSV[=.0t$t$V<( tjt$Vh ^[ÐSV[-t$ t$t$V' tjt$V ^[ÐUSWV [Ø-t$4@|$'t$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[&$\$Xt$QPX%$ % $$`t$PR&$  $t$PRԁ&$  $$dt$PR萁&$  $$l$htD$xPRH |$x  T$xtD$PPR |$P  T$P$t$ptD$(PRЀ |$(  T$(tPR蜀  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[Õ$$U$tvu $ 󥋬$$tvu $X tu[t$ $ 󥋬$$tvu $0 tut$ $ 󥋴$tvu $ 󥋬$$tvhu $ tu<t |$h |$h 󥋔$$E@mHt ։t |$$$$Xt t |$0$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XgD$D$L$$$\$`l$(D$@D$ D$ D$HT$8B$L$D$4Qx$h,1T$L$,؋ $LIfDL$9$D@4dL$$LD t;hPu$h,$D@D T$v$D@L$fH|$p1j $LII HLIA 9t$ u‹T$$D@ʍ f|$yS4OD0 0L0Rw|y G, $@fD0f|0$vxt$(Sx‹O,$L$@t$)֍ L~;|$ _L$LJ<LJ^LJvLJ#LJ:LJ'LJ#LJ#LJ#LJ-LJ-LJ_LJ|LJoLJ-LJ-LJ<LJ>LJ*LJ!LJf2Htc$t7tjtgx,܋$t`vQjPR 1 LpLLtLLxL L|=u׃^_[]ÐVZ>1L$tp4ttttxtt|t =u^ÐUSWV [j+%7D7D7(ujjQP u[Pjj3QP|$ej>j<j^jvv8j#fj:V0j'Fj#6 j#&Hj#pj-j-`j_j|jojpjrjyjzj{v@j|fhj}VLJ!ǀ+LJ!ǀ,LJ!ǀ-LJ8!ǀ.LJ%ǀ0LJ%ǀ`LJ0%ǀaLJǀfLJ ǀgLJH%ǀhLJp&ǀiLJ%ǀjLJ%ǀkLJ %ǀlLJ%ǀmLJ8<%ǀnLJ%ǀqLJ`#ǀoLJ#ǀsLJ(%ǀtLJP$%ǀuLJx4%ǀvLJ,%ǀwLJ%ǀxLJǀ~LJ#ǀpLJ#ǀrLJd"ǀyLJe"ǀzLJ@ǀ{LJh`"ǀ|LJǀ}D$ $2Nt_t5l$ t!zx|LՋt`T$ rQjPV$p1L$$l$<4( L$ |(t( L$LPu ^_[]ÐUSWVPXzpL$ $1틘<+ $4)+(T)( ljPuЃ^_[]ffffXL$fǀH ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[þt$0[ÐUSWV@[È|$T|ED$G8$u!O9OuO9Ou @9u_uWEt W|$XE3t:<10[Eǀ3A@^_[]Ë3tUQ33DL$X@9tÉD$ D$D$ l$jjv@PUWUV'뒋@D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$WN$|$T3T/1j ‰PD$<x-.D$8|$AG $tJt PwWG W"G @t;{ 8u1E3t%<10UEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$uo*E2$t L$Xu$ L$Xt$AsiSV[-0t$t$V, tt$Vj^[ÐSV[t$ t$t$V tt$V^[ÐUSWVL$[Ô|$0|D$(T$ 2D$ED$4D$D$H f%tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃH ff:f)|$ t)`Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4H ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃH D$4Pjjj 4449)4L$ 4QWPt$u4;4}2Dž4t(D$4PVt$ t$, 1|$0fH 4)Ɖ4fǃH ff9t |$ u |$ t)`Q)R[* t$VeF @f|$tW&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fH lf1jD$` `4rփփ19‰4 4fH lfAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fH lf197Pjj!Q jS[^t$z[ffS[>|0t$ [ÐUSWV$[|$un2t PP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@([7PПtjjPo ,GTd7P覟tjjPE GX!2@@xGX GXO <W$< OT` @2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PD$$<$$u$P# HuǐuU裘 PiD$$鐐<$$u$}P賱 Huǐul$Ut$VVtUk$|$~"14觵;>|蒵V艵^_[ÐUSWV[lfhǤs$ DHDHDHDH uǀ2ǃ` ǃd ǃh 1IT<,$%j T<TV$2@%4tV =wlj<$hVt$ Vm V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í7P7jS[>0[ÐUSWV [|$ |EG8$u%O9OuO9Ou@9$uxW_/t Wr`@8tUEHAIL$WW9uOO 9L$u-O OQRt$ PHGGMIAG GAE3t4<10xEǀ3 ^_[]Ë3t*Q33t@8tVW~‹@D$89L$u G8W<ut#u%'t^1Ƀuk1g RG4$膘=u8 $A @11 $<x-D$8 $tQWtL$|$u $E t΃2t2u΅rhƋ $a U 8uE3 $tԋ<10vL$Eǀ3뤐SV[0t$t$V t V^[ÐSV[ýt$ t$t$V t Vr^[ÐSWVP[{$|t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[[T$|9D$P= 1rƋ2~F1퐐D$(jjmL$ )LOx9ul$T5t$j+T5TW 21^_[]ÐUSWVP$[u1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[|D$ 0>ƈ2L$ȉT$ D$lD$`D$D$t$#%fG d 9h D$f$t|$u!|$t'QL$)RW\ŃuRG @tGr 8u=D$ 3t.<10IrD$ ǀ3G @|$tmG  f` l Hȃ` d L$ fftVWQ=Vth l Hȃ` d 9` l Hȃ` d f9uL$ff АT$ftiLjfx_ɋ4f>t%fG t~t-` 19Ɖh ɋD$fD$DhhAh l Qʃʃ19h ` ɋD$f^_[]ýG @tB 8u8t$ 3t)<10oǀ3g 룸7Pjj Q賡 jSWV[|$WGƃuOG @tD] 8u:|3t)<102oǀ3^_[ÐUSWV[Û|tt$339}3AP3)t' 333343;33PQRPas 33t331^_[]ÐUSWV[|tt$339}3AP3Yt' 333343;33PQRPr 33t331^_[]ÐSP[$|tT$ 2Pjj $[ÐX| tT$QT`1øUSWV[vTAx43fTFT$Pj +f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhhdto DHDHDHDH uǀD$ FF^_[]ø7Pjj7,t7PjjQX jn7P讻jXffffS[î0[ÐUSWV[È|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ|uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[ 0t$t$V t VN^[ÐSV[t$ t$t$V t V^[ffSWV([É0Wt$<2WV0^_[ÐSWV([It$8Wt$@2WVd0^_[ÐSWV([ 0t$|3t @1[ÐS[|3t@1[ÐSV[ý|3t13tj2222a3d3ǁ222Pt3jP輚 ^[ÐSV[|3t13tj2222a3d3ǁ2Pt3jP ^[ÐSV[}8th|3tA3tG22o3Qt3jQ蒙 ^[ÐSV[|$ |3t13tw2|$t%22o3 22o3Pt3jPԘ ^[øSV[-8th|3t3tG22o3Qt3jQB ^[ÐSWV[Üt$6f 3t3G<88 r 3W73udž311WjPv^2H`vWjP2HvWjPF@:t2HvWj<Pdž3^_[ÐS[Þ[ÐX|3ÐS[^|0v1[ÐS[.|13t)PtЁ3QP. [ÐS[|13t+PtЁ3QjP, [ÐX|3u1Ês3ÐX_|3u1Êu3ÐX/|3tD$s31ÐX|3t L$u31ÐXL$|31fffffffSWV [ÉD$ D$D$$ t$VWj / XD$D$D$ $jWj. jjC0jVj.,^_[ÐUSWV[|13PtЁ3QPܖ  u j# ƃ ~:PjjԲ $; u jPj豲 1 <}t&jSEHjjQppGt@|tQjP Et"@:t@Qj8w @Uj[ @UjXE pX jjjp襚ǀ3Qt43PjQÒ ^_[]ÐUSWV[|3 uPjq  ƃ  uRD$D$D$ D$D$D$ L$PQj ǃ @HtȍL$Qhht@P tBL$t9D$t0<9 t ǁ39tǀ3<(8<$9hu9xt WUPgK 9hu9xt WUPJK Qt43PQ迓 It3PjW 脸6@$0d^_[]ÐS[ uPj蜭  ƃ [ÐS[޿ u j] ƃ [ÐSV[ê|@HtȉQhht@P# t!$tL$t< Hwtǀ3^[t$ЃS[  uO$D$D$D$ D$D$ PQj% ǃ [ÐS[Û ~:Pjj $; u jPjȭ 1 [ÐS[>|3t[ËPtЁ3QP9 [S[|Qt3PjQH [ÐS[Þ|Qt43PQ誐 [ÐS[^^[ffffffSV[=|$ tat@|$t|u7x1t-QjP |3p贅 1^[þfffffffUSWV[ëT$|2tt6ustRRt1u8]tRuAtRt'2PjR p ^_[]ÐSV[|2tt6uqt IIt1҅u8[t Iu?t It%2PjQ5 pH ^[fUSWVP[Zt$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,D$wJPj;[ø[ÐSWV[t$t@|$FX32@@TtPVWvX01^_[S[Þ|t3tt$P[ø[ÐS[^|t3tt$ t$ P? [ø[ÐS[|t3tt$Pc[ø[ÐS[޳|t3tt$ t$ P [ø[ÐS[Þ|t3tt$P[ø[ÐS[^|t&3tL$ t$Qt$P&[ø[ÐSV[ |0t\Ɔ43t)2Fpt9PVPV(3tP3oV^[ÐS[Î|t3tL$jQP [ø[ÐXO|1t T$~93|4 RDÐS[|t3t PWV[ø[ÐS[αD$t3t PV[ø[ÐS[Î|t3tPUtJ^[ø[ÐUSWV[K|0Ɔ43t)2FttrPVPV<a3tR3~>11;3}:tt3PpT^_[]ÐS[ÎT$|t$t$ [ÐUSWV[X93|$0t$,T$ $u[8MDH@utl$4D$ UX 鐐t$ D$PL$ QD$ P蜍x)t$tL$9D$)<9u AT$)RUHt( $4T$4R7D$0D71^_[]ÐS[|t3t P[ø[ÐUSWV[خ|8D$ $4VjPj趍tSʼnt$UyiƅtMD$ $t$UD$PVztT$t$$V Vy^_[]ÐUSWV[|$3t P 3~/11퐐440Gy0;3|4+y3ǃwwLJ3j0j&r4tW2Ht<@xX3~3JP<72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448'x0;3|4 x^_[]ÐUSWVXxt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([(4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$WR 1Ґ$t$V|$(WD$0P荇t$$ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V螕 $4D$)Džu |$ $tR1VT$ s 4$)tWj VU T$L$ (^_[]ÐUSWV`[x14t `΋43t42NzRЃPWVPVXhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WP PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP@y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P^D$T$3;4}D$PRjQD$PRjQxNj$D(PD$$L$ ;47&ffffUSWV[{|$$D$hjjUЇ t)ƃ|$t:L$tVD$ tNt*T$19tL$  11fVUl$ U芇 D^_[]USWV[˥|$$2t$踆Ƌl$r:D$0D$4uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E9tL$ ft M}Wt$Un 1^_[]ÐWVYmD$T$ t$w4  p@^_fffSWV[ t$VO~~tyы9uv0Cov,8o|9p9p 9pt PmnVn1^_[v4n9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29P6nffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[þ|$ uT$[ø[ÐS[Î|$uT$ L$[ø[ÐSWV[\|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVX|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u PWV7 ^_[USWV[e$AL$I,D$$|$@1 $D$HL$D$ $cUT$1 |$@T$ D$D$jD$Pt$t$D$$Pt$$)~"D$@PVUD$P|rxNjT$u$^_[]ÐUSWV[U$$AI,D$$|$<1 $$HL$ D$$pUT$1 |$<T$D$$D$$D$Pt$t$D$ P$$)~"D$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZnL$1~t$ ~|9J$u9r ^ÐUSWV[ËnD$|ǁ31~Kl$~C9A$u9i t9UP;Ƌ9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[MjT$L$ Aq D$t$jVPt$ ^[ÐUSWVXj$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$|t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[-hT$L$ Aq D$t$jVPt$ ^[ÐUSWV[gl$1t>|19)Rju uuu0tPU^_[]ÐUSWV$[Ègt$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV YS|$4t}\$\$$Pjt$,YT\$ D$L$ H HD$4;Hϋ@,L$4p F fFV }![  fN 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8QpQjP-ɋ$KdPjQQ f~$~gD$@u]D$(t$Fh2u&9u%$PD$805;\$6>v t6>vuD$@tt$ t$tNF$j=D$@$ $jP Ktdt$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ \$ uL$L$ T$9Q|$ $UjPa>\$ |$0t$t$$@$UjL/>\$ u]8V8 8PQhrR/ $7 USWV [(2D$41\$t$LL$H\$DT$@|$8 ,!H@!t0t ILtPjQ8 `@9t#NQP!P@#Vt;tH(t&tQjP7 H@t;tH8t&tQjPS7 H@t@TDt'tQjP 7 H@ t,@tQjP6 H@ t,@tQjP6 H@@t,@ tQjPp6 H@@fy,@tQjP?6 H@t,@tQjP 6 H@t)@4tQjP5 H@t)@tQjP5 H@ t)@tQjP~5 H@ @t)@tQjPP5 H@@t)@tQjP"5 H@t)@@tQjP4 H@t3Ht$LtQjP4 H@^_[]ffffS[(0[ÐUSWV [ø(T$  <9t #BH$$BrD1B|$9J~B,|$xD$G97u(ftO!; $u tN7fGG! $GWr|)tfG;|$r[fy벸jRpjjV! 1 ^_[]fffSVD$L$ ;u@Q;Pu8Pf3Qu+I P ÅǸ tttu t1^[Ått;uIRDžu ѐS[&D$ L$QPQfPQfPPq [ÐUSWV[ë&|$t$O tR1ȋHvDžtYujUtpG@v1ɉDžu1X1tRiQuG .1t(@yQlu^_[]SV[%D$ tpP,u^[ÐUSWVP[Ú%D$H~D$@1L$I$9}Z~L$I,$ i19}ƋM tyQuD$@Ń^_[]ffffffUSWVD$T$t/L$u+1t 1%t 1^_[]ÉӃ1 9t<1lj1D1ǁt%1ƐUSWVL$2T$119:lj1zlj1zlj1zlj1zlj1zlj1zlj1B؉ǁt %1z 5É1_É1_É1GÁt%11^_[]fffSV[ #D$ L$T$t$\ ` d h 1c1^[ÐSWV[ü"L$ D$T$t$|$\ ` d h 1^_[ÐUSWV $[e"\ 79|` \ d 9|$} <ANjh ʼnh șd t@ 8D$j ~RD$8t/@@tUjPP- j @@ltUjP!- 릋h ǃd <9|` Hh ` 9|[H` 9h }B\ 8ut@xhu ǃ\ $n\ <9` h t qNh9}uuJ` Bt>\ PQK t*NjD$9d t#W$~ 1ɋ$PjW+ ` h \ d ^_[]ËD$tL$ <;> MIIlttt$ jQx+ j D$uǃd USWV$T$ [Äl p d h tD$PBpL$ t$tIT$$\ t)ʋL$ ׉)}=)9hgʉt$T$ 9` 4t2t$ t$ )t)W` D$)1Ѝ /9L$|9l$\Pjt$* ǃh ǃd 11ҋD$8\ tlj)D$ >$D$8 $<t$u;` } t$Ћl$)$t$@@9 9<$\PjQ@) @xh H$L$T$ t$<ՉL$)4/L$T$ 9~L$T$ <$\Pjt$( ǃd D$h ;` ;T$ 9<$l tot j Pt_x)p @lt\QjP5( Fl t3t j P)_x)p j j }h h ǃd 1;` t $\l$*ǃd h ;` h @@ltWjPf' p yAl t`j t$L^xp )ȉp }u D$8o@@lU8 LQj pud ;\ t \"UjP& d ;\ ~Up  d @@xuăl tjWs]x)p j띍\h ;` ~-h @Uj& p yxD$8\ d )ȃ,$D$t D$4$jP% d D$(19 ș)Љփ<\ 9D$@ul t!j t$K\x)p j td Hlt htðuu냹tt u1ÐXt@ xÐUSWV,^ƸtAP8gXD\D$Alt huu =|$|L$h|$r]D|t$ $1V\^`fFd\$ ҋL$tPjR D$Aҋt$t1PjRq $p2< !A@D$Althu uT$l2ǀh2IyTt#2IITth2!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"}~ 1DŽp"DŽt";M|⋋7f0p"Qf0r"I0t"T$ 2D$&DD$$%9uҁ>ȃ^_[]USWVY |$xv|9{`|iT$t$p"fr"f1l2u@>_w-s y*f>2~w-s q*f ^_[]ÐUSWV[ L$|:9O\~~l$t$Ifrftt$ fvtR ztC2Rt0D$T$t$ VRPQW7QjP8 1^_[]ÐSWVZ\ L$x?|9J\~2D$t$|$ Irftf>vf1^_[S[ |A9t'D DŽp"DŽt"8tD1[ÐUSWV[{ T$L$|l2uI~w-ss*w!*ff ffffVF>t,D6f0p"f0r"DŽ0t"8tD1^_[]ÐX |h2ÐUSWVP[j t$8t<@@1|EHd9l2p"fx fr"yVtRt6<$PjRy $!A@Ep"f@dfx0ɋ2@Ql 4QjP( Er"Zfp"fx fr"yVtRt6<$PjR $!A@Ep"f@dfx0ɋ2@QQ3QjPo Er"]fx*ҋ2@R43QjP0 Efxd<#H@ H@^_[]ÐSWV[<|l2tu6t@t!|$QjP !G@f@d^_[ÐX|f@dffSWV[ìD$| yOQW~ ;O~ t Q WPW6^_[ÐSWV[<|$D$OQW~ ;O~ t Q WP8W^_[ÐSWV[|xWt$1W^_[ÐSWV[Ü|$Wt$WX^_[fffffffUSWVX[tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$@( $ș)l$T$ $L$$$D$wcx)ʋ=T$P;xl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H*D$g1fT$t$j .xŋ@0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ 軸T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K+Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K+Й~ ƃQWT$H ^_[]ÐSWV[ü|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(<jVjWP1^_[ÐS[>8jt$t$t$P1[ÐSV[8<jVjt$PF1^[fffffffSWVP[ë|$tt t9t QlQ $PjW t$F u @t  D @x^_[ÐUSWV[T$$ L$1tJ1ɈL$D$t>D$PқL$QjPWKL$N|$kK)l$kK) :;:i)@,PUt;y t0q$t~fuUviu1 q D,^_[]ÐUSWV[D$$L$t@1D$D$t>D$P诚L$QjPWnJL$kL|$kC)l$kC) ;; ;i? )h-PU~t7q tAy$t+nuUwIu Al-y^_[]USWV[øD$(L$1҄t@1D$D$t8>D$D$P莙L$QjPVMIl$-?L|$ ) i)ʼn) i)kN;{N;lj*SiŠ)Ǎp.PD$PDt1D$Ht.<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WPuVqEЃ^_[]ÐS[.t$ t$t$ [ÐUSWVH[t$\lD$PĩND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P 6ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U L$QjPUFL$ȿNt$kK)kK) :3:i)@,PU$D$$D,ED$j=U訯tƉH$$D$<$|$W L$QjPWEL$Ƚ-?Lt$) i)) i)KN;sN;Ɖ*SiŠ)ƍp.PWD$5tcL$f <$|$WOL$QjPWEL$ȽkLt$kC)kC) ;3 ;i? )h-PW"tD$Et.E!D$l-D1w $$D$}tPU%PU8PUx%PUu(PU]t8PUItr8PU5te8PU!tX'UPU u^O1<5.' D$UbNj$tPP 1L$;D$v==wL$L$Qt$˯L$uD$ 9D$ tf, UQC,$t'UW0|$BU4+1t$ 1 t]|$uf, FM $QP4$N  $LD=uVQV& $4D$ H^_[]1|$t4$M1USWV[h裣WT$L$ $L$81O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG +M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$茯 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]Ř2~:^^t@\|,$n*^ÍxЃs.ÉD$$8D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%8Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[=L$ T$D$$Pj [ÐUSWVX$1h ։ͅu4$ u'$h轛 5 @0t$E4}0u"$h腛E, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$<σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,_E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $xAȉىӉl$ |$uGD$1l$뀋$8DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $B$t"A$|t+H$D+$<1$uՋ$!1ڃV$TD!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,¡RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$P!P=D$π$O6\`D$TDl$H$th$V蛂9r‹E0M4ʃ9‰\$WE,y$H$|T$8t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,rE,u0M4tڍqu4 $@1$P$ $ 1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,辛tRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[mT$ D$$1Pj= [ÐS[>t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$ОÐUSWV[è|$(t$ l$uPƅ>l$$uj+hjL$tfjVP NjD$uj(PC/D$@ x |$(u`9VqE\1F489P1D$tGuP|$(9x |$(tF|$(m%9V|$(R9Phht@Uƫ t$t$tL$t RB(JОtR0PtjjPc IA(;PtjjPc IA1t^_[]Í8PjPku9VSVP[\T$L$D$tRQPVƋ$t P/^[fUSWV[ t$|$t$jt0ʼnV:UB|$T$V Ÿ9Pt$Pt$̳ts9Pt$赳tg9Pt$螳t[9Pt$至tO9Pt$puW21* @hTWta^_[]ÐUSWV T$L$[Í9P~Ņt'}/u~L$$ t$  4$9Pk~/PiPV^u4$UiDžjW_W)tsL$v u_D$ VP,tLT$ L$$ Pt$ ֚Vh'u! $91VB'9Pc}$|$ $~:s1퐐Nt:t됐tÍMwUPW  D, L$$ t$ [tuP|tG9T$ PQhR@~)T$ L$$ t$ $9t$ $:uw1퐐Ot:t됐tÍMwUPV  D, L$$ t$ [tu$ $ȁ ^_[]Í9䐐USWV[Hl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%n\$L$ A ZAthhP@+jj!4G(hhP|$ Gt\$h(jP|$ "\$jhސ|$ G9ouG)o\$UD$pڑ|$ Go\$UVP8 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP赵 ~ gC C$ދ\$POF$ދ\$P4~ F$D$\$jWSF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$V4 t6u0,1(VRn9ſuUt$V4 ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEPUWP .,v3l$4uWEED$\$cD$:D$|$j|WȆtD$4@ T$L$ t[17t<,t\$RT$lD$P~tDl$VWQ Ut$P 1<$WlNjt$D$Pl$8u)EW|$WV茍 W蘎D$D$D$ Džt$v\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0\$<u3D$u'\$U|\$8C k$K($fC K(K(|$T$ t$49PQ>p1\$91\$-4$K\$:PuQD$PȌD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q袋 ^_[]USWV[D$t uy[:|$ 1퐐/t <,tQL$h$Pzt2ƃ$UWP 4$t$P 1^_[]ÐUSWV[[|$ t$FN,9vtU6 uCu;Uzt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[ú|$ l$1wPWuLt}D$x@ȃǃtVot$ U贠)Lstƃntfuă뿐1ɋT$z HvD$8l$|$ u)1|$:WuPt$D/Wfpr.:WuPt$D1TL$4xT$$s$tntfuσ1} t WPV l$ E|$f>t WPV̓ }t0EfEfF}WuV衃 f},t&E(fE,fF}(Wu V_ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[Ë|$ t$FN,9vtU6:}u]uUU7rtHnNT$l$f,Ninf|FFWRPg ~F 1^_[]ÐSWV[ܶt$FNy9vtW6|uCu;Wqt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Xl$D8EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1K:bGj|U蹐D$tL$j|Uxt L$U^=rUPt$P 10^_[]ËD$tPb^L$ =rb:"D$t+P>^L$=r:QUPt$T^jjPytt$ $@ 1D5t <,tFPoD$4 VUP~ D5$(L$tSD$HtJ11t <,tFPHo Vt$P~ D5$h|$t+D$Ht"t$M $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0r$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p r$D$t$HjjjPjfWjQ:VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[ |$t $88ftGt 1WG(fLhwU5G =waL,|)ƋtVPUG 9vD|ŃƋGtVPUF 9s D|ŃE$^_[]ÐSV[ t$ t_vgmv\mvQmv Fmv$;mv,0mV'mt191u ^[ÐXt@ÐYot@u[fffffffUSWV[5$(lE$$4D$$0j:WyctrjQPp9 t0V$0W  NjE;$^_[]Ãu 1؞tMut6ut xf$O:t @t@uS4$l$w$D$j@UPD <:t$EF<:uEl$4$D$D$OtuԞPNPN-ǃԞ  D$OP$$,PQhW t" ǃtM5j ԞԞg ؞X jN _0 ! HPIHP% O;PfLtX;j/V yt|$uqP$jPRQV谳'qPT$$jPRWUQV至e;VPj6SV[Ýt$ j:V`trjQP5 tt$V|1^[ÐVYNT$փ1uؚt^1^USWVH[t$dl$`L$\lD$Dȃ=ؚu<$yt;L$VPj@Q蓩T$tLT 9 $ƅtID$\WU ~*)NjD$\u $dVUQ ;L$Dt[a1Kt$\ؚDŽDŽؚT $;D$Du ЃH^_[]2USWVT[è|$pL$ll$hlD$P=ؚu $t$ uz;L$WPj@Q/t$t$ T$Ijj 跈D$Wt$ؚo $t$j 莈9<$u-;D$PuyL$T^_[]WQU6 ;L$PtNT}ؚnDŽDŽؚ;D$Pu T^_[]1USWVD[XL$`T$dt$Xl}|$@uMؚu t9ƀ;RQt$dPj@W tRQt$dVr M;L$@uD^_[]0SWV[Ü|$=ujؚu tVw!P}tL!ؚDŽDŽؚW^_[ÐUSWVP[D$hT$dlML$LL$pL$t$lуucؚu tOz=m8@tW=m6PT$ vPQj@Rjx. VPRq b<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l< 4()uT$ff׺r$σߺfDfu,$tу$$1cE;D$Lu^P^_[]Ët$dؚDŽDŽؚ,$1,$-S[nD$u&ؚu t詆-[P[ÐS[D$u&ؚu tY-[t$ Ph[ÐSV[ýt$ j:V&XtrjQP. tt$V -^[ÐSWV[\|$t$j:VWtrjQP- tWhV WhV ^_[SP[D$ L$ $L$ƒu&ؚu t--Qt$P [ÐS[ÎD$uؚu t1[P$g[ÐSV[=t$ j:VVtrjQP, tt$V b-^[ÐUSWV׉[ԓR<jj UD$UWt$؞  t$j ,19tG4$D؞5DŽDŽ؞跃^_[]ÐUSWVL[&lD$D$H1,<jU u} t @u D<@u^؞~DŽDŽ؞D$;D$HL^_[]Íl$ E< us{Us詂8|$jW u|$ u}Fu؞DŽDŽ؞Iu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:@# D$t$DRL$D@# A @`? ;19<$D# D$D@ @`ƒ?;91C# D$D@ @`Ń?+;9B# D$D@ D$@|$`D$?;;|$  ՋL$A#  <$‹D$DpE# D$L$ D1 <@4$T$<`Ń?|$_u+;19QL$ T$D $L @`ʃ?|$_u;19 l$ D$L(D$<_D$$D @`Ń?+;19 ՋL$ T$D |$_$D @`ƒ?;9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;;;D$(Q,^_[]É<$t$D$X# VRPQT$T$L$ t$ ?3;|$D/? ;D/ ?;D/D$;/T$T$L$ t$ ?3;D/? ;D/ ?;D/D$;D/D$L$ < ;L/ ?;L/ ;D/D/ @# <$<$!USWV[U$lD$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ|# ǃx# ǃt# ǃp# ǃl# ǃh# ǃd# ǃ`# @`# (}3h}4t2tkƷ< sԃ1@tt`# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ`# ǃd# ǃh# ǃl# ǃp# ǃt# ǃx# ǃ|# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# )}|$| t!qtAD>1tBD>׹@`# (}D,|t.tkŷ< s݃1@tt`# tр‍ @ 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ|# ǃx# ǃt# ǃp# ǃl# ǃh# ǃd# ǃ`# )}|$| t!qtAD>1tBD>׸@`# (}D|$t=2t$Fi%I<<fw1@tt`# tlj瀍 ;@ 1ttD~tg# }  fAB} w~4AB} w~4AB} w~4AB} w~4AB} w~4A} wʼn41 @tt`# tlj瀍 ;@ 1ttD~t~$Q}$A`# }$B`# $u1 @tt`# tlj瀍 ;@ 1ttD~t⍃}c# 0pQPQPQuw# D$pv# D$lu# D$ht# D$ds# D$`r# D$\q# D$Xp# D$To# D$Pn# D$Lm# D$Hl# D$Dk# D$@j# D$<i# D$8h# D$4g# D$0f# D$,e# D$(d# D$$c# D$ b# D$a# D$`# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فP~р3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځ@ $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D J΃  @ D 5g 4$l$T$ L$ Ń4@ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]SUSWV(]yD$<X%UUUUʁUUUՍ4P᪪@ D x   x @ D x   x @ D x   x @ D UUUU $؃@ D x   x @ D x   x @ D x   x @ D T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y8 $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3@ 3@ 3@ 3@ 3<$t$3~3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 3@ 1#t$t$D$|$811t$3=@ $3=@ $3=@ $3=@ $3=@ t$$3=@ $$1L$t$|$l$3l>l$|$l$ 3@ 3@ D$35@ 35@ 35@ 35@ 3@ 3@ 3@ 3@ D$t$D$D$$7֋T$ Bl$l$l$$xl$ @ D $x   x @ D $x   x @ D $x   x =@ =D $x   x @ D ȃx   x @ D x   x @! D! x ! ! x 5@" 5D" x " " D$@P1(^_[]ÐS[[sD$1ɐȊt tT Tt t t4 uP1[ÐSV[rD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[qMlD$$D$DD$@D$9\$6D$L$T$@jjPQjRqD$HPj ]ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP&$jPD$0Pje[\$|$ juh$PhD$lPj$Pj$PjWV)4D$ PjZt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[ån$|lD$<$`# hjD$@P DŽ$@D$V-$@8$u H$@D$f<$@UVlljD$P-t;uH;WPSP;WP;PuD$;WPPD$UVljD$@jPW! D$,u:|$$@PW#x$@L$,UV蟅D$l$0&t$\$UVD$ D$D$ D$$$@&D$ \$UV0tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWRD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V51$xUV$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-;PQRz_h$DUt$@V4 j jW hjU  hj$P D$@hjP D$<;$`u`d^_[]D$RW菁D$tT$@PQhR vl$ $;fffffSV[hD$ h`rƉPW)Ɖ^[ÐUSWV[èhl$0Djjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐS[Cjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[ÞCjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$8R4[ÐS[NCjjt$4t$4t$4jt$8t$8t$8t$8t$8t$8t$84[ÐS[Bjjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[èBl$hUƉD$ D$PjljD$V[D$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$ D$ tKWV(tD(1t$[ t$ O UF T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[@t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[@jt$t$t$@[ÐS[?jt$t$t$[ÐS[î?jt$t$t$[ÐS[~?jt$ [ÐS[^?jt$ h[ÐS[>?jt$ H[ÐUSWV[?t$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[8>t$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[X=t$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐX<L$Q##wÍ@ÐUSWV [H<|$(l$$t$ D$4AD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[î;D$ hPt$@( [ÐS[~;ht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[:D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[D$plML$LjPt$lv D$h|$df$D$VL$)L$D$PVWD$ |$$v=D$t$.D$lp8L$ QjjVVQ|$)cƃPD$2PL$Qh ? $ $$m=|$D$lp,t$ jjt$>V.V|$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>VVv|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>VTV |$)v#Ƌ $PD$2PL$Q% sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7*L$R)уtuÐWVt$  r!̐cw^_fffffSWV[lt$|$G@hjP 4j@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[E$l$N$@r8hUtE\EXETEP$t$tAsE@hjPT Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV h$$V7hVU< hV1;$u Ą^_[]USWV [Øl$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_.$hRPn RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ Wӿ hj$P  g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ5 $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PVĽ D$hWD$$hPD$;$xu D$e^_[]LffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[X|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[ÛD$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*\E E(}$uxM$뉾1^_[]ÐUSWV[ûD$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*\E E(}$uxM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]X$lD$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$A4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$A$FQ? T$‰ً$|$D$G<uD$ $@ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4HL$ |$ )t$)t$$t$,)wD$ L$?? n A T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4EBT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍*AFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N AFL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$QӦ l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj @&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B @Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅ&GPGX >G\GG?$L$u aD?@FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  =BFL$Q? (BFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$A$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't BD$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$A~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=gA$FL$Q?P$@$NL$Q?D$T$ ߋ t$gA$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $e_USWV[iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8 }43M(U,E4E09w)RVP辑 E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[ t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ÛL$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU蜐 F4n0)Pv8U臐 1tN0^_[]ÐUSWV[ t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(lD$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@֝D$?? u)D$(AL$(AÉ$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+HT$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$,|$$N9l$(4$Jى\$!4$f ؉\$V_?L$1)t,)9멁f*] ^_[]ÐUSWV[Ȟl$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjP؉ )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[È|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw e o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoUo9,$Eo9wŅt0UD$pw ic o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw ` o $ho)o)hu $AA~+ Nl$("ئFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ_ F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw _ o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQ1_L$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU|4,$Eo9wŅt0UD$pw v^ o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUc3,$Eo9wŅt0UD$pw ]] o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw \ o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU1,$Eo9wŅt0UD$pw [ o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVU2 $FlF\iU~0l$E$ыj9wŅUD$pq nZ $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV?0 $FlF\iUh.l$E$ыj9wŅ(UD$pq XX $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaV[-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$Xx$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPU_uElE\~WGn9wŅ$Uwv F n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv E n on)n)ouGGD$8xw1)Ћ$jPQU5uElE\~W`Gn9wŅt)$Uwv ^E n on)n)ouGGD$8xt1$^_[]ÐUSWVXz$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV'F}9wDžt)$Wvu %A } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu @ } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUcmAlA\uVF}9wDžt)$Wvu ? } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu ? } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]X?rTÐUSWV^rL$4t;T$8\$0Ӄs3I͉у1&Ӊi913TƒT$4zR13TƒT$4zR13Tƒl$4M1ʉ3TxT$  1ϋL$ 3TÃ1ؐ\=13T\=13T9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3T3T3.T3T $3QT3T3T3T $3AT3T3T3TD$ $3A T3T3T3T|$D$ $3AT3T3TЉ3T|$|$ $L$l$11D$D$33T3T3T3T3W13T3T3T3T3G13T3T3TȋT$3T3W 1‰3T3T3T\$3T3_1ˋT$ )3T3T3TÉ3TϐÉ13TW13TW13TW13TW13TW13TW1Љ3TO13TRЃ^_[]ÐS[lt$t$t$ [ÐUSWVXl$D$$tz \$׃vND$t$T1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVXk$D$$tz \$׃vND$t$T1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXj$T$tfǃvEt $T1ف 1υt1Mu밸^_[]ÐUSWVPXJj$T$tfǃvEt $T1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[ft$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffX_dÐUÐX/dT$J r )ыS[cD$D$ P[ÐS[ct$ //[ffXcL$ \ $ p, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_aT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P9*L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX]D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$TPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$Y2LL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كS\$T)4f f9Hxl$ $zvt$|$ +)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~]H $hMH $) $XhMH $ +(f l$|$xt$ +@)9D fHxoh9xXkhl$ (f t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXkH\$T$L$o>o4>o>tB4fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[At$VGR=yaratV=tcidu3VuVStt$PF 181^_[ÐSWV[lAt$VQ=yaratV=tcidu3V;uVtt$P@F1 y18r1^_[ÐSWV[@t$VWQ=yaratV=tcidu3VtVctt$PF 081^_[ÐSWV[|@t$VP=yaratV=tcidu3VKtVtt$PPF1 080^_[ÐUSWV[?t$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VD$PWUA 1u/(V u /(^_[]ÐUSWV[H?t$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VD$PWU 1u=/(V: u "/(^_[]ÐUSWV[Û>|$Gt,/D(UwUt D$0 .1^_[]ÐUSWV[;>|$Gt,/D(U蘚wU躬t D$01d.Y.^_[]ÐUSWV[=|$Gt,/D(UHtwUZt D$0 .1^_[]ÐUSWV[{=|$Gt,/D(UswUt D$01--^_[]ÐSWV[=Pt$ t$  t6D$t7<$D8W`t$W聫tD$ 01+-"-^_[SWV[Ù<Pt$ t$ . t6D$t7<$D8Wrt$WtD$ 01,,^_[USWV[<t$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$VD$PWU] t_VD$t<<$D8Wrt$W'tD$(014 +8&++8Vt^_[]ffffSV[;t$t$ePzK=tciduL$1=tcid^[ÐUSWV[:t$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[l:D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[:t$t$Vt$t$f D$V^DD$1^[ÐSV[9t$t$t$1dVPP^[ÐSV[Ý9t$t$t$dVPQ^[ÐSV[m9t$t$t$cVPwQ^[ÐSV[=9t$t$t$cVPQ^[ÐSV[ 9t$t$t$qcVP7R^[ÐSV[8t$t$t$AcVPGR^[ÐSV[í8t$t$t$cVPR^[ÐSV[}8t$t$t$bVPS^[ÐSV[M8t$t$t$bVPgS^[ÐSV[8t$t$t$bVPS^[ÐSV[7t$t$t$QbVPS^[ÐSV[ý7t$t$t$!bVP'T^[ÐSV[Í7t$t$t$aVPT^[ÐSV[]7t$t$t$aVPT^[ÐSV[-7t$t$t$aVPT^[ÐSV[6t$t$t$aaVPT^[ÐSV[6t$t$t$1aVP'U^[ÐSV[Ý6t$t$t$aVPwU^[ÐSV[m6t$t$t$`VPU^[ÐSV[=6t$t$t$`VPV^[ÐSVP[ 6D$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[ì5D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[L5D$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[4D$QPGt&Pt$t$za D$V?D$1^[ÐSVP[Ì4t$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[,4D$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[3D$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[l3D$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[ 3D$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[ì2t$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[L2D$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[1D$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[Ì1jt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[<1jt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[0t$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[Ì0jt$Et&Pt$t$] D$V:D$1^[ÐSVP[<0D$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[/D$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[|/jt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[,/t$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[.t$t$5YP*?=gntsuV!t L$1^[ÐSVP[|.t$t&Pt$t$[ D$V8D$1^[ÐSVP[,.t$t&Pt$t$Z D$Vd8D$1^[ÐSWV[-t$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[l-t$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[ -t$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[ë,t$t$WP==gntsu?VŃU\t$UPV t D$8 W1^_[]ÐSV[-,t$t$VP<=gntsuVzt L$1^[ÐSVP[+t$Xt&Pt$t$qX D$V6D$1^[ÐSVP[Ì+t$(t&Pt$t$!X D$V5D$1^[fUSWV[;+t$t$SP;=loobul$VzEloob^_[]ÐSVP[*D$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[Ì*t$t$Vt$t$ D$V4D$1^[ÐSVP[<*D$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[)t$t Vt$?D$V24D$1^[ÐSV[í)t$t$t$VP@^[ÐSV[})t$t$t$VP@^[ÐSV[M)t$t$t$aVPWA^[ÐSV[)t$t$t$1VPA^[ÐSV[(t$t$t$VPB^[ÐSV[ý(t$t$t$~VP'B^[ÐSV[Í(t$t$t$~VPB^[ÐSV[](t$t$t$q~VPB^[ÐSV[-(t$t$t$A~VPGC^[ÐSV['t$t$t$~VPC^[ÐSV['t$t$t$}VPC^[ÐSV[Ý't$t$t$}VPD^[ÐSV[m't$t$t$}VPgD^[ÐSV[='t$t$t$Q}VPD^[ÐSV[ 't$t$t$!}VPD^[ÐSV[&t$t$t$|VPD^[ÐSV[í&t$t$t$|VPE^[ÐSV[}&t$t$t$|VPWE^[ÐSV[M&t$t$t$a|VPE^[ÐSV[&t$t$t$1|VPE^[ÐSVP[%D$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[Ì%D$QP`8t"Pt$}D$V/D$1^[ÐSVP[,%D$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[$D$QP7t"Pt$ }D$V/D$1^[ÐSVP[l$D$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[ $D$QP6t"Pt$N|D$VA.D$1^[SVP[ü#D$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[\#D$QP16t"Pt${D$V-D$1^[SVP[ #t$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[ì"t$t$5t"Pt$zD$V,D$1^[ÐSVP[\"D$QP15t&Pt$t$x D$V,D$1^[ÐSVP[!D$QP4t"Pt$>zD$V1,D$1^[SVP[ì!D$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[L!D$QP 4t"Pt$yD$V+D$1^[ÐSVP[ D$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[Ì D$QP`3t"Pt$xD$V*D$1^[ÐSVP[, D$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[D$QP2t"Pt$xD$V*D$1^[SVP[|t$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[t$t$1t"Pt$awD$VT)D$1^[ÐSVP[D$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[lD$jP2t"Pt$vD$V(D$1^[ÐSVP[D$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[üD$jPD2t"Pt$vD$V'D$1^[ÐSVP[ljt$1t&Pt$t$s D$V'D$1^[ÐSVP[jt$1t"Pt$cuD$VV'D$1^[ÐSVP[jt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[|jt$1t"Pt$tD$V&D$1^[ÐSVP[,t$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[t$t$T0t"Pt$tD$V&D$1^[ÐSVP[|jt$0t&Pt$t$q D$V%D$1^[ÐSVP[,jt$/t"Pt$ssD$Vf%D$1^[ÐSVP[D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[|D$jP/t"Pt$rD$V$D$1^[ÐSVP[,D$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[D$jPT.t"Pt$rD$V$D$1^[ÐSVP[|jt$.t&Pt$t$o D$V#D$1^[ÐSVP[,jt$-t"Pt$sqD$Vf#D$1^[ÐSVP[t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[|t$t$-t"Pt$pD$V"D$1^[ÐSV[-t$t$EnP(=gntsuVz t L$1^[ÐSVP[t$Xt&Pt$t$an D$V"D$1^[ÐSVP[Ìt$t"Pt$oD$V!D$1^[ÐSVP[<t$t&Pt$t$m D$Vt!D$1^[ÐSVP[t$t"Pt$5oD$V(!D$1^[ÐSWV[Üt$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[,t$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[t$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[lt$t$TYt"Pt$mD$VD$1^[ÐSVP[t$t$Xt"Pt$amD$VTD$1^[ÐUSWV[t$t$jP(%=gntsu?VŃU|t$UPV9 t D$8 W1^_[]ÐSV[Mt$t$ejP$=gntsuVt L$1^[ÐSVP[t$xt&Pt$t$j D$V4D$1^[ÐSVP[ìt$(t"Pt$kD$VD$1^[ÐSVP[\t$t&Pt$t$i D$VD$1^[ÐSVP[ t$t"Pt$UkD$VHD$1^[fffSV[ýj ƅt%PV FF F^[ÐUSWV[k|$tzj C1tcPV FF FW;ŃPtQP~n VX1^_[]ÍCBBPQhRSV[ít$ tV贺P4^[ÍCUCBPQhmROSV[Mt$ tVTP^[ÍCUCBPQhmRUSWV[D$tfL$ L$QPjj1x@ƃ$Pt+ǍD$ D$Pt$ t$WK1ɉV.ʼn^_[]ÍBC(CBPQhER@USWVP׉[F,PQj t}ƍPV n~L$N uq$P' Ul' VP#9tBPUˁ$u vV1uWU蔁^_[]ÐS[nt$Pc[ÐUSWVP[:t$t 9.t 1^_[]Fu V5F $Pt͉NjFu[PWd,PQ讃j t!UP$ F~$F qWaUSWV[hl$1t 9}t ^_[]ËE D$P tߋMu[QPD$,PQj t'WP_E$ED$E y4$.iZ¯ L$1t 9tËA ÐVY~ T$1t 92t^BBtu[^ÐS[> T$t 19 uL$ tB ;D$v1[ËBu[PQ[ÐY D$t 9t1Ê@$ÐUSWV[ë l$1t99Eu.E PqtNjEu[PW^_[]ÐVYN T$1t 92t^ËBu[^ÐUSWV [ |$ 19t$$9Gt{o F D$D$Pt[$W[ȅtЋT$ՋVtэoQPRt$t$V[Owo tQ1 ^_[]ÐUSWV[8 l$9ED$ Etp} P$PtM}D$u[T$ $oRWQP|$WM}u tQ 1^_[]ÍCoCBPQh+RWS[^ D$t9u L$ t9t1[QP[ÐS[ L$t 9t1[ËD$ Iu[PQE[ÐS[ L$t 9t1[ËD$ Iu[PQ[ÐSV[} D$ t9u L$t9tf^[Ëp[ЅtItRPאS[ L$t 9tf[ËD$ Iu[PQB[ÐUSWV[l$$|$ }$tV 1^_[ÐSWV[üt$NtFt_V9wwu QPhtFVL$z~ ^_[1DDNDPQhR1DDNDPQhRDDNDPQhRSWV[t$t$|$PWtu^_[ÐSWV[ìt$jVt j V~1^_[ÐSWV[,t$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[|t$|$ʃ>tXVt j V1^_[ÐSV[mt$ jV)tj Vt jV 1^[ÐSV[ýj蝹ƅt5h芹tFFF V1^[ÐS[^t$[ÐUSWV[8D$ t$tP;D$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP^l 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔Nx"u+1Ҁ8t$FHt"tV x>t1^_[]ÍEENDPQhRzUSWV_{l$D$P1 D<&t0<<t;\$rJ1ɋB닀ztuTz;uN<szuuD$ ;D$uPt$t$i [1[ÐUSWV,[l$$Up^D$ D$D$T$t$ D$$@GLG 8trueD$ G 8dataD$G 8dictD$KG D$arra1D$@y ȋD$G D$fals1D$@e ȉiG D$stri1D$@5ng ȉ. inte1Geger1$@ ȉD$WL$QUPL$ D$D$ jRQVU]t.t$t$$HVUT$oD$ D$D$ ,^_[]jRQt$VUp]t9jt$$H|$WUT$jVD$PWU7]u1렐USWV[Ût$t+ǍE1jUP- t$tW1^_[]ËGtu߹vers3sion3P ujt$W tWtjUW tP^뉐USWVP[j,躱1 t$w7E$ws 搐<<njt$U trEjPU t\EjPU͎ FGFtlt`<-Fu<-u~>uwXtEuW(1^_[]Éw񐐐USWV[ÅD$PZ>L$QPjjj$0PD$PZ$$_HtыxnUetUt띐$$QL$ QPƅtׅkU%tT$$4$tz1U$ƅt`L$HtыxnU违utUPjQt t뫃tX^_[]ÍNFNDPQhRFFNDPQhR/FFNDPQh RNFNDPQh;R/FFNDPQhERqFFNDPQh RRS[^t$迾[ÐUSWV[5$x4$tT}tNU(t H|/tV鐐9/ 9sf$.VқH r?fD XDXXXXDistX/.plV!W$P\ 9ucV^tUjXPKWVat)V^Ut$V/`u-^8U8V^V!:81^_[]É9tE9t qy/t)rVUP 4USWV[ejSuj91 Ɖ|$hj$] tLǍD$PW,t.L$Al$h($#$V9s&W]VW]V<4$D$ l$t1jjWjjQj_,$EWX]tFjVWa D$D$ u;jjjhj|$WP|_t",$u U詻1Č^_[]VU^4$ڐSV[ t$ jv6Ra v6^VQ^[ÐS[D$P6t[ÍFENDPQhR~D$t1S[njt$t$ [ÐUSWV[5$4$0$,D$PStED$$;t 1^_[]Él$L$QL$QRUWVPu=VU$8P$8PD$ PT$,$0릅4$t$$8$8D$ PRt?t$ $,|$$0D$$1;<$4t $4jj$8W$8Ut$ VJS$,$0PQjjWUЍWF9FNDPQhRqS[~D$P[ÐS[^D$PP[ÐSV[=t$ vV蒸^[fffUS[EM L$$D$e[]ÐUSWV [,#8PQa|' W^' l$UVutPW}^ ^_[]Ét$Wf^j >thʼn(PU|$GEOM,$EV#^W|$Wt(P&V]4$Wp1l,$UW9uVMGFFPQh@RUS[ÕEM L$$D$e[]ÐUS[UEM L$$D$^e[]ÐUS[EM L$$D$e[]ÐSV[t$ 1t(9u V^[ËD$@$ÐWVYT$ 1t (9 t^_BJRu=@1u11ָ u111 봸@u 19Ͽr9yVZL$1t(91t^1^ËAQ^ÐVZ®L$1t(91t^1^ËAQ^ÐVZnL$1t(91t^1^ËAQ^ÐVZ.L$1t(91t^1^ËAQ^ÐSVPYD$t (9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPY\D$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPY<D$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐YD$t(9u@H@ty1ËT$ BÐSVPYlD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐SVPYD$t (9t1^[@HPu31޻D$9λǃ| |$t19λrD$럐SVPYLD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$f뛐SVPYD$t (9t1^[@HPu61޻D$9λǁ| |$t19λrD$뜐Y/D$t(9u@H@ty1ËT$ BÐSVPYD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYlD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐSVY}D$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t(9uBJBuy1ËT$JÐSVYD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐSVPY|D$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPYD$t (9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVYmD$ t (9t1^[@HPu1޻ÅDžx t҅űD$ĐXT$t(9uBJBuy1ËT$JÐS[D$t(9u L$ t9t1[QP*[ÐVYD$t (9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY>D$t (9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYD$t (9t1^Ët$HP@u 1xx3L$ 1 ^ÐVYD$t (9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV[CuD$D$ D$~6~$,F0tW-ukeD$jPv0 T$ D$1ɿ9&8"xxu D$jVD$jPv T$ D$1ɿ9rG8"u=jD$Pv ` T$ D$!Ѓu 8"t7L$d$D$F!jPV tu L$e^_[]ÐS[|' jPNH' PQo1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[íD$0' VP蟕V1^[ÐUSWV [ht$4L$8AAIt GQPRj W!UVtWVt UVR1 ^_[]ÐWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[Þ,#8PQpO|' PL[ÐS[^|' PWL[fSV[=j@ƅtCXPVjPeMF,F0F4F8F<^[ÐUSWV[t3PjZtjj@荔DžuUOj@r1t=XPWGjPLo,w0G4G8G<1^_[]ÐL$WUSWV[t$1X9nUxLN4 Džtbl$~4<$tC1퐐F,XPQaG' UrD' t$(VW>D$PiU@D|$$o4;o0w,Pj躖ǍMUVWF D$$x,ljh0VF,$tD$,PD$,DV|$UCVzǃ,wj,<j<t$$D$$x,ljH0l$,Ujw,4t2$ƅPt$,py&$'L$n@4@<C$ōƃM)WRP"g L$$A,T$TT$,T A4A<$D$P!D$mhbxQPFt$(Pt$ ~UFBt$(|$WtmPFUBD$ x|$$t$P`$<WVV)f L$$A,T$h t$ VW9Ƌ|$$UAD$ D$XvGIGPQhzRRVGĔGPQhR3vGĔGPQhRIJ3JGPQhR'JJGPQhTRָS[D$tX9uL$ t x9t1[Ãt$QP] [ÐUSWV[Èt$$t X9tFD$ PAF8D$$P4D$$@,D$$׉T$)ω,$D$4FPt$,Jt1Ʌ~,$벉t$9vwL$T$ )VQPd D$$@4@<W4$t$ A^_[]ÍvGIGPQhzRAJJGPQhIR"S[.D$tX9uL$ t x9t[ÃQPc[ÐS[D$tX9u L$ t9t1[QP:[ÐYD$t x9t1ÃÐYoD$t x9t1ÃÐS[>D$tx9u L$ t9t1[QP[ÐSWV[,tIPt#D$PVQ tVQt> 6$1VD1^_[ÐUSWV[Ël$}t^_[]j@ZtƋ|$XPVjP>F,F0F4F8F<}$t7htL$7PUrVPbUSWV ։L$[|$ *jjWg zFjPww Ht(ut$$ZjD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t#Ajt$(P6t$}.t1t$$.U  ^_[]Í KJGPQhKRnS[nzFPt$ [ÐSWV[<ltyPtWD$PVQ tEVt8>Vt60VR1^_[0W0SWV[Ìt$t"ƍzFP6VF1^_[ÐUSWV[;t$>W0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(GGGPQhbRwQGP;W1^_[]É.VGGGPQh`R(MGGPQhqR HGGPQhRS[L$A4tPQ4I,Dt*P1[ÍJH*HGPQhR荰H*HGPQhRnUSWV$[hl$<|$8uV9}4tMzFD$ PWtj WctXD$<9t6$V9$$V9zFPW,^_[]ÉL$jjzt?\@Hl$XPQ@6' PQ3[ÐS[.' P'3[ÐS[' jP2' PQv1[ÐS[D$L$ PQ[ÐS[ÞD$ t$P[ÐUSWV[kl$}tQX97uGW3EtS90uOH<1;M uM;H4w\t @,4ȃMW3^_[]ÍH|IGPQh{RթHHGPQhcR趩 IHGPQhhR藩SWV[Ü|$wV3Gt$X9uG@WUP  jvDžt!PWGwo 1^_[]ÐUSWV[xl$19}EuBM1tDm $t: $Uvt^Ut$D$Pj U-;1$D$jut"WPT$ED$E E^_[]ÐZ¯L$1t 9tËA ÐZL$1t 9tËAÐSV[MT$ t19 uL$t r ;t$v1^[ËR1ttVRQc ᐐUSWVP[D$1t 9t ^_[]ËHh t( $tDUtt؉Ut$P ątKKVKPQhR\KKVKPQhR=Z?L$1t 9tËAÐS[D$t9u L$ t9t1[QPj[ÐSV[͸L$ t 9t1^[ËT$19Q ut$tRVq.( ֐USWV [xt$(~$t  ^_[]ËFnjQvPt҃~ t蚨D$jPv ʼn$u s8"tD$NN 9u8"t=LKVKPQhR輡1jPj N,$Ur7ǍFPD$PU tcD$;$uZTjPV& tD|$u Wǂ1,$j5rƅt-PV譱F~n W节t WxD$$0USWV$[y11T$G=w \⍋TjAPQ8 u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5jP"F,F0F4F8F<^_[ÐUSWVP[xt3Pj strj@ 6tp1V蔦1^_[ÐUSWV[ۤl$}t^_[]Ët$j@_tdǍVP7t$jPG,G0G4G8G<>}$uL$UxUSWVP $['*ts֋|$jjWƥ tC,,jPww 諩t(t1cjjPUt$wt1U&^_[]ÍOO2MPQhBRtS[~,,Pt$ ë[ÐSWV[L|tyPСtWD$PVQ tEV衣t8>V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%MM2MPQjfR诋Q.mGP=Wm1^_[]É.MM2MPQjdRcMM2MPQjuRGS[ND$H4tH4[ÍNfN2MPQhRUSWV[t$(l$$~W|~4tH,,$PU胛tj Ut 9t6$W6$W%,,PUU^_[]ÉD$jjetLbcHVD$~T$rL$9F9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Xt$@|$t$t$jt$t$t$h9[fS[t$t$jt$t$t$X9[fYXZQ̀QQrS[Ύt$t$t$t$N[ffffS[Þt$t$t$26 [ffffffS[n1;D$[ÐS[>1;D$I[S[8t j|1[ÐS[8t j|1[ÐS[þ8t jq|1[ÐS[Î8t jA|1[ÐS[^8t j|1[ÐS[.8t j{1[ÐS[8t j{1[ÐS[Ό8t j{1[ÐS[Þ8t jQ{1[ÐS[n8t j!{1[ÐWVX=' ?+ RH4ѐ>t1 @u~H1ɐ>t 9u#:T$4IHDT 4N)' D$ 1^_ÐXL$T$RH 1ÐX_L$ IHÐX?L$ IHD1ÐSV[ t$ ~u T$F1^[ÐUSWV[ۊl$|$t$8t jyUWVw t {1^_[]øÐS[~.5[ÐS[^jy-[ÐS[>j̏S[8t jx1[ÐL$1;L$Ð1ÐffffffSWVP[ˉ|$t$uEQ QPQj;R7t<$PhvtV3b^_[ffffffSVP[lt$uQPQPQj;RsPhwt@Va $tЅy^[ffffSWVP[|$t$tt7t;uP$4QQPQj:ROsu$$PhtV9a x^_[ffffffSV[]t$ uRQPQj8Rrjh^t V` ^[fffSWV[ t$|$u9kVRRPQj7Ryrw(w$1^_[fffffSWV[üt$|$u9kRbRPQj7R)rw(1^_[ffffffSWV[lt$|$u9kRRPQj7Rqw$1^_[ffffffSV[t$ u9k1SRPQj;Rq&ff g#F F^[fffSV[ýt$ u9kySRYnjV3D$8jt$V_4 Ƌ44!3<$lD$,$ltAL$t$t$$U u͋D$|=uU2rs9,$}d)tuDur;MDMDMD MD9u71 ^_[]ffffffUSWV[U$/L$(^L$,EL$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$}L$T$ t$t$~[ffffS[}L$T$ HPt$ [ÐUSWV(T$[|ɉ\$u'TTST\$PQj?R?g\$t$@|$ |$<t9D$<|$ "v)l1t$\$VP[\$ u+t-t D$ 1D$t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPjS[îwL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[fwL$u"~UpU5UPQhRat$uHT$D$t$ 9Љ,UWt$Pt$Lt$LЁ11҃^_[]Éȉt$,9ы|$0}Ut$49Ƌ|$8}!UWVRPt$Qt$Xt$Xy 맋L$<fffffYotimNA90%ÐX?tL$ffffUSWV0Xt$t$Du%$mVaVVPQhR^L$H|$PL$u)${VaVVPQhRL^L$X1|$L$Ww.D$ ؉D$ )t$D$HOL$|$ T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$; T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$uO1l$ t$L 9u)\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|${1Ґ  LLLLLLLLLLLLLL9u$t$ W91$C^0^_[]USWV0Xm$L$Ht$DL$u)$mVaVVPQhRXL$X1|$L$WC(D$؉D$ )t$D$HOL$|$ T$A4T$4D$H9wՉ݉L$L|$9s2D$$PWT$XD$x L$NjL$Lt$l$$UWT$XD$Ht$ \$etA1ɐD T 9uD$L)̓|$DD$L|$11ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$ D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU5 T$ tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$$PWT$XD$x NjT$Lt$tB1ɋl$ 9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$T$Ll$\$|$$WUT$Xt.1T$   9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$ L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U 31$W0^_[]fUSWV<[hgl$X|$T|$\|$T!D$u HD$4tǃǃT$PT$$9L$$[T$, T$0\$|$ =$D$(\$ǃ|$ l$XL$1L$u8D$4;L$$fD$T4>-u FD$,t$0VE<+<-nL$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$ŐF䐐S[îUt$!1[fS[ÎUXt$ t$ Pj [ÐS[^UXt$t$t$P[fUSWV[+Ul$|$t$u|XXPQj4R?1UPWV-^_[]ÐSV[Tt$ u|XXPQjAR>?jjjV,^[ffffSWV[|T|$t$u|YXPQj6R>1hPWVp,^_[ffffSV[Tt$ uaYYY"YPQj0R>jjjjV荃t^[ÐS[St$j t$t$P[fffffUSWV[ÛSt$|$u|YnYPQj/R>jW#~G0t ujWm%^_[]fUSWV[St$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H C1^_[]ÐUSWV[ØRjx 1L$,l$(D$$t$ T$wGo Ouu u&t,t+$ttڍLuft?$L$5t: $fH f@xp$L$H,h(@DH =BW61^_[]ÐS[îQL$ D$T$rRQ0P [ÐUSWV[kQ|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[QD$t$t$t$0P [ÐSWV[PD$8pP7tWփ1^_[ffffffUSWV[ÛPT$l$t\tE0~-},t xr }$t jr2U蚥1Ƀ^_[]Í|Y֍YPQj;R:uYY֍YPQj]VP,3a]VP,"l]VPv,]VP^,]VPF,]VP.,^VP,޷ t9uuhl$t!j2pU xq[QPs`YRKD= 6 / ( !  l$]PQj2UUUƋD$XtPUt$\D ;D$4u 8^_[]fffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[ÌG|$t$u^^X^PQjYR1F)F31uF FF^_[ÐSWV[G|$t$u b^X^PQjwR1~uP\$wGN Qt^^X^PQhR0~uр~|$^[ÐSV[Et$ t ~t/F^^X^PQhR>0~uN .wu^[ÐSV[mEt$ u"^^X^PQhR/1~t^[ÊV u.wL$~9|ԐSV[Dt$ t~uQ(^_X^PQhRc/~u'F u <.wL$9^[Ð|$t1ËD$ÐSWV[\D|$t$u"^_X^PQh.R.1u6T$L$9w"QjV0 FfFF^_[ÐSWV[Ct$u"^,_X^PQhMRJ.~u/L$Fy |y|9IL |F1^_[ÐUSWV[XCt$,|$(O $$PWV` N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍN_;_X^PQhhR,Y_;_X^PQhiR,SV[At$ t~uF(^e_X^PQhRS,~uNuV9r ^[ÐSV[}At$ u"^y_X^PQhR+1~u(NuV9rT$x 9v ^[ffSV[ At$ y___PQjTRw+^[ÐUSWV[û@t$|$u^__PQjbR(+l$u___PQjcR+MϸwG)o >1^_[]ÐUSWVP[*@t$u"^ `_PQhR*|$ |$u"` `_PQhRk*cUL$$Hn 9uЉ,$)1!)1։t$uFAPjQ+ D$0D$8t p,$VPQp  D$0)p)t[uQNr-a $a׍_PQhRY)L$JBQjPO+ D$0)r&,` `֍_PQhR)U1^_[]ÐUSWV[8>l$$|$u"^P`_PQhR(1>0L$(#4W 9u$)1*!)1ׅt"uGFNPjQ/* D$ NjD$8Ћ $)ȍx)t_uUOr.aL$aՍ_PQhR'L$JBQjP) $D$8)r*,`P`׍_PQhRb'L$Q^_[]ÐSWV[Ü<t$|$tt1)tW^d`_PQhR&uύw`d`_PQhR&)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9SWV[|;t$|$tu)OσO  9 9tj9tly9y]^`_PQhWRq%iw``_PQhXRG%B 9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1VL$t"T$ tփuQ^ÐUSWVP[9|$$"T$(D$,<ȸ9D$ 4t)щʊD$$L$(l$y1``$_PQhR$T$L$8D$4t9|$tl$0|$ thu[r&``Ս_PQhR#GRjP% D$$L$(l$0O}^_[]ÐSWV[ì8|$L$1uLwt?;t$w6)w*t$uQRjQ$ ^_[ÐSWV[,8t$|$D$Vt$Ph ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [7|$$D$(t9D$ L$,ň̍`L$`L$_ $ut$t$ht$ &!d$<EtM9w'M )9w 8t9rD$4 ^_[]ÃD$0D$4(+T$ ܐSWV[ 6t$|$D$VPt$ H ^_[ffffffS[5jjt$t$t$t$[ffS[Þ5jt$ t$ t$ t$ t$ t$ [ÐUSWV[U5lD$$$$$7$$$ua6aPQjlRyft$pPQj VAD$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6!6P qvPVQ]S jhaa6aPQjiR$vaa6aPQjjR$aa6aPQjkRZD$@t%+ hPV5 $0$$,]PQX"e9x\O;PD$$u"vac6aPQhzR$$u"ac6aPQh{Ru"c6aPQh|R^t$uc$T$@PhQRW<$D$Pjjjt"D$PjjjD$Et$t t$ ޞjjWu t$&L$U$$$t$yD$;$uVĔ^_[]ÍccWPQP 뺍cc ccPQ{t$#jt$%xjjycdPQ+j1 t$؝ujjx*jt$xt$褝t$ 蘝ycdu^$p!uS8P$0uP$$u6$@$8jg$c dpQRj/V$ tDžtjPQ $t$u5sj$$2$PQWV ^j$$1$PWV8]Zj/Vw t^j$PQVc0dVPQK jQUSWVh[#/lE$dL$u"bb6aPQhR$|u"hab6aPQhRT$u&Ǎvab6aPQhR%$u"ab6aPQhRt$u"b6aPQhRtD$LD$PD$TD$HL$8D$HQPj l$$D$ bD$$D$ D$l$bP诽mjuD$Pa Džx ^[ÐS[N&jt$t$ [ÐUSWV[&$lE$$u"aa6aPQh Rj$|$1 t#,$D$t:BD$1,$D$t BD$BD$B΋J L$D$ L$jjQ訿 ǸxVtuTfD$D$PW,$D$f$_/,$$ffD$UD$PW yQ80uN$=uW_#,,$(W?(,$W&,$M;$u Ĉ^_[]oUSWV$[$l$@t$8|$DD$ D$D$D$D$D$D$D$ L$޷PQRV<$t$PV1tcǍD$PV誏x]#D$=uYW L$QPxFD$,t L$;Au=D$b0L$:$u 1 uL$>͍ >T$1ҍL1 -9si$:DgU;L$s>t 9sE.9r9s34$Dgh9s맋 $L1 9s$ 1 ^_[]fffffUSWV[ t$|$LUPPWV?U܂^_[]fSWV[üt$W豂PPV= W蒂^_[ffffUSWV[ht$ule8ePQj3RD$F$V~nFM1 PUWRt$t$QjV$^_[]ÐUSWV[|$,u}xe8ePQjBRJL$T$ |$l$捃eUWRQL$QVPt$HK 1uA$L$_1 _1 `1 L$a1 L$ b1 L$c1 L$d1 ^_[]ÐUSWVH[l$`lD$ D$D|$\FeE$MUu}meUWVRQt$PjD$JP$$ePQjjjjPViƍ80VjjjjWiƅZUVL$\u&ef8ePQhRL$lQL$ QL$ QL$ QL$ QL$ QL$ QPV$YD$L$ D$D$D$?D$D$@D$D$AD$$l$(L<>4LuŋD$;D$uY^_[]Í~gsgfPQhRZgsgfPQhR$XffffUSWV[t$0l$,lD$tu5#GfggPQjFRcuj)觧ƅt]UP1 F LFuF(;D$u^_[]1膃USWV[5$ l$$Ph@VW1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ Y|=P$Pt$V ƅ~.V$P$PP |) us84$Wa8|$$uj)辥ƅ~$$QP1F LFuF(4$W0W|$;$u^_[]1舂sS[.jjjjt$t$[ÐUSWVt[$lD$p$u"pfggPQhRQU$$U uj)sƅtZD$\UP1L\F LFuF(;D$put^_[]1UffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPȲ 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPl ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [|$$lD$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW袾 ;D$u ^_[]ifffffL$$Yai qyD$A(tQS[èRjjc< [1ÐT$D$ Zbj rz $z(t RPS[XjRj< [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj~; [1ÐT$D$ Zbj rz $RPS[~jRj9; [Xt@ffffffSP[MD$ L$T$$RQP i[fffS[jjt$j:[fffffffS[jt$t$jz[ÐS[þht$t$jz[fffffUSWV [Èt$ uՈhgPQjw ^ffffSWV[ùt$(WjV xqN|$,t?r$d$D?r'ݸ-8 d$8!L$jWV蚷 ^_[fffffffSWVP[ t$tB35 PQhRx>L$ $„5 )QVWRs5 PQhR5 = t@= ^_[fffUSWV[[t$uhhhPQjbṞD$D$I@t NQw<ى+tՃ-!ȃƉNtu+u0u;t#>!tu:uCtPtЉ#.!tō,#.!u뼉#> t<#> 0# Ѓ'^_[]ÐUSWVX[(|$l? D$DD$@D$ D$.L$#8 $)D$ $T$D$|$D$l$(Pt$0t$ $1҉l$Ht$t$jL$ QōD$P0> D$褲L$虲8  $)D$ $T$D$D$t$ l$$T$ҋD$ t$l$$u|$,=D$0|$,=tt$0T$(;L$sD$D$i|$H|$|$jL$QƍD$Pf= ܱ(ձ8_ $)D$ $T$D$|$D$l$$T$,Pt$,t$- $T$;L$D$sT$ i|$B|$|$jD$$PD$P< =(68 $)D$ $T$D$|$D$l$$u3ōh΍hhPQhtR l$4X|$ tD$ !A $t$0¾"T$ l$0BL$<,p^D$jPWP NjD$D$ 7|$ t 8"u$9r6l$4D$4jj Pl; 0ۯ8uQ$)l$4$u&ƍhhhPQhtRө-@@+x @耯0U}p01X^_[]](Sl$l$u"hhhPQhRMqpt+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmUSWV׉[u"hhhPQhtRYL$D$T$W~>Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ffffSWV[|$t$uՈ?iiPQj:RV$D$ WVjjjP$a1Ƀىȃ^_[fffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[Øt$(l$$T$(1aD$8tПPQ, oi0loD$(8rl$ Pt$聜ŋ$t$iLiPQhRqQiLiPQhRG* 0nD$8tПP+W4$:&t$.&Ʃ01UPt$ƛŋD$G6&oD$ G = = D$8tПP+G^_[]ËT$((E^/]ZjUPQRVjڧUSWV׉L$[â2jeV {j+V{t-1|$WjPjcyFu<$|$1jrV1tjqE $UWdt1jru%e07$w$I01^_[]ÐUSWV׉[÷= tuh$mu?ru<6R$FtjPOfv4$+u4jj2f&v$tjPf6#^_[]ÐUSWV[t$0l$$T$081RD$8tПP(f&D$08rL$ Pt$ ŋ$t$iLiPQhR[iLiPQhRѠ4蔦0D$8tПP(Wy4$"t$"U01UPt$UŋD$G6"oD$ G = = D$8tПP'G^_[]Ët$,|$(T$0VWU! j}USWV[Ht$u"iiLiPQhR趟$8tПP '= t9ut@mt9uu+$8tПP&$h1VEu= $8tПP&|$jWu U ƃu Ƥ8tUtt$^_[]ffUSWVH[(D$`|$\u#ƍiiiPQj>R蓞t$$UVPWhtUVt$&`ǃu.'8uj7~;$} VP_ǍD$9tLV~A$jD$Pxt&UPt$hW h{D$$oH^_[]USWV4[(D$\l$Hu#UiPQj8R蕝D$lt$Xy1jiPQj9RjL$`u[tu.ut덻 tǸtD$T$\dL$00G?L$T|$LtD$HT$Pɉ|$ xGD$Gz9иG|{ϹdkdD$T$D$ HSQ|\ϹЉ)kϜD$D$ T$D$OD$ dD$D$0D$ڸD$ dD$D$D$`L$$׃t[PL$V;Z (T$L9v 4^_[]ÉŋD$\0l$,t)1vwL$$L$$rx|$j|$WQR葑t,jWRP~tjWRPj+щ1ɉ4$tD$LσT$(s1d;21g1di։Ńut% 44rŃu΃T$(19L$$}4$j|$WQR虐щ9} 4$jWQRsщ9} 4$jWQRMщ9}O4$jWRP'уjWQPуjWQPjWQRщ9} 4$%jWQRщ94$D$\|$Љ׋l$ D$D$Nj|$1ʹ9 d$0H0yWL$,ȃl$L97gfff4$ֺQ׉Ɖljҍ)|$ՋL$ T$ QGj4$Qt$V0WRUt$h赺$4$jjdQRω芎Ɖр|$ul$эo |$$t$($PRt$tS1ɐftsfTLLTftWfTLNTftMfTLPTftCfTLRut:N,19tDtPkt$FPkF^_[]ÐUSWVYT$tht$1BtBظkw+<tրztЃːt *u1^_[]ÐUSWV։[dF,F tv蚏FUPdl$~D$uNtQjP葋D$ L$$t$ F1퐐fj kTjPQhSVΤkPQhpV݃1 GtfLGtVLGtFLGt6=u $$$VPV$y$B @uD$$PQ4D$$PQR(u%#D$=@u;$s#E/$B$L$ ;$u Ĉ^_[]k/USWV׉ $[l$s$$u)kkTjPQhRV$|$$u"kkTjPQhR$u"jkTjPQhRD$f谇$9 $9=*uG=*uG=*D$GD$ 9$D$$)9$f:BD$D$ D$ $f9uxjkTjPQhRkjkTjPQhRҀDD$D$ D$f9Hu&jjTjPQhER腀L$1AtATAt1TAt!TAt=u1E @uD$$$PQxD$$$PQU$1ɋ $X#T$,@tsBЋT$$Ut$P$$BT$$UP$ $D$fD$f9u&j-kTjPQh/R=L$ftL$t,=tsAuE @u1$P -$hPQ8 E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃}1E qjMD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjnl ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ KE;D$f/t$$$P $$$$$U$u"jjTjPQhER{1$ BtILBt9LBt)LBt=uf$@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=pIM lt$10軀D$/ Njt$$E @D$uP`PUu n8t E u;$uĤ^_[]ÉNjt$ 'USWV׉[ôu"ՈTjPQhR&zl$(9rfu ^_[]1t$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$zf9u;Twˉٍ^L$ |O]u`$$;D$ u)1;T$t\$9vL$\$;\$(f$ω4$ލ^ρ]tN-uf9w f;Fw$~ːf9t4$뱍7kTjPQhR"xCkTjPQhRwUSWV[El$$ukkgkPQj_Rw$$tuX}1D$$tŋD$3l$ \@h@PD$(D$$D$ ^L$L$\QP_tYD$|$D$0t$\ d$<0fD$PPju\ D$ $D$1j1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tW4PWu uhaFD$Rl$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$kjPv u|$1D$Wt$MƋ$6yd$t$8D$|Ay DAD$$uD$*8ՋD$DJtDHD$D$ $@uP 8 DAթD$kjPD$p\jPD$p{ D$ |$t$ztG$`L$tZkjPq4@(jPD$p /1ҋ$tkjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1LD$ 1H1D$ D$D$8]v< BvY1D$ D$l$t) vD$D$\Pju+V |$u8|$ $%|$t.rjPu |$t&uD$u|$u8|$ $tt$Dtu Vstut$jl$ Uq 1$u UNP;$u!Č^_[]Ë|$|$[|S[Þjhjt$t$t$)[ÐSWV[l= t-= jhjVPt$$t8= 0jF#= = tP>= u^_[ffUSWV[|$ulkkPQj= t$UWP8 = u 1T$ Ɖ^_[]ffSWV[W= u= jP0xƃ= 1= t = 1W^_[ÐUSWV[{Wt= u= jP/x5ƃ= = UP+";D$wUt$襆1yr0W^_[]ÐS[t$-ƃ= [fffffffUSWV8[óu }D$D$L$$jjPQjR%rL$0 $$t;L$$L$D$l$tL$(L$D$l$_uVkTlHllPQjERkPdlHllPQjFRfk,D$,D$D$ l$_e^_[]ffUSWV [ÈolP.[t\ƀ8tUT$D$j PV7 tŋT$t|zt)ylVP51ɿ[kP&wAT@ʹ&u[@9~ $ljP襞,$lVP腞T$t$$D$ t l= RUPjQ!L$ t>= ^_[]ffSV[ = u*ǃ= "@PV = tt= =6VP1^[ÐSV[Ý~ǃ= = tP89"@PV苏= u=6VPJ1^[ÐUSWV [%~l$ǃ= ǃ= ǃ= ǃ= ǃ= ǃ= ǃ= = = hhU艜D$ 1Ʌ$t$'L$\ $t$ = L$l$<ǃ= = hhU D$ = t$P&_j\WVO t8t剃= 8#tj\WVN t8t뉃= j\WVN t8t뉃= j\WVN 68t牃= ǃ= ǃ= j\WVgN tD8tPu= j\WV7N t8tPE= h= |$$W  |$&j\PD$ PM ǀ8tW$u͍UW^th=UW]tTfUW]t@UW]t,ӧUW]tnUW]Q= E5xxMf l$<$j\WVM 8t牃= 8#j\t$VL t8t艃= j\t$VL tOǀ8t扻= nPW\"= PW\tb`= D$"@m= PQK = l$tэnQPh\uF= <$j\WVK t8<$tP= j\WVK X8<$tP= t$t$1ɋ;$u ȁ ^_[]SWV[Lyt$u"ՈmlPQhRcǃ= = t P轚("@PW= t,t+V= [u䍃= =6WP1^_[ÐSWV[Ìxt$u"ՈmlPQhRbǃ= = t P("@PWU= t,t+V= [Zu䍃= =6WP1^_[ÐS[w= tP]ǃ= [ffS[ÞwL$T$ j@t$[ÐUSWV8[fwu#֍kim4mPQj{Ra|$PT$urmim4mPQj|RaD$T$L8D$,D$D$(D$ D$$\$$|$ $9 EtL$|AyL$ DAMZu*?$D$6 .$&(,048)fA t$ K,UPt$rq tD$ B B (B `*UPt$@q tD$ $B (B ,B UPt$q ftL$f8B UPt$p ftL$f:B UPt$p 1tL$fB \UPt$fp tL$@B `,UPt$>p tt$DB $UPt$p tL$|B fUPt$o tt$B fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$&B aD$ `|$4&L$ qL$%L$)L$-L$1L$ L$5D$ PWt$@o tD$ UD$,Pt$#o tD$FUD$0Pt$o 1ɃtL$Nt+D$PD$4Pt$n t D$1vF UD$(Pt$n tD$ 1L$ F L$ D$ PD$(Pt$hL$ L$ t$L$ u&9k΍mmPQhR(Hbr1DPQgbt0Euዃ8 1DJtVet$F t$ (L$ L$ l$|$4=D$ fzB fD$4dxD$6D$50UWt$m 1tL$LB D$51UWt$_m tL$PB D$52UWt$8m tL$TB D$53UWt$m tL$XB D$54UWt$l tt$\B ǃA WEVǃtB WEV4$'L$D$;D$8u ȃ<^_[]*fffffUSWVP[[|$L$Wك</@t)9v"9vH8/u)t\9v N8/@tvljC 9thUWVƄ+C ^_[]À|$/tÍffffUSWV[Zl$UtNL(81DJuK4$JD$j PUu }t֋L$9tJ9tEJ^_[]ËLJ wӍ<(p@눉J8"u rL$ <$։q1늾=3ffS[þYj t$ [fUSWVP[ÚYt$tttnL$VtH|/t|$/u29r9vzz/u)ρwG hUPVӋƄ+G ^_[]fffffffUS8[XED$D$$D$ D$D$D$PQj tD$(|$0e[]ffffffSWV[LXƃtk|$|$uP1uP!jjP t8jPjWjW|W^_[jFfS[ÞWD$t=uG[t$ P[SWV[\W|$t$uaY(nmPQj1RAWhV ^_[fT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[U[Ḯ̀rS[äU[ḭ̀rS[ÄU[̀ffff̀ffff/̀ffff^̀rS[4U[̀rS[U[Ḥ̀rS[T[<̀rS[T[̀rS[ôT[ḇ̀rS[ÔT[̀rS[tT[ḓ̀rS[TT[̀rS[4T[`̀rS[T[R̀rS[S[2̀rS[S[ḩ̀rS[ôS[P̀rS[ÔS[ḷ̀rS[tS[Ḷ̀rS[TS[ḉ̀rS[4S[̀rS[S[Ḛ̀rS[R[̀rS[R[Ḩ̀rS[ôR[1̀rS[ÔR[Ḍ̀rS[tR[òrS[TR[ìrS[4R[l̀rS[R[t̀rS[Q[s̀rS[Q[r̀rS[ôQ[p̀rS[ÔQ[j̀rS[tQ[m̀rS[TQ[̀rS[4Q[Z̀rS[Q[ ̀rS[P[S[P[ᐐ*̀r׋L$Q1fffffỲrJ!Q@fffffS[~Pn=SV[]PK tFK PjtsK 4+K 4K K Rk ^[ËK HK jjjhjPj1tȉK uj$Pj j>S[ÞOD$K );K t P[à QP[ÐS[^O,jP@K uPj[ffffS[OHPt$t$t$ [ÐUSWV8[NulD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y8DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ PPPt$t$ ZD$x$W"Pt$W @D$x$WPt$W )D$x $WPt$W D$x$WPt$Wq uD$x$WvPt$WF zD$x$WKPt$W `D$x$W Pt$W <D$x $WPt$W D$x$$WPt$W D$x($WPt$Wo D$x,$WtPt$WD 1D$D$$T$EHL$D$D$D$ PPt$t$ D$@D$ PPt$t$  D$@D$ PPt$t${  D$@ D$ P}Pt$t$J  D$@D$ PLPt$t$ D$@D$ PPt$t$ D$@D$PPt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ .nD$ 7n|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$@n|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ VD$Pt$V ID$ VD$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP =L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$HQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$A(|$€´|EFt PAF tX~tI1퐐t(0F t(( F t( ;~s F @ƋF PF,t PF4tPF8t PV^_[]fffSWV["t$LWPVjW^_[ÐSV[!LV֓PiV输^[ÐSWV[Ü!LW蕓PPjWw^_[fffffffUSWV[K!t$l$uՈWqqPQjV"ffUSWV[+t$|$l$ UW0Ve`ffUSWV [|$(|$ u"qqqPQhRcT$,u&qq֍qPQhR7uJ<֋L$$ЋD$ \t < AnZЋD$ c-t^-?D$ )?tȋL$  %0T$ Јʁ0T$ 78LBu8LByp8THILH t   8DPutʋL$  Ј  = D$ #rѸ;a8DP0t$  QЈ0T$ T$=suD$T$ DA`%WD$1T$D$T$Ӂ¤TT$D$;u1T$ʀcw=ށƤ|$uT9T$*9tdu|$duq ЋL$  8DButʋD$  ʈL$tPL$ T$%ЋT$  Ȉ|t!&u g˫L$ Mt=u >1(8DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xsUSWV [l$(t$ D$D$ |$$El$ߐt$,D$PUD$P|u$D$͐׊D$l$EjD$ w"`sD$tmD$t]+t$ rqPQhRXrqPQhR.-޷rqPQhR ^_[]ÐS[.t$t$jt$ [ÐS[jt$jt$[ÐS[jt$t$t$[fffffUSWV[Û@L |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉDL uj(ƉDl$UXtwn$Nj 0Q茸 1XL utjh=tʼn@L 0ƃXL LTtMjуDL @1t*n$FUQj Pa |$z^_[]ËDL )USWV[+HL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉLL uj(ƉDl$U`twn$Nj 0Q 1`L utjhʼnHL 0ƃ`L L\tMjуLL @1t*n$FUQj P|$z^_[]ËLL )USWVP[úl$U踺NjPL $tOs;1҉v\L ljh=PL $uƃ\L D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0DL tuR:Tt!jуDL tiE$SDL uj(2ŋ$,tIEj |$WP WdtE@E$L$1E^_[]t$dt@ϐUSWVP[l$UȸNjTL $tOs;1҉vdL ljhTL $uƃdL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$ t0LL tuR:\t!jуLL tiE$SLL uj(Bŋ$,tIEj |$WPѲ WhtE@E$L$1E^_[]t$ht@ϐUSWV[ t$|$ ltЋ@L t61=tDtPǃ@L D$L$ƃXL PL t?1=tDtPǃPL D$L$ƃ\L ǃDL TldD$ X1^_[]ÐUSWV[ t$|$ ptЋHL t61tDtPǃHL D$L$ƃ`L TL t?1tDtPǃTL D$L$ƃdL ǃLL \phD$ `1^_[]ffffffUSWV[õ $tA$1uhzƅtcD$E/$tt$$9ux/Ĕ^_[]?$9u/>?USWV[t$tD$tdPV$xaa1ɐ΍,?UQt&UP#y.w8"tV 1^_[]ffffUSWV[[t$V^lL PhL ƃpL 8 tj~V:u^tVtDi@u\uRDQ@u말:u~u'hL t PǃhL ǃlL 1 ^_[]ÐUSWV[;|$t$L$W91:u?8u(t$Ր}^8uuu@tp:ute:u^UwjwPQhR"_wwjwPQhR81~@t^_[]ÐUSWVP[*|$t$u"UwjwPQhRl$ tt=jUjWV^_[]ÍwwjwPQhROuÍՈwjwPQhR)럐USWVP[sl$LL$8u"wwjwPQhR$du"*xwjwPQhR$lu)wwjwPQh Rx$|$pu)ՈwjwPQh RD$ t$ l$4$h\$hL $lu)ՈwjwPQhR$|t$tx8t$tD:;|29v&t:t|u싌$lh諾$ $L$1xjjjUPt$e6xPQh|$XWGjjjh@Wjh@uo D$jl$|$(1ɍl$L1$D$D$L$$AD$ ЉL$L9rT19r=|$T$\$hQl$ UYn ƅ,4LT$|$< u|$$tT$ $1s$#gT$$lu-\$ՈwjwPQhR$|$tX8t(a:X|O;$v<t:t|u싌$l듋$$$L$$t1<9< t+< t'#<:t <\ut111D$9;|$L$$T$ $)\$PL$QT$+$‰$L$$|$|$t UmD$$t$t|$(G 4$T$\$t$ |$(l$t$ppD$L$,4$|$(D$$l$T$<:u>tuk{D$؊6U8u Xuuu@}=uUt @fƀ:t FuFT$L\$t$$Ut$ t$4 \$,L$Lt&u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:D$\$L$ щD$)9L$ |KT$<,$D$)\$D$PU))\$)D$Ɖ$T$<*)׉ڋ\$QVP Wt$DUܔ t$ t$,4/L$,\$t$ l$T$|$t U k<$ЋL$49T$v)RWuW~L$81Ƀ|$D$|$uD04$?20lL P蜸t$ t:hL PD$lL $D$D$ V4$$lu)ՈwwjwPQhRƿdD$M]h\M:ȉʀ0E€0 ȃE€0 ȃ0^u&M: tz:tuS|$)Fd$PW*у¾2w2$:밃뫃릱뢱 랱 뚱 떱 뒉l$)u! +F$PUtL$($WU~ ^_[]ÐUSWV[t$ l$ B|$$d\$~E<:uM8u*t&M8uuu@=uE<@D$\$jdJƃdNJD$\$E<:u)FdPW衶?ƹd뽍U xjwPQh"R.w xjwPQh#R|$$Τ xjwPQh$RzUwjwPQhRXwwjwPQhR1)nu5 Q\$UW萵t2L$$:\$w xjwPQh`R\$W^_[]ÐUSWV[Kl$t$u"UxjwPQhqR|$MtAp:uu8ut݉ː3V8uău뻀@0#uN@0F MlF,8t 9u1yՈύwxCxPQjER9MQF$j/WOt[FFF ~ PݚtF8F FF 1 t :tttщV NыV$~(׃~N~r;xjPjV v(vjqV xjPj^V ~(FF8hWvPD>8/>9v$uP FN8D} .~ wF F P[BuWv W tŃ~?:}|@uH)ƒVԍ]ZF F BBQWPB uvv aW ?~?:uF=~t   8u F,;8u e^_[]讁S[^40t$t$ [ffUSWV [!} lF FEFUVzRu)ʃԉF:FJFx9u40Ru-V N ;Nue^_[]ÀfUSWV0[slD$(}xPQ6^L t$M L$ML$f|$ L$T$|$QRj WP?uOt$ rF|$j WPX u0O L$FD$D$ PjL$Qb 79_t$} urP tgM9uWM % x?QPR}WuJ19r"y";L$(L jjP@ PJD$t$L$ WIt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVu ;EsD$t$W+HL$%D$"T$ ;UwRPu薱 1ɋt$;D$(u ȍe^_[]V~S[xjPE9L ]h P;>P [SV[L hVt$t$t$%t1^[fffSV0[Êt$DD$@t2D$D$ D$HL$ $@D$1L$t .$ tEt@u%{{yPQjJR{E@NT$RQjjjuЃ>T$u-5|(|<{PQj[R4T$,$ t|$ tEtHHu0{{׍yPQhRݨ|$0EHHPVt$0t$0WRUуt 0$^_[]ÐS[HPt$t$t$t$t$c[ÐUSWVP[úl$t$D$ $ t t@8u'h|S|yPQhR@8QUVwЃt 跭0$^_[]ÐUSWVP[*l$t$H$ t t@8u'h|S|yPQhRu@8QUVwЃt %0$^_[]ffffUSWV[Ût$l$胫3PQW* t"t$ VW "WjjPUu6PQW t$fffffffS[jt$t$t$&[fffffUSWV[ػl$,L$(T$ l7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]RUSWV8$[P$Ll$4u"|||PQhR謥$PD$u,$Pt"|||PQhRqt$$Xu"}||PQhRA$Pt$Pr 9FjPD$tk|$jW~D$(D$ tND$1ɅujW~t3L$$\$T@u%t11|$l$r1҉D$L$ |$41 tw|$tE9sP r L$4QPUWkx9!xt19)u|$T$$l$);$Pw|$$Xt$,V.bD$jP}tT$1 T$|$$T@uW$L$,Pt$ QW^t4W躙$t 8D$1D$(vt$,L$ɸttQȃ1Ƀr8T$1ɐ44t tt tt t 9uӅt!1ɐ449uD$l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@}||PQhRHIQ}||PQhR$g}||PQhRUSWV[D$(|$0L$,T$$l.l$T$L$l$L$T$ jWPjUa1xL$ȋ;L$u^_[]HUSWV[Ël$ |$t$t VZ1L$1jUWPV^_[]ÐUSWV[;l$$|$ t$t V:Z1L$T$jUWPV^_[]ÐS[L$1jt$t$t$t$f[ÐS[þL$T$ jt$ t$ t$ t$ 4[ÐS[~L$T$ t$ t$ t$ t$ t$ [ÐUSWV[8L$(T$ l7t$T$L$[D$L$11jUt$,jPxD$Ƌ;D$u ^_[] GUSWV[øD$(L$,T$$l>|$T$L$[l$L$T$ jWPjU1xL$ȋ;L$u^_[]FUSWV[;|$t$t V>X1[L$1jUWPV^_[]ÐUSWV[|$ t$t VW1[L$T$jUWPVN^_[]ÐUSWV[Û|$t$t WW1[1jUt$$PW^_[]ÐS[N[L$1jPt$t$t$[ÐS[[L$T$ jPt$ t$ t$ [ÐS[έ[L$T$ t$Pt$ t$ t$ ?[ÐSWV[Ì|$t$W7uGكs^_[!t_t$t%<FF ^_[ÐUSWV[ |$ u ^_[]l$ t$W\t t- t(WEtWPu뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[X|$0t$,Wt$@{D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ襊$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/8DPg%0W$\P$D$4@uW讉u#8DxuGws>4$$^_[]ËD$4  !rfUS [E$D$D$D$PQD$e[]fffffS[Ψt$ t$ [ÐUSWV[Õ$$%= uRl$|4$Jcƅt1~(Pw,to‰4$D$4D$t$@(ueO@4u\D$0D$(D$D$$31fGHЇG D$4l$L$ $Љj0 t9D$"D$ <u 胇G OJuD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR7l$ǃt$<)l$ D$8D$D$14$D$Lt$w7DžN( u" .uGt<.utʐL$tXw PPōG UTD$t1 .YMPNQPT$ R` u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRZ4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$H1}v}PQh1RL{D$u‹.1F)EHftf },$FtpP[u|$t$u N)$xDuW@8/tOF(uIjh@P tFFU $U<$u~ljF^_[]FUSWV[ët$ug~]~'~PQjBRz}t v$u>VD }t!v$Sv$Hv$ZVZW^_[]fS [ HPQt$ t$ ,$ [ÐS [ˎt$Pt$ t$ l ,$ [ÐS[ÞL$T$ HP[ÐUSWV ׉[dT$4tbQ=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWV*=u4~"كpTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[NL$T$ t$[ffffff̀rS[[̀rS[[ ̀rS[Ԍ[SWV[ü|$t$u~t~PQj*R)w9tt F9u1^_[ffffSWV[\|$t$tt1WVn^_[Íeo~~PQjBRvuύpo~~PQjCRv뮐SWV[܋|$t$tt1WVn^_[Íeo~~PQjBR7vuύpo~~PQjCRvfffffffS[^L$T$ HPt$ [ÐUSWV(T$["ɉ\$u'T~ST\$PQj?Ru\$t$@|$ |$<t9D$<|$ "v)4{1t$\$VPj\$ u+t-t D$ 1D$t$uQjWPD$T$:D$tsj1ɃD$}tTȉ$t-G $ QPeT$uG $ u|$tGRM|$y"wq<PQhRll$,}+u uD$EL$ME U'!1^_[]ÐSWV[ t$v jMFt8PMMuF^_[ffSWV[üt$|$tt;  QPc^_[ÍzPQj:R luōzPQj;RkffUSWV [8l$@|$8T$40th=t= t=|$8uF1|$8@L$8L$4L$0L$ D$t$ D$UPQVWR=tot$<ȃwX1fFFu:<>@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[[USWVXXD$|$xt$lu#\$wPQjxR-jL$ttwH\$o\$_PQjyRi$vl$p1 D$͉L$0A\$P9D$(u&\$_cPQh&RriT$tЃD$u-\$_#PQhsR*i$؉D$$%BD$l$ T$tD$t$ll$ ЉÉD$9D$$wϐD$$ŋt$l9vߍ4\$t$|WV$ ~L$tt:1ҋt$D L9u׍*t$t)փ|$r؉΃|$r1Ґ ,, LllLLllLLllL9u4 |$0l$(/M=\$cPQh'VgU#PQhrVt$|g$'u1\$_ύ#PQhsRAg$D$l$ .؉D$$BD$4݉\$ !L$T$t,$L$*lj$9؋D$$w֐D$$ŋ|$9v4\$t$|WV$\$, ~L$tt$t61ҋt$D L9u׍*t$t)փ|$4r΃|$4r1Ґ ,, LllLLllLLllL9u4D$0|$( l$ /L$<t$l\$t$|PV$ (L$ىL$,D$L$tID$8|$ʉ\$|$ 8)L$(D$L$T$tD$0L$(t$|$ 9D$9$slNjD$84(L$ \$t$|VW$ L$83L$ D$;|$ r"<$t$lT$tL$(\$|$+l$$t$lT$tD$0|$;,$ED$)σ8D$|$tt;1ҐEL5MD59u.)֋L$(|$4r*փ|$4t1ҐL,l LllLLllLLllL9uՋL$(L$ 4$9D$$|$ 4$D$|$x\$t@D$$ $ȃL$tU0uuD$,L$t9rދ,$;l$ t$lD$$\$t$|UP׋\$ L$<D$D$$L$|$ 9T<\$t$|VW$ L$0Ȩuĉ+D$lD$(T$\$,tL$t U7uuߋL$t9rkT$tD$0<ȃ98"z|$<T$HD$‰D$0t$L9t$lωp9׉t$LtՉЉt$D͉L$(|$@D$P&D$DBD$DD$PՋT$T9tl$ ŋ)<|$ 9t8|$T+|$@9D$,9l$ ;l$ 9|$ \$t$|WU$ \$ |$~ \$,l$1҈ډT$|$T$t\$9؉|$8 $l$ \$t$|Pt$D$@$$ ;D$~DL$4i\$9 $\$t$|Pt$D$@$$ ;D$9D$<$w;|$4T$t<$9v,<$\$t$|Wt$$ ;D$~͋T$t9wԋL$4l$ 9F\$t$|Qt$L$ $ ;D$5T$t $;L$\$t$|Qt$L$ $ ;D$T$t $;L$\$t$|Qt$L$ $ ;D$T$t $;L$\$t$|Qt$L$ $ ;D$T$t $;L$sj\$t$|Qt$L$ $ ;D$~]T$t $;L$s:\$t$|L$Qt$$ ;D$~-T$t $\$D$9l$nD$T$t $9l$S|$tY9r 1ɉl$H9u)Ή9r1L 9uJl$ D$$<9v( $\$t$|Wt$$ ;D$~ T$t\$ $T$tбL$9vil$ T$tl$ 9vO\$)1\$t$|Ut$$ ;D$~T$tl$ \$뵐ً|$89l$|$tIE9rl$Ht`1ɐ9u)DE9r1  9uƋT$,Ѓ|$<T$,ONONONONONONONu]Ѓ|$<T$,rPMMNMNMNMNMNMNMNuD$ L$L$99s9|$ T$,d$Dt_|$L$(|$@t.9r9rL$(|$@|$\$ t%E9rkE9rL9u\$t$0WV \$Q <1X^_[]ÐUSWVXXxpD$ L$tt$ltwH\$ ` \$ wPQjxRZ$vl$p1 D$ʼnD$8\$ P*`D$($p߃|$,:BD$"l$t$lT$tD$ l$ЉD$9wӐ|$,L$;L$lv΋D$,<\$ QW$\$~L$t|$t@1ҐD L9u֍*|$t)׃|$rЉσ|$q1Ґ ,, LllLLllLLllL9u6 |$8l$(/M\$ cPQh'VXU#PQhrVt$|X$El$.߃JL$4D$$Ɖ|$, \$T$tt$\$ʼnD$;D$$w֐|$,l$;l$$vD$,<(\$ UW$\$~L$t|$t21L D9uՍ|$t)׃|$4rЉσ|$4r1Ґ l,LLllLLllLLllL9u2D$8l$( (|$/L$<t$l\$ PV$ \$t ډT$ D$[D$0l$ڋ$t$$L$<)L$(D$L$T$tD$8l$(L$t$t$$99D$ƋD$0,D$\$ UV$L$8'D$L$;t$$rƒt$T$tl$($ |$,T$tD$8;|$PD$4+t$lt$0D$tt?1Ґ 779u7)֋l$(L$|$4rփ|$4t1Ґ ,, LllLLllLLllL9u׋l$(L$L$D$l$9t$D$t$l$t3D$,L$tW0wuD$ L$t9rމ;l$$D$,\$ WP$\$L$<D$D$t$9iD$,4(\$ UV$L$0Ȩuȉ+D$lD$(T$\$ tL$t W6wuދL$t9rkt$lT$tD$8<(98BD$<T$P1ۉ%͋D$8ŋT$T|$D9*t$lωp9|$Dt$Ttʉ|$@͉ʋL$@l$(D$HD$LrD$HL$@9tt$Lփ+T$DՉl$L$H9t(l$@+l$DD$(D$09;t$k9cl$\$\$ UV$1ҋL$L$l$~L$0L$t$ډT$|$\$tl$ʍL$9'\$ $Pt$$;D$\$tڋ,$l$$lUL$9҉T$4\$ Ut$$\$|T$<;D$9D$ l$$w&l$9t$\$tl$$T$49vډ $T$4l$$*\$ Pt$$;D$~Ë\$t $Đ;L$D\$ Qt$L$$;D$\$t $;L$\$ Qt$L$$;D$\$t $;L$\$ Qt$L$$;D$\$t $;L$\$ Qt$L$$;D$~k\$t $;L$s|\$ Qt$L$$;D$~?\$t $;L$sP\$ $Qt$$;D$~\$t $D$ \$t $9t$hD$ 9t$O|$E9rl$t1ɋl$P9u)σ|$<T$0NONONONONONONOuE9rl$1  9u@l$T$$t$4D$,ȉT$$9v/\$ Pt$$;D$~\$t t$D$$\$tرL$ L$9"t$49t$|$9rl$Pt!1ɋT$ 9u)ʉT$σ|$<T$0l$MMOMOMOMOMOMOMOul$29r1L 9uʼnl$NjT$0D$\$ l$99su9k\$tl$9L$)1\$ Ut$$;D$~\$tl$L$뷐l$T$0d$LtO|$D$(t 9r9rl$(|$L$t)9r9r}9u\$ t$8WV \$ Q-1X^_[]ffffffUSWVP[b|$8tqw$G$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$/jUTƅtF PVWY( u$*jU!t@ PVW&( 1*N8t uNN $tD$ 81^_[]fff̀rS[t][ḃ̀rS[T][SWV [9]t$ |$uՈxPQj񐐐9t uD$))t8t)Pt u+D$ P^_[]fffffSV[ýYL$D$T$ yp9pRVQP)Ih6Q4P 1^[ÐS[^YD$y%p9pP PQj@RHh P j@4R P [fUSWV[Xt$|$ueoӁPQj?RiCl$t.̉)ō$Pet)1ҋPDĠXȠt1Р̠4$D$^_[]ÐUSWVP[êRWtIР010̠$9r$9r$Рi0mNA900W.^_[]ÐS[Rt$t$t$r [ÐS[Qt$[ffSWV[üQ|$uՈTPQjAR-<jWt DtVW 1^_[ÐUSWV[KQl$uՈTPQjVR;jUt=ǾtUWUt1l$UPt$ } "19s#8A!A8^_[]fffffffSWV[ÌP|$1t,PWt |$t=t=tƉ^_[ÐSWV[t41 |t$t$ t$ Wg uD$ <=u.|$$ P 9ttD$0P M9u;P s|9v9tfPǃP ǃP $jWP >0>8uyPD$0t$S )$jWP F>0?>8u4)  $PjQ[: $P L$P ^_[]ÐUSWV[xMP tP 41t0TDtPVtP Hى|$TjjD$P tE t5jVt$ F:P tVt$V/ŋD$P 9tPǃP ǃP P UjP9 ^_[]ÐUSWV[[L481tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[K|$1|PWtfƀ<=t^4tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[-KdP覾ƅtx;0^[ÐSV[JdPfƅt8;0^[ÐSV[íJdP&ƅt:0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ JD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[èID$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[(ID$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[èHL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ET$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$@D$@ @@@@@@D@0@h jP, [ÐUSWV[?8$Q ph EEjUR8jPǀPǀTǀX`XuTd$ W蚲ŋ@~uf~ XEuh?0l$|$ h @ hD$Ɓ| $1u0dždžjP=E08jPE0ǀPǀTǀX$X`wD$L$ȋ|$ F FFFFFFDF0@h jPT* W+^_[]E1␐USWV[{=Q ph EGGjWE8jP輯EǀPǀTǀX`XuTd^_[]ÐUSWV[ø<jƐ+w?uiƸPbl$x pxkX$, 1׉j0DžDžjPG08jP虮G0ǀPǀTǀXX`l$$1E^_[]ÐS[Þ;jl[fffUSWV[p;l$j(j$hjljt$V&n u<n n n $n (n Vجn $B z$HOHOO J HJ@BGGD$8jPdD$8D$ED$ E D$ED$ED$ED$D$`t$HjhPVP D$PVvD$LVPƉGPjGVL$dQP? O4$NGFL$ jhPQ VD$$P$ tp VD$$P t[D$$t$ VP\PQl1PQO4$1t\zPQ:XL$ D$$@tQЃt$$@PQ4$PGt P@W71t$;$ue^_[]%USWV[Æ8u"m\%PQhhR"n$EjhPW_ VW t$ VW tD$WP\zPQWD$@tWЃ^_[]ÐX7L$ÐUSWVH[å7lE$DD$ChPt]Ƅ$CAljPjx69PQWVD$SPM;$DuH^_[]$LÐSWV[6t$|$ttAG$NPVQ ^_[Ím%PQhR7!u%PQhR!뛐USWV[X6l$0t$,tt1}tWm%PQhR uύȃ%PQhR }~$juuPo GtP/GUD$P% tEFEMN,$UD$PGONGF^_[]ÐUSWV@[35Mq$F9AFD$D$,jvPWD$PWv1t_D$0jPD$0D$$D$jL$QPD$PD$P/tNjFMAVQ$D$Pt$VD$@t VЃ1e^_[]ÐSWV[<4t$u"mՃ%PQhMR~$wqGt Pav$VFt PFV=^_[Ð+̀ffffj̀rS[ä3[ÒrS[Ä3[SWV[l3|$t$t{WV薕t_GhPV蠣 tIGPVOt8G PV>t'GQjjWPVnu1^_[Í!PQjGR^f!PQjHR7BfffffffUSWVP[z2t$ D$8Vt$K1;L$$wD$(q D$8 $t*twWt$T$4;4$sc|$(uVD$tcutZD$(PjNjD$8u5PQ1"D$8ut$6 ^_[]ÐUSWV[{1|$t2t$l$VUT$,tt$ u1^_[]ffffffS[1t$ t$ [ÐUSWV[0$$l$t$Mtd$)VD$D$l$PUV p D$$ht$jU?L$u$1ҸD$D$MEf}T$ twPUV* f} D$9 $D$PU$jo J  $; .|$D$D$L$PQ|$WRVy x4D$jPWt$V@ xD$$|$33Ƌ|$+͍D$jPt$t$$ y(;$u Ġ^_[]Nfffffffh̀rS[.[WV^.D$L$|$T$ :t 0rJJ B^_ÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ A ÐSWV[.t$|$O1)rD$OVw PO w ^_[SWV[-t$|$O1)rD$OVPw  w ^_[ËL$A +AÐVL$Q qt$ Q1)| q Q^Ð1ÐÐ1|$uD$ L$IHÐVL$Q1r!D$ QQ ʋq q ^ÐL$Q1rD$QȋQ Q ÐVL$ T$r1)r rB J ^ÐSWV[|,|$t$t*tIWVzt\GhWPV Fv@PQjWRuwv@PQjXR1^_[ÐSWV[+|$t$tt3jWV訖 ^_[Í@PQjgREu͍@PQjhR"묐USWV[k+|$l$WUQ1GOhQPUo UPED$wPW@PQjwRJWV@PQjxR#8v@PQjWRwv@PQjXRGPl$UύtWU辍^_[]ÐSWV[)|$t$t>t`WVt(truGPVnt WV][1Z@PQhR(u˄@PQhRyWVp^_[ÐUSWV[;)|$t$tnu"ք@PQhRWV觌t3oUVt"}uG TjQWPVb1^_[]Íք@PQhR7ukSWV[|(|$t$tt?GG>tP1^_[Í@PQhRu^@PQhRWV觋tGPVtGPV腋tG PVtkWV_[USWV[Û't$|$tmGou" @PQhREl^@PQh$Rq @PQh%RnJo t6tXudGFGF #@PQh R uGFG3Fn<Fn* GFG F   ^_[]fS\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffffìrS[4%[v̀rS[%[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[k$|$l$uoe,PQj:Rt$tu9#oe,PQj;Ru7tiFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1USWV4[Å#$Ll $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP8 ,$$XtY$\tOFl$0PQjUQ/Ux$\9ȋ$QU$` FfNƝQPR$`U$`.1Ʌ9$Fx$P$T)}PURQ.*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LƝQPR$`$`-l$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`~$PEDL$[PQ|$W$`U,t;$Tg$P$T)D$D 1P|$Wt$L$QRR,L$)D$D Pt$t$t$R,L$)D$D Pt$t$t$R+L$)D$D Pt$t$t$R+L$r)D$hD Pt$t$t$Rn+L$9)D$/DPt$t$t$R5+L$)D$DPt$t$t$W+19D$F$PED$1$1[D$ 1D$D$׋D$ tD$ $ 1QPt$t$Uy*H)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$*L$ ;$T$,T$0L$RQPW#t(8W$\9vpD$0Pd;fǍ$0PQhWs)W$\9v QW$` %1QW$` D$0PhdFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P[$1111 Ӊڋ6teN tFtI@r8ߋ\$É-PQhcRF H1 t1덉\$$\$$\$D$1\$P`l$D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj6D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$#D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$N$l$$L$ L$덄$Pj?L$1;Bu>T$L$T$Btۋ$NF\$$T$jT$ ߋ\$IjjP5 x Px.8L$$Pj`D$1uyxj%$PD$8($'L$8$)L$D$D$P$t$W7$(t$DQD$uD$uL$rL$$L$r93|lj$$Pj$$WtGo\$tP؋\$$$!L$$$PRt$W6T$vu4D$ 8\$$ЋD$ D$87\$t$8MDž}l$$D$ @xuD$ @Džu$-PQhuRD$88tqGPZfD$>PZfD$>PZ f|$fD$L$f"D$<|$h$!VWt$@9rt$ 1)ƋD$ȃWVPs^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [h|$$l$ lD$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW> ;D$uY ^_[]Í~gRPQhRZgRPQhRҭeZffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8lD$D$ L$81DKNl$\$1Ҁ0u.N t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RHlWjP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W { Pt$l$ Uz t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjRT$ |$L$F t[l$Et Nj,$U \$Wt$T$ RHy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$xT$ L$E E$\$l$TUy/4$Uy$L$$9sD$DQy1ɉȃ0^_[]D$D\$SV[t$ u"{{+PQh/RkV7y^[ffffffUSWV|[èj$1tGljPW蚀t)l$XD$\|+W) W1|^_[]jjWjjUjSWt҃UD$ l$<$D$ƅuUW뚐USWV [Ȭ|$$(rl$ NBCD3EB 3M t 1 ^_[]Ë|$,jj jV4 ^[fffffUSWV|[x$$$T$LT$L$$xl$L D$0wD$4 󥋼$D$0 wl$TD$XD$DD$ZD$@D$\D$<D$^D$8`t1 l$HxL$4,耉tXǁ t>Q 9quJْ$D$‹D$4$ =t$]D$<$7L$HL$D$ l$׋D$$$軲$`$ttl$$;%`t %)l$ $D$D$et$L D$06vt"l$ $D$D$dt$L D$0ut"l$ $D$D$dt$L D$0ut"l$ $D$D$Pdt$L D$0vut"l$ $D$D$dt$L D$06ut"l$ $D$D$ct$L D$0tt"l$ $$D$D$ct$L D$0tt"l$ ($D$D$Pct$L D$0vt$t"l$ ,$D$D$ c`tL|$4tL$DL$ D$0D$,$tXƁ Ot yI u]D$4$D$4L$@L$ D$9l$$$~虅Ɓ Ot yI u]D$4$D$4L$6.ē&ٓԓ^_[ÐSWV[<|$uƁYjVWu yWPV# ^_[ÐUSWV4[$lD$0D$IuD$HL$j.QPjzT$PQj.jRx$tEL$PQVP D.0;D$0u 4^_[]$USWV([Ht$L$-uAD$QD$ +tD$ +u AD$Q8x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXX1D$88D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʋ$y&֍hPQhRiЃ^_[]ÐUSWV[#}eD$|$D$ D$P JlHHPP˔0ppp RQWjV譋$r D$ƀe^_[]USWVP[Ú~l$PU~ pQPUftBPUHIPU0HPUOPULPU[jPU$ 1uR8MDHt?nj PU脖 m8u$8 D$/t $ 0<HD$6t8^_[]ÐUSWVP[}l$/PUtxF u6jPU# 1u[8MDHtHmj PU肕 l8u $8 6D$t8^_[]fffffffSWV[<||$t$jWQLGHO~;G~ t H WR)jWN^_[ÐSWV[{T$L$Bpr~ ;B~ t 2~: RQȏ^_[ÐSWV[y{|$(D$$u$Ps$D$D$D$D$ jWbKG0u ǀD$PW^?jWAM^_[ffSWV[zLaHt |Jt| @t |A|?t/t5GtU\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$uD$E0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4scD$E4D$ Cf U0}4D$u0}4WVuZ C)ljD$ s2\$L$ujQjhRD$(D$ Ɖu0}4\$uuU$+PWQjdjV]9E4BPVu0< E49s)\$ujQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$uD$ E0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4saD$E4D$E0A\$Af E4w-u\$jQjhR\$E4M0QU0E4AE= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W[9E4@PWu0: E49s%ujQjhRE4M01U0)E41E4u0} MU }$"u UD$ E HM HL$HM xQ:ƃE t$ XLV|$Wt$PQjdj$$+WZ 9E4?PWu09 E49s%ujQjhRE4M01U0)E41u;D$ !u E PPL$ Qjdj$+W?Z9E4B?PWu0'9 E49s%ujQjhRE4M01U0)E41u E PAPt$ jdj$+WY9E4>PWu08 E49s%ujQjhRE4M01U0)E41u gE PQjdj$+W4Y9E47>PWu08 E49s)\$ujQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$ujQjhRE4M0QU0E4AD$9`/}$D\$u M QU Qqu It$,\$QRPVjdj$ +PW\$ 9E4<P$ +Pu06 E49s%ujQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-u\$jQjhR\$E4M0QU0E4A9D$#M }4E0T$WP=;4E }4;E0 E4u)\$ujQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+WU9E4:PWu04 E49s%ujQjhRE4M01U0)E41E HM @Pt$ jdj$+WcU9E4f:PWu0K4 E49s%ujQjhRE4M01U0)E41E E P E Pt$ jdj$+WT9E49PWu03 E49s)\$ujQjhRE4M01U0)E41M AE  L$<%\$PL$ L$uL$L$*M01U0)E41E E |$\$7%Pt$jdj$+WS9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$4T$uT$ L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-u\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru CE PQjdj$+WR9E47PWu00 E49s)\$ujQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$VPjdj$+WEQ9E4H6PWu0-0 E49s)\$ujQjhRE4M01U0)E41|$\$E PL$ L$uL$L$*M01U0)E41E E D$\$O\$Pt$jdj$+WeP\$9E4d5PWu0I/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E `PQjdj$+WO9E44PWu0. E49s)\$ujQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0!' E49s)\$ujQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-u\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$ujQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$PQjdj$+P;F9E4:+Ƌ\$P$ +Pu0% E49s)\$ujQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$uL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$DJD$Q|$XWu u$E? E4u0} PVu,WI**E L$))|$1ҋ\$ɴL$L$ uL$L$$+р਀tsRPt$ jdjVdD9E4g)PQu0J# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$|$X\$PVQj2jWC\$9E4(PWu0|" E49s%ujQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$ujQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$ujQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$ujQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+W}A9E4&PWu0e  E49s%ujQjhRE4M01U0)E41E HM @Pt$ jdj$+WA9E4&PWu0 E49s)\$ujQjhRE4M01U0)E41E E ;D$%L$PT$T$ uT$L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+W!@9E4$%PWu0  E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-u\$jQjhR\$E4M0QU0E4Au wE PPL$ Qjdj$+W*?9E4-$PWu0 E49s%ujQjhRE4M01U0)E41u E P,Pt$ jdj$+W>9E4#PWu0 E49s%ujQjhRE4M01U0)E41u RE E P=E E P(E PWVQjdj$ +P=}$u E E PE E PE T$XPWVQj2jR=9E4"PWu0s E49s%ujQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W9E4!PWu0 E49s)\$ujQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0{ E49d\$ujQjhRE46J9D$E4D$W\$PL$D$L$uL$L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$g\$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  PL$D$L$uL$L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0O E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$6}4E0)E4u)\$ujQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W 19E4PWu0 E49s%ujQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0w E49s%ujQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0 E49s)\$ujQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$ujQjhRE4M0QU0E4A g}4+E0-E4u)\$ujQjhRE4M0QU0E4A}3}4E0 E4u)\$ujQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7}$+t$}$ +f@======2|$7}$+2z4|$7}$ +r|$7}$ +rz t$>}$ +rz4w|$7}$ +r|$7}$ +rz4|$7}$+Rt$}$+2|$7}$+2z4|$7}$ +r|$7}$ +Rt$}$ +DŽ$ +====2|$7}$+2z4|$7}$ +r|$7}$ +rz t$>}$ +Rt$V}$ +Ƅ$+=fDŽ$ +==2|$7}$+2z4|$7}$ +r|$7}$ +rz t$>}$ +rz4w|$7}$ +r|$7}$ +Rt$}$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$PL$D$L$uL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$\$9E4(Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$=\$jPjdj$+P(\$9E4 P$ +P|$ \$ D$PD$D$D$L$uL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$ 9E4M Pt$u0/ E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$ujQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u E M4 U0B  ru0M4B\$QVPb"  ƋM49s)\$ujQjhRE4M0L$M0)D$E4z|$)D$L$uL$ \$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P袨ɴPQjdj$+W6%9E49 PWu0 E49s)\$ujQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj}0WCƋE49s,\$ujQjhRE4}0}0)E4E \$u4u0Pj薇}0WƋE49s,\$ujQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$ujQjhRE4M0QU0E4AD$9w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$PD$D$D$L$uL$D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0z E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$ujQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u uE M4MU0B  ru0M4B\$QVP (ƋM49s)\$ujQjhRE4M0L$M0)D$E4|$t)D$L$uL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$ujQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u ȮE M4U0B  ru0M4B\$QVP  {ƋM49s)\$ujQjhRE4M0L$M0)D$E4|$)D$L$uL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$ujQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u E M4U0B  ru0M4B\$QVP[ ƋE49s)\$ujQjhRE4M0M0)E4sf )E4w)\$ujQjhRE4M0QU0E4AE4D$E0D$|$)D$L$uL$ \$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$ujQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$D$,;$p+u ȍe^_[]Ë\$USWV [H/t$,|$(D$ .ʋ7l$Ut$Vt$40RQ‹L$$7>tVt2$QW)$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sD$D$s@(D$ 9s$ujQjhR)))y"]UPQhR^ ^_[]1))lj$USWV Չ $[Ã-T$8D$4 D$L$D$"u$ujQjhR|$4QA$93<$779$xQD$D$uD$ D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$ujQjhRMQUA+<$-D$4L$D$ ^_[]ffffY?+T$4D$#ъLÐUSWV[ +|$ l$t$~Jt$~2UVAx(ƃ|$tލF9wȉ9v (+t$^_[]ÐUSWVP[z*|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }_(^_[]E ffGftC,$RW'xǃ9w,$)xD$ hHGftf,$RWՠf 8 9Xσ95,$)5|$ oGwtc,$RWc 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV ['|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$U蟞x(ŃtߍE;$wMȉ;,$v k(+l$xD$ h,h,L$H(ht$0QuuÝ]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5p(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[h%|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.A^_[]Ð~34$Ux(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu۩U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X"\$1ɐ\ \\ \\ \\ 9u΅t1Ґ9uT$r;t$@L$\$Љ\$0 $ L$L$L$|$ |$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄S|$ t;|$$sF* $D$  8t(y"PQhZR^_[]ÍPQhR|$ L×PQhR%ED$Urt$mu-T$ҋt$ tT$Di@tRjuYt$ tDi@D* ;|$$L$ <9=jfffffffUSWV[KD$$L$1wt|$ u [ "03PUWVt$(t$(QR- XL$uÐXL$wt1USWV[x|$0t$,1>0N xN|$|$4~D$ 8D$lj<wsGuL1Fщ$T$T$$l$TUT$t& $LQщ$T$,$TjT$$D$1պ r $?TWT$T$Dz$ʍF$и rL$ʋD$T$ <$tpD$ЉT$ ;T$4O*XNPQj>R[[NPQj?R47D$ ^_[]ÉUSWVP[jt$ 6ǃ|$uNPQjgRD$u f0x=|V4$~b1 9tJ|$,00r7 $ r7zB؃u9}B.벉$^_[]fXÐS[nht$ P [ffffÐ1ÐXt ffffffUSWVX[l$ll$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn%L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ %T$"jDPQj2jRCǃ9WD$"Pt$ t$VPt$t$)T$ D$@L$)L$tOT$ %|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p8 txҋ9|Wy>TWPڋD$+D$py(ffffUSWV[l$Uƃ;D$v#(`|$UW+1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[5$l$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]ffSVP[ÜL$t$D$T$ $xRQVP1!x9r豬RQP艩 ^[USWV[K|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[|$t$l$tt$$PW%t^_[]VW t W LJWVUF ͐SWV[Lt$|$jW1Ƀ PVW ^_[ÐUSWV[ |$tt$O#PW$tG0l$VW/ t WRLJWVUM ^_[]ÐSWV[Ìt$t5|$r#u#jV#tjV$F1^_[S[.D$tL$ ttu H1[i[ÐSWV[t$t_|$G?wSL>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[Lt$tAjVq"t2|$jV"wsf~ 1c^_[ffS[L$T$ HP[ÐUSWVT$0L$@[ØuD$\VjD$ P荹ǃ\$D$t6b=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$T$L$H$D$D$D$D$\$$|$,Vt$8PQRWYǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\j$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$(LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$(L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$Ht$,PVD D$,\$wPVuD$,D$$\$L|AɋT$0tD$()0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$( $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$,! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[|$  7 >L$s*D$@--tr0twPu@-[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[D$HrM %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[Mt$ >t0VS 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[ÎD$ L$t9u[ÍřPQjpR9S[>D$ #L$t9u[ÍřPQjpRD$t&L$tu1u 1tÐS[îL$ D$Qss)ǀ[Ãuu ǀ[ÍřPQjpR5S[>D$tL$ t 1[[ffUSWV[j ۧ1tQ@@jjPh &(8t(W(^_[]ÐSWVP[{|$uog/PQjZROGQ9u0$jQPh 08t  G $GT$pw1^_[ÐSWV[t$tRtC|$t3~t-0$~r4 ;~rPV^_[ÐUSWVP[jt$u"oz/PQhRF$t(.1tt$Vrt 9<$u1^_[]ÐUSWVP[T$J $Ћ*1|t$Wt94$u|$ l$tWE$F;$} $)Qtu<|uprP $كU|vx ux P &t&D$j.PWV$"tl$t$x D$P5|L$QRPD$PWU& $t!Qbl$|$TG )|$TW4$.l$tNjM;L$ l$D$9r\$VpDfD$BFP_DǍFPQD΃ 931fT$Bf"D$+<|$l$H\$h$+Pt$Wt$uYt$Dj=9ƋD$L$0)9%\$Qt$HPe D$$LΉD$ꋄ$H@ tՍT$\$t$0D$D$l$ )ՃL$0)9sыt$FF\$URP& V0l$l$$T$<)ƒ\$0)19s>Q1$X;$(uH,^_[]Ë$LiRPU蟊 1ɋ$L뽉&F|$;\$OW USWVT[$h>L$u&V ՍPQh^RXWt1T$ T$G j(nz¸RD$D$ D$$D$'$1ɉ|$ D$ L$Pt$ Vhǃt$Vt$  t5ꐐ< t쐐D$D$ t$h < t< tPWht1ɀ8 L$ D$1ɉL$L$ t WPɠtT$$9s9ȉ86(Pt$T$$ D$ + $$ȍQ8D$H|$|$ D$Ɛ w`L$ $l$9r4T$(PL$Q~s l$T$+$‰$2t$ VfAƃL$sD$!D$$D$#D$ #$hL$$h|$ ?$nL$<)N)‹D$ L$HJL$)T$L$ωx|$t$tjD$B 19wz $PQW L$ A<0A )Ń9t$uыT$ B#PׇbL$$h|$ :ȋL$D$PNeƃ)s4$h$P臇F q1T^_[]ËD$D$Vt$ W8 D$ 8|$tsD$D$wD$1ɐ$L$D$Pdƃ)ZVt$Wх D$ @L$<9L$ut$ FL$4$谆8$h$hL$USWV [t$(|$ u".PQh Rs.vx ux PV x t$t</$UcL$QRPUVWv  $tQх|$ G .T$|$ W74$蟅uǸ ^_[]ÐUSWV[t$|$l$4x x Ph@QRUWV#^_[]ÐSV[ít$ 4x x Ph@QRV^[ÐUSWV[k{44t6ƋT$L$x x Wh@PUVLVA1^_[]ÐSWV[07uW7tXǃx ǃx ǃx ǃx ǃx x 3x Ph@QWV^_[31퐐USWV։[Ttt<|$0t^ԜPQh`R謢učԜPQhaR膢|$0u!ԜPQhbR]! GG ?.D$ D$$D$t$JD$FFD$F t$..L$0))9|h)ƃ1t u/t$ t$hMt$ D$ fD$ gt$t$hNt$ ?E^_[]fffUSWV4[xl$PlD$0|$LuQPQjIRڠt$Ht*tIL$L;L$0QPQjJR艠ut$Lu"gPQhRZ|$u"gPQhR0D$,D$(D$$D$ 1ɄE<:u~:7t$LL$ $t$ ~D$L$$L$1D$jD$Pt$$V ujt$t$ V t*Yt$) Ɖt$u1ɀ|$:/tA?z$L$09ȹcT$f $f1$|$ D$1|$ |$$D$t$諤/t$$p1ɍD$09L$f$f4$|$D$09tu+D$T$ҹt:lj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ V1ɅL.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0u ȃ4^_[]AJUSWV։[_~8LZu 1^_[]É4$t$0t$u'_ t E<)׋$$x`<$1L$D$ D$}T$uU u$T$E ulD$;tM "E=t܉t$L$0QP{t$ T$ u#D$8=u$ELM D$|$uIt$MtȍL$0QPS{L$t$6$D$$ʉD$|$ T$,t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$$D$ u?tUPuTE)΋M0E0D$D$ L$$tCE<)‰T$Ή4$MuT$$M8t$ ))ʉT$M< $+4$T$uED$ ))t$$M $D$ E L$,T$+T$T$($2T$9T$}oD$ L$(ȉE)΋L$$T$ y* םPQhRFD$uE@9tRqD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQqD$e ߋD$)D$U融u E;D$UotjUxĬ^_[]Wt$t$$uT$ !ƒtˋE0tU@9t QqE0EEEe jUw1뙋t$u)y', םPQhR܏E)EfffffffUSWV [t$@|$4\$u5>FD$FD$jt$8u1D$ D$t$<\$tj D$Pt$< ŅD$\$1Ʌtr|$~l\$ +tX9\$8utAp9r:1Ґ8uʃ9s뾐u.1%)D$ L$ÊD$t$3؞PQhRpEt`tBuU$EQUPA3؞PQhR"u늋EQUt$1^_[]ÐSWV[L|$t$tCu"I؞PQhR貈t>t@uHFWVP=I؞PQhRsu뙸FWV1^_[ÐSWV[ì|$t$tCu"_S؞PQhRt>t@uHFWVP=S؞PQhRӇu뙸FWV1^_[ÐUSWVP[ |$l$tRu"k؞PQhRpEt`tBuU$EQUPAk؞PQhR"u늋EQUt$1^_[]ÐUSWVP[J|$l$tRu"x؞PQh&R谆Et`tBuU$EQUPAx؞PQh%Rbu늋EQUt$1^_[]ÐUSWVP[Ê|$l$tSu"؞PQhFREtctCuX$EQUPC؞PQhER衅u뉋EQUt $f1^_[]ÐUSWVP[ʚ|$l$tSu"؞PQheR0EtctCuX$EQUPC؞PQhdRu뉋EQUt $f1^_[]ÐUSWVP[ |$l$tSu"۟؞PQhRpEtctCuX$EQUPC؞PQhR!u뉋EQUt $f1^_[]ÐUSWVP[J|$l$tSu"ٟʟ؞PQhR调EtctCuX$EQUPCʟ؞PQhRau뉋EQUt $f1^_[]ÐUSWVP[Êt$|$txu"q؞PQhRu&͍؞PQhRłtJt]uaGQWtQ $C؞PQhR|ua $G͉QWPt 1^_[]ÐUSWVP[Út$|$txu"q؞PQhRu&͍3؞PQhRՁtJt]uaGQWtQ $C؞PQhR茁ua $G͉QWPt 1^_[]ÐUSWVP[ê|$l$tXu"^؞PQhREtltHua1?$EQUPG؞PQhR輀u넋EQUt 1<$1^_[]ÐUSWVP[ڕ|$l$tRu"! ؞PQh R@Et`tBuU$EQUPA ؞PQhRu늋EQUt$1^_[]ÐUSWV[|$T$u&֍؞PQh*RL$u*qՍ؞PQh0RHL$(t )ŋt1tXuQBWQRP t?t=G UQWP%BWQRP ttG8UQWP 1^_[]ÐUSWV [t$$l$ u"!؞PQh^R~|$(tTtv6EEEL$QU/D$,!؞PQh_R~u8!؞PQh`R}c3؞PQhR}K>3؞PQhR}$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$Uj ǀ|$tB}u.u^[ÐS[þt$t$t$t$t$J[ÐSV[Ít$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[nt$ t$ [ÐS[ND$t$ P[ÐS[t$[ÐS[t$Z[ffY߄|ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX8$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$YPQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$<w;t$b\Gn߃^rxo;l$1\,, $*(wkdT$Ɖ*t$i $*(wi (Ћ4$(Wm;|$Yȃ|$ U(!Ћ$YPQV xuD$ ƋL$$ QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$kq(^_[]Ë$NqᐐS[΀jt$t$t$[ÐUSWV([Ø|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ f0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[oL$T$ HPt$ [ÐUSWVT$[nɉ$u&T$PQj?RAY\$t$4|$ |$0t;D$0|$ "v+^1T$$VPMu+t-u#D$D$t$0tDD$t$0u20u- '䐐v-'FtP'덅t Q'ǃԸ ǃظ ̸ и tY1и 9s=t7&GtۋOtw wуG;dtPXL볅t V~&ǃи ǃ̸ }$0@Ը t|Qj Pظ D$HL$L t$1t$Ĕ^_[]ÐS[~ZD$ L$01b_[ÐSWV[LZ|$t$wv<u 76_^_[fff̀rS[Z[USWV[Y|$ DJ$D$l$$Ht$L$T$(PVUWt$<9tJ $+t$ I"1^_[]ÐUSWVP[ZYt$I8$l$ L$T$$t$,PUVt$8=9t|I8+t$ oI"1^_[]ÐUSWVtՉL$^X$lD$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$4 u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$( l$$IʉЃ|$ g$ V L$ \$فt$DPQ$j Vb$99u\$΢k $@ D$( $@  D$( l$$hQkd)<4 kd(  $l$ \$.n\$7nD$\$t$D$qP$j Va$99u$H*R )tȋL$ \$فt$DPQ$j V a$9<#9uD$\$t$D$qP$j V`$99u\$;D$\$t$D$1P$j V1`$9cS9uB\$@n$H+HA$I ȋL$ \$فt$DPQ$j V_$99u$@t)$p$IЃȋL$ \$فt$DPQ$j V_$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$lAD$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$( D$DD$D$\$t$D$q P$j VH]$9zc9uRD$\$t$D$q P$j V\$99u$@L$ \$فt$DPQ$j Vz\$99uD$\$t$D$qP$j V\$9A39u"$H*R )tȋL$ \$فt$DPQ$j V[$99u$@L$ \$فt$DPQ$j V[$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$t$.RPQjVY$9)9u$9 9$Htȋ\$]t$DPQ$j VgY$99ur\$ŢL$$$Wt$ $ƒ8\$]t$D$qP$j VX$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP!ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VT$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j VT $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j WR $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j V?R$9qc9uRHx1t$DQP$j VQ$99u $L$ 1t$DQP$j VQ$99u $\$1ƍ|$DVP$j W$Q$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u785\$]\$$3L$ $<$\$t9u4$<$Ήƺųʉ kdk<)΍\$VP$j t$TVO$$99u<$D$ ;D$pu t^_[]Ë\$IUSWV [At$ 0D$PiT842$D$l$$Ht$׋T$(PVUWt$<9t1 $) 1"1t$ ^_[]ÐUSWV [HAt$ 0D$P蹴T81$D$l$$D$T$(t$0PUVt$<9tD1 $) 61"1t$E ^_[]ffffUSWVP[Ú@L$y~X$T$GsY11t50V\sPmVױ^[ÐS[>>\sPg[?SV[ >0V膱1 Vv^[USWV[=Tuɉ$t=W\$1=L$$ ~.( WPuD$$ u$hRJƉEtS$jt[jdždN-00|$~$( hWPO ut $ $BT$ $D$%n.>iFs5D$hFdNt$ t3;-00tB׋L$!Ɖȅt<$~81퍻 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[9t$/[ÐS[î9t$jt$t$[ÐUSWV8[s9M 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$*)L$ *11uj+KH(;\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}q`1ɋU+dF$ GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$n'1kD$ \$uuPV_tML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[l6t$0W\sPXT QjV0W覩^_[ÐUSWV[5l$t$0Wl$ u\sPTUjV0)W.^_[]ÐUSWV[Ë5|$t$0U( uƃ( U1Wj(t H(^_[]ÐSV[5t$L$t$j'ttH(^[ÐSWV[4t$0WA( uƃ( W( 1PjC't H(^_[ÐUSWV[[4t$|$0U̧( uƃ( U賧 Pj&ttH(^_[]ÐUSWV[3t$|$0UL( uƃ( U3t$jQ&ttH(^_[]USWV[k3t$0U\sPWTt |jP.U訦( uƃ( U菦jjƉUn^_[]ÐSWV[2t$D$t |jP40W,( uƃ( Wjj/^_[ÐSWV[\2t$D$tF t |jP40W豥( uƃ( W蘥jj^_[ÐS[1D$t@ PN[ÐUSWV[ë1t$tF |$0U( uƃ( UWj^_[]ÐUSWV,[51lD$$$(=ΉT$y |F g!D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽. 8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ USWV4[H.L$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(0V}( uƃ( Vd<D$|$L$jWjj'|$uL$jWjj~'|$t1ՉNjt$0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[,0$PP$ u\sPl$|$Tt?BR lP~;yQq|1)͋$Pҟ^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[[*0Uԝ$ u\sPlB|$t$TtWVP ƉU艝^_[]ÐUSWV[)lD$D$fBt π?:t W?:u$,?/4$\$u(\$jW=\$ Ws?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WutU\$j.PUt59tx/ux.uHt/uэ|$H4$$," 4$\$h@WuǍD$HhPW +&y \$0\$WD$(WgdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$USWV։[ÑtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$ 1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $X1 D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$UD$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ 5麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$臚)jhUt$ qT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP;)Nj\$jhUt$!L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ zt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP虗)jhUt$胗U\$CT1ڽT$\$jjdURD)jhUt$.t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4XD$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjHt$t$Pt$t$G[ÐSWVP[ D$L$T$t$ 4$HVRWQP ^_[ÐSWVP[D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[Ët$}XjWE`HM`~;Ep~ t EXHMX WRqjWd^_[]ÐSWV[ L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[íD$ L$ $XQPR[ÐSVP[|D$L$T$$XRQPV0D^[fffffUSWV[8|$$t$ |$(u|;ڤPQj=Rt$t qJTD$(H @1r<$tQt$uU;ڤPQjQR7j|$,WG uy$‰Ņl1<$1qyQuE)ljuދl$$$)1t$ ōACAAAjQKՋ)v1WPVS L$(9l$Q|uh}T$RPV  L$(A)y-;ڤPQhR1L$8A)AjQl$$jU$+D$1t$ ʼn^_[]ffffSP[=D$ L$T$$RQPK[ÐSVP[ D$L$T$t$4$VRQPA^[fffffffUSWVP[t$|$ujd/PQj>R8PV|1訮ht$t$ LZ x=|P[fF FfFfn vtF$F,F(F $tjjjVa^_[]fSWV[|$u|wPQj;RMjWҽw jWο^_[ffSWV[||$W臖;D$w+t$9w 9w9w 9wPWV虷 ^_[{fffffSV[D$;D$wt$ Pt$VY ^[<VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[[USWV[ût$u|PQjL$0ȁ1ҍ$X1 D$xT$|$t$8$u $\QwPƒ.D$ƒ;T$0v$D$8MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$0D$$xD$0|$\uƄ$/D$(t$Pp\$WrD$(L+D$L PD$L$W n|$ptD$'-D$D$\=\$4u#D$(8NT$ L$Lu]|$`o$CmD$@T$ L$߃GD$DufЉڋL$dtL$0\$@|B9\$0|<)y1ɉL$0i|$`$$K$?D$8D$' L$0ӋT$L$Lt $0|$@Љڃ\$@م D$0tD$0ȉD$|$X|$@2|$XC9D$@9D$T1ҐT$H11ҀD$D$t\$@)D$‹D$HЉD$L$T\$@9$GD$8D$%D$D$@D$HD$TD$D1)+$1 \$Ѻgfff)À0D$,L$ I<ϋD$, L$ IϋD$,L$ ID$,L$ IEHMPwEHMPEHMP1D$,L$ IEHMvEHM1D$ y1۸D$'-‰D$D$t$X1 D$t$u RjPj1Ƀ,EHMT$|$PH8T$T$ ϋD$,L$ IϋD$,L$ I D$,L$ I8EHMEHMEHM8EHMT$L$PT$T$ JEHM1qEHM1wEHM1:EHMD$D$H$QitO‹D$D$t1 $X׍D$tu $\Qt$ PR{t W虝1ɉL$8L$(ɋU$|$0x<$|$0Wjt$@蒜 |$\$4T$ tW+D$8L$0L$9GD$A$t$8zD$y"O)PQh&R3\$4T$ D$D$'1D$@D$HD$T1EHM1D$EHM1D$ 1GEHM8EHM1D$EHM1D$ D$EHM1aEHMD$ ɉyD$'-11D$sEHM0EHM7EHM811ҋL$t! t L$t D$$/D$ȉD$'|$0x% D$tRD$@ uT|$0uM$|$$|$@|$D$@D$?% T$0t9\$UρD$? ٍ$$t$XPWt$ t$PQ$|$\$uM$t=\$|$T$?T$D$$t$Xt$HWt$ Pt$0(.Ǎ$|$8)D$e!D$1D$@D$HD$TD$D$D|$0\$4T$ |$ ;|$D$|$'$/L$Lt)L$\$PD$D%D$\$4|$L$ \$׋$GÉ\$L$ [Uu/$|p$PQhR蟸U\$ۋ|$.$D$PR+D$D$ $0|$'sG >$B\$L$ rʋUu/$|p$PQhR޷U\$1ۅt<$D$PRn1ۃD$D$ $Xg1ɍ$E|$|$'u5|$|$'u D$ $|$'txD$'BL$ D$D$L$ rHUi$D$PR觐D$D$ $t $/Ƅ$.0$.BL$ D$D$L$ rLU6e$D$PRD$D$ $t|$OGL$ \$׋$GÉ\$L$ <Eu/$|p$PQhRµE\$ۋ|$$L$QPND$D$ $2G K$B\$L$ rʋUu/$|p$PQhRU\$1ۅt<$D$PR螎1ۃD$D$ $X1ɍ$E|$$|p$PQhRUD$hD$ $$/$|p$PQhR&UD$D$ $|$D$ $D$ +D$L$ |$|$ljЋ]D$G $BD$D$L$ r‰څu/$|p$PQhRGUD$D$t=$D$PRӌ]D$D$ $P1ɍ$;T$ $\$ T$ B|$lj|$L$ E$L$QP7D$D$ $L$4D$0|$D$DD$8D$BD$ÉD$D$ D$ EL$4D$0D$Dus뚐F$|p$PQhR覱EL$D$ $L$4D$0|$D$D)|$L׃UD$DD$8GT$ D$ÉD$T$ Uu3$|p$PQhRL$DU\$D$ۋ|$ $D$PRkD$D$ $L$4D$`B|$\I׋D$(L$dȉD$L+D$8L$@9ɋ]D$8OD$ȉD$L$ L$ څu/$|p$PQhRUD$$D$PR苉]D$D$ $vD$8$XD$x$Y$XG\$ L$L$\$ +u/$|p$PQhR=UL$1ۅ~$D$PRˈ1ۃD$D$ $P$|p$PQhRȮL$DE\$IL$M $؃L$GÉsT$D$`|$[D$0$D$BЋT$ L$L$L$T$ Eu3$|p$PQhRȭEL$L$|$C$L$QPQD$D$ 1D$$L$ "'1ND$щЉډÐT$$ 0\$T$T$|$D1ҿ;|$|$DڋT$rÃ|$@B<0:|$D0.D$LD$҉|$8^ $ 1ۍ$D$`1ɍ$D$8T$dBGLL$CD$ Eu/$|p$PQhRKEL$D$ɋ|$tT$L$QPӅD$D$ D$ $L$4t/D$L$ L$4|$D$ $L$4D$0+D$dуNj]ʋL$ D$G $BL$D$D$ r‰څu/$|p$PQhR7UL$1ɅtB$D$PRDŽ]D$D$ D$$1ɅOD$$4D$`\$ ]ʋL$ ϋ $ B|$L$GD$ څu/$|p$PQhR`UL$D$ɋ|$tU$D$PRD$D$ $D$`L$4t-D$D$`ˋL$4|$1ۍ$D$`L$4É\$ \$\$CD$ $0D$`BEu7$|p$PQhR膩L$DET$T$ |$ U $L$QP D$D$ $L$45 ( D$ $|$@)L$ D$D$׋$G|$lj|$L$ REu/$|p$PQhR薨EL$$L$QP&D$D$ $ D$G 9$BD$D$L$ r‰څu/$|p$PQhRקUD$D$t=$D$PRc]D$D$ $PK1ɍ$;D$ 1D$$D$ D$D D$0u ыT$ D$x|$ GD$D$JL$ rEu/$|p$PQhREL$$L$QPqD$D$ 1D$$kKD$XD$ $D$@D$8|$XT$ t0D$Tƒ|$H|$8D$L9wD$8D$X]D$D D$0T$ u1D$x$X$XBL$ D$D$L$ Zڅu/$|p$PQhR覥UD$7$D$PR6]D$D$ $|$0 L$ |$|$|$8|$8T$D$TuD$XUD$?|$ GD$D$L$ ruu/$|p$PQhRޤUD$tG$D$PRr~D$D$ D$$t'i D$D$ D$1ɍ$D$L+D$8T$X9ÅۉD$8ZD$\$ ؉D$D$AD$ UҋD$u/$|p$PQhRUD$tM$D$PR}D$D$ D$$\$ t-} 1$D$ D$1ɍ$\$ D$X8)׋$G|$lj|$L$ NEu/$|p$PQhREL$$L$QP|D$D$ 1D$$r D$G 7$BD$D$L$ r‹Uu/$|p$PQhRFUD$D$t:$D$PR{D$D$ $R1ɍ$?D$D$ 1D$$T$ T$҃\$H)ӃT$T)‹D$X|$8ljЅ‰\$H<47|$0ߋ$jj RW[F )ˀ0$D$$ËD$XD$H(|$@ ߉ىËT$DML$ߋ$jj T$HRW0T$D )ـ0|$OL$Y|$|$8|$tL$H t9ϋ|$@uу rL$L\$KL$HytL$H\$D$AD$ $|$0D$ 1D$$D$\x Ћ]T$ ߃]T$ D$G D$BD$D$L$ rljڅu/$|p$PQhR蚟UD$D$t=$D$PR&y]D$D$ $U1ɍ$@]T$ |$:B|$lj|$|$AD$ ryڅۋ|$0D$u/$|p$PQhR؞UD$$D$PRhx]D$D$ $t Y|$0|$\D$(L$d+D$8|$09DžD$8zD$D$L$ L$ rqڅu/$|p$PQhRUD$t=$D$PRw]D$D$ $t1D$ $D$0)L$ |$|$D$G $BD$D$L$ r‰څu/$|p$PQhR'UD$D$t=$D$PRv]D$D$ $P1ɍ$;׋$G|$lj|$L$ rwE|$u/$|p$PQhRhEL$tB$L$QPuD$D$ $L$4t*L$4|$L$4D$ $D$DT$ L$ |$T$ \$C D$$B|$L$ rċUu/$|p$PQhRhU|$1t:$D$PRtD$D$ $T1ɍ$A|$UuS0T$ Ӌ$Clj|$L$ UrҋL$4L$4u:$|p$PQhRyL$DU|$$D$PRtL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P\E|$8E|$8|1 uT t$ 9wS$w닔8wl$Pmt t$T l$PU\ / U| 룋$L$19u $P{l<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$袌USWV [ÖD$ 069rljT$D$uj$jWPH 辏(跏9$T$JHJHJHJHJ H JH RPE$jWP X(Q8t!G0t$Aj40*)4$PjVU $L$D$ 81 ^_[]ffffUSWVP[sEET$@t$DT$$dpU }yjjD$܋tT$\$8t$<EΉ7tƉP1t?D$|=WjP@ )޷jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]ÈUSWV׉[÷l$YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[ãm|$hE t$p |$<$ MM$Uyjjl$l$܋t|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPd )޷jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[E\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$yjuL$tyD$0D$lD$ $D$T$D$\$]uNjD$L$ttW% ?L$@\$D$4\$j؋E\$޷ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋|܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖw(v؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃ(D$u[j؉( ʃrx,vRt ,q t.,vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋`|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$(D|$<ػ8|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$dM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋`|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك`|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃8L$T$vث8v؃~0vtT$|$ ؋t$pxfa(ȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋`|1t$H|$)3jadwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PeWD$P#dW`VD$P؋|$ |$(|$ |wD$0ufsD$\$t$WOe\$ Džjwc|$|$l\$WPe`؋L$1ҋD$DD$4D$RC_D$t/L$4t9t\$Q"_D$\$P_\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$+^T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$^eD$T$|$Z D$1e^_[]ÉL$D$4|$ \$D$0L$T$tWjt$`L$¸tQT$Rbu d$|$ \$T$~0vt@L$(t$$D$4|$0thjt$`¸ҋL$"QT$RaD$ |$9t$D$ 1|$ \$T$N|$9u@F9L$|$ \$T$@<9uF9uL$1nFd|$,D$|$ 0|$0t!|$9tD$ 1F|$ \$T$)|$ \$T$L$NfffffUSWV[|$ t$`tD$.t>L$$t6 ruLQUI$t?$L$UO$1sL$^_[]þTs0ffffUSWV[[t$|$l$t?xצɦPQj5Rmu1 1 ^_[]fffVL$T$ tu1 ^Á1 ^fffffUSWV[ÀM1ЃωT$(ЃM$U (E81!|1 Ƀ9|$$PKT\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fyj<j)B$tW\$R&SD$PVD$ ,RL$ )M ~D$$Pt$ VL$ P_T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋|܃$ۄ$܋҉t$$~@CM ~O$VSM$U ޷jQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$w(v3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$Lwm<D$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$كx|$tT$L$؃ݜ$$$$$݄$(D|$@ػ8D$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكxD$!؃|$8=؋`كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋`|$XD$X fD$hl$h۔$l$X$$ڤ$t؃8D$D$9ك`|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ث8v#T$u؋T$xvq(|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋`|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtK+D$HD$T$,‹|$LD$~$RQOt,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$Q2QT$|$t$$$Y|$D~RD$T$ L$$jjt$H D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PRNDž~#T$?؋L$؃T$$jj QG |$@c΋$jj t$G ‹D$8 |$Dt$$$/L$|$D$D$t$QfFD$ t.L$t9t$QFFD$$P6FT$%T$$1|$D$Ȁy0ItL$RFL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wDO L$O ‰D$ t$QR< jt$MM|$D$ D$$t$|$ W_D$,t$WnNt$ t$Nt$t$,k$jj PE ljD$ D$L$L$D$D$QPƉ|$Wt$ Mt$ t$GNt$,N0L$ x $tPrDL$(T$D:Pt$ MVIDT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QD D$jj t$D NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VD D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$KL$ |$$F|$$t$t$ Z0D$ t$(Vt$bKt$t$z|$D$ jj QB D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPI\$ht$D$ PJugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ HD$I$t$t$ ID$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[ìkD$1r 1 9vW=t8Ɖ^_[ÐSWV[LkD$1r 1 9vWK=t:L$T$8ƃXt𐐐Xut^_[ÐSV[ýjD$ PHpR=^[USWV XjT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RU5F|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[þhSVH[ÕhD$0hjP)U D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQjKD$$D$ D$D$D$D$D$jPj=W jVjVS[îg:S[ÎgfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffUSWV[ëft$|$uΤ_PQj?RQ1tt (h1^_[]ÐUSWV[b}uu@\$D$4P D$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$(Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16(T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$()1.%+D$9Y+D$ىދ\$( ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$(L$@\$@1) L$,A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$(D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$,D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ\Ht$(PV'T$4D$(wPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ: D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhPb5 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}""P"L$D$ffffUSWVt$F98[1 |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[1u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[+0t$D$T$<n~,D$9r9s#L$9w)QjPn ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXO/@0@4f@8@af@e@Af@EfffffffUSWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[.D$H~( 1u 9r1$PƉ^[fUSWV[û-L$?tP裟 w t{ ?u1>PIƅD$t/Fn?tPCFF ^_[]1?tPت4 )ʉʁ oΉتoUSWV[û,t$tbF!r VO}t3W荞}F  tWk  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[è+l$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U1}$P=}T$,B ti4$\}th$P1}F  t14$͛$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[(j,tL$H@[ÐUSWV$[(D$9| 9}T$P7P|$, $r0wD$PjR5 $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rUK9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [S E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[u$t|1 1 [%PQjERP$1jjUm ʼn$tƒ9tE t)D$P$ts#D$ =uXtZfx $tu f~ $fFvtF$F,F(F OĀ^_[]fffffS[t$t$jt$[fffffSWV[|$u|ZcPQj=R]jWGHO~ H0 WjW^_[ÐSV[mt$ u|cPQjIRFHN~ H VL^[fffUSWV[ t$uڨPQj>R|atrt!w 11ҊNt\tGɍywl@ؐ+u˽뿁뷁 ՋL$) 1^_[]fSWV[|$f jW"G0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:|&PQj8Rf t  ^_[f̀rS[[SV[t$ u|a-PQj;R>F0u ǀVuFH^[SWV[\|$u|iPQjJR8uGG Ⱦ uuL_ O @G0taW@9t Q?G0GG81t&W]G GGfG u WG t' VPfV͊GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐSV[t$ u|iPQj;RNF Ш u V\1^[fSWV[Ìt$t1mT$ |$L$D$t#t8uӉ6@VRQWP@26@VRQWPV6@VRQWPL^_[ÐXL$aFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV-%$0$tNC}%(1V(1^_[]14dž$j$btJp|HH,H lH H0rPt~ot ub8~)1 9}8tQ=݋t P|zVt81^_[]ÐSWV[| |$tOW^_[ÐSV[= D$ p|$s t.jt$ 1odž,Xdž,^[S[ L$tAt[[ÐSV[Í D$ p|$tdž,1t$t$ ^[ÐSV[= D$L$ qtdž,&t 1҃ƒt$t$^[Fdž,빐USWV[ø L$(D$x)$xuLJ$LJ(LJ 11t f} t2nD$(tE9(G($19wJjjWQ}Ɖ鉅 hf}u A(9vA($9(LJ(u$lPQhR1(f|Eu;DEjVPW ƋhLJ(f}tf}LJ $^PQhRu1jAf|E@u(9LJ $LJ(LJ,^_[]Ë(L}w*jt$(t$(VRfu‰w$ trT}t$t$ r|})ǁ$w<$_ t)׋t$ ~t$΋|$$7)ʉW $(15SWV[||$t^_[ËD$tx4t&jjW uЉuLJ01뷐USWV[|$(o(o(OG0!D$;G9} $wD$D$ P$L$L$D$QPt$ݝ $L$QjP t$$D$ Gjw $tNG(PO 9~ LDLDG G,9vG0 G,Ut$Wى ^_[]ÐSV[t$ t$t$ #F,;F(~#F0^[ÐSWV[Æ4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBrUSWV[xD$ t$$|$ B~r\PQjbRF 7f.ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]fffffffUSWV[Ë|$oEtjPu觳 EjWu蜳EtP蘽E EtPwDžDžtPPDžDžU-W$Vv^^_[]ÐUSWV[È|$0D$,pFtjP6衲 Ft^_[]Ë 1uʃtttjj6g t$b1D$L$T$ |$# l$hxP H@b1jP6 6gY 1KfffffffSV[}D$;D$wt$ Pt$V ^[蜈ffffffL$1s!t11҃9rfWV_ D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[HL$8t$4T$0t'D$zD$ f@H+L$(fHfLpыM OLL$L| v6Wy ~uuWyT$ t$F($ < $uF;uFf9rfFl$ uwztzukfuf1ɸHzr#\PQjbRT$σ;L$ $ufjR6 |$p uL$IQ0VH 1M;L$Lu%P^_[]1f1ɅL$$_1yffffffUSWV([XD$ E9sލU,$D$)$hPT$ RQ$ $t#9<$v,$}/(9w$) $L$L$  D$D$$t%ht$WX: $t* $hW =蘾1Ƀ89t$1퐋D$(j?Pt$蜘 tWH0tȋL$):,T$D$19u^D$PW<uk9t$u? /ED$PW<E/1Ʌ#D$$=@Ž1詽1Ƀ8gdfffSV[D$;D$w.L$t$ 9w9w9w9wPQVB ^[%effUSWVx[lD$tD$pD$lD$hD$dL$$T$dPD$@FD$}fjN#$jN1$1$jN$jjjhjD$Pj9t$jt$P9 u4$W991Wu>}etUt< F FFFFF FFUSWV[$lE$L$ DŽ$DŽ$DŽ$DŽ$L$D$PD$`GD$\GD$XGD$TGD$PG D$LGD$DL$HOD$dVP$覓 j@jD$LP8D$, 9AxH 9P; "DŽ$DŽ$DŽ$DŽ$t$D$PA D$`GD$\GD$XGD$TGD$PG D$LGD$DL$HOD$dL$h$L$D$lD$D$pD$ D$tD$D$xD$D$|D$$D$j@jV7D$, 9t]xH 9ϋ$tX$lj jVo7 E;$u>Ę^_[]j$jPK7 j$jP97 P9$^USWVlL$[Ô$lD$$D$hD$D$D$D$ rT$)Љ9wʼn)$?D$9v) PQhR螱$9L$v)"PQhRo$$D$9t"*PQhR6l$ su/1<$@r`OPQhRL$(T$ t$ D$ UD$,Pt$$茐 <$@sT|$t!l$(T$ t$ WUVX |$ tD$(j@jPQ5 D$$;D$huTl^_[]Ã$@GtT$ t$ l$ u݋$$D$\USWV[e$l$D$|1T$L$OD$xD$tD$pD$ll$,T$lV} D$HFD$DFD$@FD$ D5tcju t$67g twH jP6i 7E (D W)fWfW7PQR> ED7fGG G jWD$0h 1^_[]ø]USWV4T$XDD$ D$PL$(f\$r+\$ CVPQh|R葑\$D$xr(\$ \PQjbRV\$D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$D$f;D$f9u(D$t$Tf9L$I T$ @T$LB4 t$4 L )\$LC T$ t փ L \$L$f9v>NL$TAʉT$T$LB4 t$4 D$f9w;L$,9D$$f9t7ŋT$HJ)fJfLBЃD$\$ Vt$Px;\$ r+\$ CVPQhR肏\$9D$0g|$t(D$ tD$ Kf1D$A4-=r+\$ CVPQhR\$D$HfpT$(B(t>BL$;u3Bf9rfBt$f9s D$HBL$L J)fBff9|$vD$Pf)8D$LD$ދD$f91i\$\$L{ \$ Ńt$LF)fFfD^\$ QRP9 f9|$t$19t΋L$I T$ щt$\$\$L{ 4 L \$ VL$Tyʹ9\$\$L{ \$ 1/fy&\$ CVPQhR4D$L$Lfif9uD$LfhD$4^_[]Ë\$ ^fffffffUSWV[H|$8D$,hEtjPu`c E l$wJrr GE(uI1GT$0:zD$PVtHUD$PV|$a$ML$fMjPub juu` t1BQ A8E,jju3` ?fpjWua jt$u_ Džwr\PQjbR G or&\PQjbRĊwD/DD$ l$\PQjbRqE,jju^ ǍD$ l$wr\t$ PjbQG GtfAjWuc` jVue^ Džxl$:eE(Err/D$T$ \PQjbR)D$$T$f9B$fD$},|$ f9{l$9aFjRue_ jvue] E‹npr׍\PQjbRu|$q2jWjWl$u^ <$wr\PQjbRft$><$fD$l$.E(uEft,$fD$$E($EfD$1OH$fD$u,9 GjRu ^ jwu \ ftB :$f|$wrjRu] jVu[ 1rjRu] tYjVu[ `@=r'Ǎ֍\PQjbR萆jR*|$B uSfiDBtjR7\ jV7Z 1ul$$fl$1l$D$D$ B fyDBtjRuM\ jVuOZ t3xr\t$t$jbPo{$8t$EtPfE EE($}fu E(jQt$  OfL$$Ɖl$;tjVuZ 7GfD$Gft$fD$t $A4 ;tjt$u>Z $@jPu:X :ʼnpr\PQjbRPfw,$l$fwWt$UN* t$l$whr\PQjbRf9u>pjPl$ueY tljVu^W fGOT$,‹OJ3t$ $;tjQu Y D$,0L$fHL$fH1^_[]Ë$;ujVD$0X ҸffffUSWV0[cu~,jj6V &|$ NL$eL$A }HʋfqDBtjR7 X jV7#V L$D$xr\PQjbR31fu:8u 9u1)^_[fYD$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^L$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPw F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjP w <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVWv^_[]ÐYD$ PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Þt$t$t$ [ÐS[nt$ t$ F[ÐS[NL$T$ j[ÐSV[t$ tA$j@PV[R FPhjPt F@FDFHFL^[ÐUSWVX$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8dD$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPj FP3nPtPWjPj UVj~jUxj FPNHVLN@VDPV^_[]ÐSV[}}t$ tAj@PVG FPhjPi F@FDFHFL^[ÐS[}t$t$t$ [ÐS[|t$ t$ [ÐSWV[|t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVh ^_[fffffffT$D$fUSWV[{MD$$&yd$Ḱ ~? gL$ \4D$? ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <8 1D$D$ D$D$L$8T$jjPQjRtD$88 D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$߬L$L$FL$L$6L$NL$hjjjPQRD$L$8T$jjPQt$R%L$81 urjPY _UiK1D:0D$D$D$ D$L$8T$jjPQjRt$8|$<QPWVyD$D$D$ D$L$8T$jjPQjR/D$XL$_ L$ohjjjPQR}uMD$D$ D$L$8T$jjPQt$RtD$8}ee^_[]fffffS[t. [ÐUSWV$[tl$8D$D$D$D$ L$D$QPj $P1tctDljhl$ t&< 9r 9s F V>t$$P6jVj9 $^_[]ÐS[r@ H P X ` h p x    t t} t{ ty tw tuh#-[1g`YRKD=6/ ( !   < [ÐUSWV[ëqWtV6u=aPwƅt3z=tUmuW@0H=tUmujW^_[]ffS [p t [D$D$$ T$jjPQjR0t1 uۭPQjAR[ 둸S\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[ûol$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP5OV QRPg ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRP`4t,NQW QRP FEE1^_[]ÐSWV[9nD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [lT$0|$,D$(L$$)q092sVP2$D$00$D$ jU0+ Ÿtr|$9rL$EQPt$V jUD$(0-D$ )t+Ɖ4$juD$(0r+ ŅD$u1 ^_[]ÐUSWV[kL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0, L$,+|$ $t*D$D$Pt$(L$njUD$,0I, 1ɉȃ^_[]ÐUSWV[j|$D$ hj07* tk@ uVxPQ4$9vDt$jW6) t9<$)HL$PV9|$w jP7+ 1ɉȃ^_[]ùfffffff̀rS[$j[ḿ̀rS[j[̀rS[i[S[i[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[i$lD$D$huԫET1}8XM4tI$P#E8*$$E4E0|$ 1D$L$j`QPu8VR ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$ |$ W.ԫ$Ƅ$D$TPW t.$Ƅ$8u$L$ThPQ0 $ 1 $Y?l$$PW %D$t2) $j UW$WƄ,j W$U !RjD$$PU; ʼnRD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PCt_`u|$ <5$h$PW h$PWr U|$|$Tt$h$PW? |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$P4 E$$t8iPltC$($,2D$XP$0V $0$$tOt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TP)$,$ $$t%(tPD$(PQ/) $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QP t$|$ t$$tP$$t N"$($,uWP  t$l$$t$|$t$P^E$$8$j`t@8@P$i$t$|$t$PE$$t8&M&t$l$tW$,$$t(L?$($,t t$7$QP t$$t$$tP9$$tL$$s.SWV[[tM΋uA~8t:~4~"`N4F8 I9rP&F8^_[ffffffUSWV[e[$$$l$$9$u t!6t$!P$VURQD$bI$>I+`|$ lL$1t2`r/j`PWD$ $D$ `1t`rŃ`j`PWL$ {$L$ `댃$t!$9b`Y|$ D$荫p$ $` $hjD$ P=F tF;EuED$E$D$ETt+hPt$$V Vbƃ t$ $tVD$PQk#L$ t$$uO$;$uSuO-wBIlux|$|$ $u5$t&H0;$^_[]Ë$lD$|$ $$Pt uœ틴$L$t$T$9rD$Pt$UN" 1gL$Y;L$O4H :ffS[îWD$L$ AQ jQ0 [ÐSWV[\W|$t$t+jP6 tH  W6,^_[ff̀rS[V[D$t8t9@€tuuuuH+D$ffUSWV^ƅV$ lM$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QWO,$M;$u ^_[]ÉffffUSWVLXUD$L$ht$dl$`u/t+t'\$?7PQjlR?L$x|$lu'\$_7PQjmR?L$x1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$ePT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$<l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x%I\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tID$tR\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq21pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[At$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø^Pjj%Q-.SWV[AD$L$Pt prxxp| pPxtz xyV: 1^_[ÐUSWV[è@|$ l$9v`wDt9xtNȅuT$81$Xq30<01*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y/ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p+ D$ L$Q$ЈA1ÐSV[Ý>t$ V P tHP tQ P V 1^[ÐSWV[<>t$>gthGt tww$Ѓ gpNjPQw蕮;u<tww$Ѓ .^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[<D$t$tA|$1ɐt 9u)tPjQG) ^_[fffffffUSWV[x<t$0|$,ttq,TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P, Pt$8=t +l$1jt$81^_[]fffffffUSWV[è;|$(T$$tMtpGJB t zRty+ |PQjGR%T$4uƴPQjHR%T$4h`+F \$/}u-D$ $$L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj W t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$a D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$L$T$( 9J9s\$VWPK t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[7|$tpjW0G 1o7)/1ɨuOOtVUwW, ~f)uODt_wу; WP7W& jW^_[]ÀO @1USWV[;6t$u|ҴPQjVR N 1tQ~tJ.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ü4t$u|GPQj1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[l$$t$|$tu"|PQhR-D$,tL$ z91Ʌ1^_[]ÐT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[t$u"}|PQhRkD$ t|$tT$t121Ҁ9 11^[ËD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[$[ЉׅtKϋ$tVRWPQ$$$4UhVH$yPVj S[~t$jt$t$PUSWV[U$$l$$ԭ[ЉՅtK$ tV$RUPW$,$<QhVt$ԭt;il$VPQhUJPUj ԭtWD$ hjP' D$D$DŽ$DŽ$ L$VPQjԭ$;$^_[]ǃԭ P6ԭ҃¿+w狔 у̃ǃƒêS[~t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[D$ D$D$$jVj} uƃ dtjljj0jVjS} jIjfffffffSV0[Zt$̀rS[ä[S[ÎjPt$t$t$[ffSVP[\D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[[PS[ý[fffffffS[Î8t3[Ë[ffff̀rS[T[S[>j1[ffSV[|Fu!|V>u 1^[fffffff1ÐÐ1Ð1ÐXحÐ1ÐÐUSWV,[Hl$D|$@ 0u"XPQhRƃ$Xf Fw  =uЋ Ɛ=r4$UhW두 덋 |$@l$Dt= t2 9s8u+p ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]ÐfffffffUSWV[U $$$lD$@$t-u)%PQhR$  $$D$ D$8|$$l$ BE <%t9sߐD$D$D$,D$ l$\$4D$ L$ zt *[D$ H1 w71A*MЃ rl$ D$l$xD$떐l$D$느1퐐,AȉӍQЃ r܉l$,l$\$48 L$ tȉD$ L$$$L$,ɋ\$4\$,L$+D$ L$L$@L$1:lu D$ʋl$L$ L$L$r$D$yD$$TD$x!u4u uCu@ug $O $)ED$El$; $l$( $l$D$ $)l$ l$ ED$ l$( $f $l$f(L$L$ɋ<$D$ x7uu u"u /@t/<$l$D$oЍW$‹D$ L$-L$xL$ L$l$1͉l$1Ϲ,$D$D$ O?D$D$ UTg3 $ $D$DD$ cbD$,$D$u'u um@tl$ED$D$11$(uT$D$l$(PjUD$$= )L$9ȋ\$ȋT$D$,$D$u'u um@tl$ED$D$17DgD$8D$ $u~ Ϩu @tɉgL$DD$D$DD$(\$,$ED$D$L$DgD$8x1) $1BED$}D$1iED$}ЃD$K)A $T$l$ uL$ L$ʃ,$uʹD$T$T$D$ |$T$,$D$ xd$D$ T$8u$D$|$_te$\$|$ ؃E1ҿ9T$ T$8Ér$|$ À0ʼnD$1;|$l$ r͍iD$00 $rgD$D$\$4jj WP=T$ $4$4$4$4U$0R&U=r,j$ Q;$u;^_[]Åt|.u|$1UPQhWflffffffUSWVX[x$L$p|$lGtGx,t$xDt$|CPVt$|UQr$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$VKxnNj$L$|PQO$L$xPL$QmO$ǃ$fB$) $W 9$A A L$|PQN$L$xPQN$PjN$PQN$ztQ$WT$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPIƅxՍ7Pj N7Pt$N7PjN7PjM$ 1۸$IUSWV[l$ |$t$D$@tP>) l$$FPj)UMF|PQ8MfFD$@ u1ftPVPLVjLG fffG )^_[]ÐUSWVP[*l$0t$$T$ |$D$@tPHT$$։)͉ $9L$(B99t$4D$,WP9LGPl$U(LGUVPL$4 )΁r&q5PQh=RL$8QPK+l$ ^_[]fffffffS[jt$ [ÐUSWV[$ $lD$0$jUKEt U uEEEj聊U U fE@$hjV Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh݉tkǃhpjP| EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jUID$ djVU P|ƅD$$}`hVW1 ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ Q0tPǍ$WhhP6E`D$EHD$E\D$4D$D$|$Sǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #j P$P< $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  p"鍔$P5 $< t< 0$< w  A< vhQt$蘎 ƅ_Pt$tD$ kc$< t< H$< w& A< vhQt$V ƅ_j VctuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tPVm< D$<@@@@ @@D$@D$8j5Pj j$P D$PD$;t$ s E$EtJPEDt%uHPWu퍃PPbrtNV[ML$0 ;$u ^_[][USWV[t$xPv0džft91 9s)tQ40DŽͅtMtt|]9ut/xt P/W~džtPadžf^_[]ÐUSV[Eu jPh$D$F$F\fF e^[]ÐUSWVx[cElL$ L$pu D$jPhD$3D$fGt$VpjWV VWGL$ ;L$pue^_[]YUSWV[t$xP|.dž|$ft;19s)tQ4.DŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[äD$At"t$0UP EO $L$(T$ L$DL$KL$ F< t< tjt$VX XjPVX pj PVrX jPVXX &j PV>X j PV$X jPV X  jPVW jPVW j PVW ΓjPVW jPVW jPVnW jPVTW j PV:W  wjPVW jPVW $`FP5d$/FPc|Gt^aGddGtAPt$'F P|GGtzPQ7< < {$H׋$ut$0UP $P뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]'PVm`?r?D$PVt$ D$L$Ƅ|$'PV`?r?D$PVt$ D$L$Ƅ($H^_[]ÐUSWVx[h$$l3 h3 p; t|OV9h@t)V|x$D$D$%D$ D$D$D$PjjjQtctt.T$u8u XL t P u# h6 L P xl @T P X PD$ lD$T X H ${X:tnq6w \ ` KL{9u 뷐KLf;{tK;|3@ҋ` D$\ 4$t$L$ 1|$)T$ X CT t_tUD$tKNjD$ 1t0<2 u*d)փT !D$ D$ X L$L P ,},T$tl (Ml \E,E,T E9u9rT$ }(PL$|$щ)ʃ|$ $sO߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃl ED$T$)E uY$}[u}M QWkE7)ƉT D$L$,E <$t r }tz1\u袉t' t"L P IL$9uʼn L P @D$ 蚕L P @D$\uWjP輳Ɖl uX88<*uL P @D$uWjPGl tu莶l L P ,u1ɅD$uBtE,1.\0D$l L P , $|$;E vAVuil$ A AKq NjEl 8L$@DPD$ $1t$X L$` D$\ 19E<2 u d|2 uߋdԅ>L P @l T H ։L$9Pt$ t$D$ 2T H T$kX9tt y6w \ ` KLt$k9t$u 말KLf;ktK;|;@ҍQ6w \ ` KLS9u t$.t$KKLf;SuSX:t` D$\ *${X;L$ t p6w \ ` CL{9u,럐CLf;{uC;|3@ΉЋT$ T$$ЉT H 4$kX9ty6w \ ` KLt$k9t$u$뗐KLf;kuK;|;@΃T 4$0jD$ 0D$0"cD$ D$ 0%9tuƊt^8L$9 $|Gy $ DAD.D$8V H9s .1%0Pj賁$^_[]ESV[]L tzp N9P  QPdL t{NDDDDD DDp .jXL tǃp ǃP ^[ÍEUSWV[Ëj0kXƋD$F PNXFF谍(Ff~FF,L t P 1ҋL$9u

F(L tlP 9tF F$F衋(L P rl RT P\X ^_[]19u말S[ޚu6QPRz jPSWV[ìt$8L t3P 9tbt,X T zl L t7P 9u P ~t veVe^[19uΐS[Ît$d[ÐWVXmL$ twAQQBQQAA,L tHP 49u8P 4~l vT P7 \ X ^_19u뽐SWV[̘t$tvTL P t/<t)X T zl t%MLH4jP7? ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [X~|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9unLUL$)ΉL$+D$PRT$ R' $ fL}$fD}9L}D}fufL}1ً|$EftEftUtUr&ZPQhRgT$ftUfUD$ @8D$$H1 ^_[]USWVd[}|$xG =tjj$W臍$jj$Wct$H I xfL$0.AD$D$D$D$|$ UDu (L$DLu)L$HL$T$LD$DPD$lw9sf|ww L$LT$)‰T$PRQ$u ;D$|uDu|$f+|$tBlj)ωL$RPQ DuT$ff+DuL$fDMfTML$L$D$|$ <1 $iEft$t$,pt$T$0z|$(D$ L$l$L$$T$ T$|$xMfv#f|Mt$[D$TP$D$,p Pt$t$(W [L$Xɋ$OT$TT$ ?T$\VL$ЋQL$ IL$(hD$$D$ t$tM+D$,fE<L$9v&ncZPQhSRdET$)fLEfTEjt$(V$W荊O t΋hD$,L$ ɉD$$tQWl$ l$ l$D$ T$Eft$T$MfG =t‰T$fl$D$tuD$ (L$4 .))ƉT$L$<|$@t$8WQ$r ;D$|ufL$fyr>TQ9t$|$|WƋHL$T$TQ9vPt$ |$|WU&ƋHL$(T$P2Q D$ff|$(f}r#L$0IT$4RуDE9T$0vZVWƋHfyrD$0@T$4RЃTQ9v*t$4t$4VWk uR"t$4GT$0t$431ɀNG8G8tO(1;G4~ Wk^_[]ÐUSWV]rt$4\$0V{4ufr\$0K4T$Ns DDxKS !T$S$1҉|$9,$~t$ 4L$͋|$!E;l$\$08un19؋$p ,L$08rT$0jjjjQPRT\$08mD$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$~j1Pjn f`1JуT$  1fljڋ$jt$8VPRT1ɃFttHT$*]tjLjfLjfw8\$$ZPQhRY\$T$ D$4@ftjf|jfDjfȃ^_[]Ë$V*1Ʌt‰ D$0L$ЃVhP[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$0891USWV[(nT$B =t $|$ t<|$,t5|$$|$(j<W}T$ D@fw'֍ZPQh#R/XF P=tfOtfO1 ŋJD~t-9$w$D$ u( D$ uD$D֋$;PD$ u fjT$Ty)‰T$ L$ʉL$‹D$Rt$VPOT$ D$ Ɖt$)$ƋD$L$f xD$ L$fDy9f)tyfyuM|FaT$PQhROT$2|Fr"PQhRN1<$V $D$D$ $09wЉl$$uL$D;QuLN)L$.Wt$P |$$)Hf,Nf?Ń$r)PQhRNT$flFL$fLFt%f~t$t$<2tWŋpf~l$M|FPQhR|M1$^_[]ÐUSWV[øbt$ F1҉$1FHT$t%fft:6́ftfu(f|Ht LDHNjVPl$(UrƋD$cPUT(͋$:1frDHfGfGVD$ PQ<$fl$E =t)σr+`PQhRL$E ʋ$f|J׺=tfTOD$ Ht VUD$t9t PUE81^_[]ÐUSWV[`|$,L$(D$$ $qH tȋT$0f+~L$49~ L$,L$,1t$|$ )$hf+MT$D$49gf|Nud|$ Nωl$UT$RQ uhDnjt$Pt$0VptRV tm9u.NWRV t ^_[]ÐSWV[ì_t$|$LQjPQW1pt2HfyuftfDHjWPVvo`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVn+l$͉ $l$,t$0t$ED$9G u*D$G4$P L$,1TNGDHjWPV>n t&dž(@f8u$dž  ^_[]ÐUSWV[6]zA =tl$$G)B fT$L$D$ uf͋t PY(,$Uj!|$(todž(dž $FDGjRPV.mtiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$L^_[]DGjt$ PVl t׋@f8u$dž wSWV[ü[|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[f[T$$wA =tF)G D$ *$Ffu^L$t P&4$jL$t$,t$,jWQPt$DFjWPQ\ktjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $JЃ^_[]ÐUSWV[Zt$0l$$D$jPj :|$[ffffffffffUSWVYQT$r 1t\z:_K _K _o ݃K 9stǃuƁK ^_[]ÐSV[JQVjVlVP^[fffSVP[ Ql>u1$ TjjPVjQt<$ t ^[fffffffUSps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/202503281350Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20250328133113Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%untpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.2--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.2 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.2 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist