'V!f 01l#NetBSD/earmv7hf ramdisk 08 f<   fGW]t ]t f@@<@T 08 f<   fGW]t ]t f@@<@TU f]t`A f fi fiA f f'8 f'8mA. f» f<3 f<3A f fT fTA fh f0 f0A f= f<3 f<3A fs( f3 f3A fN f3 f3A fp f[d f[dA f1 f3 f3C fm f63 f63 A f1 fl3 fl3 A fl fY3 fY3$h f f fmD$ f:4 f}5 f]^d (08@HPX`hpxh$g fA\ f_ fuL$ f  fĠ f M$k fp f) fmQ(08@HPX`hE$a f` f! fF?6px%K! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ 4! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ  B! fRֽ fRֽ fRֽ B! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ "! fRֽ fRֽ fRֽ "! fRֽ fRֽ fRֽ "a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ?\! fRֽ fRֽ fRֽ >\! fRֽ fRֽ fRֽ =\! fRֽ fRֽ fRֽ <\! fRֽ fRֽ fRֽ ;\! fRֽ fRֽ fRֽ :\! fRֽ fRֽ fRֽ 9\! fRֽ fRֽ fRֽ 8\! fRֽ fRֽ fRֽ ?\! fRֽ fRֽ fRֽ >\! fRֽ fRֽ fRֽ =\! fRֽ fRֽ fRֽ <\! fRֽ fRֽ fRֽ ;\! fRֽ fRֽ fRֽ :\! fRֽ fRֽ fRֽ 9\! fRֽ fRֽ fRֽ 8\! fRֽ fRֽ fRֽ :\! fRֽ fRֽ fRֽ 7\! fRֽ fRֽ fRֽ 6\! fRֽ fRֽ fRֽ 5\! fRֽ fRֽ fRֽ 4\! fRֽ fRֽ fRֽ 3\! fRֽ fRֽ fRֽ 2\! fRֽ fRֽ fRֽ 1\! fRֽ fRֽ fRֽ 0\! fRֽ fRֽ fRֽ 7\! fRֽ fRֽ fRֽ 6\! fRֽ fRֽ fRֽ 5\! fRֽ fRֽ fRֽ 4\! fRֽ fRֽ fRֽ 3\! fRֽ fRֽ fRֽ 2\! fRֽ fRֽ fRֽ 1\! fRֽ fRֽ fRֽ 0\! fRֽ fRֽ fRֽ 2\! fRֽ fRֽ fRֽ /\! fRֽ fRֽ fRֽ .\! fRֽ fRֽ fRֽ -\! fRֽ fRֽ fRֽ ,\! fRֽ fRֽ fRֽ +\! fRֽ fRֽ fRֽ *\! fRֽ fRֽ fRֽ )\! fRֽ fRֽ fRֽ (\! fRֽ fRֽ fRֽ /\! fRֽ fRֽ fRֽ .\! fRֽ fRֽ fRֽ -\! fRֽ fRֽ fRֽ ,\! fRֽ fRֽ fRֽ +\! fRֽ fRֽ fRֽ *\! fRֽ fRֽ fRֽ )\! fRֽ fRֽ fRֽ (\! fRֽ fRֽ fRֽ *\! fRֽ fRֽ fRֽ '\! fRֽ fRֽ fRֽ &\! fRֽ fRֽ fRֽ %\! fRֽ fRֽ fRֽ $\! fRֽ fRֽ fRֽ #\! fRֽ fRֽ fRֽ "\! fRֽ fRֽ fRֽ !\! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ '\! fRֽ fRֽ fRֽ &\! fRֽ fRֽ fRֽ %\! fRֽ fRֽ fRֽ $\! fRֽ fRֽ fRֽ #\! fRֽ fRֽ fRֽ "\! fRֽ fRֽ fRֽ !\! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ "\! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ \! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ $! fRֽ fRֽ fRֽ 4! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ?\a fRֽ fRֽ fRֽ >\a fRֽ fRֽ fRֽ =\a fRֽ fRֽ fRֽ <\a fRֽ fRֽ fRֽ ;\a fRֽ fRֽ fRֽ :\a fRֽ fRֽ fRֽ 9\a fRֽ fRֽ fRֽ 8\a fRֽ fRֽ fRֽ ?\a fRֽ fRֽ fRֽ >\a fRֽ fRֽ fRֽ =\a fRֽ fRֽ fRֽ <\a fRֽ fRֽ fRֽ ;\a fRֽ fRֽ fRֽ :\a fRֽ fRֽ fRֽ 9\a fRֽ fRֽ fRֽ 8\a fRֽ fRֽ fRֽ :\a fRֽ fRֽ fRֽ 7\a fRֽ fRֽ fRֽ 6\a fRֽ fRֽ fRֽ 5\a fRֽ fRֽ fRֽ 4\a fRֽ fRֽ fRֽ 3\a fRֽ fRֽ fRֽ 2\a fRֽ fRֽ fRֽ 1\a fRֽ fRֽ fRֽ 0\a fRֽ fRֽ fRֽ 7\a fRֽ fRֽ fRֽ 6\a fRֽ fRֽ fRֽ 5\a fRֽ fRֽ fRֽ 4\a fRֽ fRֽ fRֽ 3\a fRֽ fRֽ fRֽ 2\a fRֽ fRֽ fRֽ 1\a fRֽ fRֽ fRֽ 0\a fRֽ fRֽ fRֽ 2\a fRֽ fRֽ fRֽ /\a fRֽ fRֽ fRֽ .\a fRֽ fRֽ fRֽ -\a fRֽ fRֽ fRֽ ,\a fRֽ fRֽ fRֽ +\a fRֽ fRֽ fRֽ *\a fRֽ fRֽ fRֽ )\a fRֽ fRֽ fRֽ (\a fRֽ fRֽ fRֽ /\a fRֽ fRֽ fRֽ .\a fRֽ fRֽ fRֽ -\a fRֽ fRֽ fRֽ ,\a fRֽ fRֽ fRֽ +\a fRֽ fRֽ fRֽ *\a fRֽ fRֽ fRֽ )\a fRֽ fRֽ fRֽ (\a fRֽ fRֽ fRֽ *\a fRֽ fRֽ fRֽ '\a fRֽ fRֽ fRֽ &\a fRֽ fRֽ fRֽ %\a fRֽ fRֽ fRֽ $\a fRֽ fRֽ fRֽ #\a fRֽ fRֽ fRֽ "\a fRֽ fRֽ fRֽ !\a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ '\a fRֽ fRֽ fRֽ &\a fRֽ fRֽ fRֽ %\a fRֽ fRֽ fRֽ $\a fRֽ fRֽ fRֽ #\a fRֽ fRֽ fRֽ "\a fRֽ fRֽ fRֽ !\a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ "\a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \a fRֽ fRֽ fRֽ \ ! fRֽ fRֽ fRֽ i! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ  B! fRֽ fRֽ fRֽ B! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ ! fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ a fRֽ fRֽ fRֽ  fRֽ fRֽ fRֽ bpf! fRֽ fRֽ fRֽ $ fA f fUn$> f  f f $ f, f ft$s f^F f"G fNj\$ fK fO fG$ fML f1  fA f% fF fF m fu f1 f o$ f fb f  $ ffF fG f*c[ A f/ f 4 f 4 A f f 3 f 3 A ff fb fbA f f3 f3A f f(3 f(3A f f\3 f\3A fk f_"3 f_"3A ff fJ<3 fJ<3A f fv3 fv3A f f r3 f r3w{Kenuk hGx1je<}Aw})T:/gOixWLZ3mgggD԰BxqhSn{_d9X`G|$7(y7~-[ pW&|J~hpzn{,wZy"@K `8)D_-k~x̿IѵkoQdWdI\ؤ^AFeb^Z&%_a1pC6"PL0DM@ ?|Rmb6xv;?- mWsW{G~ T[My@J{kGW$q A$.o]PftlCfS9@"BPDvLڳrL)I@wv>3-Ekt ׇ?/j'6hNB9QBI &~ ]\G7lJpa+Iy*"@Rmm1]t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@48$4 (vq#vq#L#L(L(dLLL#L(L(Ptdxq$QtdNetBSDlAPaX NetBSDearmv7hfH-MQ `10 ㌗᝘@@PP R     0R/S SP $P( `p`pV*0/V:d\`\p`pV*0/V: -'(((((('('X( cp@-8@@4PPUp(P`0/9c@((0H- @ P@P0/T0(D'(A-@TpP$`/WP@@P@e_P PQ )@$@ @0a0 A/A- )@@$@ @O @`P@"@ VpPPU: vP :P kP@H-O-M`P!@x㄂ B 㠲  p@)@)@)@@)@X gb@Qp p p p p p p p p p p p $ )@ )@BP\ 0@  )@  )@ )@ )@Hp  )@`P  P A p8  a)@P[ !@ )@Q )@QQ )@Qk  p)@PU  @^P  )@!@P @PP2 pz )p@ `)@P` `PP0p Y P  X V @`@@@ )@P )@P X( PV@ I@ X X*  )@P8X@* )@P`pP @P` >XX^= )@Pm[+@! @@ )@P^`pP @P` XX$Q`O$yp`I`pP @P` !XXM ^epu `pP @P` X `XI^IQ p`W^MIpY `pP @P` XX--7pG  )@``P@`pPy P XX& p!(`pP @P` XX^^p `YA`@?Qp Qp Q X` X @  )@/ !@ )@ ` `@ W z )p@` / !@ )@`pPUP )@Va$ @8Ѝ )@Q p)@㰲 OPWp)@U  @]P  )@P 5pPvJ ᥕpo (  PzPwPʇPpUb ppPZڬ )@vWpm Q@`V zPZ ` V IP w@Q  )@` P@ ἓp=@Y ѓP@y ʬ )@/ !@I )@OPU ԓp Г/ !@5 )@`PUhG`@2`V V`@[ !@ O-M`P=!@hxJp@ )@@  0rQPd@Q) ,,,,,,,,KPP HP 8LP PP: RP \ 0@   XP! $ ) @0Aq@-T@P V PX P pRpP0p  )@ R&p[pZp Q @@RX `GP@ a<p@ V@H@P @ `q5P$@?P7P_PUp`@ P2Ldd@@P 7pPbᨳ !@#)P : $ `ᖳ !@`T XdZ XQ 9/P [ / !@`$@H-^_  )@@0=O-OM@P!@, oi)@̦  )@v  )@І  )@`@)@)p@)@ oePH@ Q,X L$\ )@ )@ )@oP fP6 iP9 lPF )@pP/ rP2 vP< )@aP. )@ )@ )@  )@ )@ )@ )@ )@ )@ )@ )@p  )@@DT & )@) @ RQ'  & )@) @ QR Q  )@Q )@Q @ |@ )@Q )@Q )@ )@pDj)`@Q$W P@ QPQ/U P  A A Q Q/R h@^ )@Pᥒᮒp_^P'T{ )@P  )@P!   )@)@ ⅒p  P) T^p/U$@ /!@ wp /!@  P  )@)@p `V @ PPP:@ /R @ @R: A` @/R `V  4 )@/O-M` Ppq3Pz @5Pm  ⵌ)@P!@p@PTh8hh8hh8bᳱ   @+ ZX 0` @@ P : \ @q5pP-LPPZ, P/Q@P!@LYP 0,/QV/Q/P@ E0A P:\ @V   P Pp/Q  PP )@P ᜑ጑pP2 X 0`P!0#0`(%0#P}  @ᩬXp  P  N8Z  U+ : S   @PᎬX Z 0ZE0P0%V UW`8h\h8hhh4 )@PF uD6 )0@`6 )0@P5` PSM Sg6 f )0@)`@ Rpc P  P) PS  @E  7L )@P  P P LP  PPPpU  P)@P(  @ "P  )@P LP& ) @AQ< P)@P Xڏ  @pG4ẐPpo\P 3Ѝ /!@$@# M+U;@ @0@6ZR\ # h+o;@ @0@?Z@- M@0 `@ *` @*@P z @ ЍO-M-MP )@P )@@[ JPF /   p<}  Xp)@P  )@P `)@P  )@`V`Yk )@+ݎp8y , (p P@ p4` x 0<p  P֏$` A )@8P )@)@`p@0GT# xP`P  s0 A `$ @ 4 00@p  a@T`/  !@ )@P J )@)@@ @JP@sr )@PP  )@@ᣏ+Np8p )@/ !@pt`xL 4< )@(3ZP8 A V v @)@`0)P@)@)p@8 Zxpv P 0 A4  `00@ @  <(P(p`,zVM`S )@ P@p P YP @)@V 1p H Q p )@ <ԍP7 )@R !@5<- Y@0/ !@,`(,p PZ / !@(p`,F 8P)@@P <IP )@ @ <埍V ᛍPЍЍP EPUPP PY  8偍P )@/ !@PP )@(PP )@P8@ŎP )@/ !@P` Q )@8瓍PY@H-@P z=U00 }P` )@bP -Z`P )@ @`U b` )@IP )@ @w` W"  )@PpZU E )@Qp Y-PP )@ @R`U )@P`A-M@ `P#㶌p Uj)`@ PP @  @ ьP  @ۍ )@P Xap@-j@Q)`@ PڍP @PὌP @p )@P p@;pp@-j@Q)`@ PᵍP @P"P @p )@P p@pH-?Y  )@@0O-M `*@XG  *@V*@@) LČP@@cHPW =p,PX `QV  0pPS S 2/`V #=@Q B B @z  @ Q6 #8 @@Q@ !- 8@@ *@Ѝ@ 0E@X@ ' E@ r@@@yTH-M  @ 0h' * @' * @ЍH-M 6 @ 0T( * @ЍH-M@H-M b @ 0=( * @ЍsH-M n @ 0'P)@Ѝ]H-MX *@  y @ 0 ' * @Ѝ *@$/H-@H-M  @ 0' * @ЍH-@H-MX *@   @ 0ն' * @Ѝ *@$/H-@bH-M  @ 0㺶' * @ЍH-M  @ 0㩶& * @ЍH- G *@*@@P! AP R0PPPW *P@aQ8 *@ ' * @/H- /@ !@H- /@ !@H-/-!@ @H-/-!@ @O- MP@1k!`@\ ᴺp  )@@7G *@@$P  [ @!@8$( @ @8Zp($ ? *@븇 *@)@P: @W XG *P@*@@$P @(8@$# @8 !(p(8 $0 !3/ p( $ /!@ *@xg P*`@@  BP H *@@p PRp3WP PRXW *P@#   Q 0p@(!S#XW *P@1#1/@h *@@@@]V@YV *@@ @ @^/) @P@ @ *@  @ 0R*[ Z UU80 ($03/Pu p?!p 08op@@? 0 `)$ PI / !@g  8p!( p1/ $/ !@p   0@`P0@ 0 p@8 0@@ 0 @ 0   B  *@XW *P@1/w *@@ 0iXW *P@ kY@eIH- *@@P 8@PC @PP-G X *@*@@  aR*FU! `W *P@` T!`Vp `(P 81/pUP 8(1/po"@@O-M P*@ `G h *@@*@pP PX *@ m  80( @0004/ @p  PpP/ zU P`8@<  P*@!RC# 0@#   *"@  p`G P*@*@@ '%'   *@Q  `$*@ [@㧤  S pWPWQP p Rp0pRp k*  *@`G *@@" " AB& * @  p`B Ѝ"@ ЍO衇$ @$ %@$ I@#$ /!@&H-MP p@`*@ ዇8 ((03/@TP ~TPЍp@-(PUp@8 03/p`81/(`p@@-M@(8 2/P$8  P 0( 8D3/P ( 0 1/pgTP  Ѝ$ /!@@-M@*PЍ@舚 uPЍR70S5 0 0C S/1/.!0 R00000000 0 0 0 0 0 00/  /O-MF *@@ !@ † !@ 㺆0h 0*@(^^@@ 4 @,dDPp$8@HPp'fF ᘆ-2 }?N}SbAW(/ P,$PbGS"CS?0w@f/"p@`@@   @   $! @d'4F f   @   =! @d' F R    `C@`P!d @~' F ? /0M؃`Ge 0!UA@@g! @d` P_'E  ЍN@-@KῇG-Mg *`@ 9 0pWE @_X /)P@*@!@8 ($0 3/PP 7 Z$!8 ($0 3/ R!:80 B($0  @T@pGW0p@(! pS#1#7/p Ѝ@N$ /!@QB-MG *@@ 0P`*(!s# p1#7/p#C P`80 ($03/PP`U: 8 0(0  H3/p Ѝp8 (  0H3/p U* !#P"`P $ /!@O-qMM`!!@L(Ñ 0@@H X *@@*P@  ᔵG@'Qa0IhIQQQQQIQIQQQQQQPIQQQQQQQQQ@I`IIQQIItIIQIIIJ( *@ *@D *@ ", *@8 *@@ *@0 *@  *@$ *@ 4 *@< *@tP?H *@P\ 0@@T nQ QoPo@o@P *@,a%pPP ,Y%PP㢛PH *@UP @@W ,qD%@pPPp$ *@P @ *@P( *@P8 *@0 @ (( *@*@* @ RP%@P  )@P1L P*@w ATU F|OP r /D `!@ @@ ᷅p QvPqP LH ,*@@'!P  Ⱦ@T|4 *@PQ !@  @jP L *@  0ᯠ4 p *@*@Q H *@Q P < *@PDp>PGpȜ `&4 *@P +P < *@P  ,6I뗹$DZ P  ,'IpU  `*@PEL *@p  P*@P(@O  0"@+  *@PL *@[ 0t D *@@Ȉ`$T Q BC>CP`U7 $ ` ` K a1;U0\0 ";@%+![ *ar A  a1;U0\0 "; P@ $@+! *`r*a @0 `@r*b A `r ` B p[$ U*@P)L *@Q' P :PL| PpU:  $ *@*@P$ U*@P`L *@`U (rqߍۍ@}@v.@zy@u@p@bR@]H-O  )@@9H-M@P P|`KP `PU FЍ@;0H-@H *@P Q P P QP *@P *@ 0O-MMD *@P  0P H#R @ #R $h8L( P*@p0`P&0R P@ @Xh @3@LxP #@ |0@ !!"@V\ X*@@  *@Q  TH *@X *@@*@P P#  P4 `l@@R` *@@  E P! )@@@ @? B)0@ 3U @ @, )@@ Av@  *@Q )@ 5 @X *@[`( * @@P?P)0@  B o0)`@ R0 0S P` P@&8 `*@P $5@0@50@ @  0 *@P #%@ @ @  0 @\(@ TpRH TP0 *@Pl T 4 *@`Vo8[Dp@`P9Jp!PzH僜0 )@$@ QE@`"p *@P t)@@ < *@`@ iH^0 )@$@ ,\@nO-MP@m <, *@`* @ 9 *0@$ *@pP  *@p@@pP) ȉ @*@*@P8 `T ` @P, P *@X- VpPW(J@ `TY [Vĩ <\ *@*P@P" T@  P- *@*& !yĩ <\ @*@*P@ )@g p*@ 000T0PW pT` Q`ЍAO-MI ̙ i *@@*@*`@*@P PP@:Pu U4`3pZ  Z  "3 ḑPJ 9 *0@ Q ` *@`O P< *@  *@R R,P0p00僑P  *@`PP *@VY  '5G*  )@@&$@;P8 *@71 @Z+   *@  *@<, * @ QR P  @ F  )@@㼼@ЍnA-@P!P@B`᷼`P  ;P6Jp!PF巚0 )@$@ ᅼ@ p *@P t)@@ rHUPF啚0 )@$@ c@PO-Mp` *@P @W( W&$ @*@cP) PW< *@P *@P P PJ@AP*`p P *@P  ЍH-y @P`*p@T Q ;@DPp2F'  )@@@8O- M l *`@@pp PW.@P' ԙ *@Љ 9 *@W*0@!  W  ,P.Py  @*@PP  *@ @p Ѝ@ > @@PJGZi GP*`@UI  *@P PBpZ  Z*@ pPo `pP  ` *@  *@=U5 @P. i J*`@ @PJxPPZ@|Eq  )@@@&$@ @*@P *@Q} QpZ *@@Ci Љ *`@*@ ZP၏P QP% @+AE6  )@@&$@GPL/E$  )@@&$@5P: *@@ -O-MZ ؼ  @)P@*@*@*@pP p @:Tp`E`` R R,p000P; Qp *@J D`< *@@ V *@D存 @~@@`T  *@ЍD员 @b&$@@P *@ R O-M`@P @㋹z T)p@ )@[ `Q A` Ep Q? P@<Zi X"@hd` A` \P @^RQ*p #QpQXX\X\ぺ`V @ P3P "8@@0@`p Q0A`0QXf8X X 3`p A`0Q&QX X XP`p QQ0A`0X X Xp>`p QQ0A`0X X Xp-@TPu`P@`XX X ЍO- M\6PPr@o +X \q )@@*@P@)@`0p@*@ ѦoP p EP% SP *@`xP! sP& pP AP! -P *@P`` *@`2 @ 0 *@`@5P @BTP@BB@B *@`P%[ *@QP P $PP D@JcPQ@@4PC@8cG@3i q*`@P , @* @Q / !@$X*PPJ  *@P P3 *@PJ+ P0JP  *@pP$| *p@PN *@PID@bb@P4P. P`@`Pu u6 u( D@bi4P P*@PD@bb@X4PP  y*@< @*0@btB @VǵP) 54P y*@< @*0@Cp!4P !PD   *@'=, @* @&OH-M @*@0 h DvP JP#@")@#% P #@")@#%ЍH- *@Q @*@0  H- *@Q @*@0  0H-P *@@P !P !@=P /}P @@0A-\  l L *P@*@*`@*@@PJ | *p@ 0 0 ;R,R ;Qp R R  QpO-M L  *@@)@ 00@ P  00@ R @p=0G=SG`,       h p       Ȏ$    d           dЏ<D`Ē0 t$`,d  *@P;  @0 W$ !WZ *@P PP%J` QpR nR lR   ` *@Q 0l0CS  QP`$ *@PPJG@okPJVW`GW`PpQ nQ lQ`~ @`pQ nQ lQ` *@QD`pQ nQ lQ` *@Q.`pQ nQ lQ``pQ nQ lQ^`| *p@kPPzJ`PpQ nQ lQ`| *p@PPP_J`PpQ nQ lQ`, * @ R ) P* @ RA , * @ R@ PP3 p`PpQ nQ lQ`, * @ R@ mPP !P@ *@Q`pQ nQ lQ`\ *P@Q  ` pR nR lRE   ` *@PPJ`PpQ nQ lQ9` *@P P` pR nR lR4   ` *@PPJ PpQ nQ lQ"  *@xPPJ|  *p@*@`P~J *@P  XJ$ *@P V X``PpQ nQ lQ` *@BPPQJ PpQ nQ lQ  *@'PP6J PpQ nQ lQ @  *@P$  *@*@kPP p`PpQ nQ lQ1`4 0| P*@*p@`0 A R*"? PṬP?"Px ` QoQ Q gQ`pQ rQ`` *@PPJl  *`@*@pPJ *@P= XFJ$ *@PA`pPpQ nQ lQ` *@Q`pQ nQ lQ` *@Qڹ@p  *@*@ VPPeJ1@P> 'o)`@P>"P@ H` @$@= P6 $ *@, *@* @Q -!@vD P# *@P *@uPP $  *@*@b PeZ   *@*@ PPJ *@` P  *@*@`qW`P`Q`S #@, *@Qn xP P *@P *@ *@PJ9P P *@P *@ *@PJ$ *@0RQ P *@PiA P P *@P[ *@ *@P X  QuP Pg  P P`  P PY  *@ *@" PpQ nQ lQ P P: )@*@$< *0@0SB`P P'VGGGoogPPQ" P *@q. P \ 0@/*@) @0 Q S   P *@P  )@, @* @ PPJP 0l0CS  Pl @P P *@PI *@@Q o P*@p;PJ $ *@P *@ *@ *@PpQ nQ lQ`P PI *@@Q  o, P* @ 0, * @ !@@WWPwJP *@* @dS @g@bS #@X QY ^Q QK8L P*@@ WJޘ *@P^^ #@7P P5$ *@IP8J 1P4JP7JP!P *@ ! P*@ R P@pPJ ()@ *@@$)@P P *@P  P@Y [*P@ FP ,, * @Y P , *@,, * @( *@P *@n[ 0 4 *@*@" PJ *@ RZ  " QpR nR lR    *@PPJ`PpQ nQ lQ`P PPY , *@ Y!P  qo oRQQPPh *@ka _ , *@* @qY QR`h? @EP P? *@P ` PpR nR lR   `!P  o oR]Q[ @P P P *@ *@I!@JV @DPЍ`PK-P" P$ *@P3`0P  p*@@P  0PP JpPW@S #@@O-M L 㔡 *@@)@ | *p@P@ Y  @ Y A$ *@ I6Ru0ЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩЩT ЩtЩЩЩ TxħħħħħħħħħħЩ ЩЩЩxv: 0PPg:"Pcin< *0@;Y , * @PPR.YPGI/Io[PHJPY7^YC 0 @ S @%^Y-YPE: ܧ`P::"P f^Y`-Y`P ]PP JJS #@@/PЍP S U#@JQPO-MY7  $ *@P*@pU W!ppWpW  `P @< *@P  0  0屙P pW @ЍH- )@ @` *@HO-Ml y *`@@*@*p@*@P PPA  Q PMJD  *@PQ Q=P.Q& P# PT  @P U *@P *@  Q P *@ Ѝ P)@ ` H-, * @ R  *@ *@, * @, * @PP$ *@ QS #@6O-M *@`  v P% $ *@P$@Ip P *@P ( *@ @ *@P pRP *@ЍeA-M \ *P@ RDl @ *`@*@ QGy L*p@  P_ Q@7 *@p0 j )@ @  00@ R RQ@@0s@P) !Q)P J8L *@@ ZF@ 0 S0 0pp pp 0p WP@P@Ѝ Pڗ @q]8R  )@@!&$@c@P *@ K-l @*`@p W ̜ *@*@\bP$ QP *@50./OW G*@ 0\S00S@ Q  8  )@@ɭ&$@ P *@qO- M@$ *@`P@ P6 X *@*@PP \ p*@@Q Q@  Pq \, * @Q@ *@  /` P\ `*@@QX| Y  Q*p@*P@@  忁PR \ *@@R  *@l fX *@ @KPNJ\ D*P@I X *@*@@P  P  *@ P 4 /P+#F7;  )@@ &$@LP47)  )@@&$@:P *@  Ѝ *@ H-! ) @  @`, aA* @1S *@000O-M$|   *p@*@*@@  *@`PBP0`UP00p`@7 -P P $P P P` P1)`Pp`QPp B@   *@*@@Q  *@ P  *@ЍDH- *@Qe$| ) *p@* @0@`S, @@ up$ʗ!@P P(P` |P @pP/Q/(e .Fh0p@@ N)H- *@Q  @*@0  *@᣹O-M| P*p@-@ *@`0p V*@0Qp0  BPQCSy 0F P*p@*@P% `U ` CPP P *@@HX@Q P *@Ѝ?O-M  *@*@   @@g { @*@P^ pL *@` H *@Q*@  Q  "`P L, * @Q` *@AB!P !Q" Q %QU YA Y `P L, * @Q`. *@' W_ @U U`mP L, * @Q` *@ PP \R  P *@Q p'L *@`QD  Q ,`+Pv L, * @Q`1 *@* 8L *@@QQ P| *p@ R( R `PN L, * @Q` *@  A Q P A Q   P 0 Q:p/TL *@@U8L *@@L 8 *@ U   (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx"`~P Q`/ 8L *@@5|4q  )@@@&$@P @h4]  )@@,&$@nP *@" " *@8L *@@ ,P *@P!@oBЍ1@@@-@_zP 04  )@@&$@$@- *@ R `< *0@AT B R@Q:H-P  q\Ro MH-M  0*@' 0ЍH Ѝ/H- , * @ P P@@G00 QQ ^ *P@@T< @@78@P3 n P*`@(| *p@P Q*yP  @*@@ jP , '1* @@@ 3凇  )@@V&$@O-M P*@`@ P P@ @\P [Pn@P] P]  PP `D*@V *@P  *@*@  V  "p}P PpP *@:+ x+< *@@P)  0ЍO\)3  )@@&$@/PP *@  "@ @PЍH-  ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA- p*@PPP` V *@P @3PP PPP1 @R2PP EP2"P@PgPPO-M \ *P@p%P R N P *@*@@[h Y  Y*@ p` ,P|P  QP @pP  *@p@P  \Q Q'Q# P *@P j L )`@*@@P P*P P ` @P *@Y  [*P@p `  "@9|P  Q@ @$(N *@@P"S @1  )@@㰧&$@P *@,@  *@ Ѝ1  )@@㏧&$@P *@  @ *@+1O-M|  @ *@*@*p@Q o @uP 0s`VjJ@V2 XP_J.  * @*@@`P6 @V ~ `P( T @*@P *@8&  *@*@AXW 0%`PZ *@P *@   PJЍO-Mp`PU% < *@P  0/ @` 0ʐP  `*@@p[B ` V?   *@[#9  *0@*@  [ , pzP )  *@* @< *@ppP *@P  0> *0@ ( @F  `*@pW#  W*@  , zP  *@ P< *@ *@P  0 (  0PxJ@`pQ Z Q  0 P] `@  *@ R  R *@*@,p000_zP4  *@pP *@jQV  P @(P  05~ *p@ ;(Z  /  )@@㶥&$@P ߍ/Ӄ  )@@㢥&$@P *@ /巃  )@@ㆥ&$@ *@P6O-M~ *p@  @P*@*@*@0n *`@ \P3 &Pm P`D R0 R 00< pyP p~ P*p@ *@UBF P00@81@Q70@P3R`D R0 R 00< pxyP p~ P*p@ *@UF P00@n *`@(T  T P  "pFyP= p~ Q*p@  *@YZ@IP]T  T P  "pyP Qp *@12).ł  )@@㔤&$@P.崂  )@@ヤ&$@P@ *@Ѝ+mG-( ,^ *@*P@p`P$ d*@ P   )@@N&$@{z$N *@@q   0!A-,^ *P@AQ $ *@ 1S@pT 5`CzV@AQ, * @$$ )@ *@ ()@O-M$)@p()@p% @.,^ $, *P@* @< *0@P *@" *@$ P*@J 0PCpa@FT:V, V<!0 0 10`'0CaP`!` ` a!P@ !`PP` p`! 0 1p0``Sqp'q0 /P0 1 0C @P`p` 0Cp  *@P 1, * @P  $, * @ *@ЍHO-M`@P/!P`$@-)P+! @ነp  )@EQ`p5j0~ 4 < `@*p@*@*@ kePrPf@PbhhD *@KPLP PPMsP vP wPE@ *@FP8 *@@ *@8 *@H *@L *@p$H M> *@=  )@*0@R-RE 0. * @ R R8> @~ *p@ *0@ aP P P @ "@ ED *@@Q aP  P, `P  PPP `P PPߟ/!@ H-|,  )@@0[̟O-uMMH *@P`P U7  +A QP / P" @0l P;g,?4 h*@8#@ @Q  2/P   PQ,/  !@㶙puߍڍ`P   P D *@P s`P   P PP,@ *@P' /P ]`P @ @@+|P / @0" @B`P Y @ gD`P`P 8 *@PVz < *@PVH P( ^0 'P /P @@/Ppp'P D [G X Tj  @# e4 *@c 0Pc ^PJL p*@P\M *@ 0 @㶠Sz )p@X{밀@ aP@` )@` P@p P YP0 *@P   P__Pz /   @ 0p .NN_PZW  #._PI 8-<="#A H-L="#9e  @ z\\&\ \&H-XX0Dd T  V H H0S \\H&H-XX0Dd T  V H H0S \ \H&H-XX0Cc T  V 8 80S \\H&H-XX0Cc T  V 8 80S \ \Hx&H-XX0Ee T  V X X0S \\H^&H-XX0Ee T  V X X0S \ \HC&p@-X X`p@tPp`t0 T  V  p\\p@.&p@-X X`p@tPp`t0 T  V  p\ \p@&O- MP@!@~`X P*@ h Dp^PP,)@\ p*@` *@`]Pd lk*@p`@ I1@GQ>` ht\0LlP|0Txh *@` *@ *@ *@h *@ \ *@ ` *@l *@p *@ *@p *@ *@| *@ *@ *@P *@ *@ *@@ph *@ *@| *@x *@ *@ *@~ *@ pJt  *@qh *@l *@ ? *@ *@` *@] *@ *@'h *@ l *@ ` *@p *@\ *@t *@` *@h *@ l *@ l *@ *@h *@` *@p *@\ *@ *@ *@ *@ *@  *@ P *@x *@| *@ *@ *@h *@ p *@ ` *@l *@p\  *@)@h. * @p *@PP !@gP <,)@Pt P *@. *@* @`q >   *@*0@V`*@*@`R. l 0*@* @`S` Y` ``^`RQ X *@ *@/Y *@Q pP P P6@0pP P P,0@&@#| *@P @@| *@P @x *@@ @x *@@ \@R *@` E*@Q @p *@Q |@l *@Q @h **@ @0@S. P* @ 4)@ T *@ ЍH-'  )@@͝>O-Mp *@@$ @P |P P`: *@P ЍO\ *@pPbP\ LT p@!@@*@@PKhL@LL@$ { ,w8LP \.Pd *@P*  *@P *@P  @㲜 \ wP  @㦜 *@J *@PX  FpPt'@p'@n'PЍ$@ 5S \ S \ \  S / S . * @ RL R . * @ / S \ O-M-MQ P l *@*@`H *@PHP$ L@,PT (p<!@*@@8 PP$z\ nva`X \.P d *@P *@Pa0 PHP XVDp<*` Qc3+S82Ypb0``P 0P4[`3 ^0 QV@ 8W< @ 4 *) R( R4(pSp"60, (pS ,   l *@"ʨ0D嵜T P`p!@*@l  `*@P _p0* $ @~pP  *@P S 0*  $ @k JP 4p$Y $ p W  *@P  @VP `wlP p4p_ Z *@P `O$r嵜DT `p!@*@LL@TLP H地PP n *`@ϪQ  Q. * @ 0B?O k@`  @ *@Q V%@U%EQ k@. @<8g@0*$ @^Q k@ Q`  @N *@Q V%@U%EQ$P Kk`(0!@@ 2,0 * 00Sڴ0B@P *@1/l  *@*@ Q vqPUЍЍH-PUj @)`@ p  ,`P@`XXpX 㕛PUH-MPXp `*@P  @Q@@ *@P.  *@P p  !@㰱pH   !@3 x*@ 0B?f  *@0 @Q@ @  *@*@ c X *@P o @*@Q @Ѝ *@P  Q @5O-4MM@D. > * @*0@ RD PU9  3p2`)@ )  X*@P , @㿙 *@P1  x*@Q +! @   ; $p  !@ ៙ *@ 0B?  *@k0 `@P @  `0 0 @ }t *@P 8@s (@n *@P   $@d   P(@ <0 &  P$ @P` p*@Q !@` 㰰p 4 !@ 3| *@P 0x *@P@P  *@*@ m X *@P y *@P  *@P  Q  PJLP / " @0\/)\0! @ +Vp Y @ݘ  *@*@ "#w0L @X *@P   *@k`@4P @c/  !@㯘`P@`XX X ҙPU4Ѝۍ@@-M L R . l> * @*0@ 0  . * @ R K !@@ @p ) @pЍЀ. @ * @3L0. * @` S@@@B@?2 0Ѝ@V@H-M x\PP@J P`p)@@V`Q A` p Q P X X pGwX` *@P P`U`Q A` p Q P X X `F vUXC/p /O*@!` @0 p P \ P`U`Q A` p Q P X X `Fv*X`pP @P` XX X P``Q A` p Q P X X `VX`pP @P` XX X ߘЍ0H-@ *@P \P"@XPP\S00H-@ *@P tP"@pPP\k0 *@Q \  "@z\/ !@vH-q! Q  <  <  < <  < < (  )@`p Q0AQ`0NX X @GI )@`p Q0AQ`0@X X *6 )@`p Q0AQ`05X X =( )@`p Q0AQ`0*X X % )@`p Q0AQ`0X X |  )@`p Q0AQ`0X X /X@ X* X=X%X|X/*O- M p*@Q,p *@Q  *@Q 4p . *@* @ ,_)P@0`S ЍOL`` I, 3` @, [ ppSp [ U:zRp pYSP Jp  P[ /p pp/ !@p`@T<H-  )@m@㿔0O-MMP@Ⴅ!@rl `@*@p*@ hPfP hP *@ vP iP:   *@pp.  )@PEU(Aj *@(@H *@PERP  P `$a P !@U=NˑP Z/P / `p p/QP pp/~PPP  Q: @m` Q P`X@ᑑH-4  )@@0ᄑ *@/O-M-MP *@@PRP MQPs 'P 8mRP 8`gRPM / !@ @ |g *@PhRPd @X@  PMQL *@P SRP 8.RPIRP)@{yT2`NpXI>  !@"0@ V0 )@ @p噓0@  P  Pp$@ Pp G  *@*p@XF LQP @`` )@@ gj )`@P@p )@pw W  AQ  Pp `YPD / !@؊$글cP $ GPP;p 㵋)@` PP[ `*@P  0 A pማ Ѐ  0 A *@ @ 0 @   p$ PPx.$ 徾p @お$P80 `@*` @*@ GPP @nTX CPP" P @`@@P/ !@W'QP @O@K@$O O1@ PP  @< PP -P * @. OP / !@PP @ `*@P @ ЍЍ Y@0H-MP@vPP=  %p  d E@@l X E@@P$R E@@kЍ0TPP7  p  d @@X @@P$R @@ *@0EMPMS-@ @@@ @8 #0@/ !@㮉P -@M@@@ @M-@M@@)p@p .O *@㈃  *@)@ *@_ o (*P@*`@* @Pm""P"""T5 !Np5 . @09,T2 !Np;@T. !NpBB. @087\)@ U*@)@ D*@)@p  *@Q"  L*@)@ L*@)@'. @08p  *@Q  P J8+@Q Np (O *@@Op  P  P%  PK t*@@ @@8 } *@b.0 @@8tN@ 8DOPЧ`V \)@ +@+@h)@nQ? &%%&%V# +@PU S 0psp2P Чp `VE:VE@1*}:0@P 0!QP+@~\V0P% \ V  +@PU ?  S ~\  0K \U [ V+@P~\ ~\+@P\)@h)@P@ЍyH-M pP`@Np/k`p)@.P VpNMMV Nf`@Nf`@zNMM 0㘼p Ѝ@@@K-M@)p@p0Hl+@+`@ *@- P*X +@P +@P @    *@*@ *@ 㤐x L+@+@@ @ 2_ *P@P(O *@@NP   P *@xN`O)@)@@P $ +@P PM(MP  P L+@@@':X+@    *@*@0P SPR" { +p@ Pd)@     X\L+P@+@@Q P @  *@* P x +@@P *+@+ @ p 0+0 0@ㄏP*@PЍO-MMC"P")@@` *@ +@ Zp00  )@㰠VXW P J`+@@' @@0 l-~ @' @0r%p @7Uc *`@Q 㠐' @ ^0F"n% @U  LP@*@0` &~! @' @09%p @"08(z* @+p@@g d?`@)0@   Ț +@  p0 bl-n @' @0H% @ "`0U "N  Kx +@"> !@ ᱎߍڍA-~M *@P\_)P@P @o @)`@~,KP~܍0H-M *@@ *@P@_ )P@0@QJ 0[pʬ. @5@Ѝ0H- *@P@X5 *@Qx @+@@0 +@ G5H-@P`p dKPp@DPTWH-@P`p 4KPp@DPTWp@-\_)P@@T9  *@`@)@:K@VT   +@*@ 00T" @  *@T  *@t@d)@@ @4*d)@~/0 @D5pO-M\)@@T@)@`pP  JP@pPE`UW@T   *@@ *@ *@_ *P@@Q *tC P@@4@sP4TP  0Q*J P0zPZ#P P P tʻP P@@EP@@T JT @  *@PT@U4&T t +@Q !Q x@d)@@ @;4 B@vd)@ 0 @4ЍG-M @*@P_\)@PZ )@P@O  *@P/ 0* @0/ * @`V!*@( *@)@Pp 0pwQJUpV` oR` 0 U0eQZP P@ @)@ HrKPJ @@3ЍO-MpPPPPC\)@PU> P*@@P7:@@)@` 0PQJ( *@p 0t@`Qo)@``r`pP  0P0 S P  P=! @3PPЍO-MM\)@`VJP *@P PyUm@W3pV @O `)@@p~,rIPp@)@Mᎎ@H/`H`Jpm/H`Jp~ ~,NIP} `@~,FIPpd/H`H`JpGW` KtaQH/HJpp p+@`@US  0$4! UM @U@o)`@ 0Wq& P 0sd )@0P @o`p',& @``;pq! @ & @ ! @T& @~& @3p`pߍۍ H8Jp?"0 @&0 @2O-MM +@Hpʷd" @2  Hpʪ~" @2 @*@P *@P *@P Ѝۍl+`@Px +@@y2 L*@)@PBP D)@<P  *@pWWWP @*2d)@@V2x+@@P2@M2`2P6JTdG>p@P@`@!@@@@.P& P  P  P  %2"2 232PZPZw@2\@)@nd/) @ @@W28@@W1b#)@ @!@Q1x+@@1@1@1@11P9J.㇣CSs `@@@@P@p@*@.P) P QrPYP SP ?yPp7M@sP3 1 11111PZ\@)@@/ * @ @1X +@O *@@P ` / P*@* @ @k@{1#\@)@]@@@-@)@p'pH- *@*P  *@ *@`*' @}1H-UHp HRG' @o1@-@HpE[' @0a1@p@-MPH@p5@PP NPP  P P &` bHp   P `@ЍpO-M@PsJk+`@H0/PlJ 0/PgJ@x PUs  )@*p@̄㸔X @Q @0`3/P= 0P*4P3J%["P!P*JP%J/P PPU  0 )@@  0PP P (0/+@ pF SЍp' @0O-MpO)@)@@P J\)@L B 0SPp\PfJ*@pL  PpWPH \PEJZ)@PN @0  `)@PJH  2/pp)p@*PJH  2/pPJZ)@P" @/Vp pF  A@/ LA +@*@T ЍO- M 㸈+@*@p`pPJ @P,K+@@$  *@2/P F R h80*`@ 3/P @ PG W)@PB @/ @`p[ P P pW)@P X@u/ bp P@i/ Ѝ5@R < *@1/P *@~@N/O-M`P=J+@H0/P6J 0/P1J+'P.J@< +@PP )@EP h( @/ +@P $PJ@IP (0/+@ `E@'Ѝc p*`@̄㸴@P  @Q @0`3/P 0@[PJ P   0@`P  +@P UFP 8 ,+@+@& HFP!,8 +@+@QPP ` ` Rp RP~JPyJ # 00 @/P P@N T P+@+@& EP!P +@PT+@QP ` ` Rp Rj0 +@P P+@ 0=X +@PP l+@Q )@P P@@Q:P P   @P3 l @+@P @pJ @03/0l +@P@ 00 +@PX +@PH +@P @ 9 7  0\tU"0 +@PX +@P +@P @ 2 . +@  0 @3." @*0X +@S 0@PP )@p X +@G-AMp *@@/P P`PP  ؏ *@p *@y/P ( @0p-PP/P PW( @0-AލO-Mk@+`@PPeJUUZH0/P]J 0/PXJ,+@P "PPJ Y e#PIJH 0+@+@X\+P@ x +@@ +@;P4 (0/P`!P&JH +@XL+@@P +@@9@P+@ B@ 0@@,ЍS 㸄*P@P  0pNP P P !PJY  #PZO-Mp+@ Z P2J `P/J,0/P*J0I} +@P N"PJc *`@ P W 40/+@ `B$( +@P $ `Ѝ,LP+@@(P[PJPT PP d!PJK_ Z m PJ P a.  jBp )Pap@/P LP   XT h +@P  p  @POg(0 @j, _ P ~0 @+@PP P+@ 0XX +@*@1/pkP 0 +@PX +@P4 +@P @ & " D03/ p~ 0 +@PX +@P +@P @   +X+@ ^  !X+@WJ P P J P PJ pP C *@@8  *@1 H-, +@P C P JP J +@H0/PJHO-MMp|`+p@, Q P @`A+Ѝۍ@ /PPU/P /P@Bp&   P+1`PJg PJ#PJ +@P PJc *`@i P +@ `A:#9 A'0 @`\+$ @,d@P  p@+@ᰬP*8 +@  /PPF @*XBPA  PJPJ B P  pT P+@+@ /BPb 0 +@P +@ X+@( * @+@Q 8 +@QP.P4` 4P(T@Q:P PF @p 6uppڰ pp _oX,` R p RvP +@PT+@Q4P:` :m g(0 @*hp0 +@P_ X +@PZ +@P @   ㍃X+@E` RV p R4L q,  0 0H-J +@@Z *@+P@ R +@ ~ R"@~< S@<)0h)@+@  *@ p,PJ+@:+0@  *+ @0@-*)@+ @  J*@+@@Q R ~ Rڄ@~< @<}) *@pPJ +@0 +@*+ @*+ @h~)@* *@+ @ +@/O-MP +@P @G)@Ѝ +@h +@`)p@R@PJкԪ+@+@pA`? X P0P0 RpPPCJ:PU+0@ Uhp)@Q P. P:h)@ @}PJh)@  *+ @ Р+@000ZMPSS)@S@SU@(G-lo@)`@PE )@PC@(;zp+p@1P3Jh㸪)@+@PxP@ RUPpP(PJPPPjP j+`@ 0+@@ : +0@@M-M@ @@L zЊ+p@+@ @00C`So``V``  /PP`5 +@ ?U P'J*+ @РPU`U @APPJ  0P000S00PU `u @Ѝ@K-+@Q hoZ)`@+P@Pj+@p +`@pj +`@0pp J+@+@@pPJP mpppP +@0H-J+@+@@P0+@PE0 hP)@0HO-M@ +@Țh+@)@ P  P@'.pdڸ +@*pQ+ @a`T` +@`pPU U- PCJ p+@*W+ @?TP`D*+ @pV2  +@*+ @`V!*+ @@D` *+@+ @Q "Q  +@Ѝ +@pO-M`Q!ԚЪ+@+@phP)@@HT]PJp@T@ pPE`UpЍO-MQԪК+@+@`P@pKWpP`Wp s`@DPT`pЍHPpO-MPP$ԚЪ+@+@`@pKWh)@PJ`pWPp% PU`Ou`ЍO-OM`PpF (D 2F+@P C>p b.0 @&XzJ+p@ho+@@)`@ @RP-J R <PXx >pH L0"# @_&p @W& +0 @& b.0 @&OߍO-M@`pQD J=P k +0 @&ꘐYZPPP崐1ԊP+@` +@ @RP) 0 R Ph,+ @ R  0` BRPZz``W J R PnX ``h `+@P 8P  $@%ЍO-]MPpp4 50pE,8 @$D 2E+@㌄`P 8==pb.0 @%`4`D`E-=P + @0%P[ө (J$h+@@)@  `Pl;P&`P0$ R( ,[? 4u4 Ph)@ p;`P Pp .@)(<px |0" P#`$ @s@ P 0%`W, @0r%` P LN, @ P0Pe%`@0$Q(, p!R P4p`]ߍG-`@P   /R Jp+@@PY @$QQ  G:pANP+ +@QAPr- @0pp3\r+@@pP$( *PJ 0ɟpp[- @0$ +@0|- @$PPSPp,O-M@//Q/(P@ p` P`;P/pP+\p6 d +@P   ;p;P G 0./pP  ;Q  PЍ/p@-Q$J@`PW:pRUP- @0l$Pp;pC-0 @_$;S +@pG-MQjJ`P@T@*:p%- @0A$d +@P $( QP`+@Q P  pQ+@t+@Pu:s:pI)@)@ P`p pHP 9p - @0# ;R+@ЍH-`p@-;PP 9P +@1/ @0#P@-@9P +@O/ @0@#H-M@`Q0 `3cS)`@)P@PP* :P x. @0# Q 8 =b0A0R``pBQ H =b0A@R B9P MNPP 9pA/ @0]#Ѝ/H-M@(* R $ PRP ` V  P i:p   P@ " 0ЍA-MpP@L:P *9P-  `6P X#8  @0@ # +@Q "#!"#  @ "Ѝ  P "@P ]9p9pX'  @0Q/ 0 0H-M@P 9QJ+@Q   `' &0 0`' &@ 4"ЍO-MMP(P!08@P#`E($pEE ,( $p@P }}}}~x +@, @P @ +@P C9P8  P Y% L#8p; Cp9P8p P p,j,j 8(%838P% T T lP Ze\ +@P 5pl@6.$ @0"d +@P  P|- @ 0!8`L+@@Q P l< P;Q$l唃㐓)@P)@Dx +@@qP<  9p0PP,P. (@_@ U!@5C8pl? 8Q?"0P8 .$0 @!0 #@ l@ @ o`@ $Ѝۍp@-M` @8PPJ +@P PЍp  P"@P 7pVP ^P@ o8p +@ ]P@) 0F!PO- MPRa 0PpP4W@@@P `T V RQP z z܌+@+@؜Ԍ+@+@P N  hP (ZJ?  qP!J`P  `0PpWPE|@q / @l/ @80 Ѝp@-MPR ` 0@Q J+@ W6p ʊ_P@_P@ 0 PЍp0H-M@PJPw6( +@P `$P  @0 Ѝ0O-M Mq` V k# 46PPp@@ PP  #6P`8`9@Pp*$ 7p`HL  # ` 0`Uq8P @b.0 @  @/0 @ `Ѝ ۍ@-@<,+@+ @ QRL,+@+ @ R@ +@P I P+@ @P J( +@P P@CR @@O-M$K+@@P 9 +@J p+@)@@+@)p@\+@+@Q P Q5`Pp PV P` qP V  `$P+@ `Ѝp@-P@P @p `HP P@P/Q+@ f0@S  +@ PPp @+P+ @Pp+@Q  $+@Q +@ D+@Q+@Q P/ +@Q $  +@0/H-( +@P  +@pW @ a)@P@@`@Q P wpWO-M-HM@ +@$+@Q PPJPP P( p0 PFQ  `+@$0 P@,4yP @ P<؋؋$  -PUZV  @HN4 ϊX   @ QD0 +,W4pNp  0Z!  @$!  @0'( +@P" X` P8@0 Pp8 <0 @DP"P $*!  @[PX  P8礍PȍP P(PPPD& , #0 ( +@P  `Р  8 $ 0 0 , ⻴,(@ Ჴx +@@PP +@HЍЍK-hMP0 +@@P1 (``pT\\ Q-p㟸P!@0Wp t  @  vv<PH @ 6P$0  @dvhЍKt  @[vj0 "@Uv<@Q* @P @Dv wPRhЍA-8MP@0400 0!4 @p`mP1 ! 0@ @ @0P8Ѝp@-XM@` P0`8[\0D @ ,XЍpp@-MP@PP Q `P0 5 QЍpЍp@+ H-Q \ 000SQR P* /00B Q:AB60Q:aBV0Q\ P * 0Q0A\A|*:H-A0\ Q: W \03#€A#2\ Q :A1^0Q:0AQ*H/@-Q0E\ 000SQR% PH* 00@C TB"/ A@CTB"@ a@CT1B"`   \& P"* 0@0T00C!\@? S 0! S@" P$: H-00C\ S: W \03!€C!\ S :C^S:0CS*@-4 @+@Q@@ @H-P( +@@\q 0p@`Q` ,k+`@` S! H^`U?`-V,,+@``````V ZP:V  )@ @Ha,{`+p@`:P  )@Q ! `)@` )@ @0t?`/p@-4k+`@Pp  +@@ bP  S )@@P@0 atPx +@, @MPQYO-dM/x|P+p@,b `@ I̜$\P+@+P@ +@`u ` Pp@)`@@  0B0@JQP\\t8\ \\\\\\\\\И0\\\\̜(t\\\\DP\\И(\$\\\\\\\\\X \̝\`\PD̛\ؚh\[P8\И\|\\\\\\؞Ȟ\\\\\ 0@<)@pPc}$+@x)@P @)@pPHb+@]\ 0@P+@7ڀQ  . *@"@Kn @  *@El)@@L+@;\ 0@)@pP#) @*H+@%)@64+@+@)@'@GP \ 0@08+@<+@+@)@)@)@)@ *@0 \! +@0 @8; +0@ @+@  *@!@\ 0@pʬ)@P*\ 0@-QQK  *@ +@Pd+@)@`+@)@  { *@@0+@)@P< +@P\ 0@P h +@P +@} +@Py)@u +@d+@l *@ e)@pC 0   0#)@ <X )@ +0@  R Q[q qR+@p)@L  !8 +@++ @Pv -q@`s p@@0  )0@l\ /PT0BJP|@@@@@@@@@@@@@@@@x@@@@@0HHx@@@`@P@@@@@@ĥPH@@@h8@ 0@h X@`)@ BP 缡@@ +@RF\  0@*@)@  *@!@|, +@iv +@`p +@`j  { *@@d+@ `^\ `<0@d|CS+0@+p@)@@)P@ lRmR oR pROaR eR#) @h,\ 0@M p1c$\  0@*@`k0+@i\ 0@*+ @ p*,g8 +@f`\ p0@)@  @ L0oP+@ ̜h+@4+@g\ 0@p @$fP ls )@pp@H+@bL+@a\ 0@ pe@+@d+@`  . *@"@ *@\ 0@ pb<+@e\ 0@ `+@P@+@cT +@@|lx\ l0@Opq{P +@aj\ 0@pojb+@@`\( +@jVR[k P@l)@s p@IrRB  P P )@+@X.0)@0'L Q Pl +@f 0`@+@p[ PK@T*@ @T ] @\P" PUP P 8++ @p 8  +@ p pGp@Tv 8 pp+@  p@)PP @ !@Cp@P4 PP PA  P HFYW U p @ qPWU +FUp &FPP p  pʝWU F  @ P)@ H p+@ PQ   @Pj8+@e )@'D" @ @Q Q-)@0 H0-)@0 HB 0)@O". @0  #Qp)@+@LP$:@Q:P7  )@ PJp+@ 7p7 d )`@ P7pl)@ d )`@ P pH @<O @6 \ 2 0@@ R @*l\  0@@& @,\ ^ 0@@  )@@t @dT "P@oL o""@V\ 2 0@@  @rl @` @  @p[ KPY P% pP!ʔ@Tw ] @PYm p@P @PPZ pptP  @P  !@nPPfZ )P@P. f v @`@p@ P  oP XpC@P y@T5EPZ/  @dP } pP}  @$P .pql)@ O *@@PPP  @PP @dЍ>` @ .7K-g@"`@uP_pp g/"`@W `PJp pF#  @0b4+@P  /H- )@ @Blk@- )@@  @0ᴲ] @ 0᮲4 @ 0ᨲ. @ 0ᢲMkA-M `P Pp0 WA L: RI 0lS bS kS(k5xP;mS wS(o1xP.`k4xP# (f:xP  0S xS *SP(P6 0R!0 PЍG-PQ> @bP) ؛4K+@+@@PP" ,`P=P p =P 0 S00PVR @{ @R @'fC$G-Px  +@)@ @ @#mU @!@p5 oo mVUP@ڰ  Gmp@-MPVP P@P PPP`=P PE` _ +@`P +@`ЍpK-MP@P| @e`p\Q QY Qpp,=Pj  KP ` ;C^ @ 0 B<`\P P+ P``P" PPP6 P fQOQPQ SQ 0gQ sQ pQ*  GQP B @ [ۍQ+@ R +@  B @} B  @++ @A-PP2 @*p@P<P `pp 0+@  +@PR ``G @``H- +@pW tK a)@P@@`@ P kpWH-+P+ @Q# 4p@T $l0+`@`V <+0@0S Q Q Q BPP0S  @P0SP `P/`q @/Q @ @PP/H-+@+ @p`W P 00 /P}lP pW +@o $+@+@oQ` p+@P aPCSUSK-P`>Q&?Q) [QS.QK  !R`!Bo  @`P? ]P# p-W pW]W Wpp#P @P *QSSP Q! QP R`*P P P  0P QP P +@Q /PPG-MM@)@PP `p.W.P{  @?PyW Q@@QP.QP.QP/Pf +@P U` PP^ P P2 P ` PL +@P| x +@ @o+ @[ @} @PP0J+ [ }l p!@@@`@ cP 1 P! @ @E  PZ P/P @ >PЍۍ.P P @dP P @[` p,&WZP @I P 2. ,/+@pW7 P/P`P  ,@p.W ʩ @PpW P /PP ` P   @ P.WPʩ @P~O-MM@ &p+@`P,㶧X  @'@P(P`'` [h 0SPa V3Q V* V3W V1: Vs P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  @NQ \R\&R Z:Jp '@` V Bp, P ZX  C @ Ѝۍ V*' Q pP P   ] '0@ V ` P' P  ',' P  )@ '0@ h  )@@ hp@-@P` 0PJQp  0pp0H-P@P/TN@N T) @ 0@ U:UNAQ:0Q0N0H-@MP@Zy )@+@10 'P<84004&0&P<8400(&0&P<8400&0&P<8400& @,+ @@0 t+@0 0 b @ @,0Y|p+p@P  NPJ HpP  ?PJ 9pP  0PwJ *pP  !PhJ pP  PYJ PQJ pKڧPNJ"@$p)@HڙpB !@P@PF@@PP PE/Q +8` +@V`.  U & ,@+ @/@ *@T_@rC)@@@P\>".  @@Ѝ-  @ @x  *@P +qP @@-@0 +@X +@T: _ @@M +@P %|( +@P @jdH-< +@P 0/C%=Q5aQ^ PU  +@P  /C#=1#aQI 0S  +@ R> `0p PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V RA-P@`PV|+p@P=:P8 #V \V `#P` ?P`e6P P/C!=Qh6paV Q P7P `P@ @ }  @{ @u A-P@`PV|+p@P=j:P8 #V \V `#P` >P`S4P P/C!=Qhk4paV Q P6P `P@$ @ + L @ @# H-P`@Vp @/hpW PP`VpP0 F R :,VU .V,P (PA`Vo6P W`P @p bRCR MR mR cR5p @ TR(] p `Q G JpUP+@ R +@ ``,`+ @` @0 ! @ !p R. @ 0 ;  @ { ;Q @u H-0@PS$  p)@ .SmWpj0S`W 'Qp!@׳`p@ QH 8hhhhxhPP!@k@d TO P!@P@P!@ P!@!@ݴp0H-\@+P@P  8P @ @0O-M +@Y: 0@P4 \1: РPq vM㐡`aV p !  !  pP` @%5P, `P$  @ `Ѝ ,㚢  AP Q ::: @x H-+@Q 0$0 R: RC qN vAMDI%bAT0 $ P "P%  `$p% "  @T:H~:K-騜+@P y`AT Pn:l:U@`V 0H-\@+P@P)G 8P X +@@ \O`+P@A@3p)@ }"  @ 9 0 @U @0O-MML+@@Ql p PG% t堳)@AT `P L ! 8 P7 dP8 @T 24P ` 0-QJ tP-  0+@p` a0P  @ #pA @@ !  @8!  @  `@ 0T PA @@ 9Ѝۍ@-M @Q0@@B!S !Q 0@Q@?0 !`#!K0" ?^   @@@T: 0 GЍ0H-\@+P@P 77P @) @0A-L`+@@P$ "@PqW P p 3P+ puP# `oP qP @P `PP ,9VP  @"9 9- @ PH-|`+p@P@P"_qW P p Ġ0H-\@+P@P =6PT @ @0H-   PM-` +@@pW# /PC!=ahP Р+0* R 2P ` P@ @n O-M+@PU 0/>3C=a 3@0'sfp$0 "Q  U `p'`&p PS0 R^ @ PN PXZ 2PE  p  p P "B @ L,+@@+ @ 0%=R />3C3&3ᓌc1S ` p'`&` 0 0   "  PP@  @  @Ѝ 0@ K2P 0 pp ``  0H-\@+P@P =5P @@0G-M+@P P=p aV  0 $@ P?(` Z ЍO-M +@`V8 @L@P@/8C<!=㐱hP ! # " # " (0@ 1P p P ( qP @$Ѝ7+ @ЍOAG- +@^ /NCCD%C=Q%dAT $ `Ёp)P(PPЀP) p(P (PU@  (00 R7P7/G-Mp0 +@PP/P` C`P' (o1P p]P @+@0 @ `P Ip0v @ v @ 7_ @ ۍO-M\+P@@T, `㔓㐣c+@)@)@p)`@P$P F  p pKP 66@TЍ  +@ Q/H-+@0S ^Q <+0@0SQ@- Q @P * @ maP )@)@q  @J @ 0H-M@P b `00?(P2*2*`` 00 Q*  ;00?( P2*2*`` 00PR PT @Ѝ0O-MP4 S f ㈓Ь@P@`@)@+@p@PP P@P @ 05 # 6 @ @0@c @ 0ЍO- M@PS`PJp( KAQ:,<+ @+0@P ,<+ @+0@w d  l , t 0 |  p[ Pp$``  4P  KJQ1Q 2Q ,  KQ LQ ` /R5Q (,,(  `  ` b$   l b `/Q``@ Ѝp@-@ Q P`S5peRe #p@O-EMP`@Q 0@dP`ddeQ  @@+@Q@P@dT1  @ p8 d ٜ@Q:P P/ @ @ @ @ @12 d 㯜0 |0  `@+@@@!| @idPЀQ :1qpA~1QSpPQ: A0 cA ,\qlp Q :1QPA^1qSPpQ: A0 kAh 0\ytp Q :1QPA^1qSPpQ: A0 sAMIpJ: P Q :1ᒁA䅎1QSPQ: A0 A0s `  ?(P2*2*`` 0P eQPp pQ :1QPA^1qSPpQ: A0 A[0 l @@Eߍ Ѐ |pQ :1qpA~1ᩑSpQ: A0 {A3  O @h'@PJPJP P@ //0H- Q @P P*  @^P 0 @ ^P +@P +@Q @ 0H@O-MP@PJ㐄`(  lY!R ,m`/  KAQ:,<A+ @+0@@5 ,<+ @+0@) d k |  p P`p$p`  HVn)H=pt Ep ,` (᭟pl 4Pm GJP1 @R 0 `(<D (  aK@Q:gPxP !& xP#@ @  @     +@QD KP  bC   1 ,  I PQ p @ /O! (  B  /R     !'KP@# @  @ Ѝ O-MP@Q :P P @+@P  @! dP +@P  F`dQ0 +@P&Q$d@ApQ /Q @ @TT }T Y 1`/ P%  }d 0@ Sa`23 75pTPtt44x1p @ 4 Hp `q `OIVDQ :1A@AN1qS@pQ:./O B0 5W&FQ@p hqQ :1A@AN1qS@pQ:./O B0  0 ' @ @0|` f$  QS:1a`An1qSH6pp0  |0 PK d ㎙ +@@`| @Q :1a`An1AS`@Q: A0 {A-  ' 0@ @ p+@` pfL|Q :1a`An1qS`pQ: A0 {A  @@=rutF` +@P  0Ljd` {`Q :1A@AN1aS@`Q: A0 cAo  -0@! @i,lrl@ @pQ :1qpA~1ASp@Q: A0 kAN  h 0@" @H0Lztp pQ :1A@AN1qS@pQ: A0 sA.  =' 0@ @(@ +@!@Aq:P@ @Q :1QPA^1ASP@Q: A0 A  A' 0@ @@ߍEP0 㷜k !`@UP x?)X` q?j  `  ?(P2*2*`` 0+  ?(}P2*2*``P P 0@Q :1A@AN1QS@PQ: A0 A  G' 0@ @}@PJ OPJ\+P@P l+`@ P J @ 7PJP P@xA-MMM `P@jP@, U U +@ @+@+@ mMލڍ @ y0H-@P PN @ 0HH-MM A0 S0Q ! ) @@ 0P `.p*V ?V.`pp\pp0` Q0/P @( 0 @ ݷ@P$JP( 0 @ зPJ@ ( 0 @ ķP J@(( 0 @ 㸷O@ЍڍK-M-PP  !@YPP 7d 0@ TZ )P@w p`@ᯰP @ Q 0?k`P @ @)@U hЍ0H-3 @VPJ@@g\P+P@ !@g +@Q0hQ +@P < 3( @ @00Mp@-MP@ +@Z H 0+@+@)P@ 0Xl+`@P  &3x P+@ !@X / 3Ѝp@Ѝ/ M@-ML+@@  P0  Ѝ@ Ѝ/p@-@QP +@ R `Al2P @ @YP@@pMH-MP@ +@j H 0+@+@P)`@0X|+p@P X 2x `+@ !@X ̶T6 !@uX 2ЍHЍ/H-M@P5i!@a6'f!`@p ELP PPp?  )@P:. @P) @/P%f @ -P @-Pp  "@p  0"# 0"#  @PᨄJ )@@X@yU@ᕄH-  )@j @WhUO-MP@h!@p5 {h +@+@`@+@pp 1EeP qPrP vP xP8 VPPP RP fP iP) +@ pWP dP +@ +@ p+@ +@ +@ p   )@`V +@PЍ@QYpPW> P+@H@Q  /Q@ pPP/Q /Pp.PP .PP PpW @1ppQpWP +@T*[+@w+@PU l p@!`@@、P+@ Q iPF  +@P MPI I?PE EPA / !@N;Q 05 02 Q-+ @ R' -+ @ R Q  P   P  P +@PPJ +@P x0PU~= +0@P0m+`@ `Xp rP @@@᪸]P+P@PQS/㵼p!@`!@@ Q HX +@Pn X Ph һ``+@Q X PU P Pf P 5$+@QPF p4 & < #P+@Q. {P,/ +@P$P' P?P$ X $ ]4] +P@/ +@PP P+@QP  M`pPvh +@P +@P +@ C-P )?P %P$@~B40!@ kH-  )@+ @UGS +@/A- M@ +@P  )@@ UJ )@@P@'P& `+@P5 P P0 5P+ P' c; +@P! @9/` )@KeP P@  !@"0@ V 0 )@ @pZUO-OMM`@Q  p  P#@ hp PP Ѐ # "!Ѐ # "  PMxpRP 0w pjЀX` XzPp X PX&P 0e ?ЀX` XzPp X PXP 0:ЀX` XzPp X PzXPr 0jW WjX`  PS  vnpWPJWoPB 0:РZ`wV`: Z `Pj PPZzApp`P  p+@p/ !@K h p+@p/ !@K^OߍٍG-P@d!@2p$p@` mApP p  )@P2P+ /P!@pp/;P PQ P p/*K{K P IQH-  )@R @S=QG-P2Pr  pRJ+@GB4;`'pd>; :; +@ aR +@P G H-@Q  0S mJ+`@P@' `qW iP `pP R 0S JA' ` +@/p@-P@U  Qm+`@o)m)k)P +@P PpH-] }+P@@`+p@Q `'VP +@P HH-@PQ  0S`J@' ` +@qW P pT `@-@P@K-m+`@K@o: P+@ 1S ppW1 0'PR0P +@P 8>0@ rT hu@)p@ `^bQ A ]`@T Kk: @7p@- mP+`@@Q  R @RP'UpO-MBf+`@Q< pW8  h@@)@ =P @{5P P ?^aQ A ʶ\ l )@@ ^pWF Ѝ0H- H!@@CBP aP@0V@+P@P o @ A-Mm +`@)@@(S P@ >-p+ @00SqQ Q, Qp&]Qa 0AS@"#P%P%P%##P%$$ $,$H$T$P%p$P%P%P%P%P%P%P%P%P%P%|$P%$$$$00 @G -p+ @   G 000% 0@FG@+@@'9]+P@ p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S    j  @H-M@P8m+`@PL㟮P  IRNP  㒮pP  ㌮pE +@@ +@@@ +@PP8Ѝ @ 0H-@Z]+P@ )RR0H- +@ M @dA-P'@2 ,0$)@) @fp +`@ P Q @Q A `9T@Q@ A T QQ9PK!@@ QI9@8@l +@o@& !@ 0Po\oK-0M@ +@pЀ(,``TV F P :(( 0#@P0ЍI@PWV  F008@P``  @0b C]G-@P̭+@ %Rpo`&P` +@W@ 0W  @E@-@Qx@ *(*@*P*h*)******+ +)+ Z # qY PM 0_^R R ^" #o ? `2 0PQS? @PS2 `QSQ!!R .," # 0  @ @ @p@-Ml[+@+P@`3^@8)@`P T0 TPM$@@ _@PPP P R ( @    RЍp) @p#@|A-@pP +@`P, +@@$ 0A-MP@+̍`+@p BP0P `pR +@`o`P 0ЍK-(MP`@p!PW&WI We W +@ 0p'GP:$WB "WM+@@#PtW> W|UH ЀJVnU+@Km'@W+`@@P'WP` @ @ìM +@ 0o᠂@ +@{ 03Ѐ +@l 0(ЍK'FP]U+@ Ѐ +@`'V'VP`  @t U[ (Ѝ @{ @w @sO-M8̽㼏 P`p+@@#@ +@   01@ DR0 0SR* @Z 0pD`PP PЍG-M8mG )@@@>peP P+@PU' `V/ ܝ+@pW "P @pg5` D0 D3|_3P!@\PPp @[-PPJ E"@@P@.P.PP/P3X @ P# p` Pg5 PJ  P Y gQ Dp  `P @Ѝ @3\P +@+@PPP} @ @p@-m@+`@Pp +@Q  @PQP 4pp@A-MP+@@p p +`P +@P W 8)@6QP V+@P@Y@ P@ +@P zO-MP}U+p@Q)M+@@P #]+P@P +@P SP  @ Y @ Y@|Y4+@ 20f)@,+`@)@@/Q PQ PP@e5@UP U/P@DpWI Wづ!P@"@ PQ /Q @hP P,  `P' P@/5@/P P@#5@Y,)@T1T   t/R@pW,)@T }+p@ @@y];}+p@P@4@/P4@]M+@@+P@P C",)@3  @Y @ YP@ +@P Ѝ+@P/ 0RS /S  00B /0H-M@P P/P"@D p ? p  0"# 0"#oBލ00H-'FL!@@P;pP+@P6LU_8]+P@P0P) hE)@@[V! !UQ A  V FV0) @& @" @p@-@ \3`RP B3"P P2`2+@p@03Tpzo)" @H- +@Q   @HMX @HG-hu)p@P`!V  @P !@ Po`Vl P @T7 \T0@a DR0=t>|>>>>>>>>>>>>>>>>>>@3\T1 0T `@ P0 BR6!Aqr@#\@` P, Q A KU `V@ @ @ @ @ @ @`Q A -U @`@X Q A U XU6 @nH- +@P-+ @XH-M +@P +@ P+@  Ab+@P 8)@6PaЍ MH-MD+@  Q0  @-@ +@00 +@Q000%UMH-M  0 H-Dp+@M0H-MP@ 0< p@-`,)@@ PPQG+@Pp8+@ R @)@!@U +@Q @)@!@UV @)@ UTJ@K )@"@UTJ'/ @!@)@UlE)@@Q A >T @)@p@xTQ P,)@rTp@-@P` M@-M  @0 s@-@l M@-M@   xЍ@ Ѝ/0H-@P 0Hk MH-M   `ЍH Ѝ/ X@-0p @ r R P  RM0&+@@$ @ ZU@+@+@+@ +@/A-P'@4 ,0$)@) @fp +`@ P Q @Q A 1T@Q@ A T Q1P(+@Q1@0@$+@(+@O-MP @0l +@ !a9u)p@P" 8dP @)`@U ^PZ  P +@P0=9PP! 0[(+@ZЍ%O-M8P)@(^@U+@`h P p0+@QGHH I4I\IGG(HHHxIIIIIIIIIIIIIIIJJ^`P ^`PPP# ^`PPPt+@P P^`PPvP PUbP]0U`hP``ft+@P PW 7t+@P Pt+@P Pc?t+@P P5`!/t+@P P$t+@P uP> @S,)@Rt+@P dP ``(o` / / +@P "QPP 6 Ѝ2 `P{QG-MP+@8)@PP l +@` +@FG R @ RplE)@@W ` LpW @Q@R p` UP +@@JP Q @Ql)@(RP;P8 (+@1M+@@p 6H`P +@P  JP +@P P Q @Ql)@QލTK-@pd8)@PP. l +@` +@FQ @Q`lU)P@V  zL`V @uQW @pQQ A mQ Q]W+P@'`Go"V(P W(+@OP'PW@P +@P >G)(+@P +@P (WPP l +@` +@DF Q @ Ql)@KLQO-MP+@@8t()p@`^+@P3^+P@`P QP $P"  `P P P^P PP@P`1`@ЍO-M@(8+@)@ ^P#.U`^+P@p`pW  fP h.+ @00[U lkp l+`@)@P( ` +@E}PJ!@zP xPQ A uP =PQ A fP P R)(+@^PP P P [PP.(+ @+@@ -ЍG- MP-l{ +p@  @(`+@T7 +@P2`PU  P PU@T P `P8T)P@^P` P  `V P^@P ``i- ЍO- M@P +@?&pPW8 +@`P p> R &PPP VEPJOEkVJE`BpWQy'( +@R +@P ЍVJ&## @O-iM8  x+@L$ +@ +@0+@c,4@+@l[a +P@T  aopP n:P @T p_W _O`Q:P  pW p!P ppp+,tQ t 0t1 t8 )@6 +@R( PpPt(pt AtRu ` +@DN|Qlu)p@U1 =` @ Q A N @@P @OQ A ʷN `` OP @UAT P Q A ʙN PN@ PT @T Pu IP@ PTQ A xN Np\V_@Pa |YL `J `@@p DP$Y=` Qr pt1 \ @ Pp@`P -R -RQ! ` pV`pV$ U@PPp\ pW@ptt $pV_PXPFtV $0P MV_@`8)@`t+@Q @QG*`@P@PAP0 m+`@]$Tlx lYp'&PPp Tl!$P! l(N+@@Pz lPzh@dtT rPP-LPx &P Kxx +@P x 0+@P +@P dDhCxx@QC*`l@ PlxP Tl)@ 0@p0l8~+p@,8Cm0+`@P@L zP<hUP+@)P@ +@,,P ,PD+@T?% +@PZ MXPx @ KPCFT+@@ +@ a8| 0` HppH0p1pp}+p@t`0C0004 pZP +@P PPPP~m`+`@PPY+P@L V\PA+@|PPk` Zx `A=ZS +@ 4-1 h DLQ EP +@P +@Qx 8 +@$@Q `@P@P T +@4 $ BIPl BpPVV|QPT 0@ 4 )0@@t! '+ @@`1t!+@xA$.+ @pt@3/.P P0T[+@+P@4Pw p @L+@US0.+ @4P| }f,P (+@LNMl@)@)@,)@qM P -ST4+@,V/P 8xd,p ,P,Q]P[ 0 +@ +@P ` P DxP Tp)@0  0A(P ( $@)7Ncl)iߍ P@NP|+@ @L sO0T+@0l!"!Tl!0]# 8P)@% @(+@J,0N +@@  RBP |P B@P_NP.P0.+ @tp ``1$ p +@P8/ H @/ h DP xDXvR +@ +@ 4+@LvN @P +@P Y6 @| +@P0+@`(D.+@+ @P W0H-MP. @ PP@Pfffff(g(gXgdg  @TP   `6  Ѝ0@-MP @PP I5P 8+@ 0Ѝp@-@fPPP p PPPP  Ptp `x`pH- MP @8)@^P6U4 '(}+p@p+! `!P +@P F@b> `P +@P  ( Ѝ% @@-M,N+@@P' 0)@ |p f'P   0)@|p =PTD)@Ѝ4+@/0H-MP/F+@@PЍ08)@NP6Ph-<+@PU BLP@N8 +@ 0  A +@/+@/+@ / +@ /+@/@-@P,P+@QQ.@+ @cP@@g @H-M(n+`@/V+P@P @G'P8+@P +@^+P@p:&pZE'ЍH-M@8 +@/ҜP P%  P&  P) PЍ MP pP `~P   P& 8PP "@y @ @.+ @QU/H-Pw+(+@ .+@+ @0 QSQSQ 0+@ //G-HM !@.8ZN08(< p @@`PDh)@0  @ ` @PJHЍH-M@NP+@@`pW's`qp@g`+*  @ @ `z@ 6P0P 5p0Q P.R 0r0S !@ U|@Ѝ N@O-MP@/p P }PP 0TkP U9  Pp;:H㘰`P+@WP 08UMPP HP D P ~p PP9P%  9pG`P> ER:UU ~D.@+ @0!@ H-`@PpW pV Tg%+@8+@+BO-MX+ pR%pPPP :PW v0D)@@`Q%P,d)`@U@  Z/P/Ѝ "H.+ @WQ:Q:Q =@ЍO%O-MZ P@p`@-b@Q'TtLts\thtssssssssssptxttsLttp`@PW6 +0@` RW pW P  V+P@AP PDuPu\uhuX [ Z V pWi)@pi8  +@0z PPPQ PT P PuH&+ @pWAoTL +@pPU PvvvvX[ Z V poPMPL+@|Y:hE)@@`GP @GP PPЍK-L+@t@+@)p@ PP `Q QQ`PP|U:P +@P KK-M RwHxxxXy8 +@pP @ u`$PEUY  @5H'Y,.Y,  @F/ !@'HM+@@S PiP +@P  @kFiF! @fF Y @`F @]F/ !@G hE)@@P Q A qF *Q A dF Ѝ% @H-`@Q  0SCL~a+p@!(@r !!ApQU P# pPV m+`@j)#P  P +@P P+@p@-M+@+@@ 0 0P +@P @O-M/@`P0P  8 +@P` C @P `zP+ pP P P piP eP a  )@p P p)@p @P@Yp P)@ 9PN H +@ p"Q D @v'P P RL @k'P /P  W YB P =p   PPj P P P p@ pY l`)@@A0$@ @}F: p(@p㴐+@`W ppAo  pQ B0R0 @ +@P W    ЍM㴀+@@`pPsp@op`P,)@@D!!UP pP#Q @ H-, P@@P `pQ%V P Pp@H-< P@@P `pQP Pp@0H-< @P0@PP@P0H-L)@+@ 0Q R RP U 0|S(K-@8 +@D `pP@P P:Q :PPQPPQ %Qv&P`:QPp@D)@@qVQ`UV Cq `A-L^+@+P@`@T pPNQ@p@T`|V:P +@P Ap@-m@+`@pPP PQ Pp +@P p@p0H-M]@+P@84)0@>0 0O P Ѝ0 +@P Ѝ0HH-.P QPqO-Mf[ P@`p@)oPP VP`ppP vP@cP  /o0"  V+P@ 0S X | @p@@ `@YCZ @` Q᤾P9 PP? @Y ` @DX @B :P @B@DP hE)@@Q A B Y `  @B @BP l0 `@ P: @ `pPXĈ؈/P* P7 ~@Y-i^!@@Y#_ @BY  @Y- @Y @D 8 +@@@P B @kB@XC-Y !@D8 +@@ p  +`@DTY  @P !@ @C@C | @ `p@@@Ѝ| @; +cP 0@! @ @yj @uH- ,)@HYA-P.+ @00. p+ @p.+ @0.+ @0l++ @8$) @0f )@,tFRnP)p@+@@+`@00yX PP@ CI @@Anp+`@` 5p+@ @p` W ppQp& +@ Q  @-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp  p%+@) @  ,N)@+@@P`~P  Sp F  ܆  +@ `P<UځE P%0h8888Pt~+p@ p U :U Ul+@=UPutPp pP EPp ,)@ AApPPp PP~ tp,pP p@Pp=P +@pP} P|{+@P1, )@@Q)pQ&uP^ PUTP('PpPN p~PJ=U PpP @Yp ;p P5 P<; p( P gp P!PPp UPl+@lp+@pp Y P`pЍO- M+@@Pz pe+@)`@~+p@@` P_P @Q::P @P- T0@6 PT5  U5*@T T` `@#P' $@ ĮP P `PP PPU: $@ 㯮@ UT PP ` U: PpW pWQ P   ЍG-PN ^m@+P@+`@+@+@ >RR4 *R[R?R pP ȱ P ӆ' - PP }P P  R Pp@@T0H-P0^@+P@@@Q@0H-N+@@P ]m+P@+`@p pP P 2P+@O-M P,n)@+`@A4F84p☠+@@)0@P[ 9[ ځKQ:[ Q W [ [ /[ Q A 684)0@EQ pЍQ&Q P ZY!@CP9 OEP $ p@Z y P p P*p P PPPy/PU/PO-$M`(#  @=P ᣑ@o`   P*  OP2 p`   +@/ `Dp,>)@+0@P0RC V< [H0 z ؾ+@ {B P `p Q @P+@,)@+@84)0@0AS p*P@P p R OpPe R$Q PPQWؾV+@C+@P: `FV00`/ PQdؾU+@ `p P +@P +@P PPU`F R ,)@+@0PA`倰@ c! !@P+@P ` `@BQ;*Pj  0 2lؾU+@f `$ @u P +@P +@P PPU?B Q0xxxxpP +@P>+0@p!Wp P @؎+@ V*4a >+0@,)@0PA0 00 0P~,$+p@f) @+`@ 00 @ p,)@+@ A x R +@ 0S S@`VW   S S00SP$Ѝ  @ػO-M44`)0@+@ `,t -+@+ @P)p@ @+@+@ @ E 4 `+@)@+@p[ܦ E+@4`+@ @ +@@P@ʴPqJP +@P b pP UPS p@X X@[PP[ A E@QPE P@iP@DTPʁPP $ @ P p P *p P@@PJP P 4+@P, )@Eo+@PP +@P ЍO-$M؞,+@)@- +@ PHP@a`@ Al +@`p(ܦ+@ AQ`  @= @@ 0@S "R  @ $ЍH-~`+p@@PP Q Q `+@`P @PK-^+P@PJ +@ P#n+`@P }+p@+@@@P P 0P P`P  Qm}+`@+p@@Q@P P PG-Pq Q:PP U( PE`@ p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F べ`P@V tPO- M4)@ԎpR+@`F^+@@+P@P V,)@p p  =@p ЍVP0X <  @0@0l @t@)@@ ;~O-MԎ4+@)@PpB`W*(QF+@@P +@u.+ @W,)@`P P @,$ Yp `P^V`ZpW:!pEW: `PGZ`@P wQ  0S Q:ppW*apEW]: ^P<GZP wQ  0S Q:pp`ET@* AP Z Q@.EV`+ @D+P@0`CW P@^f+P@+`@D@p@@ЍᒸO-:P:Q @ PPP3[Pq -Q PU ]U \UPY[44@ $ `8-PJ $ 84P-P]P9 R RX ( @ X* RX (3 0@00 0Q 4X* @0 P  ; @Q: p  [`N[ `?<Ѝp@-M`P@P*P@+@P< U9 P5P2!P)@@P@)0@@ P%@@ 7%`ᘷP=PPV +@V @+@U PP @ЍpO-M`P RP@,P! @ R0+@x)@@P+ ?P -Pt @@T\[ 8v؞P@)@+p@+@aP P   P@T+@Tp+@6 +0@)@`TA0p  0S0P o/o$A V؞"@@+P@+@だ  X) PR  P PP   u   P( W P :P P[P   J   P< [ P PP QP PPPv (+@N+@@-Ѝ0@ P` #`XP=PPV V+@V@+@Q +@ @嘀``P v^$ +p@+P@ぐ@PX X)  P PP      PBPQ P PP   t   PP`PUPN PGP|?+@PT1P5 Fn+@@+`@pU P :P P#pP      PP $A Vn@@+P@+`@p P PpP      Pp@- M P0 Pg0`BfF TDaOa`C 00``BS:UP0pV-+P@ @P @ ʪT@P ЍpO-M@P ZRDڈ0BSP:RD [RF 0^S!S 0pCW,:[S ]SD S# 0:S:0ps`\V:V  ]R V 0S /SpV /V]V  00S/S  ps :R *R?R R /RP PR/R Pb [ P AR*Q@ Q:n+`@T T/Qb D"@ՑP> T/DZ`PFQ*V`+@P"P p .P.V  7P Z Q/@Es+@-Z/EЍ^ +P@0pCW:S000S P uPJ "@P R0H-@ᨦP9P+@ 0H-MQ)P`p pAQE@`Pp嬯pp`@TP@`PpPЍH-MPp+@ 0n,T)P@0$@+`@) @+@@F0 +@@ uPKA @ЍG-@@ !@k5h)@Q A 3pY p`PIppPUw@N5Q A 3pY p`3Q A ʵ3`@T pH- @H- @@- PX5 +@rDD$)@Q ` /P Q pTPTP RQ /PQ QRP% P +@P paV @C%08$) @N RQ Q  P v@-`C+@@QT+@Q\+@QX#+ @ 0S 0RS Q c @u'A-MP @h+@P R00X"P@!@t<Pl$0 $hh @ @5 PU In "`@PU`V _ P@P `VP @m!@N"@e{ @ @ @ @ P  @ | @D @t J!@ ~ !@{& @uc "@+ @mj !@g`V  _ !@p@P@LZ H PS`V @ @H @ЍAA_ P@Z !P@ _ P@_ P@_ P@_ P@0S `+! @(" P  0s @+! @ (  @ Ѝ @ @ЍAO-Mdh+@+@ QfJ x @@$p@` P<UځE Z 0 @$P Tp|P #U $U'U =UO \U U:F"UYP\P3`  P @@ 000C S: P @@IP@P `}P` @ 0 @ SN)P"@ " "P0QPC[P@0U@Q V 0PQ P0SP U  "`=P:P `Q"AЍp@-PpIn @P"`@T 6PB?-PUpO-Mp@P+@ P  +@+@ 0 S|0 p`P)@X @ ,Pp pPe QP/QiP@ SPJx+@!0RITGH+@Q PPP:PU P PH+@, )@p#;p p@+@Pʓph/  @ a@@P%lu)p@Q A % XЍO- r  w  @ x   rw x  rw  x  0  @ hE)@@v v @&Ѝ @SϞ \ @J< @EO-MQ fP@@RPP HPSP aPj `@pT  pP @+@[ ZP  @ Y@P5 @BYP @0B P 0@L PS *0@B!PH0 @ R 0:Q@MPP0 @P:H%Z< s  @"p@@  @ @@ P % Q@ 0 @ 0PZ  Z P5apD [ @P@ Pp?P I+@@P@ P%9 @ 0ˋ & !@0hE)@@k D @Ѝ @Hĝ @@꼝  @8 @3R0 B0S// R/0R/@-M@0@ P ] RR @ R!Ѝ @0A Q/Q/A-V8tP+P@)p@@ 1GAq `t+@`@ob6P V P P66f+`@PQN6QNFQP -PF R  P QP 8N+@@P QPw @ R00 0+@ 0R 0 S AlK-P@+@+@ RT w+p@0-S +S=P-P P7 PP(P8 -P`c@oQT poP 7PP TQ TPf RTT8)@TP K( @ @0H-8T)P@6NC+@@P0vP/ P  @"@@ 0H0H-P``Q@P pPPPppV+P@@ p`A-@P PTJ T @P @@Te  @IK 8Ts C "@`)P@p@@@PE0 !@`FvhE)@@Q A M3vC  `!@p@@@Q E P `Fvh8t`)p@Q ᙗP `V  @ @MX P  1 PUR@ @8tC S `)p@@@@P@ Q  R r`VhE)@@Q A  8)@ 1pW`V PAPPU pR0H-8 )@1@T P @ @Q R APUP00H-@P0P PIP0HCH-P6 RF+@@Q/]A+P@P `pQ %pG`WQ P +@P d @ @P 0 @-M+@@ y+@QP +@P :@-0A Q  @sP+@ @H-MPP+@0 \ 0 0Ѝ) @7O- M0PQ`V R 0S -QpW  `-V0-`S @T 0 B@p@@1?`Qpf R 0 :R  0 Rp:P R WL @!@ @:T L @ `Q8 pL @ @ @@1@S )@@ L @N!?`@0@p+@ @! @ ~ @,P` ` P Ѝ:T  L @ `:`@g )@@PPrL@-+@0SQ+@ @T9 -Q60Q2 -Q@T+ P 'P% R@ R! @ :R  @ R :R R+@ 00P '+ @ @6 @20H-EH3)@@P P+0@PP P!P P@ U)P@]@P0 P @H-H+@HO-M )@@v @ Tm P @ T+ @,P) Pt!@p`QP pP  P @Pԋ GA@T ЍO-M@)@T P   8%A2X Pdp`P@Q* P wpU n[ PPFP*pP PT"TV@TZ   8A1 VTЍnH->)@   p@-@`2P P`P `0)@pO-MU)P@[B `@" @ P H+@   @   B/o"V`p  @ pQ  '   A[Ѝp@-@MP)@@ P`Ҋ P &  @  & @ @1 "&  @ "0 `ἊTU J & @ @1&  @0 JA-)@pP 8T@)P@PT5@DP pd9P}P f@_`PZP%PhP` @W F! @H- )@0 @CO-Mu)p@ ; @ P$PP@2,P44444444444::44::::<4<45::5:6 Q    Qo P BP<P7   P,P! P% }PuP `P p `PP`Pp pQ P,QF  @P8)@P Z> P 4P{ 08A P%0`lP     `tPRP P @㥒PcQa( @     Rc   P3Q< Q0"P`p  &P#p QQ;p`0\  P @Q* P QA P8   0P Q,QF  5 )0@ 0  @P%"%`P Pi`Pi P$PPc@ @ T Z P  @ Ѝ @ʑP PP)@0`lp   `t PP p)@ @R*uP)p@@   @zH-U)P@$@B PU@Q* HYP$(`,P R R R @0 @BT:R R  r R"0`8p     F   P ` @@-@P (#  @0/0S/00/H-P@-@ )@    @O- M Q  (S  p)@P@@`p P'0 @ V `W   @   p R =R    QV$@0`@Q 0XQ]POT)P@40 pBW:R R$  r R2 000- PPP$@08 F0P0 Ѝ5/hP8A4 @9 @(#  @0 0S/=S 00// 0AS:Q Q/q Q/H-R@`PP 3+0@+@0 P P-PP UU)P@0`8p     F  @PO-MT)P@@`pP|0,)@܆)@+@p )@\[ V P ` v\ VQ P P  Q P K VP F PpQ?  KT\V P@Tp` V f`p#P@EpY P P@:p `D`pP L @ P  P@p,)@@G@AЍO-M,4P0)0@)@)@ܖp+@0)@8 $ ," @`Q0`& @(  #@Q ``P`@rQ IE@HFpH`P P?@<P*?U \U3\PPm   p@P0@ QR A@Q7P@a@Q)WP@pW% m@@T $a  !"`@1` ` 1UP6 P P`PJp@%SU Up@ƕu P P\P 'P P pHP+@VA@Q$!  @ P@p@?%P'%@%& Q Q@ƕ p B  SUC UApA:)@%P<%&@#%R R@ƕ%3A3 S SAp@0SU Up@@PuO%)@#%R R@ƕ%6A3 S SA%#@#0R R@pA Sr L+@  `@rU6J%,@#%R R@ƕ%9A3 S SA%&@#0RS RQ@J??@P  @P P PP@_`,)@p@P<PT F ,@ ) PQp @Q@PЍP P `P pp#+ @+@ WpWp>U WpC"&P |P >P #&P >P <P@@ ` (-P(" p PQ$` @<Q@ @c @cR @]z @Wt0F @NP *: @Gd+ @A @= @9] @5t @1O-M)@P  H+@P J5  t 㑻 @ p Q +@P WX+@  PUL@@TTh)@)@Ql)@ Ѝ ] j @_\Q m @d+@ R/0S /0H-\W +P@@ :pQ  1p  +p   %p0  p 0t @ᢳ0H-P \@+@P PP0 2/ P0@-()@ P@ T  DPZT@g fFP Q!\+@ K-M]`+P@@ T@P sTt`tttsslsls pWJd+@P  R 0 @ 5`V`+@P  R 0S T Wq!po P啇0 @8)@VP prpi `p   P"@pp ]PeJ`W  ` \ pp !G`PbJT  8V)@ P A Vo"Wp%<P +@P /P P Ѝ +@P ЍKrP  @፲xD+@q d @}@@D+@] F @iR Q%-ꭺp@-M@ ᮺp`hyP P C P ǹp% @B忹SPMJ G p@-]`g+P@+`@@ Pp +@P p@pX+@P/p@-@`+@PUpT `V PJw`Pp@-\g@+`@ R+@RY  VPZZP VPJ R DPP G@p0H-@ PP0d@+@ $0@-d@+@P  R  $@#O-MpT ( 0@`)@ @@``5pX X \ P@0@pvP sPV` !pV G7 B#@P p+P -P @lxNP#@XU: P  Q B#@RPQj oᠢ Wd aQVm г+@%  % p@P0P`P"xPlW+@WdZ  0+ p' PR P  P r _pH   R SpC Y  0I`VV!S+P@P J@@ 07ThE)@@  @~Ѝ Qx @ᨰ0 @ᣰ @ឰ @ @Ꮀ @ኰO-Mp`pJ WhuP)p@ g!@  f!@ `@[N6` 5B㘕 @@#0@!@#@"@  PU[ P[  UPP z0 @S[U x @ n!@ЍOhЍp@-@QD PAQp`R P@`tl `@D>Q <Q  R !@=D@Q:P P @ r!@& R!@pP@-p@-@dP+@P QU0p`+@P Q  R 4p `.p O pU ) Up# @ឯ  ~ @0H-P @j PP hW++P@! @ 0XY P@0A-@Q P@G /iuP!`@!p@  ?U U P@(P@UO-M@P PP9 #@PP4P2!@{PL  @uPP&tg}P+`@+p@+@@P TQUPP @@Tt@+@@7U` @FP @@PpPU`PE #@0P JA @h)@a PPEZU" @@U)Z tg T 㺅@+`@@"P@!@p WWp@WPT f  T@[p@@WoZ㠂t+@Pu@ZP `V tWr@+P@#p@P k l"@P& P# @[!*Z' X P  @ @ P 5 @ `Vl )@ @ KP `@Vn+@P  P [  e+@P +@P `T !@tW d 㺅@+P@@"`@!@pP P T kP T@p@Wp@@WT !@z b@p@#`@PP D)@@T@Ѝ-PPU.H-M@t+@PP U+@`Q U PTT TT8)@NPt+@P `P`UP TV T8)@6`P`xxT+p@`P PVЍ p Q8)@NQ= T;'7 9V V VD@up U`V7PD ?Q @:́"1p  㑴8)@6Q+@Q `6QP`H-MtW+@@+P@`pPP `p W:t+@ Q +@P HܬK-Pt+@HtwoM`R+p@+@@+@PP`P:FPP XKt+@Q/t+@ 0S00S/ <R:/0H-@9tP+@TQ +@+@Q- P+ +@'Q%t+@P t+@Q PT +@8$ +@) @6 R T +@PSP0p@-xh@+`@PP@Pp8~Uptt+@+@PQ /PQ/O- M⸸㼙+@xtXt'9(`+@+p@+P@+ @+0@+@Q@P.QAT   PိٶtX9t'`+P@+0@+ @P  P ӶtX9t'+P@ `+0@+ @@ Ѝ?+@ R3/1!@R/0H-Y@+P@P0# @0H-+@ +@A--JM Y+@+P@ P(+@+@Q+@Q  )+ @ R $@P +@@U$@Pt +@+@@Qtg+`@@TP; $@+@qP +@@qf `Vf@ jP @ϊzF?Qϊ:"1` 㭲F˲b尬h)@0H-@Q PP@U Pl)@P00HGl)@p@-@Q)+ @ 0 P /Q(mP+`@ AP ]+P@ Q +@P ɪ@p@- Q @RPH Bpp Ӳl)@G-@'PRPPP ( @L`P1 P/ P@`'" @ ePP@m"``EP@_`\'PpUWB 'W P@IpV P@<P@2P@(Z`P #P pP@`V P@'l)@PG=0H-( @@㰋P'RP @ U0P0H-,)@$@)@H A-RP`p@ GP P y~P  T@:pGWPH0H-M,U+@@)P@ P Z P0 +@P 0H襩0MH-M  0 ЍHЍ/@-M@P g3Ѝ @ᰩ MH-M h)@  ЍH Ѝ/Mp@-MP@, `,0 PP@X۶!@Ѝp@Ѝ/@-M@l++@+ @ @ 0B@XKL, +@@ @QЍH-Mp y@P@+p@` &P plpPWJm +@@ @ P@3ЍA-P``Q=QRJ`X@' `+@A@pW P H P @PppX@p@-Z@+P@``p`x q @@Tl` "@@T @ p@K-BMpM`+@@PP   p*PBߍ0H-P0SR00S ( @@00SS @0P0PSS@DR DH-M@ P=`P" pU op@WpPQ A =U `Ѝ  @hA-M8`)@@ -ppTpPH PZ Sm+`@  Q ,<  1/`Q  Qca  Op! +@U +@U GP" +@P    #< 0 `u`p  Ѝ @H- M! 0  PP -P -+@P0+@Pc8+@Pf8)@6QiFQl+@QpPs  @  Ѝp@-mP+`@U @3PUPp +@P p@dp0H-P0@PPU0K-MP+@@G-PP5  <P p    ` 0R`` =Q/  = tc  +@pPDYEIP :AY BYp@pWr qQ ('P"P Pp@TP  @J@p P @ t+@E #~q (@( w t  6+S t #+S  +@ 0*(XY 'ppW P 00S  0 {+p@ A +@)@@P -ca0 +@S0 ^oQ Q 888888dlt|a!&QQ "Q 'Q\Q P  b tnvfreM  Q`Q@^-s p  xk|[+`@r+P@ }xk|[+`@q+P@} {+p@ a +@)`@P  ++@+ @P  P+@P +@P \R Rf P+@P0]S 0S MS ^R/ -R P+@P^S% cSC . Q++ @PP0@`` 7TQa +@PP)`@ @+P+ @P0;+0@w t  t   x+@ `_@ +@T@ x :o s +@0p v  0+@ 0  +@vo   +@ }p +@/+@a )`@P\P PE p@]P 0P" MP^P -P xp^P cP&   p/j@ ?P app 0`` 7S00CQpKx+@ +@/ !@qxk|[+`@+P@ s 7 W}P \P' khE)@@Q A ' 00 UP PMhE)@@Q A ʳ 9hE)@@/  @ ᪛+! @lp 8 +@@ l)@0ЍЍ  )@E @r%YNW  @BT 6 @՚A-P`p\@DV/V90FPF*@0PwP@P0@Aq `0Q Pi\F PnF P%DLT\ @T @EV9 "VD 'V '@=EV@9@7 @5R @ x @+@) @' @% @# )@@0pU``  A`GaGV/`6`3PV`3ABq P R @x +@P@"@`EQ R @x +@P0H-M| +@@T sn ፼PUP @PЍ0H-k@+`@hU)P@ p R R0B0 00p pRQ A ʆ @p@-M| @+@PU 'P"P`VP  @tx +@ ` n f@`!ЍpA-P`@AT:8 @Rx @+@{`D+p@ [j@@@-@P Q  @ m"P" !@)h @%x +@A-Mp\ @ P@ @ 0 P=`P  @ 0P3`P7 pW3 P<U uUm @s @UiP P &P  PQ"pP ^U-P P?PPPHP,ЍK @ { @ @ ׼M @ѼGip@-M@  0 @a @Q V `P@ T QP # @Ѝp@EO- M@:@P `p@ @PPz =@Pw 8 @ BkXcX- iX: @hPW  #@hP.q !@ *$ElX oX"% @hPB  #@hPq !@ (-< @hP$B @hP( Q* PX hP QQq !@  P P Ѝ H-Pc @H @p@-M`P 0@-Qo@@@( @P ( R  4Q 1/Ѝpx @K @ƻ< hH-M$ 8d0 |ЍH-(Q @ $D0@H)K,58<@ 82D8<  < D,H-@ ,$"D0@ HK 5 8<@D @-@4908 PMKD0,8C D/H-M$ 8d0 $Ѝ@-M@(`HP    :,ЍH-@2 @ p㵞PJ8, Pᩞ`v2RT8T<T@THPD TEpGwT\T`,@-@48,( 8R <  <  8< ,/@-@48,@-@(P @$D @H0K%8<0@D8@  @,@-@40& "@mH-8!@HeH-M H㫟pЍȍ @ H-nB㞟pȖ @ H-oB㒟pȠ @ 0H-X" @@0  @P@!P t# 80@ @P H$ D0@ @P $ <0@ @P ,00A-P`Q @fP  @Qp@-Tp`Q PfP QP-T`O-MP@pY`CVt @ c @`Y:  @`T  @`U  @`V nܫ P+@P f +@@Y  U@"Y @Y  U@Y @@Y@3Y  @ ! U@  @` & U@@ & U@ `& @ & @u @` & U @ &  @`&( @ &0 @ !< @PP E @ !L @uY T U@l@` &[ U@bu&b @YY i @P  !o U@FY v @=Y } @4  @,Y @#` & U@ & U@! @PP 4 Y@P @Y @ ! U@`YV U@o UQ@ @PP  Y@  @ U@ U@ ! @Y  U@u`& @  &  U@` & U@z & U @q!& @gY*P O / @@@pW 6Y p`P@sd 0<F pWP r7P i_ `P@`0S* ?y p @p@Y P   u<<0  k<` V ;v9v` 0SV p1v /vЍp@-[@+P@`V ZIP:;!@^/ !@Z  +@ !@Q "@Lp@-QsE @@$0PK++@@! @!< +@M0S^S@^0K+@@O-tM`@!@û  )@)@p[0 qD @tPyZU#J)  @a@Pp 000p \ 0@帚ppʣp[pP a8@ p`4Zp$@ B D pP @dhD p[ @$ Dpf @GP:W W Pk(  0p'4P0Q q p`p)@@P%P =PpP   'P<!{P0ppQ0P  pʔ#@ 4P gH ᐛpw @c\ /0@!@ | 04x @㉶H-f  )@ @EH-™>O-M`@!@㼺fy +@tU+@p@)P@o@o  0QP ePfP hP vP; KP P HPRP dP )LP PP%\ 0@p  )@V QQ Q`Q` `X`[ Q`A+@pP+@W +@P  3ᥚp0@  :9pP  .eZP p+@ ppP #P +@p"@+@@ +@P4+@8 ;P$@~@=PfPe R굜`!@p@@ P2Tp|U AP=`Pbܹ X)$ ӹ Op@ Z+@ qXP Xr 0S   7/P P / !@! P s$@  @H-M +@+@p: /P )@ @0@0 @ \@-@P#P GP / @+@p@-M@`reP #PPሳ`feP PЍp @ 0/!@ O-MM@P +@p+@a <+`@ +0@,+ @ ,+@+ @ p+@l@MP$5@MP `  b@ p@`P QQ@ ^ :tb\ `@+@0@ A@6Q Px,dXXXXX`XHXXXXXXXXXXXXXXXXX8XX\XXPXXXXX +@e Ѳppg Wi0 +@Xjgf 㾲ppd"Px +@S( +@@PO +@4+@E +@ p >A, +@&8 +@2p!@,`P) @&`P=" |ppXd"P:  +@$ +@ +@  Ed"P +@ps [= [; p +@P:@  @ @ w @ @vP@f$+@Q0Q=0Q! + @l8|+`@ 0+p@`00V<+0@0S! <+ @+0@ 0S! 0+ @ PAo0)@ )@$+@, +@P HoB@   +@)@pQp[PE pU|(+@QWWta<,;+ @Wyp /<,!@+ @$ +@P  P  P$+@G@PJ `Hx|@U; (!@L6@/ @0@P0" @c7Kp P@P/ !@@U Q +@+P@ P0 +@P@ +@LU!@P> /!@U m H\pT@PP@P&@ iU @ +@QQ@ +@@ U +@ @P@P +P@f/([PT @  㑽@ +@@P @@@P <,+P@+ @ +@  p@)@ 傕LPp ʫb#PS7BPJPUt SPJP hoRUb !@qPX P@ +@fa.`V ZPo @XWJP@  P@ p P NP% P!!@ @P )@X@<,+P@+ @i +@ @ +@@Pd@s/ !@i P듕@돕뤕 @JMP@@@j0"@ o4S@mF@&"@ @PPpᬵ90H-@ @P@]P  PQ@ <<U+0@ UPPP <+0@ < +0@ ,+ @o! + @00HA-a @+`@ +@|o+p@ PP #2! @TP0@XT @@K-MsQpP@a@ 㼟 z)@`@@  0WzPp!P@W@-M@" @PP j@ @ 11@"px30@" @8o@D"t\@Ѝ0H-P@@ P "P<$0HS0H-@ +@P\+P@P X@P@ P @ +@0H"e@ D+ @\p0ȟ@PX@wP $ +@P( +@P +@PFeT@ QD+ @4P @ + @-P0@HO- MP )@X@m0@  R\ @ @!@( @, @0 @8 @4 @40 Phl`@h,k@ @!`@z4S @ rk!`@4S @ hk!`@4S @ ^k!`@4S @ Tk!`@P0S @ Jk!`@T0S @ @PG h }m@p@`@ P8  0a0p &0 !0S$ !S | @"@1@ P"B @ +@0 "@ Z: ) ЍOHO-M@(P- ,P- 0P- 4P@ㄯP@|8P,08<Q4<P ([Q @ee@t@@Z Ѝ@RP ([Q @G @B 8+@ R*L@78` a BR RpA @Q ``@p @0v0hS pRa`P R v@ <Qv@< Qv@P PU*v` R 0 0R *0 Q*Mb @ۮp pR:ppW:rO-,MM@ (P +@  ʮP \ p@\ @ @P{@>l@XM :2P(R ({(@ *l`S$@V (ZP n  @ZP> !@ZPo C @8PP +@P@ +@V$@ (\o @`@P ὲPm `@ V:0  MP  @EpV. I@@P( g`( ᘲP  @㒲P  @㌲P  @ (p [@ +@XV @P T0  P + @p@ +@\ @P(@ +@@(dV`(dl"@$ZPx L@ZPv o@ZP} @ZP @ ZP @ZP  @ZP @YP @YP @YP @YP @YP @YP @YP @YP a`@VP @  w0P:($ @ n@ +@R @e @ +@+@@ +@@ +@ ㍸ \P0 HPKPH QD@ +@(0 4P7@ +@,0 &P)@ +@80 P@ +@00 P @ +@<0 P |(4@  @ +@40 P@ +@0 P@ +@{0 P@ +@m0 P@ +@_0 P@ +@PQ0 P@ +@TC +@V*V:Z @ 0:@  (@ +@"( +@Q 4  ((d +@V) {@j(VP @@`V yO P P P @[: P w( )@"#@TO`(dP' {@i(P0 $P  @p@"T : @ @@@@(t P  0  d  (( AtP P (s@! (+ @Q P  (f(! + @Q Wz (W@! (+ @Q~ Pm  (J(! + @Qr nW@ (<(  +@QpTp@ +@ o,Ѝۍ~ @㛫pp@-M@` PW+`@VH@H>+@Q.$l+`@P!f@ H+ @7p[P [P&P m H#pژ)@P@P f@ H+ @pʅ@'@Ѝpt@T@{H-5)0@0S H'[@-@@ +@Q @ f/+@S@nW@-@[PP P 0 @P P@ / !@@@X @@m)@! H+ @O-MQ $+P@; *, 4 +@ +@R P @;`KS놔 )@X @-pkE I !  +@fQf/SP +@!@Q  GP} JP@8+@Q W%1V"HQ WVHP p+@Q: P 4 +@PY ` @ 0yQ&1E'EQK0EEPF & @ 0e=4 +@P  @ 0W +@P7 n @ 0 +@P @<,+ @ +@ @? f/R +@ɯNP  @ߍO-M`p@4 P+@P8 @ ,7 P5U P:? QQQ Q Q8/PP@Z Y  Q4 +@P  @ǩ@ߍ4 +@P N @4 +@P o @㯩H-P@ +@$H-M @BP  Bp Z"Q@x +@ЍH-M @BP  &p Z"Q@\ +@ЍH-`@Pk |P+p@ RR$ PR0* R v   +@+@ fQ@ +@M@ H-,+ @0,S P0H-MQ +P@ R@ 4+@0P0PЍ0p @ 4@ @H-MPRP@ p`ᛧpvY""Q  "QOQ QQ! ) @ @Ѝ0H-PP@P0{@H?P {@QfP@PG-M@PPQ~@  0/P @ᝨ +@Ѝ /P@`  0+`@p/8pP 0,`pP   p@-M@PPQ~@f `  0`^P @V +@Ѝp ` Q 0P #:r/ Q 0P #:r/O-M-8MMPT@fg8 (p슟8)@@X$ P p A@ `"@@+K fPD @T)PF(@aTC: aP?(a @ RB`@š⠀ i( @``@@!P! p P) ?P``@@" q`@ 3P `"V @e0S  3/r@X`@(  @ A B*@    ,, @ p P( 9P8haV :aP8< |xP*  0qL(Q @<Q:;( @ (  @ A B*@    +f @ [pP P 0< A | r (Q @ 0<`00V( @ 5 ( yP   +@0z +@PP @b R q R @T:  +@0 Yg$@8ЍۍЍM0H-M@P 0傼* ) @P Q Q  zKQ  Ѝ0HЍ/0H-C@P"@@@ j PQ`@0H`p@-fMMr0+@Dup <4< S@L@  @P yP<<fߍۍpp@-MA +@@,!@ @Q3 @ P nP yP" @dۍp0H-@ )@XP<,+ @  +@ 0HO- MM1 @d <,)@+ @X  pZTk `p@P@@P!Op P ?P @ᤪP @TjP :@2  @@@ @ 0(pX P  T  RTt `@P@$@p@(p@ P  P Tu `@P@$@p@( p$ P  P (UAu `@P@$@p@, p P  P f,aUu `@P@$@p@0 p P  pP J0Uu `@P@$@p@8 p P  TP .8Uu `@P@$@p@4 p P  8P 4VAu `@P@$@p@< hp P  P </VSv `@P@$@p@$Lp| P  P sVv `@P@$@p@$0p` P  P Vv `@P@$@p@$pD P  P Vw `@P@$@p@P p( P  P P4GQg Pp@@$@`@T P : P kT Ѝۍp@-M@z@  0P  ۍp, + @)@ X p@-MB +@@0  @! @Q @ PC@`P ====C @bۍp0H-M@@ PP yPP z @ 9l)z  @@Qbۍ0O- M@P *DP @X `@p`dGPp@X P`P00@ Z HP`H@OTQ:j P)`@ `pP @P` XXX Xp At Z*%GP@`pP @P` XX @T At`P@`XX  Za Ѝo@3H-M@p $PP4 ɘ`PP_ bQJQ KA P[ ABBBBBBB$K@9$[@4$j@/P |@*T @%  @ 0 l!R@p\`D]p$P@  pW""@ 0 H;O-MpW `S 8@T,PU@a @ 0@ !R@@!@ @ QFxGFxGxGDFxGFxGxGG< @SP PD ;!0@ @F @ =Nt` N@N*T @@ 0@&8Pp,@Mu`MPN@* 0@ @P&@a @ T0N+@! @ )@ o8Q MV @ e<P@PPW+ ቢL8@ D HNQ TTG*TTD  8@Mc @@ ,< P @PP+8NQ @PP*'  @ 0 Ѝ++** t pH-@(`i@Pz 9@ 0 P p 0pW:H9@-W%@V"H0P f/:J p@- (2/0Ͽ ? 0 b B b B P2/<Ͽ>3?( 8 2/8 < 2/< $/$$/$D 2/D $/$$/$$/$$/$P 2/P T 2/T X 02/\4\X ,013?1  Brpp 13?1  Br  +@0`2/3?HVXO>_ XH0p0` 0P@5_4OP@@4O@JJJOJ ^:p@-@8 +@P xf/I W5V2HR2/R ,q+ @ R3G-MP-2 P +0@  L!tΛJ p@@ P)@@ pa K`9`P@`XXX kpGwЍA-P  )@@0 @ @ 0 ,㴋W @`@!P@H0p`F v7K-M`@@L{p@P Q Lp b +@  +`@  ;V p+P@  `2/ЍK˃@  /!@K-MPM@P zPG* t PG*P  M`P@pP "Rq:*w=ڑP  $P5P"P p4   +@`yLلp, @ЍM7@ _@  @ @@ @@ 0+@ !@O- MMP@"@KP_ p@KP "@KPF +@@偄p    P  ` @w Lrp Y Ġ (<P [(F +@@Q 㰙P XZ 0p`P @Pp 0VH3B `=~+@@ @p@ w+@ L$p Y   P `  0(Y Rf x+@Bp^ +@ rp 0 +@@pF x+@@Bރ p] @X?  )@XP Kp@yP*;$G p ( @0d,06 P. "@ @]!7 @0᥼ 0V`pX Ѝڍ  +@ )@ @a@tq @o v)@.@ @C @@-MP@  P* {+@H QpЍ 0+@ !@A:@ 0p@-M t+@ D4pB R +P@  @ @r@Ko!@@ `@ @    @   @ 7  @f@ @ Ѝp e+@@ A-MP @+@zD ۂp  P`0 @ `C @yЍB +@ @ p@-MP$`@!@JPP @JPo +@ wH㟂pЍp 0+@ !@O-$M @T pP0@)@ p@` =qP p ePjPd |+@L @ @@ep Pа Q P*%PJ @p  Mp +@ @ ?Q) 1x?0@ m  +@0= !@0@R07 @P HQ` P@0p   `@V:  +@ @ $Ѝ +@ @ @-MP @+@ D p+@  o @Ѝc0!@p@-MPLPPI `@ @.IP !@(IP @"IP  @IP/@` h ``@@`UM @IP` u+@ H㚁pЍp 0+@ !@ O-M-PM p+@P$}Pˊ@`(D( @ ϊ @tp' ˊUϊ@ @ U' ( +@ $@ P  Y p+@` 0( @PЍЍ +@ @ > @ 6@-M@P P5!@HP +@v H#pЍ 0+@ !@0H-*JTR0O-\MPPH b\ @@ `@0@p ᵯcPQ@Q:aPl@Q _deX`de_de_dep`dP <p6  )@lW E R*W( rGdWo  @@p acWoW(PdWt lW 0 Q@PQWQ RWQ SW H@ ~ H᐀p2 @pW] rW P$ 0 C @ @  DY   P@@ =P `PpU@P,`@UD`@| (H Tp\ @IXH@ ~H Ap% @6 @ {H 0p@ @%p@ix"P @ @a|  @I| @ z}$0 LyPfU} @'zP@Qy @Pw Tz@ @/ !@ၗFT `CWy `)@"P@rF   : ?P( @p ?Ë P tiFPὒ q᝞@P Xp  @ =Y\Ѝ" "@ @ @ ~" @px" @k @nM @ qH-MJ 1 @ 0 )@=O-$MHP A@PXE  L Hp@ `P: p  ;p3 P5 X"@pP Hn "`@Y ؿZUu  @пXT  0X姖Y$Ѝ1 @< @0H-PI @PsiFPtiFP rmFP# gtGP9-yrFP loFP./ " @@P0H@XS@/ !@y0H_ & !@00HnYPT` @&X/P0ᆽ᧊ @O-cMP @+@(  +@ +@\  +@e  +@+@$ +@ @, +@0@0 +@p4)`@0,( /RP0S@'P'jlrrrrrrrrrrrrllmrr|m lrlrr@prrrrrmpllmlmrr0l +@0@Q-A@Qx krrrkkrrlP +@L& 80 @+ @0PJ8PEL P +@+@Q=QP +@k(nnn4 +@0 +@ <ⱗ<QFp|C< +@w8 +@s] )@ R  Qd ` +@/Px puT, +@N$ +@JpF` +@@ +@@& H +@D6 8q @+ @+0@vP8P@ +@ P%@ +@  +@`/P" @a}PH  P)@r  +@)@)@\ +@l `+@P /nP 8l +@ pP  p 0W> /VP< `9ly )@ +p@"@0VP {PJ(}p_ 4`VXv +p@ V *{POU P {( X +@+@e)`@`P  p: ,V /PP  p( (| @hdKJP `@ @@0 ኽPEucߍ @ @l +@/ !@ȵ:T @px  )@p` +@P0 P-` @ / @ @l +@/ !@㟵l +@p @ l +@ @l +@ @㘗 !{] +@P$ +@P( +@P1  +@P +@P( +@P "  +@+@Q   +@Q P @ )@oP @XEPeP)`@4 +@P@ |P H  P4 +@4 +@P9 4 $6 +@+0@ ( +@ v +p@\V +P@0pP@o2R zp)@8I @c[ +P@  4jp)@'ʌGP? !@+@cb? !p 嬍P @b? p@P` +@Q 4 +@QP{p/m @P!\ @I @+@eTx) QD + @{p@ @㣴x) )@+ @{p3 @x +@f/e?)H!L1  w @pP␖  +x +@ R< 30@R[@B ?0|,0(p0 4x) h + @+`@,p(P00?P4< t{ +p@x{ +p@0u)p@P|{ +p@4y +p@009 +0@8 +@[49 @+0@ R89 ?+0@B0 +@@R0 +@\  +@+@0 P)@)@T!Byp)@ \ +@/ !@E)@@yv)@P U Ȍd P+@( @ h& + @uP% X +@P p hV XF +@+P@+@@n/>oh& U + @PO @O @O @O @h( + @n ( +@+ @Pf +@P@& 09 + @D +0@+@ 4) H + @+@8 +@0 +@ P4 +@ Px [+@@<89 +0@?49 +0@0@ 30@P&0 #+@ 8 +@@P* ]b/a? P5Jt A 4 !$ t_/^? P Jxp!B$ 4p|1p"8P`RPP  03@ &"[*! Y Q  t 4$!@p] @4 +@P @ L +@P@4 8 +@+@h& + @P6 !+0@L +@R  +@P(L  +@ h '+@L&  P+ @U3#UE3#C@0!//@!!!@!Q*P +@hf !+`@ 0SV*0qW WW@I !+@@1@`!p0 `0,4Pf0 T (pQ$ QQ! PP!R!RQ !С0 Z P  W p:  @} 0  +@+@QP\ P(  4 +@0 8 +@+@P+@ +@P  +@P )@ 0 +@ 0 ,00(008U @0( +@P)@$ +@P0 +@Qm ( +@P&X +@P p hV XF +@+P@+@@n/<oh& U + @)@ @ +@RC @  +@P$ +@P5  +@P h +@P @ +@P" @x @DR  +@Po  h +@+@   @3R @P h +@ +@Ꮇ)@PU  +@P @U  @P@0 [ +@j )@{増؀+P@)`@p@ @P E)@@&q5 .i @ @)d ᑓP8 6@QEQeQQ  @PP[3 [J   >)@ r  @' @P 1fu@?P `@ p@  @0@ @@@  0 @@ @@@ 0 @P@@ eP h& P+ @QKJPU @+@P @' @P S @㓸Uep P@ `@? p pppu @P h6 +0@P! !Th +@x +@ |>ؠaopUb_]  0 P J P  tPpW4  X+@#@0 +@8 +@w@- MC@50 !@)@  d @ 00ٸJp@-`@P&  @ @p U* `P 4& `+ @ RP  @0a @Q`pH-!Mp @Pj%g `@ @`p1 \ ; @ P !  ue R \A , +@P P   @P@康!ލ @!ލHO-DMp l@0h` tQ+@0@ r# @ +@PpR T4Z"@ *p8phV +P@4!@8 4 +@$ (8<8ppRp(pPr  @pb8   0 p 0+@ +@P s< 40S48p@MP @+@p8pG4 08`$@0o< ZY@PV @) P + @+@ p؀W,090@ PPQ S `  \ ' `Q `   P @P0 WptP 4P X +@PPo$z@ P@ ,0+@P[j `  @+@Z0 @P-P +@ pV'% h +@ 2QU QV 0VP@`0 R :S p00P 5p0P3h +@@ 2aV a10PW`W```@p 0 S 0P+@ W < 0+@ PN  @\  @0 P  Q? 0 @ C, +@l @9 @+0@`8 +0@0P[P,[0 0 [` `J "@ 0 0P0p SPQ[0u @) QQ1QFP `X ( L +@0 P@9P P+@" `)0  VPo} @  @0%,0PT/  @w@I +@@P P$ @ Dh +@@DЍ//!@PO- M p+@ 0 P+@Q3PB  @@ +@Q4{  @ ЍOLP  @Lh gkP+@!`@P 0PUP%@ +@ Q  @P[  @dzh +@ 0U  * 0 ЍOP@  @oL@Y +P@P8, )`+@ @p ឳW   0*P Q  @㊳@W  0   0*@plWP" RJQQ  @L  @[P Ѝ  @ ЍOO@-M)@ +@P* @Bx  +@+@@t | +@+@0 @024  +@+@@0 8 +@+@0 @0"@ +@ @Ѝ@" @  @K( | + @+@x+ + @0t +@)@,@ @ pP  @K 8 +@+@@4 +@0 0 +@@ P @P L +@+@  @Ѝ@ܲ M0H-MǢ @ѲJ )@@P@P )@9P P p P@' Y@oЍ0H Ѝ/ @G-M@8 +@Q4 Q1 pP`%  +@P%& \ 5 p \<  @@] @㽪. @Ō܍M-Mⴅu4f )@)p@+`@0 P0Q8 h& + @p- p +@PX XV +@+P@@LTڤ$p? @@Y +P@P% @ؠ$p 0@T @n m HdqpZ@dT @_0 P0Q Ѝm HLqpZ@Lp@-M@P< r`PP P<"PP:P`ЍpA-M@ +@pQY ZUh& !@+ @"P@PbP@ +@1P@DSQ z  @ ᶱ1  @ ᰱ   @᧱1  @ ᡱ 1  @ᘱ1  @ ᒱ ?0  @㋱ 1  @Ⴑ1 @ | ?0 @ЍAs 0Ѝj  @ ЍAbO-M, p0+@PQ  @ߍOJ p pơP` P` P``$T @h@ @P $0㥯 P $@` ) @%+ 8 @! @Y, )@ ?K6U @ , +@P P +@ RX 9-㺰 P1)㲰,v +p@Q Qd @m @ݰ 㡰P KP!?0 0y!@@ @ ɰ!?0 0 @ ὰP B P PPDPP=P@ +@ P7 h +@P2+ @! @ᛰ$  vPp% @`$p `P!@  @ 0ᄰ  0`@pW h +@PQP ߍQ+ @! @ c $p  p $@\P @Q , +@/, 6+@J? @ 0@+Q! @0. @ ?';W @ 06o,v 6+p@J? @ 0@+Q! @0. @ &w @"pPX$@U: R W*P+ @! @ J?P6+P. @ 0@0 @! @  @, +@P1@P Q !P) p$@ 0k c+? @! @ 0@ pٯJ)P+ @! @ ίf)P+ @! @ ů,v +p@U @G-4 8 +@+@P@0 4` @ᩯVe5T`X  BQ  BP  @G蔯TP R/K-MU)P@ p- E)@@`V-ږr0f!!  ?2p  RЍK5mPd +@/mPUF,\{2Ѝ" @8 @H-h O+@@B^*  Qapa`?A aQpQP?QA@@DP@ ppW L aQ3O-LM4℀ !p @ @@0[ ($ o{+P@@@0, D@P 8<4x |0  @=4 8 +@+@0 40p8@< 0 4)@ ? 3Px| 03  {P[ 0@+P@p @0儀@4墮* d) @ P  FpHp$P P Q  )@-PhH HpD$@^P@PX  @ D@P P U+K $@ P  @ Pa [ {@+P@@8)@: "L +@P 03{@eP& + @  @儀 p P$0000`PTPQ(@ 00T0 P@[ +P@D F PxD0[| Tx |# @}+, @ @L D+@{P8< <0<LЍ @$O- M@QbQf Qa P @y +@+p@R rP[ @W0P4` P0R`0L 8+@PQD PUA OㅄPEZ, 0>C$R' P `0p a1P0F@y  [+p@R +@Q8Q t `MHQQQG @ Ѝ @O-M,(0`Q4  +@ 0Pr p@r p@h q+@@pWpW@PpPWPPpp[p +@Q\ @Y +P@Pr {h +@@!R RR>Q QQ[@ !+@p@$  PQa=t A+@`Q V ! Q  0  R Qq\  @ |GFR 6QpQb@I +@@`  +@P\ P広P$  B @ J\Z @Y +P@P 夃P$ @ Eppt0\ " #\p Pf0AQ  B p RprQD P +@0 @p As p@CQ @P\= $P9 U*   `+@ p+@Q% QP  +@P? @vysP p@ps p@Q$ @#%@r p@pЍU @~@-@I P+@@ ! 2A b A 4$$@O-M@ @+@`, =&P} Rؠ*@PU 0 p 40p0T0PRPP B $$d5UU  E 4pP  g+@ B`   D!!p4 8 +@+@ @1` 1kV Pd 1`ᐺk 1Ja  ?(1`)?@) + @Ѝo@O-M⤕)@ pA )@pB1!?! gPo 0.p  R,ЍOi!d +@+iP 0x. !  d G+@P,l. hPЍx @xO-kMM␿ / ? {\ _ O `-+@+ @+0@  p@0@+P@+@@  %cPd @RE0簺dddddd<dTd\dddddPP1 TPyP :P p F P  +@@T% 1P& @I +@    ++@! @2  G +@  = p_ +P@O +@@B6N#0@PQ nR R oR +@\KP!@@   B #@PPp/ + @  )@ V _ A+P@`  ᵽ@P @/O)P@ @% ;" @ 0@5  P P)  㕽Pt p @@0P  @0P  @0Pf  0 P`:FY P@T. ;pT z D@LiP e.DEipI gNk'Pa@PC"PA* @ATAg@@ H! +@T2  @0@`kߍۍKx @/ !@ @ @@ @ @. @ @.4> @!  @H-`@Pᨾpჾှ p H-J4  )@<L; @ 0@(ᙧA-`PV &p&@ᦾ) ` @0CO``p@-@P: P @/P  @/P  @/P' +@`V P/P `V +@P  +@P  +@`V P/P `V@pO-MM +@0[@!P@Q `/P `V@@Z @/P@ "@ +@QqT k  N0b+ " @ @P= B#@ ╁P4 BV@p@`#P@ F[`P -P = qP p   u  @ qhpP @ @ 娟 +@ a ,!@ @V    @nT JpD "@@P cW $ gp @P9 P < :V @ %  @㝠P - +Ѝڍ p P PQP\ @~/QP  !@  @ PP .P= G( >O הf @pP"0@"@@d#@ @   2P [  < 80S2PP#@* f  @$ +  @ ʧPgg + @+@/+@/+@/ M@-M  )@@   ጂƥG-p@2댐+@aVQ +@ !@㈧P+P@P Q+@\  @z htQ!@mVP -VP+@@.2 j  @Zၥ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    FO-uMM␰+@N"@8fpB@ #dp ppJ)fP/JPJn+@@  P-  P oL >pP /  !@p pP* ePZ  @-  @*8%<5" #+@P Pep   P   @  @  @  @a uߍۍH-M P .0+@ @q.  @+@g+@ЍH-+@Q 1/ e0H-T1@ @0 Pd+@P0F1@0@-B1@l0081@O-CMM@ (0+@00p $40 ()@+@㰀0 ,P  `P 4/P 8xP P0P L @ 4PY   0(` 6/PT $P , P ,W WPYPYw C/ ; 埿p z8DP #e`cv ᐰ H# )@H * @  (+@`V P  nPP `ź` ᠺ(00U0+@+P@  00 0`` PU  6,P P㡺P |y vPPG^ @ $@  @;4PJ pW20P(+@`V OT @@"P@S pW Mp `V0(+@P+@U@PUPUP ,`(P $Q V`@PU/ 8!@yCߍۍ #A @ @z,,` Cⰳp  p4 @C(+@pW P p [ ᗳp U `U4Q   0 @P UUPP PP 0   @㇥ PZ +@P` ` {{{45 +0@PQ @  T% 0+@0%T+ @A'  `PP$(+@@T@ Q Q(OP $Qc V (E@P $QX `X`@` pi` Y, E+@@P% /`P!@# @>  @ 0@PU N!@!p@ @@0P  PU =H-M `@p0 p4/4UP+P@ Q ? 0p4/P QPЍO-Mb\ P` p@0@8@%+@+ @ mPn0@ So@@<8%+@+@+ @lddddddd|\8<%+@+ @PPfP pQ[ 8+@P @+@P k @.~  )@@`V< G.P l@A.<+@P l@8.V$AP [  0Gp`pa @pWH@PXPЍH-V.  )@ @6᧡MH-BM@<+@ !$1P D+@Q^T\  @'<Wp> 1>DE@+@+@@ +P@! @  @Lo:Oj P @@)`@@XP@pᩳp W  AQ ᙳ P  mWNW YWyWnW Y@BߍHЍ/G-M<P8+@+@De+`@ Q  @o `@p P  `@P Jg @ P  㞢P 㘢txxPP\ n @ @RA};\0/`h\p P: P  0`] 0p y`R PU:P @N;`PwP' @A;`Pi `bPI @-; U`UD!  @P  @0` D @9` 4`PЍP3`xp0|P"%   @'upC @V ( Pd @P `  @` `{ @ 0B`Q x_  @O- M` DIaP pW P @p|pvPP|@xp _pW!URQ  @g @x]l+H@TN 'PJP L A@@ $!1X(,PvP|@2GvP|@)pDQD% qxoxmxXY `@ P@' !`z 6 @ @p Ѝ @e($X* +HU,0s80004ps$ 00 J  _PBR"rBa!DAAFPPP a @ 0 "@pPY R"0a!D 0U:JA130p@$ 00 A  ^pP80P<@5# @  @E @ X $P, ,  RTg @|N @@&DPFQW* * *JL> @10p04# 40   ^PA A O ]P& 4 @D  ` @0 R : `eV @Q ww "L P\* @ 0Ph0dl Q* /L PUPBPP=PUP8pP4[ @H-MpP` u@P|@ p00t# 00 " ^P0<0@p10q\# 00  ]P wE @  wЍ @O-$M` 0lp@P PR*qP * P PP: LP p0p@@" @@ @ v0k @0 @I @y  @QPLCLpqD Q@>P PLp% P @P Lq @QP@LpPPPP@P PPPP @PLpPQP?:P P p 0    o@ 0  e@P 0  Y@P R * 0  K@PPPU:$v v$ЍG-M@XpPEpP  d 0="!  X\X Q w @ u @ Ѝ0H-ML@P 0T!@!@% t T llppЍ0T: tP0T:L1 0@ tO @ 01 @o  @GP P; @/ p 3 @3/18$@ @/O-MPpP:VG `p @@ P 2R B p:C q : p4 q5* r$ @ @ 1 @. 0 "@nC p:S6 s1 0@4:48 0@$@0.R9 rE*! @GN @  @P' @+rs#*;G @@R @8 r$$@ @  1SA s:*A @@<;7 0@ @  @P H;' @9 @ P P<=$8 @$@   @ P  P' @P )D8 @@$@@ @0 1 @P VG @@ C @ xVGP P @@ Pp`VE:Ѝ@-R:P P *2@T@PO-MPP:`"Q2 sS p @PQ`:Q*r@pTSPP`VP:Tp P@ RMZ:Z*0 b `V Q Z :AZ0:   z/Jb q:Z z*! @Z :Z *@ 0W   @  @ ;' @$8 @$@   0EPpW:<R @ 0  04`P @ P UPZ *  V pZpGV:PQ *"0S 0@@Q@@PT P@ЍK-@p @P Y:P 0S *r` VP 2S  @`hP Y:P` Q*`Q `O- M`PX@ mP &Ul L q " Q&#  @a H0Lp/uPWPwPP   ~sPQG:/L0S s2Slpplp00rP'tppppp%r020'2Slpplp02#402Slpplp02St0pPPQ *RUlpplpp202#20P0Q: P @X !P 0W!  PY P  @@ Y:@ss@ ЍO-MPpP@P<:`@Q  Q P`V:(   @ 0b@P @bP PQ *"0S0Q@0P. <`ql Q+@q PQ*lPP 7' @ # @L @V0 "@.P PP:"R PV6@Ѝ @:0 "@`Pl`<@A-P W@Bl`L+@V` l@P+@T@ p+@P   @Ir @+K{lP) T+@K]%D8Q:PQ*" P:R$ R 0S, r:y^  @  @T+@rr @  @5  @ @8P T%2+ @ pp p p@-H%+ @@T t+@0@00TT@+@@Q p%+ @0S @0S0SLUX+P@+@@@qPe+`@q@@pG-`T+@0HEtUp+@@+P@P 0   p O-eM@ Pd0 Y:P0Y*h0 L4D$P008 H<@D\`T0PdP 0I `!8@ q 0LU! +P@(`,p /X Py YrXp1PP\` d( Q Q d PT(` VhpOd \F  @m @P( d Lu+p@TP@(`0(JH 8H< Pw UP{ Xp P *  P:  @}PXpd ((dP\(e`hpP P P@@\ 0Q$P L 4RD`X \DK #  P  | Q@ P @Qt@Qt ; @ Q. 0  p R0 Ph FJ QDP @ @`@x+@#0 L0 oS0 4D\D`4L@8 dD0T4     08H< 0 LXpXP@  Zq0@ pq0`Q L 4RD L DLXp`H XpLq\   X x +@@ ,Xp`0@dLhXl# hPOT 4   D 0 8H< PP KT 4Xp QL+@TP@PL\T_ x D+@ @PP$ Q]*x +@h0@ APpW\M pE@P?pT pEP0U: T @>:U<*x +@0 APpW@T- pE P?pR pEP0U:R @:U* 0SpW 0pP?0W0  Q: $\p P` EQ* \p  @\ p4[D pDP`@PP  @ @WDp DLpLpLXp+@Z@PP; P0 P !@ ӲPR h{:  @dHPP*<  Q 4 <RUE h pb@ uF:<G  @@hS!N  @;P' hH  @" @lPHM PLpH!<P@APXpJdP P3P@?hw  @i  @d`@P @6P \XpHLp @#P] YXpPAT:HPT*<  +T TE H PTA*<dT@*h!Q 0 @ @XpP( $ A$$@P h  @ @@PP: P`6 LXp`P@P*DHd Q:hy  @ @XpP HPAdQ*VP| +@@? j  @kᒑ MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    WO-uMM℺+@N"@IRpB@ #Pp ppJ:RP/JPJn+@@  P-  P ἻoL OpP /  !@p pP*  RPZ  @-  @*8%<5" # +@ P PQp   P   @  @  @  @a uߍۍH-M P .0+@ @.  @+@x+@ЍH- +@Q 1/ Q0H-e1@ @0 P'P+@PW@0@-S@}I@O-MMP`plQ@PJ   P)  P/?P rQ-0@ @p!ⷷP{p `ȼ P `pWkW~h Upl~ ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P !""D`6oD`#@`6o@`#H`6oH`L`XLL02/3?6o8<\1L` X`\p `` @p!8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x wU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+;PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO ۍK-Mp,(@ p@QpPp  'P@ ` VLB Dl# 5_ PIt P PO'a` 0 p ЍG-P@ p`CF P =FP  !  @Tc@@'FP !FP  !  PF@pA-@Pp9[`K ` @0`AO- MMHQP(8 +@ 0Bpop @o?`Tx +@4  P p P+@P1 p@+@@ R000 @Y + @?+@P`6o`@`To`@p@p pW v`ov Q p p Rm0tPe  + @@T p` Vk# @+@1/p@ +@P+@P+@Pp + @ R000 |@@0p + @@@ mox+@+`@  *c+@EC+@P =  Pppp Ѝۍ @A2O- Mx@+@ p+@`4  R000 -@p 0P+@þQ  P 0PU 0+0@`0 S< 0/?sP8PU  PP % @P `D p @R000 ?  + @+@00` R  W M  MP0Pr `P@ +@gQU USVP  PI 0P+@`Q pF0 PY6 % @DPp@+@@ R000 ? 0+ @ R qp+@ !+ @00 P000 U  p+@ ЍH-M 0ЍH-AM`(pu @@P1 : 0P@CU :+@P:q @'>P +@Q p* @ P"@  "@1 @1AލG-Mp@PK +@Q p`V+@Z +@P+@P` 0oP] ( PEUP /+ @ #")@ Q p* @"@ P @B1pF @ O+@@P+@Q u 㩋  @1P  @$P# @=P +@Q P wpp+@Ѝ @  @ ЍG P wppЍG2 O-|MMBNpX `+@PQ p  @"@ Z* @0 +@P +@P`<  @7$4 @]=PR  #Co+`@ `Pm + @`Ph@U$+@)P@0 d$ Qp S 2/l$Q t 1@ l$ Qt pBo+`@/> @v0+@PV @=PZ )@ 0S 0 L P /+ @+@ R5  @#14@$  0+ @+0@0 S R AqR AqA`+@P 㓊  0r +@Q p  PjmBP+@ @`  0{ t` @P:㠄f V @  0j! D@0  f V_#+P@X 0Pi  4B@ ZA\W!P@  ` p  +@P +@m0+0@+@ 0Sd Ri qe @/ @1<P& )@ 0@q %) @ P@;] @a/p @] @Y/p@+@@|Ѝۍ @N/!@" 0`PP @$h AB A @6R qk_+P@A   @ 0/p  @0͉+@P ㌉O-$MPHp): @P`#:x+@` 4  ? 0{Bp؅+p@)@ PP  )@@ +@ + @ 5_ ARq0?1<1 0 )@  @+ @ +@ R A  Pt+@@Q p@tR B@x(@Q 4Ox+@p +@04 SPpppp <Q x` h 'h A'A +@p R0 w0?x@ +@@eP)`@04PW00 b+ B'B pP4 0 S:p+p@@  R PUpPP _`@P 0? Vp `@P @P 0+  됋{ ` @@P }@P y@PP+@P _ l@Ph@ 0+ @+0@0 S R qR q $ЍO-MMZ:`+@P 0Z0*0V0: V* Hp @~P8`P @H @ @( @P@LH+@p+@<@@X@pW 0X t 0( X t  !+ @`_ 0; X W  F0p W@W  F0@ T F0p W  F0@ T@ q HR=G 0 ?  +@@+@4 X pP  P8  ᬽx + @ P0 @S10 0cSc1dQ v X (Ѝۍ8=x@ +@@ (0+@p, P$p0+ q+@PpxQ- m(  0@da$P [XS @81(,+@Q 1@0  (*` @@+ P@+@ 0R p 0&#h 2/0h <Ͽh h4+@P@PpP0 0 g +@P5"' 0Ww#Q pSpP 8%0-p L0 0 p@ +@@pP000 9PPPlJ  x+@0 ,09PPPYJ p +@0P q0?xu+@)p@ 00 Q `+ @'@0@0 0Q: +@P0@PQ4 @P c:P @S30SQ0X8-L  p+@0Sl9Pp+@PPa  +@P$ pp+@00x + @S @(`0P@ * RPO$@ IPF "8@x+@P 0qqpq + @ 0`R 1P.h 2/B1$@P $R ,Ph B,08 L=p+@y gG+ @'@n @a++@P  @ @7P  x<+@$@40 > H\Ip@-XM@P`P 08l   AH A A( A@+@h0+@H  PQ`p D@S  2/L Q t 1L  Qt P  XЍp@-d@ UQЀ+@ Q 2/ + @ R M= ЀO-MdP@tQ pp+@ P p0@S1/0 B?0r 0/3? BR"p0̠0+@t0 S =D @* W Q+@QQ@ЍO- M +@p0 ᱶ + @[ 1 /r  0@+0@`0 0@SA+@@`@0@Q@%*R# GP Q) pW(,PP^`S pP/P pW` `PH `+@P 9 @ބ Ѝ`+@P +@PJP PPp[ Ͽ| L@P 0 L @@p@W0 PQ` ``+@P +@PZO-MMMp8 0(@(PS p000+@0p+@W`V0 c /r  : Sx * Rx + @ (%0P?n|?+0@0S <PfRW h[ WC C,@n W0PVP 0 #( `+`@ $ x + @ 0 0B?p( PX p  +@@x+@(08#0+@ @TR x+@8% -L`T ? a`0 Q+`@SQ(0T    R ҹ(0 P Q 0H $pR00HP/U, /@ p+@ : @( @5P px+@ + @ 0R  Q ᒹ1/ YxQ ჹ   @Lt+@+@ (0+@px+@ @X8 R \(00pOaP!C_pXX   + @ R F(0 P +@Q 0$  0 PHPV / p+@ i: @i( @5P [3 x+@pt?#"(0`V $+@P " +@+ @ Q@@R PP @t +@+ @ MߍۍO-MPP@h:+@Pb: x +@+ @t+@  U :x`U?:k0 됷?#"1T9A'(\%R !p0Ž¯'t+@ r!V`x``p g 0W 0QS0R0000 5x+@0x` jU /+ @ 0`+@0Q0Ѝ @0['t+@ / O-4MMPH`P@:/; @ ^Q3xp@+p@@0 25Y,0 t1I $P(``*/*PA`0+S\1 U4KYc*5KV왢"p5#0 { !+ A a`0 T$P1 Q0kS q!(`#?$ P 0 + @0 X1S(* +@P (,0P(@pP,0p@T (,0P!2/!(Q+@ .5PT $@@ pPKx(+@tQD(,4q+@P    / % @9P +@P ,,p+@,  xp+@tZ+@4$@ p(,0PXI+@P    + @ R [ P +@Q 0 Z&  0#HP#! p3@+@  }8 @}& @)3 pP$@,0  1/,0$@ p[(`P4Ѝۍ. +@+ @ QppR  P P @t,0+@ + @ O- MRPP@p+@ P P GPx`+`@8Q+@P A A0  0 Q +@Q   @0ƀ`? 6\%TAR 000U<6R pp 0p0 0S0T+@PN 6x`R+`@ p p0 0 @ @က\5)S A0  - @#6 0S0!+@P 6x`R+`@ p p0 M @0Nf @ 0F ЍO-M`0+@8/@+ @ p$%R:@(?+@+0@Р@ V +@:x`+@0H+@k@@  Pᐇ/ !T)A'\P 0 ``?" ``  pLp+@u@T\+@+@T`p`@+@dPxPX/T+@+ @ 0j ` Z032Q  `OS  0e+@+@@03u U rQS 0v3 +@(?+0@+@P @pQ 4 Xs`+@@`+@YPQ p P hp~ yoPp7sPEuPp7jPEu@lT@x|+@+@(EQ<@X5`+@Ƞ`P+@+@P q QQ 1P1PP`U TJ P  % T:`O+@+@@0 c3(?+0@+@,Q Ѝ @0#A-`x+@0Pp@ I 8/+@+ @P0+@`@+@`H+@`+@P8H +@ pPX+@WP5`Fd,W \+@P?`L+@+0@T/+ @T@p P` 0^P  @0# @#@-`O+@@P UO-M@+@P+@U Rp Ⴔpx+@0 0B? P``0V8OPe +@ ?N V+@,` `#V*o $(p p(0 U 0?0`V  [:@X 0U p`pop0S`P`+P@+`@Qp.+p@GSQ  d +@Ѝ @"0H-P+@@ ?+@P !# " 09 @0"p@-@+@@PpP+@+P@Q`@TV*TTpA-MP@`pW+@Q p# @ P" @j "@#Co+`@P!  @q0H+@  R0Q  pL `P0` px6+@P +@, P @y/PP@+@ 95t +@  p+@ЍH-PV @ 0@m}Ud:+@P8q@_ @]}P+@`+P@+`@P  PpR 0NP u @  PpR 1D $@8}Q pg @p.}+@P " !@$}0PpS   p0 @}P(Q 0#{ @H}H-@ + @P8 0U 3?`@0&0 0t0 D H-@@P`V DP +@P 1Q+@ 1R:P 6oV+@P:pPa0H-8 B@$|0@P@00H-M@ $0P @ @! Z|H4 AR: Q Q Ѝ0 @b!O-MP+@` @*4Q P@q+p@ U *4`P P@%$ x+@0 p '! + @ U R/: Q ``W`1PP p  ! P* F00 RpP+p@ Sa3`x+@1\%T9AR !0 0 p +p@  ?/x+@ +@+@Q P QP x +@ U @ P PP 2 x+@0 p! Q.\Џ +@0x+@ L#@ 4t 0S4 B  $*+@d1+@P 9+ p  X+p@  X  Xx+@82 +@p s1W pp+ @ R N z溯+@QN 0P(t z溯J @ n  @ nd 0 XⰠs + @X  x + @p  0`T @ br; RpSQX   0  4P(& 㰠d_s+@ P 1x  + @ ?T b;r RSqQP ϰ 0p h0t+@p +@+p@ p0W  ,ЍO-tMxp0+p@P 弐@ + @`1\%T9AR !0 0 P  ?+P@- +@+@Q P QP U @PPX@X  @$ ~@P+@@ + @P pR 1dPdt0h 0dPdth `P +@,@+@ atP+@ @ P1`PQ d h0PpppP P20+@  R0V ? 0 p!Ur p@Q\.0O +@@4L#t0  4   $*+@/+@P '*P P @+@@0 PtЍ @`TO- MxP+@+@@P0 SUs2# 0cQcUaQ T /r 00+0@@YT  @ᗯY@ Z@x + @ 00l ?PR v Y2  R4 Px00 PV`0 U@  p㑊PU`J+PU p Px*@Y  R  pOQ( 0 ^ 7,RQT 0 O (,  0|+@P  0pq+@@P p@  0] + @ qR 7@  0Mx+@P`0 +JZ0x+@0@@ Ѝ @O-DM+@p+@`W VP ɮx+@P@WP`0 p V ` p Ხ  hV 0,P@ `T><4 @dSD>FQ 0t0"8PrPV px+@ + @,080 $4,0_R 0PV <+ @ R z,!T 0T2pS` $0P@㕨`Vp8+P 0V P 0 @P-*0pP040 $PpW@̐N  `DY Wx  = @r$PQT@E 0PE QA 4O?+@Q 0,(x `+@0+@ +@0S R  0  R  9 0 0  $ht+@ T !8P `x+@ + @,80 00?R00 <+ @@ R ̭40$ !   *,`@(  0 +@P  0 + @ R   0 + @ R 0 x 0+ @ 000 *4`V[p>8aPE px+@+@800 /Q0  ,+@<P  j 0倁, +@P 8 0 4`(V& 0`F4`P@`}pDЍ@+@Q 04 $TlU @5 @00H-xP@+P@88-  0 *@0/@0O-M@Pl+@@R6P }54p+@pl+@et+@\ px+@㕿p|+@ `@p0@+@ dTP"a@Q)d PLht|+@EP FP PP h+@UP XP BPp!@[P| @UPxut+@l +@pb#@ 0 +@ @v l+@ @p 2PY  @,PW c @ 0+@P+@/ @Px+@0l+@pq m!@0 )@ R *g @Rv`p+@Y+@+@P+@pI+@+@@x+@p:+@+@/p} RY` +@P  `P  @iP`  )@pPUa +@Ph+@yP @s+@P (@j@fU6@t+@QLPP @ X 0  J1pp8I`3T@ @T@ @nLJZ@p+@P@ЍT @ۢH-f  )@ @Fvsp@-M@P` nQ QЍp @ 0ḢO-MMo@+`@P@+@PP  @@p PP  @ x@+ @P+@@  @#P  @ @+@P P A @l+@P _ @d @pP @iT P @bP @[P  @T+@P P) @H90+@ (+@ 8@ov' 0p  D @/x+@@dDt!!/00b  0 0dP@0!!  0#f @  @tP+@㈰+P@+@Ps x+@0a+@ +`@Q 0O+@@   @tPW x+@@`, ?P4?@R%s8(p+@O!4# @1!@0@?a p+`@0@p0Y`0 0   @htP+P@P  @`t`V H @@ Xt`V tP  @Mt`V I @@ Et`V t+@AxP+@+P@P lo +`@@04*+@)+@P ^$ `+`@Pp+@( @+@@,P pQ J ,pW:J+@  Q P '  @1p+@_@+P@P, P @!P W  @P ("@P( (@ $0@"@"@$@J2P Pw  @\1@ЍۍO-M--MMx+@+@+@P,P=  T Az/:&\%R0 ?Z 00 0 0Z p`Ppop`PWPOPNGp@`Wx+@,Z:4@BHL$0P_`^@PPA@ UPQx+@pXE(+@x`+`@0+@T @t,P pP4P8< xD@㸠+@Ћ(< +@)@+@@0 qTyAT@4!\5S 0p0 0 @ +@@  ?Pp & +@+@Q P QP  +@+@ QDR Tdp`,p0 @ 0pms +@P  +@PP> U @P\ 4U @P T*  @U @P X X0 P XA0TX@ 0pX@0gp` T劁 X` *ACP p$@b`@(ppp\u:  hpP )l+@pQd  + @@TQ@  ` x+@+@T 04%!TX\ p+@` p p᷌dPd+@ ⮌PXZV00!  Q  :0QQ : ^dVa:d+@P   @ 0q  @ 0lPP @#P  \+@hpQ6 ,+@5\p+@h<(0 p\dP @X+@ XSPXb  @ 0P @#P  +@Q< ,+@;p+@8@ +@ `@6@+@8pP7Ȁ @wpQN+  @ @[#PG ,zP+@x+@@+@ 4R Q# F0!@ +@zl`@hpPpY:pȀhPQ '0? ? 4`O,xH`+@X@0 B?qk8 ` * R`@ PmH0+@Xp Pd+@Pa(P J S:|+@Q <S* 0P+0@!0n S!So V: FPt,L@/jb F`Af0+S[1kP4[Xs#5[W2"F  K '+&A ``0 T,L@1R0;Wb"!![/d+ @X0 RH :  @ dN;s:hP (+@LP 1d +@0+0@0"00@$P+H@+@P  0X f  @@qp ~P( H+@Ph pfP +@Pha ` v+@ V&ʆ( pP (1_0l X V Vt@ pP? h pP U+@!X0 PA_@p3 Q L!X`PHpLP/ 01 +0@+ @ R l@ \pP^APJ LP+ @HpX`@ O ?+0@0S P' +@ P ῥ 0 @/+ @ R P  +@P @ᩥ 0  @@@o+@XP 1  @op+@  @  @!LPPHpX`@ D  Rlp  08LP+@lp8p+@!P7+@Q2 +@Q pP PpP l0+@P/Q ?s0 q3?p01 p0 t+@"+ @P"+ @ + @ pR P1t0Xd0PtXdp,py+@P +@P +@P;4 \+ @` h@R 1Q ۤפQ  ,%  @ 0D  @ P @+@\ Q Ol M+@PW \+@Q 0PN x +@L0 @LP@PU x+@ 8 \+ @ R 0x + @ 85 =`L0`T  0b0 RWQ!d`  + @ R g40t p2/L@@\x+@ 4ap %+@P`P + @`@ hpR : h+@Q 0`@hp 0! 1 , Cl  @ 0 P+@P  @Z @ PJ 5 +@PQ  + @ R +@Q 0h,P  0  &ph}x+@H0@XpLd+@( P 2/  @@@mp+@ rx+p@+@P@0 pXp6:p*0+0 `1 T@帀+@40P0003`PPS`Pa, \`&% VB*(BPA \pT@Q`*$Hpx`T@+`@<帠@+@+@,Tr:fD+@Ѝ؍ЍC  @`0Y  @kC  @0$}  @ R  @4!O- M؁PH `XRP:  @?P " @+@ p R  @p pW8P`+P@P   `PR.+@1  H`00)  @^b+`@ 0 P >>PS Q +@ Q ` 0`& 0#0 Q("+@`0``000  +@ # " `pW%  @+@P  @n`  @`Pp+@pO  @+@@PP  @`P  ЍP!jO-lM@X + @x+@ +@ T @X,Qb < )@+@@P Q d> p, u < @0+@mQ6 pT+:UP& `+@+@ P@pR P1\t0P\t`#P  @PpW:,X:lЍO- M `V:BPЀp+@@+P@  PpQ   "   @F Z ZP Q `Vpp ЍO-cMMz#AP 40DhC  @ @P,  @P  0+ @+0@0 S: R?  <  @ @{Pp+@!,  @ @nP  0    @Sp+@  @TPiR   CN+@P #` @+`@+@@T3 0@ S^XFl @4xP($NC/@(<X+@Ѐp )@P `+@+@pK@Qdx @ 0pk<+@p(P% P%`- @k +@PE  @Pj `+ @+@ (Rh Qn Ǡl +@Am ` 0 "  +@+ @ R   @ @    @ @ O+@@P  @d (+@P@KZE(# @|P + @+@ (R Q mp+@Q c Q ^     Ck+@+@PU Z (C.@=0 Z. (C.@3,C 0(, Q 1P  0`P0`0 , Q): 0@`30`$ Br0C ( 0, R 1Q00 `Q`, R: 01  Br$ aU B Z $U1|0$U|CS/@Q<+@([:+@Qu +@@(Tm*CS^(`pp(Pa C+@+@[ Z (C@ 㤟 Z (C@ 㛟C(, 0R 0 00 ,0Q:C(, 0R 0 !, Q:[ `$ @CZ 1|[ t1|[ t(@T:+@p(W]*!@ 0(0S `0@&P#P0s(pW:B `  @  @ 0  @P(  @@   1 +@0P @  @ 0 ~@p+@+@p+@PAP` pPQPW:+@pW*P    " pP=cߍۍ\  @ 00@/O-IMM@@P8+@+@P%+@P Q 2/R !p+ @7  W *Q 0P +@ P*O   @@T "@0PQ Q 0@+@@,Q"@ HHH9. @ R  `p  Q P2 S @ z @-E @*P` @Q/ @pp)P 4O  C . @  @ P7Q 02E @P4  +@p P    A p+@+@PP@p.`Q 0p+p@,Q!@n  (( 6 P  P  /r P0 A q0 P0 AP= +@@0 BS qPU !@P1 ~ p@ ppP P<  @  @7 @7PH Pd/+ @ RZ  @V+@P 5_ PPP . @  @ Pt p+@p @+@P PY/+ @ RO  @K +@Q L". @e  @Pp+@+@Q ` @p  ⰐP  0 xA@  Rr P.Q`VP. @ .P/ @PPI 0 Q 01+0@`V *? 0@00P( @ZP6+@P- Q 0PP Q 0P PQ 2//P @0Q  @(P(P @5p+@PPJ @ Q 2/0  P; P+@Q 0% Q /* R   * R   Q 2/p`GP*PvWB @+@P+@P IߍۍGP:WR WxPW0 S 2/= 0@PQ 0p0 P2   P 2/00`j/ @ @0 +@P  @R( @xPP Pǡ+@PQ@UC0 S 2/?p 0@00  @OPp+@p  @7 +@Q/0/O-M+@P<  +@+ @@ @ )@P P+@`K@d @ 0`eP`(  @R@p00R ?+0@0S0+0@0S!@W, 8q+p@P(P%J@P`  PT@0+0@0S R @ p g:j8q+p@T/ @ 4 @P\ PX  `+@ p+@`\@PpW P1dt0 "P%,Pdth  @ P # @" (O+@ K+@@[(*ߍO-lM@Xcx +@@,Q !T!U @PBZ` %.8D|0< t00 @p ?.x0H +o+@ PP0 XPUHP%~0 +@ B| B Bx 80 B oPR0c /0`P`OPN`q~``@@f`pPp,P TPT4l @P! p`&#\TAP  0`dP+@hp p pe?2w5 pU7Q% SPl/)|p ORQ@+@p@Xp hXlp  B%QJG,A\QJ ܐP @z@iPd$P8 ZP`p(@ R  ! S0!T@!X!1 A xPhU @ QD及&U @PLX PJLpU @P2 PAP" U2 0@@QL!pPU:W:PP0UB @@/SqL!0AV8+@P@ 0p_^pAP~0Cp70UB @@S0PpwQpq8 RPQ Qt1` U2 0@RP  01 2 +@XPV  PD dwU" @QD! !U" @QHPEPETd  PpHWa P  =$P\@`8!818`V[$п+@P(`P% \0X` p Q $UQQPQP`U`Qp00V:Q $%Q! ! p / a t/Q x/ALs  %/  ZxP5 +@P · A( @ 0@] @sP * `x+@ Hl+@N+@P # p+@+@P 尀 Lx pA+@@+@@Pd xP+@T @\%R p. P!' +@+@QYP @ %, %*+@+@P Y +@P  @XY +@QKYI `+@Pf0+@ @ !@R  @Yꀏ`+@PS+@PPL=+@ N@ p  @P fs@PW @ @  sPO  @  @P"/+ @ 5 @,0p+@0  V @_?`P @XATl ءZ +@`4P [ Q 0p8S8Ė< \$ P!+@T)A@$P `{ @ P 0@ PE *X30+@ +@P ^+@ @ RQi O  @P @ P+ 5  %*z+@\ +@P 1 P: @- @j P  *W+@9 +@P  <dQ:< @- @G P < *4+@ +@P  +@P:Lq1 QQ+` @|O+@@  Q + @P- @ P*+@ +@P S +@P 0 Hq,  @FO+@@ 0RaH + @P  @P*+@ +@P z 4 Lq,  @O+@@ 4RaL + @~P  @P*+@s +@P H |+@Pg@!@F~ @ \4S+ R( PQQ PUQ P !@  I R  :  XIQxЯP+@+@+@+p@% O+@@P + @P  @5P*$+@ +@P } +@Q,QS 0"!, 0 @iO+@@0Q4e + @P  @P*+@ +@P @ +@ (R xQ2<Q0  @1O+@+@@x 0Q<S( + @P  @P*+@ +@P a H8%<5"#. B @O+@@ HR?8<5 + @_P  @P*r+@T +@P ) @L@%D5"#D g @_+P@ LR?@D5 + @&P  @JP+*9+@ +@P @ @ @ pʘ+@P  @8@H 0 A+@ + @@QzPx,%Rsʘ+@P>  @d?Lq QQ ڇ @UO+@@ Q  + @P- @P*+@ +@P ,  @ @P +@   ,84e00 < (%* @+@ +@P Z+@  QWPULpQ+@P  @ @PP +@ h0 c L0Pp- C0pO$e>qV1 `@U_a\``@ LPp00   *E+@' +@P  P +@P*'+@ +@P  h  +@p @3PL  1QW0P AH4Qd P8LdL×+@  pP@ 0b432 R"1Q SP X>  @:  @P +@P  8Hdd L+@P` 0b632 R"1Q S+@P  p0P Q+@/!`@ %3P+@= ,[(P+@> C+@  TK+@ 0P @5@1+@+@@ +@:(P+@P3(Ut_`+@+P@+`@P  @  @V  @p`+@`8,z  @@ 2P+@  + @ Q P 7n` KȄQH+@+@ 0@PP p`L0ADP |+@P k  @`  @ P ` 0``@` 1Q  @Ro+`@P  @PZ @P  p P  @/o+`@P 4 @P  @P  "  @ o+`@P + @zP  @P ` 0```n `pi%  @P  @% @~PJ R@p XLuPuP+P@ *T8+@P   p+p@H  @PP  @ mP|+@t  @  @  @`PYp 0PRp @1Q/Q `V"*Q:Q  @s+p@P 4 @P  @P   Q 3  @Ko+`@P  @PZ @Pj  c@0p @ p 0P @@@`D    F? @ @`P T P1$ T9A  R 0  Y SP TgJ1% @ @ @ 5 $ @ @ @ 0@Q^ @Я+@|+@|_+@+P@ !+ @QBP@  @nQ!+@`+@+@+@+0 p0pWP@ +@@0p+0@R  p0 ! @>Q`A%P+@P%U+@PD  @ p+@JOO- M+@ЯP+@+@U *o  0@Ppmp)f @+@  @@?/P` 0PpKP  Xy @[+@P +@P +@P x+@P P  @  @P:  @+@P   @P Jx@+@@*P >80!9AT)A\Q\%+@Ao+@h Y2 @2@ Ѝ开+@d 04C'"+p@p#%Rk ?W& xP@+P@+@@i+@P+@P *) +@P +@  o,qTyA @1!\5S A 0_+P@ ?>@P+@P ᶾx@|p+@@+p@ h +@P 奾8 )A\QTA\?fP x+@+@P  @@h Q pLa @P0 R DOP@pU:{ @m+@Px@+@@E @| @| +@+ @ 8A 1\%T9AR0 49AR1 8C\5/+ @ R \%R  CR/ATA\/ + @ RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R60H-P@ ` @XX<<@@\ \2 p 2?τu/ `*`*@ @h 0HiH-P@ ` @XX<<@@\ \2 p 2?τu/\ `P *`*@ @$$h  ŕdp@@SD `PHPS0He @h ńdp0HeHAi\%Q TARTAR(  C TAR T@R 8AR AR /ER CR x$+@QAo TAR/x+@PP!+ @ + @+@+@/P/@-@+@P  !@0S`p'`&p @T@T  @  0000 P@@Ѝ @A-Mx+@t+@pPdpp ` @P`2q`SpT,tQ! +@ @x)+ @+@000 0@n@`ЍO-MP P` `@V +@ pg+V! @ @ @ 0 p 0p p+@T<x+@ R60@+@`+@pL3 BR@Q  v8d H4LĐ@P 0b532 R"1Q S P  \p0@ `RЍO-$M⼀`+@0p !?Hp$ @/P 0"P^  Z0 @)_ @LWKP+@ @  / +@ R0 [Q  f  0 @%0 @ /) f? " ?ἀ0 +@ @ @0K+@  `Z K $ЍO- MPJp+@`0@Pᐢ!( I/P+@ ЍT  !@0P @KT P./ P xf 0 @K P`U ЍOCKO-MP +@PЍp+@+@P&JП+@ x+@+@P+@PH O+@@P  @P+@P +@ ? 0+@ @'P( P PJ+@ f ? *+@+@P Ᾱ`+@  eHP+P@`! P+P@Y!먿p+@@T TPtpO+@+@@p + @PL H_+P@P { @,`p+`@.P!!pU U@d @P& P%  @P$T$X$*@+@~+@P S  @P @dP+@+P@P  @W@*@p+@R+@P '  @+@P e @6  *O+@1+@P   +@P x t+@+@@dP8e0: @ GJ1+@-ЍO)@# @@-\%T90@R"-RH?>ˀ c C*l "BLŐ % E|0 %,@ 0P%0@P%,0@p@-`+@@PP IQ @ 09  @Pp HO-MPH0x+@p8^+@ R/P 4+@+@N`PC YJ@.!2 @pS @000 R@0 TPpUpPd\%1T9AR  !0_ 0x@ +@@  ? P+P@ +@+@Q P QP 効U @ P PyPz `Y!ϊ0P @+@~ 0a"!on P P `"@Tq !x@ `+@@P(8p+@ ? W 0Lcp R "pGp`@0p00GQ$ CP$Ls A$ R?0 B O +@@`*p+@+`@+@P ᠷBP P PЍ  @)p@-xP`+P@+`@ @ +@Pp p@H-XM pP`X@P` @IXЍO-\M"`pP&@! o|)+ @Q@P*  X%$H "@"@ \ЍOB& P* !@`D@ ! @@`@D  @K JD/P T `|+@|+@ P|+@& ?eH+)\Ѝ0H-@+@ P:x0+@P +@ Ea1S0)@0 @00H- Q(P@p(aCnHg0*/1 Ga]☠ȟLu C4 ʿw0*Fj0`\ 5 N P ߍ @>H-P+@@paV Q PR iP P A@`5 @0 +0@00!R  R//G--`PP:@Pp'PIx+@!% #^1 F7KR 9 # "7 ! oQ.+@Q) i0+`@<P  R   Y+P@{)Q( `p @ P +@ w ap A @-x + @0!% ^! F'K^ 9.$P% "  / #"o  O-8PU/p$ p@dq灰 @p> X@A @a pWQ\ 5_P5_pPQpH8Ph@`WXH-`0SLLLM 0 B @@o  @ @ H-`0ShMMxMM  B o, @ @ H-`0SM,NNHN0010B0B< @ @ pH-`0SNNNN0010B0BI @ @ HO-M$uW Őlp|hh79ON`SQ0vvq|$p pWp!@4OW:0p[ P` N0AVU P 0f PPX@``U0@B D  Ep_T pa R  p NpG`P  W0D R| !  !P! B!Y @2/P 2/ ! !Y2/ B2/! |Y 0@0ЍO-M@R PrPV @ rꨠ D P pP e D |pf (0 c0< C0 $ D8(% @ePp `P @ @ E F @ @ @  @ hP pY? z D 5p8e D .p4 p) 0( PU!*`&`U  0 P m @=0 *@@ Z [ߍ @ qK-8MM8 P;pPW^`p @0 P9ptW ` 2!8ЍۍO-MMP`pl@PJ   P)  P/]P rQ-0@ @p?iP{p `ȼ P `pWkW~h Upl~ZP `p -@`PTVJnPQJ  !o MPBJ040 #SP9JP5J[N- @ 0 @P#J~PH  8pNP- @0Ƣ P@PZ` P V TJ@ߍڍ   P ` P-_ @0ᙢf@^`{F~PdZr@`oZ ⩽P ^/Dp P nX BA-M@)`Pp+@P  0xp+p@0P  R Ѝ0 +0@0@ 0OS+@@cP P*+@P ӱu PO-MPp+@ `@lhT yx +@2+@QTР xP @ + @ 0 ?  0 Р +@Q x p 0 Z,*P?p  p嫻p` TP`0+`@P 0XDP`@ 2V xx0@P 0 0RP, x @% +@8@VApERp^1 F7KW0Su #3) @J,px+@#3 @: x+@# @ -p+@P  @P @P; W x+@ x+@G @ +@P  @xV @P 4x+@ `᷾ 0,x+@0Z,pP0+@ + @Q ppPRp rw!$ ? V@P +@p TP (p @1嫊 `媊J`$WJ$`Z:(p$ QZ :!p171(pQ p(pWx+@0, `P`Ghp(0(@@ @PX( (,p 0@P((P( Py@x$+@[0@`Pb: J!  +@ 0L x @G+@P + @  @PK (@$P@ xP+P@00? 0P0`Q((x,`+@0`0` B (p+p@P0TPpW v, p@V @ @ Z @@( ([p+@,p+@4Ѝ0pSR z / r P{ Y  @>x+@#3 @O-M+@@ 0P Iv@Pw x+@0 Tpp  0s 0RpPY?w0@`p   6/  H `+@ЀZ   v%$ @  v$ %`P@QPQZ u@P` @  PPP@Q- @*ЍO-Mx+@Pp0@o 0᣸&"0W$! + @ `pS W/p  3R` 0㊸눹/+@>` ! (@Q` R5JX+@P 0+@3?R' 1 D @ +@R Z @ +@P + @7  @]P pPTЍpp+@pO-M`㥳xp @ @V+p@1/  +@+ @+@V   SP 0j0PP /"@ @VY @gS=XЍ`\0p @Z ppPx `pW 0@P X Zcp `@X"  0@  09+@P  @ @P  Pp Wp+@O-LMP+@ppXP 10P 0@ C@ (XP `vp8РW,$@ t@P %0$ !,t ! U pW`@+* , @ P #"A p`, p @P` at,\t p 0 ( 3} @ 0+@P + @  @@P  +@P 8t $p2t$p , LЍp+@0H-xP@+P@!8 ^! F'KQ#@ @\@+@P$  @@3 @X@# # +@P@  @@P 0 @;@+@P<O-M(`@,P 0ᰶV` 0p㩶P @h`0P " Z sP`pUЍA-M`p@,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8P_&d6 @ @ 0@l_)&<6 @ @ 0@c_&6 @ @ 0@|Z@-@,P+@ [ @,,#8P0@_&z6 @ @ 0@7@-@,PTP @_%5 @ @ 0@"0H-0@PP 8 R B8 Q   04PU8P0_P&z6 @ @ 0@_P&d6 @ @ 0@O-M,P/ ` p@0 QU   0"P  %PPU@@4[Ѝ_%5 @ @ 0@$O-MpQQ `P 0Р `@`Z`Q @AT*:`[ 0P `QS [QP(PEР[ 0P:` `Q S[QP p`PpVQ  0 Ѝ_+'6 @ @ 0@3QH-,P @NQ CP\ @`P'`&P @TQ_%5 @ @ 0@>&_%5 @ @ 0@?G-M,P+ `(pJ,W @P P # "  0@PP pG@ `WЍ_%5 @ @ 0@O_%5 @ @ 0@QK-0<S 0 @ pT@pppW@`LQIWPQP@ @ pQp^0 _&6 @ @ 0@fA-MP +@$@ p`+@@ t @ 0q9 0`ЍA-MP +@$@ p`+@@  @ 0S9 0` ЍH-Y+@+P@P  @iP  @q  @PX7PQi*H+`@p @@  T 9P pW@-I+@@P,Q H-M +@P,^Ѝ Ѝ0H-P@X0+@ + @ Qd0R 0 x+@`QaQ 0! 0pC-M+@P P +@xP@+P@!s `o+`@Q a AR *7.@Ѐ2W @; @  @P r @ d# %a, %*n+@P+@P % @!2  +@ 0OP%  @  @PPZ r @0 %d3, %*7+@+@P @ d AR *a#BP0:RQ-  @Q'  @l  @P"  @sO+@@ d#a#*+@+@P ᶦO+@@V @Ѝp06O-M@v @ `0DH@`P p@\XTPLHD@ H %kPlP tP bPP   p X 0 p)@pPЍ d )`@P0 @ dRP0 0P$X P\0HL P p X(\$,PT`@pDP P0 S * @ s@rP[` p pK @#RP " @ YS p @  RP PpW:PW@ @l(P$ $$0&,   0 ZP[ @U 0, JPF 0 a ( I `  P P 8$ RpS 0 a  B`  R0" R 8$ 6wp7 dP+00! @0  @0P% @ O-MxP8P`L p@H@@DH@D<40< $aPLP bP iP cP+ v   O pp AP8  )@P@`  P 3 P@zD p DP 4)@7<v @t @ߍ4)@+@ `0$`4 HL0gP @4HpLP<@DrP 0`,PP P ) @7 X $pT p( /P @S@  O*e"@ @0p4ڔAT3 $O4P `@PJflp)  n (fp n/ P$+ @`"! @t @`4! @ !  @n?C! @ ` VY ! 80?(`"R10@``WP? p oo'@84P-`V* Z V. Y 8$ m0 NP#8P , !$  0 !( 4P , !$   pW^ @.G @+ ``@F$0p" $ 0p p  @ D@ X t @K- @PPpW ` 0`W0 0 0KqO-Mry`P p@@ 8#pPpOPp AP5PP fP/  p)@WppP"P` P [P ~ P  0@pP ^pL Y@ @HL)@@B@ 0@q +  0@^P, @վU  0;  0 @ ip @zx @  @p@ @@ЍG-u `P@!p@ "fP p rP@  )@P  p  `P  U @ d)@GoP @ F`W $ b  p VP$ T p Z `P$ E p= @ @! @Q/H- @r0Q0#1"$#O-QH p`V pQ^; ࠠ@P>k6 V  ``?k7 VPQpW#* `  @T pW*@`!C @@ X*`!F @!CC@`@T: G-0pW 7O0@`pWT ?p@T s5T P@0S6 @T@&@T@ @@T@p@T1W1Z:@ PUpP*U p p@0p0@S VS(BွK-Mp($D` P fP$ 0Ⴖ!  $ P7 ЍK-MP$Dd' 0` !`   P`ЍO-M p@P  @MP  `Q @`Ѝ  Q 9 0@P`rQ "$  R)$HP  ka 0Q nP PV %  @ 0pP`V0%1 # PP ] @ 0P `P   @ 0X PqQ $*  @ @ @  $`  0@ `P [ a P`u [sP@`To T @ Z+ MP1 pD 0 PPT$@/)! @ 0@P  @ 6P  P rP7 P@ PZ:/Q   @ 0 M0H-MP@ 0 0Ѝ0HЍ/M@-M@P 0  !@2! 1Ѝ@Ѝ/M-MPpM`P/ @HL< 800d`@,$ 4(4;T$ĦKp 8)p @  P-$tTWР|p f &@  @*+np& @2 @p   @|@ЍpWQ Р [  0ܶ`pP @ 0zP  @ 0` Pph 0D p p 0pip  0pEp P6 V0Bꨤ ᬴0 ᝶!  @ %@D p pWU @+D p Р  pk> @|l @y P P ${ Rx*0pqe @`MH-M  00 ЍHЍ/O-MP`pP$ @U P#? "R R$# P PP @ 0Q @P  @ 0`P  @ 0P @ 0 0 @P_ 1SS@[ơʁ @ 0}P ! @ k1S SSH L0@  0 ip) 0 P @  @ 0>`A 0 @vP1`ЍP/@-M@BBQ  Dp  @8 @ Ѝ@/K-@`P p  Ӛ)@P!@ 0  ׺  )@!@0 )@p T @ K0 K @-@pP jP  d`QP  @~ @ @K- @) @PT0U p`v0PU#&d  PUX 0ps`PUp&q#4' Tp Oq @ @ [$$ @-SN"@R0^\ T /$ T! /$  T! /O-Mp @P T= P 㠁 )@`@0 /@T- ᷬ @ ;m!0@P )@P `@ `" @ 0/T:p@D!@  07 @`/@TЍH-(4$$,0DPO-$MP@P}P M @P $Ѝ 0~- $tX` H0!p *cga 0 Q0 ` Pp`PZT X0 00SPR  @} @ 0  P QPU`a  0Pp $GPW p 0` pPK pZ0 WE0 P0IBRE#8\    8pu $$Hp2`r"pTp`` H QQP p`pZ P`pV:LP PQ @J @" @C 0&p<  0 0  0 IP  4$$  > $@ ` @O-Mp@Q W#V P@WB P@$P PP`  0P l @ 2 @ M @ PЍp@-M\a 0`@@PR7 @W^p  0r c @S @sЍp0H-hRLR aR bR,%iR sR tR#P @ 5H@P\ 0@P@08 Rs @D ( Bp @ @7@0p@-MP@Q\a 0`@ _PQ S @Ѝp0H-P@Q 0\ 0@NQ0 @0A-M@`Pp,\ 0@  P # 0RS sS bS SS pW bS S BS R ]PJ $$2!PЍO-M` o r 0R(Q0Q{ @pPt Pp fPk P P`P] (QQY R 0#"P R " 0#F$p@ T +0P p8$ m00 pGP/ @ ?GP   9GP"@ @ 9/$ p)    T 9/$ p 40 @M@PUpЍ@ r @ GPwpA-`p@_PP  7/$|p  7/$ qp 4  @PH- sR iR aR Y p @A-M@ P $dPp0 G  @ 0` @, (p0P1 .` @ 0PЍW 0㳤PO-M\ 0@@B#@IP" }BbP p@#@ @`iP `V    'PP ЍH-}~_@` p@ P@ 0+`VO-$M!@ @9jP @`  !@ P !@i iPU  `/ @O!@ P !@i i$ЍO- M`Q 0@4p P  @( ЍLP P0S* @  D  T + @ EP$   Mp  $ 0 T0 У0  0 :p  @  @ H-`P @ E@P \q 0p@vP  @@p@-MP+` ! @  @>Bp * @0*P !@* |*Ѝpp@-MP  )@P:($/,4 @$: @*$$0(@,ۯ K @0 @UP$ ` p ] @*"{ @# @+ P80! @ @v*P @r* |)@Ѝp@ @(@ЍpO-DMPP@rs ` @ p@)@ @4 Ad @8 XfP lP4 r8 1PW\  0@@ ߰P  !@*PA  JP) # 0F*@&Z E:  sPp%0S"  )@P(/  @ @ @  )@Z : @ )@DЍ 8$ O-$M [ LH P p@`Z` [ @ $Ѝ `  pWp tL @P ` "0# pH L0 %! PP\+ \U& N5\ 0@ @ !U @1 @hP@\ \T H 0L @UTX $@(`P] @HTPLPX $$ . P 00R 00 P `p`8  'p00' @@T` P`&(PP! H0Z P L@*k !Hr`are B`Q H8 @@P/@-@$P @O-,MX TP\0R, `Pp @ P 0TPTP 0@ ` p 0@V  0 0 $X(F P=@T9(P5$P (PR`pa  0ZW0 `P p  VV VX,ЍR᙭V0 000PvO- MS9J4pw60P@9  0  @ P0@TP p`T +X@ PR (pP+ V 0pp0XI @ @P ЍX P  @VX0 P0  @d @8 @ ` 0@P(  0@T P 0 %$#@PK*h[!Hrare H @0T ` \ @@PPT @0\ 0 @0T` 0`0P@T@*h  `Hrre5 Q Hv$R/0S  //QQ/K-P $ ` p@ PRPQ   TXp@-(M@(P`P . ` @ P `PP 8 @(ЍpO-MP48 ` @㹭P` UPE @@$E\q 0 @@,0p@`(  lPm@ P[8 ^8Po[ʰHP TPO@@p $004Opꀠꗱ ,p '  ,(ppE @@ꃱpP, | < ,<P PpmP  @ SpZ  )@UU R!UN vA)p@   Q  P  @pQ PP4  j@"@0PJ@7  -Q & P` 4 0 ,00(00`-`P 0 3/p @V @Ѝ @ @ USp@- @ @㸬P K&h)@P6 @ @ 0@ &  @ 0ukm@MP `@$@@PEu$O-,Mv`P( p@(@ pPpp(ePp AP"fP sP  )@P(@P`;P p  @)@M,Ѝ  $0@p  p ~ p@`` $RƱPʑ1Q PI/'+@@@ @`@ @ 0N!RR'C 8 H0 @(P P  `VR R R  Q @ R  1< @ 0,p p{ $P 0O @O @O @O @ pi @] @XO-M `0P W8VHQQ H @ 4 @Ѝ(庨Z @ 0S 00S000S@P R@Ph @ 0뺨$$0pZ  P0#S:Y/'+P@@ @㐃 @Qs @ 0}B<0 3/p 8 H0( (唠$Dᜪ 倀PT 0 R0  pW:@-@RR R R @ R R@@@ @>p@-0@P R CPpHpSp#S:i/'+`@ @@ pp ppp @a @ 0 pK-M0$@P! @p  )@P P`P  @@)@ЍKqm ie$R 0 "0# "  h @ Q  6 @o/o"R P 0  @ЍP U0Zp  Q P  0P  0p Qp 0p(  0pP# p~U  0 0 pp  @: @ @ @M-M`@Q V*LJV p @P@ Wp@ P@ؠ  `RP p  @ 0 @  @ @ ЍO-M`PpH V V9'  @B @ & ǗB @ @ @$$  ` p H  L` 0$@p 0U @  @ 8 @ ЍA-8MP@ P @y` @4 p@ A# @0 p p  )@P,  @0)@)8Ѝ @ a @/O-LMyP`D p@@8<@8,40@0(, pbP p qP   0%p% (  )@P8<PP 8< 0S0S @p"`!p P)@PLЍ,0@ D004,p pPp @@D,`P pF @$<P $$ 0p9 P pP pW @ @ Y " # # T 0 0   0  0 0t@!$ + !(P2 @P$p{  4pr  S @uPiO-TM(~zH`PL p@sH@ sP  0FpMp qP.  )@P'HPL  0 PF@p5 T  @ 0D$$卦P`pP  @ D @0 )@PH L0 @  < P   @ PTЍ0 4 P, P)  $, p   QP  @D @0,'p! P" @~ @ @`p  %  哒 8Y*`p @ {;P  V  Rp`8倐Y:D p@0RV _(<0PV[,^@p  t  $  ^   D  ^D  ``Y PQ> @i@pD <0tP(0@  `mpO  0  V00 P  4$$  兣  G @x @+ @( @*  0 Y0`  `R\ $@0 `P@ p 4P(0$Pq#( Q0 0 0 p" @ @O-$Mw| @`P p@   aP bP iPTP  w TI TC  p=p NP9 lP3@ $@2PGP  0S0S `p"`!p P 0T  )@P  0   ;4)@2$ЍO-eMM\@p` P@ a@ Q<LLLLDL LLL  pIp uPE  )@P7 P @6P P  0S@T `0"p!0 P@T P `P `VJ @ `L)@`eߍۍL J. @@" @ }+ @ @㹷 P  pP)@l  `@@  0`pP @P` XX X  `pP @P` XX X Q  @ z`P@`XX F @ @@d`P@`~XX tX  E/)! @ 0k!`@ 0,P$@ *]  @v  @r0   @i8  @f$4`## !@ 5p/ !@P$4##. @H`P@`XX X k8@$m0 `  @/  @,#  @PU.X LL J. @@" @ }+ @ @˶ `P Z Np @)P@ @@    `pP @P` XXX `pP @P` XXX Q H @`pP @P` XXX `pP @P` XXX  m`P@`XX X pWb @ P0$$y @0$$5 @/)EO! @0+`! @0PE$@ \E@ @ c+0! @.  @Y8@$m0 5  @N  @K# @ @`0A-MPP1`@pdp  @2  @  @0 PA@@$ 7 0@S @  @  @> @ЍA  @  @  @  @ЍA0 @#(:. @'  @PP(& @1&+ @! @S  "@ЍA P8$ m0 + P0! @+! @ P0 @ЍH-M0P@4p b #+! @  4p Վ @0P !@ RЍG-HM@ @P*` P < @8` @4 @p A/ @*H0 z TP p lR* T"  pT$ cpT 8 @ 6P  )@P%80 @ Jl)@p@ $@PpHЍ a @/G- Mz@`P p@  * aP bP iPT   T /T  7p)@ ЍlP@ $@Qp P|P  0S0S `p"`!p P0T  )@P0  tO-LM4p sP㴐`8  000<0尔,`dDEF$Hd<@ `@ P P6P Z48 LZp+lPHd<@p `@P 86P pW48 4ZpFGI0H / @Jp4800 p,pK`$` YzLЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00 @ @ p`[X P 0 QQ1"2(pHdp `@@ϡP pW d I(. 0rp 0O-lMP# H㐟,p @ @P0  @ ` @ @` ``y  :/pWlЍH-Ht_@` p@ P@ 0`Vp@-H @ A@@P` `P PP@TRp0 p@A-MPP #2  @p `p @ sp0 P0 W3:pW@ 0 p  @Z*04 $< ( p 00s` P0p P` @) @6?  @0JLЍA-8MP@ P @y` @4 p@ AX @0 Tp T pT  )@P(.  @07PP `.  @0)@8Ѝ@-@R+@Y +@ ` @@-@R(+@K( +@ `8 @O-AM rb \q P@@ `@0p@ oPp  )@P`P $$rڻ @ @P fPX p#@ @@PMP 1P P [oPp@p `@PPk PS  PK !o!@jPD !  @cP= !  @\P6 !  @UP/ !S$@NP( !  @GP! !  @@P !)  @9P 6  @1P  rD  @)P S  @!P s`  @P W6pP P @@T Wp彔 @`P#@   @P  @ " P? ~ @P +80! @O   @P P rS @P   @ ]PP P $P` @P Y [ @PP `+! @0S$@ UP @+! @0  @ FPx  J "@0Pp  2"@0Ph  T!@0 P` @ $m0P  !@PP PK H@$ T:  @P; @  @뽔 P`#@G pWMP@ p  @P'  @6P* P` )@XU ()@AߍOn @6 @` @` )@X='` @ AߍX u C$ 2 @ @ 0@Fu # 2 @ @ 0@=u # 3 @ @ 0@4O-AM S \A p`@ P@0@@ iPp FP  )@P$$0(,)PP`@p jP   @)@AߍO Zo RP   @  @j P @ |PE  @P $$0HP=   @ p$7P9 40, P3 pS@ $@P( X@ P @ 1P J P "@P 2H "@P  P0 TPH8 LP ,pP,4$P,  0!pp 0$4P  ,0$S0Z8##!  8P $$8, $RZ @P  #@P Q,! @P P yP ,s <%(vP@ @ [ @BP , o!@OP   @GP  - @@P   @8P `S$@ /Py   @'Pq  q/ @ Pj  ) @Pb  6 @PZ D r/ @PS P @ S @PB ` s/ @P; P,0U*  0>! + $$,$P$$P @P^ 8 0( $D`S| $@^P |~P | @RP |$rP J "@P  2 "@P  T !@P | !@1P |$ [, @fP !R$, @ӘtPs$D0 Ø!  4$,  CP$8 @!1#嬘!  $,  .P$,@ ဟh `8\ <$0( 0(4P,REEIB DPT4H 8 0 BL PX\0$$d! h $$,$Pa,@40 <``8\$4#S#A! H $$,$PApn @ pAߍ @ @  @ @| @ p,wn @ @ @| e @ 8 @ @0V @u @)@O-$MMP @ܯP DY ̏#p`+@VP QQ4+@o     P !@$=S`  @p P`fV ᤗ$0P 0oQ a` p(P  p !@e`̏+@ 4   ˓P !@$Ri  @Jv` PpgWK  pcp $ @16` 4   埓P !@$R}  @ P'  @-  @V   YY㝰$ЍۍH V' @ @EA  @@AG--MPHpϊ @0`x @Pt H!h @pd @H ` @Ll@ D  <4,$H@p8`0@(@ Pȝ  ϊϊϊϊ1ލp@-M `@P㱝 r(  ` @&p ' Lp Ѝp ' @ @@  @@O-M@`pp PVP pR R*"@P P_ !@PP Pm  @P   @P L  @wP PhQ @ puhL  @cP ohZ 0 S 1A pv P P PX  @H@[  $ Q 1  [sU  ,0(S 10P Y  4Q 1  Y t  @"@HQ 40L S 1PZ @ h P 1P l 6P 0 S 1@ ` p$@ `p p R 2/p 8 Xp Ѝ @H @) @(  @?\ d /!@?\  @?8  @ ?K- P! P hP p>P ` @ P TP .+K-M0 P @ @&P ``p t p!@P@TЍ =  &L xp !0 @0 `yH-Mt !@PЍ@-M@p t !@vQЍH-@PLP pPޜ?ۜ` `~ DH-@P.P pbP *`h Dٛ굜겜?`H-M# #@ZP ꢜЍp@-8M@  @PHPI   @P 6 `+ @+ `L . `+ @+P @ w`/V q 0p@0 P P @ W@D8Ѝp ( ? @ @"0@z0H-M @ @P PP ` '`H @+p Ѝ0 ( 9 @ @ 0@VU"  @x>@-8J +@@)@@J$+@@@@A-(MMA.P0 C Lp P(Ѝۍ@Q) 7`C @'P Y P@o@P$@Q) @C&P Y P@X@P@-M @@lP  H^p @ Ѝ" ? @ @"0@ٙ@-M @@KP H =p @Ѝ" ? @ @"0@ḙp@-M@` P @ &P uPP PP m @dP ZЍp" ? @ @"0@oሙV  @= @ @  @=@-@ @P m @9@" h U3 @ @$0@b0H-M @Pp    @P  @@Ѝ0) u @ @j=>  @\=" u U3 @ @$0@4p@-Ms @ @[P `AV*%P Ps @ 0p  H`PPӚЍp^  @+=s  @&=  @=  @=H-MSxi `LPp  @=pP  @<@ pp%  @<QQ/Yp!P@`W \p`W Rs O-4M @ `+@@ T @@`P0⏪p  @<ԏ+@kpeJ  @< `0`V{ T)@o@堲 PpW`VhQ pWQ   @ 0"0 PP1/PQ 1/P +@P p p `0  ! P<W90`VP0/FeDL`I KCPpp@pp @pp`W P `i0t  Pʏ: ;CPP @`W@`R8$@<p@-M`P@P  ^p  @ ; 0H-P*@"@t@P .qPJP {0" L U3 @ @$0@᪗V  @;0H-M @P$p   @P 0m _!@ @Y@Ѝ0) @ @;" U3 @ @$0@zp@- M @ @P `mP P @ 0_p  ``HP`p ` Ѝp0  @q;E  @c;  @g;p@-(M@l @PP. Pp$ $ p0  `q ``Q 0$` P ` @ @PD(Ѝp" / ? @ @"0@d0H-Mr @@oP Y PHbp qڸ !0p@0 LpЍ0" ? @ @"0@.˖0H-My @P=P  @Qp / > !@ @z@Ѝ0p@-M`PgP  @'p  @ : ////40)@0 /<0)@0 /D0)@0 /L0)@0 /T)@0 0/0H-@\ )@kPP P00D PaD"P# *\])P@ᣊ?Q:  ADPP*@0H-p+@P0@ Q:a@QW@ A@Q=@H-H/O-M(`  `T )@P PH*+ @p@0PPU 8@ T wp`_0 0` p$P( C AP )@! pX  @ : )@ p{  @:)@ p  @94 )@`V 8x)p@ `V+@X+@\+@j h )@)@Ho `@P@  pVP BWCW NWI+@PaG QsGP(45 766556+@PGAW 7\55|6555\6555l6+@PwWW\ 0@!  Ɖ/+ @Q p lW+@P`WFCWY LWM vWFmWH sWh )@Z )@)@Z+@P+@P++@Py\ 0@+@P!  〉/+ @Q +@P+@PY+@PUaW lWQ)@NwW zWJh )@Z )@Cꜩ)@@ᄩ@)@;h)@6  +@)@P   ?+0@0S0>?+0@0S9?+0@0S?+0@0S0/+ @ R/+ @ R$ $P  ?+0@0 $0H$ 0(0 P P @+" @8b\ 0@#@ 8$ (`@ p  @8$PP PP PP @+y`p` p @PH @T )@P V  + @" @ R" +{; @" @ 0@52/^0 K-MҕPP ! @ @C8\m@)`@mRipLNiW Qb P !@ @ `@)@㰐 W0 @0  L )@pW 1/pmP] ` @  0PPP PPw iT )@ R/0S  /0H-M P@㲔  @2P *"@P , pp ⺍H $ p @Ѝ0" U3 @ @$0@᠓0H- M @ @P P P ` u*` H @*@ p Ѝ0" / ? @ @ 0@g{  @7H- @H- MP 0 A A0H p Ѝ  @7H-M H PЍ  @p7H-\ )@hPO-MMQ .@,TP - @ @I7\`"PV`YC  ^@0<88@4H0P,X(`$h px p)@`XP T[   PpQ uPG t!@ BP= +@pP +@P+@P +@PpP᪓L 1 p* pP +@P PV N T傴 `p  pLPp T)@Q P pP p \ XKP ` p-  @#  @ M  pXL p Q @;   @   LgX{pQ @%  DPH\ pz Pu^ P@ - :-  @c @P p  ~pP@- @:P pgpPD \)@pW   2/pW pf@XP Lx P @ ̠ L p P X L䤍p   @ p\+@+@HDP 0\ 3/^_ M+@L PX- p @ <0m [6`@#@ !P@ " @]( +@  "  @!@G8  "z @!@7  "  @!@'   0 @46#@ @"$ +@  "  @!@0  "z @!@,  "#  @!@ < )@`VF 1/`T \P)@`V 0 3/`VL `Y+@P z\\Z`Gߍۍ  @4 @ @ @- @4  @4  @4@ +@ @  @R40H-M P@㇑L  oAoЍ0H- MP @@`P  `*` D*Dv p L   `*` D*Dx@ @ 7PE Ѝ0H-MP @[ !P@PL 0- 9  @ @`  'Ѝ0"E 0]  @!@P@P!- @!@Ѝ0p@-Mv@"@^P  @XP   @RP  @LP +@?+@+0@ P 0``7L `{ p Ѝp   @&4p@-M@P1/ !@ KP  @\P U ` "P@QBF #@@P Q " @ЍpK-M@P PP(p pP` @$ A]8(L p? Pb /P @p m @pI "@Q !@eI "@)% #PJ  ` @V0  @ 0SR2 R $@F3 PLL pm @TT  P @3 @ @ QRR TG P  @ <L  @{7! "@!@ mP& y ㏔ t P @ @ p@P`! RQ9  `V UP:Ѝ蟞L  @$3 @ @3`  @3< @/$  @3@-mPO+@@@L@f  @2 H)@0  @&K@-M@* @=P+@? ?@ Ѝ '% ? @ @"0@ᮎp@-(MP`gP2 4 @ @P +@P  @$ A8 (LpQP4  @ 㨾P +@(Ѝpn  @ 2L  @2> [% @ @2`  @2H-@v"@P! o@+`@pPP P@pO%  @  % 2 @ @#0@/0H-M@PI @0PA2p@-M@o  @GP" @PxP o@+`@ P+@Puq&  @Ѝp % 2 @ @#0@p@-M@9  @P @PPB~P o@+`@ P+@Pu q&  @ꇏЍpA-@   @P ܏@+@pPLP P@Pp `b % 2 @ @#0@2ግ,! @VH-`P F@Pp 0p @AH-M`P p@ P 0P ^P  0p ` P    ЍH- P Q   Q 1/pK-M`(P ( pᵇP@p:ގ"Q P ՎЍ UPƎ"P , 0 qp ` 걎 O-MAT$' Q P Q PP#H #@CPPHp孍UpPW Wf Wh W ~PЍW W}P B#@ Rэ$@PPQ /jP( P $0 @0( DP,pP `P$P( [ ᫚P (QJ VH( ( 0׆`P$Q? 9`_P`7Qp0 :R Ru a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0@xP:iPP `V  s Q QPP:ˍ"P UW U3>P- 0 @?P3Q0 !P-P* P(  R$ %PP !` CRp P`VPP@``P pP ṅ$@P `oV  0pP PP `P P@RT  RP U P 5 T& @ @0`/ @ @T&  @/A-PU `@pP:!KP  0p `  O-M- MPPU͊J @pP%  0`X6/P' P)P `半1 aP D  ͊ XP  0}pPPU[ [ Wꯌ P hP D墌 ЍЍp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V @pQ P 0P -PP P `VNKЍ @(@Q QQ Q R-0aaaaaa `sP P0 0  0p 4  `  @T.p@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`pP !  @p`$@ H-`P@pyP  p @PB @0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P QpvU P `PUP QpZA-p@(`P P @ @p =PA-MpP,`P @$ ( ! $ @ 0 Pp@ЍO- M0Y$ P 8BP J 4Q44 Q Q((8YP Ѝ`P$P Q(`O- M@40PP*U( `@p HL 0[*  0@  4/PFPYU@A  ꢊ@ 40 B| |LB! 0 [#*U! @Ap  0`6/P@ LD 0[ *PU, D,L 400 ЍK-R P@`V`V p6/y P@T p@-@`PP pP V  <P PT  ' PpG-FM @ @x P @~U`P   @ @`  @(P R" pF` Ppp 0ppPƘ )JH @p @JFߍ  @0,0H-O+@@)@syO@+@@@o_h+P@@k}0HK-NMMP@+@`pF)e(aшKL XW `p/ ) + P*(p) 4`"~ 14`JO ~) 0P ,*0* 0Q,U1   @  @Nߍۍ 7)@0  @CH-I H4p  @+p@-^@)P@`,`@P p T p OT@ |p@@pO-Mp@(Q0 0X ! ) @ xQxAo@X; `xPW \P6Z  )@   % V1* ! ) @  W B V)*@0 H )@W@0@@`X `I @@p PFP@P` @| @H@Ѝp@-P@QU 0P  )@xQ  )@ 000  @UP ' e @@UQ p@!@Up9`!`@PUpp@- M `P 0 BP B P$P `@P`@Q@JV:Q `ᇇ  R@P P`  ᘀWP ЍpH-p@Pp `>P  ' H衼  @*L  @*H-M pP`@J @ЍO-MMMPi Ppg `KGpe @F. ; , @$p@XpYI @ἃP= P9 pp , L $Ip! !@ !P  +@ 0/o004"  3 X|P3P 3 !@  @ @%Y,cMߍۍH @ @ @'  @*H-M`@>p pP㸆 y pp  L p Aꁇ@+P #@)w@1P r/PtЍ @H-/+ @ R @HsA-Q P`p@P PP`V@- M  @p  @P 9 Hq%  @)  Ѝ ( @ @v)@- M  @mp+   @ጷP   :P  @᫵P 9 Hq%  @H) Ѝ T( @ @;)0H-@0,@@)@u{@8,@@@qP,P@@m0H@-M@ p QP t( P @^ @ @ Ѝ #)@0{  @3AH-P`@PM @P   @p`P )@U1  @(:L Ep@-M@  @MP  HpЍ  @( - ? @ @"0@Nዄ@-M "@@P  lpЍ  @( , ? @ @"0@Ml@-M  @@ҴP IMpЍ  @~( , ? @ @"0@AM@-(MP@  0 A  By "@p L p(Ѝ~  @R(b t, @ @B(0H- My @@ᕴP Y PHp  p Ѝ0R  @+( t- ? @ @"0@q3  @(K-M @<pp v` `Hp\PXC P k @Hf#E|P@ K  @ lPXp )@ :Q0@\Bv@#p@0 :P3 @` TP T  @' 0@$P AAqX\PH 8H q  @'Eݍ% 8- @ @' 0@-0M  @0@ap P  Hp0Ѝ  @w' , @ @  @c'p@- @,@@)@P`)@0@,@@@8P(,P@@@`,,`@@p@O-M-MXP@Pϊ$ P8(LxP{p` h` dp@ⰰ ϊ 4P  PPLϊ ϊ NPPyp !R* @yVpL+  Dp P @+@P @ .p P @+@P @  p ) Q @x+@P @oI p ) Q @`+@P @WP4 y A8pL  J IpP  Lp^  @8PS  @1Q @-PJ` ᐋ(f@px ĀXQ@ppP1 )0@0   :R P C  @mjP  @pCm P `@U ,KqPEoP3 !@ @PL mp( , Lfp! @ @ q_P w1 @Q ; @ xQ ' @ލЍ @^  @% 0/ )@0D  @ >H-M P0 CHpЍ  @%H-8MP  A( A8Hp8Ѝ  @%O-UMM8 L@p+ ] " |op&P [PJ+PJnP PiP +PZR @ @~,8 @y P?n A0Lapڴ(Z:@ p!0(  P .PP`@pG'Wʹ 9 ) @ 0@h "@ @09  u{ `@ @ 0@  p@((Z:XV  n⬁@ P@ @(@!0!     30AS9Q 9Qg)  00  0d#A, ,L",@Q  0ppS0Q H,@p@ H0,@EPPP0IPPHPcP,@PCPPPP P SP @P@BP0PA P  0 p (@ l" 4` `Z @+p@. 4,!)PPaT̍P 0 @p 3 @ @0=1Pe*P8 0P>/ . !@ @@0P ^ @)c @#`D@ pT j 㘕 P @"@ ˶PEp @UaF଑@@FPU% o ` @/ @P P /"@P* @* @* @!" @ "@`F@ @VK@[:t @>+p@2Pm P@T:@P/  !@ @P ^ @Nc @ D pP fjJ U  `@ @@"P@,9 Kp[@,II@P Z ,o ` P@ @㬑@$  @P !@P "@P* @* @!" @ "@p`F@ @V,K$@Q'  P @ @@/ !@Wk < T!@ `@ @  P!@ 0  EB@T#@>㬑@XV k P@ `@5P  @7P    @0 C @`" J@@TPUUP W @0 @M @ @TP>P ` @P  @Q PB@QND(4@LXdp|C @T:@PP2 P / $ !@ @P   @|Py )  @s@Qi ! @眑* @bP^ PY @[㬑@{P*/ $ !@ @PQ  @`[@!P@ 0p"" 0  pr@T>3P `+p@㬑@,3 @%8 @"N @X @` @h @p @z @ @ @ @ @ @ @ JZ 4`0J`'ZP*3Q  , f6/O3s2"0r R 00 , C,L%"^#Aq, !ɠW%#Q:A, A,L"KUߍ؍  @5"l  @0"@- M P@ 0 C@@@!H @Aspa @+@ ЍO-MY ppS   A^Q0S  l3` V..@ЍO.r!@ ]3`W JP:PJ9@`!@  `V*E@UPH-`/ @!@Pr`<NpfoWpfU W `E9P!P@yoV `FpWP-4>H1 ` P"@/ @/ @+@` P"@/0 @/@-M  @@ၭP  WЍ , ? @ @"0@^}@-M  @@iP  ?Ѝ ', ? @ @"0@F}0H- MY PH@p H  @IP  qR @Y Ѝ03  @H! C, ? @ @"0@}O-dM`p @@ "@p0 @8`  @`(P b,p P < LNp <Q I @!`  @P )@@ @  a p@ P @ 0P@ p`R @ 0``H( @ B4 00,( (@ $P`n ?<@P P @<`N~ J~_][ X `T\T0\`0p H~Qh,@)@Q 1/dЍ` @ ᣲ) @P.A  @@ჲ #! @E1 8! P @ "@@ 0@A ჲ ဲA-hM:Ph,@(P 0P @ D@(@ 00p( @ @@P(  @T@} }u+p5 @Pd pJ P)p@o @ UMp PP8 P5(㫰}Q%P Q Q% ( } } @ 'MP( ~} z} @hЍ @PQ P PX@d`\XBd @SO  @@Pȱ` P @PX A.m @ @ @ P.C"@@=  @itRᷱ Mp@-M,Q, @P`A o``` `}QЍp@ Ѝ/H-l,@ R00@-@B @-8R{)@// Mp@-M@Q P`A?Q:|P"1QЍp@ Ѝ/ MH-M   ЍH Ѝ/@-Mh@,@P 0c/p @ @Ѝ@-@̯  @㘯㒯p p  @   @ MH-M    ЍH Ѝ/ MH-M    QЍH Ѝ/O-Mph Q \ @`@ P@0@ ~fPl@ Q! LСP xFP RPR? Ph ` gPf#Q  P P&  #Q  P c4P  P 9  P  @*p  [)@6 p,@P\ tp/I,p@㩓 P啳 !@@ @ @Up,@`P wPq q  P `XP PpGPG U*@Q @pP cP bP  XUp*^ GP*U8p{{    Pm{P! UZ*p@,@[p,@t,@XwP X Pp ZpP P  !]  @  6/ R Y@ @P啮W  0ᾮ;p3{PdPa RP `( `W H`L !(   -V  0ᓮ Q P 9p4ڸ qr +pp  @:Ѝ  @ . @"  @  )@uJ  @'  @/!@   @/!@0H-{z@ )@P  @Y  @ 05z  @ NH-M 0)@ -P  p,@R  0)@ -P t,@ЍM!@@@-P@@O tP ^  60S1 0@1 0@v1 0@0H-M  @0)@PЍuP 4Qqs0#4 S v 1 @ 0@ Q 011 0@0/H-P P&@ #Q \:v 1 @ 0@\01P Qq0 0 S:v1  0@ @ ^14 0@ Q 011 0@0H-P0S\ v 1 @ 0@\01 0@0P S \ :v1  0@ @\1 @/@-P@O0$S@q Q : @ @v @P   #Q\ :v 1 @ 0@\011 0@0/P   #Q\ :v 1 @ 0@\011 0@0/O-qMMpdV \ ` @` P@0@ 0@ acPd@P紭ddddddddd$dddHx,@&AP 0 aP# 0@@|,@@@ 0P BZ  0pz  )@GPY Pj PoY dP w ㉑ P`p@ @ @`(tP  tP  tP P  "@P P4 @otPP(N   P+ 0  000 000P` P `Z @,P l !@Z'}2PAU C`P`P 9`P`P p @tP  @tP  @ tPp @tP U =P(8P( pP ` U +`P(%`P( ȀpP  P @ sP p P`  |P   A   ~(P @PPl( P(P@T`gϪpp$wP}'P++/kPPajP q Qr'P㪪pp, Pz,P@D P e(D ᩪPy 5jPaP:a@P !P @QᒪPP` U @ 4 0 0`qߍۍq  @3/ !@  @v @  @ @   @0H-MP0@U   @ ERЍ0H-M!w   )@ @0pG-P@pnQoQ Pp1B#@P B@#@nQ`oQ ``P @PK-MPPp`DȜrP rP p`VЍO-AMM  p@0P $ ,(IQ $uT  @,TJ $f  @MPPP/P@ 0 PC `?P) @P9 `ȼW P@p dȀZ ^PY  UPW @TP p v @3$ @$ $@7Pp 5$!@   $@ $ @  $"@`f `@ZN ;pᨠ@P  @ P $LK @P P' @.! @B 0!JH  @$L fs@( TB45 B#@` HP. Buゾ@p@P#@ @EWT`PP -P =AbI@T pA @Pppp P`4|,@`x,@o 0S0P X @w VD `p"@@pV [ (tp^ @7#pJ @P $ P [P- , 8i剨 u^[`F( Pc bP(`FP YPVP(  MP[ )@Xq Dp P PQdV!@$ P FD\ @`Aߍۍ/QP#`[P :p ^|`,@P ;  @ 0# @p/  @P  !@Py[ ( , ʨpq @b0 >O f @`^ B~"0@"@@ @ pHtP  F0StPB @09>O-,MM`ᨀp@ @ 0P䚿 !@OX|U!@,@6 < $(`e @"`@@p Q Q Z PU f P:U 0- E!@ @  Z  @0(`$@pP  Z  @6P / !@ !@vPI ' Z  @lP> Z/ !@ X`Php^  @X  @RP7  0@,0 0  @ FP ,P , GP, 2 @/N"@,Ѝۍ'!@ @Z/ !@,ЍۍO0H-Q  Q @PoP QP,@ P,@0p@-@P5 nQoQ2 cP# P ,R RP @P,?GPP ``,7GPP $@" @᱿@pP,@ 0H-P@=0H-MM @  P0 $(Z@00pO  0 @ @ @+ | @>FO-Mp`P@rT 0@ \   )@P5\ |‰ P@0@  mTPe@ Q$lhhhhh h(hhPGP MP4xUPgt T  0 @PI p  )@FQ: `V X  X  V `p!|ZYppp Y4tZ8xV V Ѝ D  @ !@ H-r  )@ @j0H-MP @0 RQ pЍ0  @ 0@-@DP/ @@@-@P"@@@-M @Q QpЍ   @ 0H-P@\,P /P05  @N  @0H   @ 0H-P@0H-M @ P0 ) ~ "@0˥p !rP P  4  @ @R @ r (J 0 @[O-MP,p  ()@r \ dm T 0@@ @0@ `@ oP 0P p  )@EQ A OD  @'H-q  )@^ @0H-P@+P /P05  @!N  @0H   @ 0H-P@40H-M P 0AN ( @ "@0,p qP P  4  @ @ @nqc J A> @O-MP,p  ()@r \ o T 0@@ @0@ `@ moP 06P *p  )@EQ A OD  @H- q  )@^ @Z0H-P@+P /P05  @N  @0H~   @ cH-0H-M@A 0P" t@0㔤p | @G#O-M,r (\ la @pP @0@ `@ oP 0P p  )@DQ @A +|$ЍOD  @ H- 3)@0  @0+0H-P@*P /P05  @N  @0H   @ 0H-P@0H-MA>@ P +$?@0 pO  0 @@ @$ @ ,<\!w @@[O-MPp @0Voxed \  `@0@ ILPg@Q!4444dt4444t9P GP9||||MP( UPw| |||  @0Pc ||  pp  )@QB0Z S  S Z `PY`[ p( [<pY@tZ(Z PP3$||Ѝ D  @ !@ H-Wo  )@ @70H-MP @ RQ pЍ0  @ 0@-@P/ @@@-@ƴP"@@@-M @Q QpЍ   @ ~0H-P@))P /P05  @㏾N  @0H芾   @ o0H-P@0G-JMM4P 00@ 0 l H!@0嗢plj4@Pp,@!`@nKPVP S QP0 P U0 0wp 2@G Pʎ' @8P  p< 0 04p@cP >gq @#<0  @`p @D L0 T T @Xp\`t@T$@p `JލڍO  0 @p@-@ ]P PP p@pXQ,P@`m`p$@O- Mp`H@0vm)@H f낸  @,@,@ j@P@A@7P Xh D\l|@<2PJ 3PQPe\ D0@h@ \ I0@^( \ R0@P)@ )@}\ a0@;8 s,@mi e\ g0@#P]4P Y@UQ\  0@ 0 @P P ,@   @B P  P  @ )@    @     $@!, @  C "@ $   @      @ $   @ <    @ 8    @ @    @ ,   @0 \ r0@X$\ t0@J, \ w0@= u\ x0@30kP bp  )@GQQ0`+e 4D  ЍD  @H-  @0H-M@ PQPЍ0  @ 0H-MSl : @ 0@  )@ @ Z: @ @ @ 0@ &0H-P@Z&P /P05  @N  @0H軻   @ H- RR%  @A-M`PPJ* VpPJ@@ RR0 % P 0pЍ%  @QH-M` Pp0@ 0@ӞQ 0:ЍK-M`p@PHp? 0 4pP< $0,@0p4O76oB048 AB<0<" A@`@Ih@~p P 1Q 2/R B R @ @kHЍ @H-BM@o^% 02/ 14 10>p p0@ 00 P okd[  @!@~fkH<Ͽ BߍA-MP@` p$Uk UP ,@2/R1QP5_U @4O:k@8k0g  @ @ HЍ2P(0/O-Mp 렆P `@@ p{P`DH @0@3/pBkP=p@wWP ` p@y+  @0 3/ qZ㋐r UP P YR*  @ @0j<ЍO-MP0`,@[ @.>P @:^Pt @0 PPP0 A,p Cl!@ 0JcP %c @ 壶` PB`t@ $T`P@pp P/   p8 i ]p P p! 0xb D 0tp PQ 1 U,@P,` P>jQ p @㬹P/,@Tt ,@Qyqp0 ,@UD ,@000  PߍO-M-MpPP$ A`T 0@0@ KH \ @ F0@ 0@00@ $ Ӛ) @ @ g@QoxxxxxLpxxxxmp  @ 0P @p @ sP u  @ lP Kpn  @ eE 0SPk@ e @ WE 0SPf@ ]I Z  p  )@EQ$A+@  ምp9 0<S p@ p(00Qp0 ЍЍ' U @D  @  z @ T @) @ @ k  @ e   @ h BH-h  )@  @:0H-8MMNA. 0P$ ( @0᎜p4 @-  @P@ @ @(埮P  @(( @0,巬P   @,( @00 @8Ѝۍ0  @ 0H-P@?0H--M  @0@EP  y   Ѝ  @ 0H-MP @ RQ pЍ0  @ 0 @-@+P/ @@@-@P"@@@-M @Q QpЍ   @  0H-P@C"P /P05  @㩷N  @0H褷   @  O-LMP8@H  08@C E$S4<CE(SH89柅ⲏ9D, !2/!A4q"X32/\c3?s6o7"X3\cs0  ??h  p  p , p $ 0p (0X$2/X$\ 13?1 Br4 0Ѐ1 ŕ$5<Ͽ(u3?,e7 6o ń$5(u,e@ 8p < Hp {D`H%L52/Pu3?7H%L5PuT0TX0X\0\LЍ0H-@P` [!V!Q0A-P <$`6o P<Ͽ2/3?> ( 0( 0 $`dp `` 012/3?7dhl p0tppI-PP@3?<Ͽ> /`o `P!""D`6oD`#@`6o@`#H`6oH`L`XLL02/3?6o8<\1L` X`\p `` @p_8+ ` @8+p0"S/"!0 R3?0/O-M0`10$0$(0(, 02/,10q0  2/40419q? p 71 p13?1 R\ET AT LpQ \TpXP75_012/:\p`0t1ptl0d 3?x 2/TpXPhl0x YU @Y :5_7$P  13?1 $5R\ET AT5 0S  13?1 0RPP$ 0P?0T T0pa6oa`@P`@VO@p W,S0ЍP  QO'b` 0 p p/K-M`L RppBDP=P+^PU  QO'b`0@U 3?4O02/ !q p ^0@ p R  R OpUO ۍK-Mp,(@ p@QpPp  P"X`d VLB Dl# 5_ P+ |P PO'a` 0 p Ѝ Q 0P #:r/ Q 0P #:r/O-MM⸲p[/,@@x"e  @Я뼂P,@ PP  @`PpGPP1 a @Q `@`840,( 4B@4Q D D D  D T D D D D   D D D  D d D D D D D D D D D  D PD  T  D D D ,  l D  D ,8 \ 0@!@@`P @`P \ 0@@APe m\ !0@   @0p,@\A 0@@ @8P \ !0@   @0U,@g\ 0@@P? ")@, @0wP k h\ !0@   @03,@E\ (0@ * @0#,@5\ 0@,@/4 >\ (0@  "@0 ,@\ c 0@   @0 )@ \ 0@"@@_P / @_PB,@ ,@ q l\ 0@@P ЧP \ !0@   @0,@\ !0@   @0()@ >)@0a @@r,@@ \ 0@@"@_P,@@ @0 )@ 0 \  0@   @0k \A 0@@(02 @,[,@@ | \ !0@   @0F,@X\ :0@@,@@6Pf/6PaP ,@W\ 0@!y00 @ 1", @ A )@o ~w, 4#"@_P. $@_P,@',@" W @0$)@ ,@ )@f Iw( ,@ Q @apI  )@)@@P#ʴ,@P  @M C @  @C @>D  @B- @-' @*pPt[oQa뤢,@B AG@P' T@P# Lj!2"@ @ 0@  @ @  x [? @Gp0  @zaap* PR,P@P T0B,@,@@ p R!b pn @@ pt @|z P"z?!@ B p,@@$ z⇖pDpxP!,@@*@z P", @;PJpz↖p( @", @|b,@,`@ ?g\@P@[ot"  pz apb @v", @ ?I\@P,@@t @@ P  P *  @0-Y$p<4P$pJBR,@@,P@ $RQ! ʰ,@P`,@, zPp}yP+pP*(p,@R x  P&: @P$S,@ ?!#$6p,@0 @ $@&p K @Z,@$P,@ Up$#_ @BLP P_ @ pt`",@, @ b7 'P y @ 0PU$@V U   `Vp V *p\+ Qʰ,@Pb,`@P  R @+㈰P  Q* @~b,`@PP,@[oQ )@PʜR,P@P U`% @ @ @0X,@Q#) @0 R01, ( 80F@w W ēy PU B!SP @p4  @_ %0B @d4(㢓㠓㞓"@j,@,@&, @ p @ Btx [? @)p`%B @d0 v4@pfs@ȀB_<`u %p1 "\PZ ,P P  /p% P<PP >B/0 @pPPr @ @ B/ @X\ @@  @ PT)`[Y p OK  @PrG@[Pz  [Pu `F[Vy pPPp异㸲㤢[o,@,@,@B,@@ ?R ,@  kpt @", @',@6 Q,0@RQʕ @ @PPs  @ @ @ aP ,@ 0Q,@Qf[os@ PK  "1 @, @0@" @, @ 0[oP[o4  "1 @, @0@A-R,P@@N_TJ )@@1[; @ 0@* @&@h  @ 0p僁`@P @P` pPW|O-$M p4_` ` ح @Pp0S$ P PaSKC P 0 t  t t t t t 0  kC P0 t  t t t t t 0  \PBSP GSbSP gS V @0C(P`\ ` h^ 0Xx 4 hpScQ7VQSVQ"R. ! *@PW ,@P-  @ p` /HL Q ", @ R!  @ p`$Ѝ y0 @7 @ 0 @p` p @`  0O-M-]MM1ᣒ,@,@P? ,@P:,@,@T 2 `AP@` 0P P`p p 0P P`wp ヒD 0epp Wp  㯲fP,`@| @C] 㤲P,@q 9],@2)@,@,0@P 0P o %x ,< (%(,$()@)@Q ~  @,@Pe @P   @,@P[ @R,P@,@ B0 4  @,@P1 @4A   @,@P' @4,@ Q-  @,@P @0 Q [ * @,@P @0Q چ ( @,@P @04 Q  @,@P ,@@TU3UE3CD @ @ P*0\PB\C0\@,@PXPYU,@ XQ  @bX80PP$0 4`@BRFPfLP_ȟpbHpP@0pS0PVT0QTR@P`@80pS0 P`1  @,@P ,@4`a  0Pp8p,@ϊ`V @ TX @ 3㰁,@Ѐ pdY4 TQ?Q8T'QQY!Q )@TYAd@Q3R:E  @,@PA ,@,@48$`<4 0pT @1<0\@'D00LPx |`!$ 0X 0p!( '᧑x 1\Uta F? V 0A0E HP? VE_( Ph`@F $   y9!@P R!1R@F,@@y  @\,@P ,@P x`8@bWP8<@P",@xpT` 8q0 0a2!# 0Q0#Q0Sr<8 # @P0^VPao 0A@ԁIP 0 0PP*!0CVPP0Aaq.W:`AWtP@0 $Q!1Q 0o.0!^ `Ñ!~1AQ1`  0R\b>B boQ"\#Q 0O.@0!.` ` 00 pP0pU0p0 AB0IQAPaqQ!ȁ!!! 0`iI PQY# W1I 0U!0B@0UW` p0KIPD\@@ !?>1``PTf_nQQ 1 0 `1 S@1 AR> U 0I@ \` 1aT܁/ !R!!܁P!!  @,@P,@p @8<$x`I`p!善e0VP18 X? $Um?H$U,0To`P`3p`)0@`0L S|尐4? @ 0@ @gV,`@p,P@ 4Y ,@p,@,@,@7,0@PpH74`,0@L 7 ,0@pp)@@u<VPD QTD!h A? ABXD@HE B`0 ,p B<4q 841 S!` 0PY2 `ɯQPYSQ@68@p@0U D0QP@SppD? Æ $O0܁PSSP0S4qP DTD40t)@Q H( p0 T,@㸢@,@P ^  FK P1A VQ dZ0 pa `Q 9w qSvQ @ ! P `0+SV,P@@ 8   !  +S,p  @`0,@  P07R,0@\%7,0@R| @P 0,@@ @P p,@g,`@,@P  0@ @P p,@ ,@X,@P{B,@@ r 70 @,@P  ,@0R", @ 묐`H @pJPE@T`VA ,@P !,@1L,@ .+0,@,`,@|>,@@ Q,@ L+0; P L#X,@ +0 @,@V.P/Q,@P @ PJ ,@ WP) @fP#aTiA, 0A/r"\uW A0 0d/ 0`13 0P#QSS. @,Z )P@z/PhD ", @0 QPPPSppGRpSq,@,@S T,@ `X\@p@8<$唦Ϡ\ P0QPPT AX !  @Vaȑ f,`@4 `@M TAX !/@ f,`@QF,@@TW EUR P@ P$aQq`0p)@P tx R !x  PJ,@P TX\`$%R?0,@Q@h$l` R/dP  @e,@P ,@  Pq W fP,`@U @ P`$P 0l)@QBdRU" @QTT! !U" @QPeXPeVd ! ! !:S@pRta!q! F,@@+SRf,`@8P Z:aUR P@ q0R\  /0 A ,@8@% @4  4  F,@8pV*@ 0Q"`P1 !`$$f,`@8pf,`@Pf`7 P`h$P 0l)@Q?dRQTT! !QPEXPETd ! ! !R`PQVa!UR P@! f,`@yRQF,@@8pPQ AT @,@44W* P`!p$W$:T @,@$Q+pQ( &p0P `  R $ER A@A @PTp@p`pUF,@@:fR,`@ $5R 101 7',0@, @ a AQ.,@Q W4 ,P@s  @dF,@,@@Px pW,P@w4 ,p@d0 ', @41U0P   UZDN,@P  G0x S00# !T P`\uWl`P\@T,@ a/6'\%1T9AR !0p`'d, @P0 p` 5w pPSQNܡ,@P\PV`x 82PPN`,@0p @a G,@F,@@ `lP`Pa,@AT@AATIA&6#\Q @ 0`08d  h `X9"HFQPܡ V 0SapVB,@@P ,@,@ȑa\ȑ P,@,@a,@PS YJ.IYBk!Y!`@\uƒ2#I "@aTiAW P`p0pd ? p`2w0 pP7QWS! O @* PaP, ,@PF `,Vu:Y ,@PK T,@)@ R P  0 0AP; `I ;A6ш)@ RA<,)@)@ G@!P4Q@`PLP `@D5Lp0? d?`A㝈 | `_p`l  A,)@GE  @*@E @UP!4@'!  ,@@5DuL`0pdP04k4qa`0 0e03 0UQS4 <  0p 09SY` pp@ h 9P,@0 ,AB,@@ 00aqp`X `p !@TP` ALX 0X4 0 XPX#,Qp `pTI @@,@`R,@\%R+!?0OQ? 9d\Tt0` X P tPLf @DuL / 幇L d9!1+ Qo` A;*A0 AtC!4 @ @DuL +4 p儇ld @ b4 RQS <a O 0CAc`p@#P ,@PP,@40)@Q?.; b*c "A4 ,@@A*P`V.fKVDVFR,@P P,@P8A\,@` PJ 'R,@ ?WM 0F,@,@@P 4 5F0,@@dpHd g4 L6 WQSr 0,@P,@P 4 0w,p@4 dV,@4(KЍ!@v @`&%( 'X @p @ p@-M@,@P"`,@P ,@,@  N@P,@Ā",@$! PЍpBR71 @ 0Q$xM-MM@,@PZTX $,@pW 7,@,0@0 42'pЂ ,@P,@ P=,@T P*0/ @ q`V 7Q  QW_`M `F,@p 0KMi*0`KH-M@,@`P ,@P! P'p,@$%,@ T! aP Q埥  @ 0",@,@ !?Ѝ`0S  L @L \L xL 0/ )@ @ J0B0B/01//p@-`,@KPPBP)@PC/DBpO-MV,P@F,@@0d` p f7 VQSc,@P vU @ QRQU QM * ,@ 0P) @ S` `` o b @R9rUqŏQUtQR@N XN xN N `@1 4G``@Q,`aQ%Q ! @,@,@8 _Y0z @* @T @^P Ѝ S`,@R dO O O O  0 @w G 0G !0F,@@`$P0l a>Gp `@', @  @P@  ?  0 )@PLd ` 0P9QS?J QTT! B! QPuXPuW&d 0P  ` 9QS?J먠 (b 0? ,@qJ !?lJA0 P; 4p8@ 0 H  8 A ? $ $8A4  4 ,@`8P `?@>p T`@`A0o~ B0"  &, @`8 P,@P  ,@`dp g 00o `WQSHO- M,@F,@@`0dP p e7 UQS,@P UrP p@ Q z @d],@P Ao"R \ A !. 0P 0dP p e7 UQS@', @ P@,Z : @0_,@P @؋ 0 )=y?`#"1T9A)%\%R !`Ž?#p2!P`xTJ0 d`@ 0d `T036QSp 0k g0s,`@ [0QS :FT),@@ @\Q(x 0p<,@SQG `(!1pG2/ w( X `1qA3? qX0/x 0<,@TQ% @p`p!p`X`p@!p@W   Fl ,FF `,@@P 00 ЍO" p@-cP)`@@P F,@P 0PppO-M@R PPV @ ꨠ D &|P pP e D ᬂpf (0 c0< C0 $ D8(% @㕕Pp `P @ @ E F| @} @| @ | @ |hP ȌpY? z D ep8e D ^p4 M0p) 0( PU!*`VU  0 MP m @@0 *@@  ߍ @ K-8MM8 P;pP`p @0 P9pᤀW ` 2!8Ѝۍ0H-P@P /P05  @N  @0H   @ O-M(`@,P 0];V` 0pV;P @h`0P " Z ]P`pUЍA-M`p@kL,E( P ^ ( FKpwP 9w:0HPZ0 P@P(PPP PPP0P4P8P @!* ၼ  A,@@0 P,@UP sF8,@PH,@ r<R,@ 0i P `@pG!Q! pW 4G,@@P  @TP X.,@ @  Z )P@4 PhDn{48',@Q, @PP0P S@RSH  B Xk[,`@9 X@,@@P$$,P.LPd +庵 ,@X,@orE ?XX ,@,@&X,@0Xk#,`@>< 0,@ +%A!, @0 @%Bt (E@ P  +" @R*1p71 A E *PP:Pp p PW:P U:0 0( 8(p EV EE[  P0  0  rE(P P$P pᗐ$3$pdW:0 0 &(PU:4,@P1,P[@p LPdQ P(8,@Pg PU_.EUPPW[3:[` P, Q R) !b P Q RO@,P? U I "@ !@O @PP*4,@P"  8,@P[:[ P Q R !b P Q R 㖺P0[U ㍺8,@PLP \ DO zP y q" W!pq  d0 P808pl! CH0 C(0 CppXqP\ Fv᧋P$ 0@塋P VGU $D<U*0 UQ*  6$ Sd( ,p':Pw U Q:QP YX h PYXRH* @ Xk,`@Q 0PR*A:D, 0v <G(P0U0*!!U:$' @ @m0 @us 3Q 5B02V@@%P %P@0@},AU1P\  0p'U*$AC ʐ$P  0  0ALP ` x )@x )@`pV@C ` y V `#P p l h dx&ẗ|)P V0p :,pPFX ,@P PUXK㘡,@@,@& 07刜)@V㴰 :,pF `PV1~C  < 0  㴰X pⴰfH` 0F0bCLpP`Mx`)@@PPdPplh7xG|됁P,@ 1&,0@@` 0唑,@Eo@+bUC<&0#=<<,@(? 0%C01xiߍ`)@!@,b @' @3 @ @X @)6 @ #^ @  @% @ ; @ 8   @ E @ d) @ @0d) @ @0 @ @ @v @ @u @ @  @ @ @ @1 @@-X,@L(ƞP d Q:Q0 @S RT 0Ad!SRT\  H-MP8,@P<p,@`T ,@%G!  ћPЍ?_) @ @uG-M@8,@PU TSQ-P@pWXk,`@pp<,@P$>`H,@V8X ,,@,@P P+0+L @ q`V 7Q  QW@> D,@0ۍG=+0~ۍH-MP<,@p`P ,@%G!  UPЍ& @ @G-X ,@a,`@p AW @ a p,`@P @  :PUB@D`Rq@ : K-X,@`0FQR vWO:ገPK P 0@  T 0 Q0pW S Q @pa0 pW)`! 0F'6&00 A0 @ `, @# @UO-MX@,@Vp+P| W@%:( =@0Qu   0`&q06&0 00A@(`WN*@W P0/p&!& $&T0f?/#0( 0 hx0" X pSQ $&?/T@)@ᒐ(L%P 9 P ((||||||k& d 0@ ЍOs @ @  @ A @( @O-M@R PPV @ ꨠ D oP pP e D upf (0 c0< C0 $ D8(% @ㆈPp `P @ @ E Fo @o @o @ o @ ohP pY? z D Vup8e D Oup4 @!up) 0( PU!*`GU  0 @P m @10 *@@  |ߍ @ K-8MM8 P;pPx`p @0 P9psW ` 2!8ЍۍO-MMAn@Ph0@0@/\ 70@ 0@ yD4\ o>0@0@/l\ p0@p@tp `\ =0@ 0@ T@~\ =0@ 0@ JHt\ >0@ 0@ @Wj\ $>0@ 0@ 6pXp]\ 0@X\ 0@ @ O\ 0@S(I\ =0@ 0@/?\ 0@L:\ =0@ 0@/0\ 30@!0@/&\ r30@!0@/\ 3>0@ 0@/\ =0@ 0@ p,p\ 0@0\ 0@8\ >0@ 0@ pVp\ 30@ 0@ `V? Sp`'&H?`pP B?| `|P3 P0p2?P+`p%  )@Q*Q/@P  @@D.; @ 0@;.@P A.xЍۍ| @ V[H-MPp> ᘍ@`>P?V=JP5 Q6G@ Qg@ P0H X h x H X h x $aO $kE $fJkDЍJ @ 0U @H-@`pP> P  VJ @ 0H-j>  )@@n @I @ 0 y[P` p@!P@!p08`FvᦱO-M@R PPV @ ꨠ D lP pP e D rpf (0 c0< C0 $ D8(% @㏅Pp `P @ @ E Fl @l @l @ l @ lhP |pY? z D _rp8e D Xrp4 =*rp) 0( PU!*`PU  0 =P m @:0 *@@  ߍ @ K-8MM8 P;pP`p @0 P9ppW ` 2!8ЍۍO-M-MM`P0FpxQlp'q#$dP{`(@t{ppdp1#upo`oo4PrQbpb`oo@bpP``oobp00U53sU5E3sC00E`#10@d#2`0qq@p#<0$0⃀pqppQtpp\0o`04r0pJppH0p}|0ppG003pp0p80 100tpXp00\p ph00< 02R  1 p夀U PT / P*P $aYi/AKop !1!5 @ oP 0A5 $aop J @/qPYA0A_P P @ ㍳P Q耍[ rPXv@  @uP``DoY8PN T8PI pPUXv@p耝$a0  @oX    04+$WPU k@ `@+8P D@T"LHD804X`P)0L PX 4 R$ H(R`D QPQ`88S<@,0P $A/ (0P@0S  )@000D B0SR @D@yT`QU HPDP @LaQ:`PPV?p耍P @☠蠝$?  gp t04w8@  %pp@ p/ KᘠUY: Y P?*H?W?p#PWHp2 DPX7 XDC*pV耝@  05`DP p P P  P *1%?SP0:W QT` P`@V !P S!@ *P` V`V_ T\0㘠saP:a !PȰ P pP pPpPp吐 !PȰkpP ipPB P wX @PP@PP@P P?*Q@:QD `?6 P   1P Q P *P@P PX@PPP[B /YP @ M#! @ 0*@PT mp J`.oP0,@  P  q@0  57'!0T T  aQX@ P p `,\pq(`吐<P PTP嘠 QN Z꘰ P a[ W@5TB@5`W 5pᙵ!/ TQ 3f:XTPPq<b @ `5P5@W z5!/TP U<D: @Q P P P`` Q` T X T V@X T V TZ@ Z:  P) ^!~@ ;5 [P 35 P X TPq<ZPX  Zh: R"[ P X @5`W' p@T @5pT TWP @"! @4   $ U:pW:YP*$ ࠐ0 Y ! U : +` a耍q E@?0!!P "Q p@P0 0{'qPU UX U@4Y p 0!@ ^'@@GY㐱+T @4`P`Zk:U?? U0Vi*Y p@PLQ夀 PHP Q!@ᾈ @$师[!@Gd!@v @/  !@:!@!@3!@㑦!@,(,!@)!@%$ !@ 0ገ/ !@{!@,!@ x!@ !@!@7!@!@j @|P0$xplP4pVU U @!@+!@O!@!@{#!@L!@r!@0= 0@!@ VPP`P``R`0!@P `ǭT$0 QP #S!  @ 8  P3Z8 W p RT; R6TP4 !@ A!@!@TN!@!@.!@ @-!@o. @(!@ f!@!@ڇߍۍЍ!@- @ S !@i 0!@ bXQ !@\TPQ !@U!@QT !@KHD !@ 0EU +!@?T|A48 !@5E!@2JyW $@@o P@Q(L!@%Q@TP LQd )lX \C \X``\  @$p~Pt  @u7< `Q 1 W`S0 !085 0@` aQ09!@Y 0W00T@VAQ `$pFo,r P c /oL0"d 4 &$`8 ,x ( t p ,l ( d `% %%| , (  D H   X    \z@PA\  )@-@Pd Ay2!@$! 0@-@ @pP  @Z3@Z <T3P  Q ( jp PTP   ;6XZ@ $P /P Z$#"!|DH   $ PP` @321x/t.p-8,(l'd&`%0p$p)Ph`gfF P`@h !l' 0)@ PU `0P P`%`PP@ B rMP0l!! @ 0pW p@pQ`TPP\p 0S 00P @T .U WA Z:Z* J2QL ZP  )@0S 0 0 0p#p00KA q0 (0 00?O$(@ 1@T. Z P 4ZU @rAFRaDnLPi: *a/!`%>r#h"""B{"Bp@{"B""p@{p{*c!`r#h"2"B;"Bp@0@;"B""0@;0;*b!`r#h"""B+"B0@  @+"B""  @+  +*a`ph  " "  @ @ " @@Q A  Rhp P  Z+$!@/ $eA$!@/ ,^ ,!@ )  -@/O-M-MpD`C xip-@ oip-@d!@Hhpy!@㔢hhp!@帻F\ 8!@@0@ 6C@4Q(  T |  0 ̿ 8 h @ ` l t -@<My<-@ P9@ 4\ -@0@  !!@- @\Q <0P@ I<PzڼZ -@-@m  )@@8 }-@\Q <0P@ %<QPڬ-@>\Q <0P@x<-@ P@  ` U-@{@\ 0@-@\Q <0P@ w<P X 9:\Q <0P@ <Qp-@ '-@K-@F-@A-@<-@7-@2-@@0+\ -@0@ + !] @- @0 \Q <0P@ 坡<QPPC -@-@ 4!@=pSA-@@-@ @ Pm a  P =gPp a Z5gPr-@P-gPo Q@P0 AP ` x.@@ .@ `  PP A-@@P[!@ -@ Q8! QJ  G)@PG  !@' R!@#n!@ !@ !@+S!@`RMb@A !@ !@{Gz?eA !@!@5!@!@!@GQa 2 -`@!@-0@ 0PPZP  f-@ @-@@!z8-@[Z``Z` P-@P@s-@@-p@`ByP-@!@ `@  V) -@D``Z!A-@@0S )@X #!@ V =r-@0J.@-f D0wB@kKv"P"\P A #-@@ap. @-`@ D0 fp!@!Q-P@ D0 fp!@ D0 fp!@ D0 fp!@PC-@.@@(.@   0 '  !- @0  0 (  'c TS-@.P@@((<.@*D0p pkfp!@!- @A-@@  -@CPp )0U"  p   0 p  0 =fpK!@ )@ 00 * 00SQ# !Q!H@ 8 400 (,00 0`,Pb 0 `PbB]0 @!@(0P4 @!@(0P* @!@(0uP  @!@ p 4!@%!@ @#P.@I /10y!@$!@2!@W!@ߡ h!@.@ס@pp Y:Q Q Q$W !@㿡pQ Q@PIT** P pI@WT@T"* p W,x H 0  p p !@㊡mW*D@f [!@A`D.@V.@ PZ .@ `.@$xc [.`@ !@& !@ !@YjIp T6:@`P@`XXX u U@DI T :KI T* p p`P@`XXX S 3@DI TIYK xc[.`@ !@DH W `P@` XX "묁㘣-@.@X $X⬁㘣-@.@.@S.P@pPqP-@  j@M ` R P` $1 A. @  B* 0 hH.@-) @@.@xc.`@+ p+!xb P.@ C)@CM.@ `Ͷ @/0 RU P,. @.@ T.@Ww ,@d H 0  p T.@ BP (PT .@PX-@ T.@ !@IT .@P E-@ 7R !@O9 !@Ln !@E !@B !@?p !@= !@6 !@3 !@03 !@-M !@*c !@'z !@$ !@! !@ !@ !@T .@' !@PUp  )@@ODqPU!- @  p Dqp0w !@-@KU S)@S@Q-@P, H 0  p p-@p QX-@S -@-@` G@DfPC #WP- @ PDPPWPZ,償 H 0  p  #-@- @`0ED !@㏟xc-@pP-@.`@U;!@ @{P-@xc.`@ p|!@!@A-@I*s.p@j )`@Q#. @.@P0P.P`p P0@P`0X X PX.pQ q#. @.@P0PPC`p P0@P`0X X PXOpT C.@@P `P@`XX X 5.@Xx.@ `.@ @)@-@o)D.@P@  K--@@`pu먑-@) !@ 0(P͞X 6 !@Ȟ< !@Ğ@  D h!@0+S춞  X )@Ky@@A--0M@<T R !@-@㙞Co .@@!@哞S .P@!@卞Pl.`@Q !@ㅞP P !@| @ ` !@ 0+So 3Qr q"-p@ @k   @.@* R +`H.@+`;Kq+t++ )@ R;.@ `;c3+SK  ;d!@b; 6; .@H  0$. @P` 2 B* 1 A졛0.@  X,. @P`  B* 1 A졋0@ !@@ +`` 0+S0ЍY@@@eA-C6?H-M0P0 h.@!@. !@ڝЍH-@-@,#.@. @ 0#Jc0.`@  .@Rr  B* 1 A pa  a .@P@dtH<eA?333333?G-騑`-@P@p @( Q#<Q .@QW.@Z @ @Gh,!@. @dH-A`-@@p P\U U U 0/1!@ Q  I/r!@H8/pr 4!@0/1!@H"0H-M@-@ sP PZ h ! @.@0Ѝ0/)0h ! @.@Ѝ0HO-M@ r!@ Qᾐ`p5` b*!@ 0៖}!@ ڜ!@ 0Ԝ寜!@Μ婜t @ȜV: pPW *9@a!@@ỜV`FW:ЍO- M`p~'@-Qf@!@R#P .@ !@H#P .@R!P@@ ᙊl@Q T t t t t t t  t t $ dP .@P p  )@P- qWmm`` P``PZmW Pᐂp W@x[PZ T?`PlZlP`k  `@ .@Pf!@ z!@%z/ !@> ZY!@? .@P!@ z!@Y!@ zXy!@ zsc[!p@$`@!P@ ;{ 05{YrYF&C&@&=&:& 7&Yp!@Yp&PYHY tYp @T  jYps&P (!@ !@>!@u Ye!@̓`&@OYnp!@PMz 0"@ !@ 0\z@-.@K$@!@@Q@#&  )@!@0sO-MMP?` @pP!@P@@ .@㥆 @U-P t\ H]㼽!p@0@!@@.P@.@  ( MP!bBP4, p |   0Sn DR MRẛP/P.@ .@NR@ RR .@ AX-. @QP )@ .@ .@ .@ )@A 3-) @QP .@ .@} .@ykP  kPq!@ P @`bAP P- kP -rQ Z-@rP!@ !@ T!@e!@t9  )@@.@QtP.@ @$ PP$ @pF$P$J )@@0.@  @㝙cW p)@)qPOrPe tP xP Oĭ㤻@.@ @+T)P %` )@P ]& 0!pWC  .@P _ !@2!@ !@!@Z pRP[ iP  EQ@arq .@ .@RIP X0!@ !@} L .@P *X0!@  @0"@ DCc Z@ P@++(  0PpWOC!@@r% 5 ?P CX0!@ 4 .@P ZX0!@  @0"@p!@ Z   .@P .@P vX0!@  @0"@Q!@p,0H-#@ )@P !@᭙!@ ᨙD!@ ᣙ!@ យ!@ ᙙ O-MMN @ @  l @ ( @ $ @ "@ a``)@p!@.@``.@ J^P@ P LLh @.@@ d.@ P ,P xE.@@ Q/R;DT#ɊXbxuP!@.`@.p@  @/ A   r  Q J^P@B@P Q Q @ԌQ: `a*`.@! @ p/ ؀ >@" @. @@ 0[p2,J>P!@u u u#@L"@  pa!@`, a p!@`" !@ !@ !@ 0 J^P  ,@  P L屳a@QD`.@T  \     p       @    < l @H $@゙P+'P %@J .@ )@P 0$ @  0 a!@`?P.@c DPP4 !@SP].P@P : !@r@y $@@P& *PJ.!@-@ !@)PlPz!@ P @PV = .@P .@@@ !@P> !@' /!@7$U!@! @(t!@!0@,!@0!@4!@8!@<!@.!@N!@!@ p!@!@!@!@!@㻗O@};  @㷘P] P[ P .@P @.@ @1K .@PPD JN P P @ `P gP J^ `PO !@ %@ h@o( " @0P Plf o `\P` .@P @.@ @1 .@PP P"@3P !@-P PP\0  P h!@  +  `Ph P@b !@PJPL @@L "@6@& !@P/ wP @ߗP"].P@P)  !@ 0@`@/ !@ȗP T@1 "@㼗Pr  ᱖E !@ 0p> !@J{6H @, .N !@ 0Y$ؐ }M`J@ PP";  < !@ 0/sP` a`V!@.@c l@: 0@"hV`T0 L XPPH@0P ` S` ^ P0T 0003S@ PH 10Y :/oHL2/oP`PT"X@] .P@ "0$ 0S|@ QL LL4 Q0 Q  ' -pl'l 0@xQKQT@t@pPPx`xdpPm 㘶 .@Q x !@ŕ d PQ A  QC PA   ?PQ A  Q. P,   |P#* PtP*t@AP @PѸ ڰP@TpPX o[a`!@P.@ @P:@D ok`@0` (ЍۍK-P P& m}@.`@.p@.@@QQ Q  0B01z P hp.@0 0 p; 0H-P @P .@Q @". @0 A!2 .@QP @ P0G-"@`PP  @ P /P.. pPR* pz Q 0/S/Q Q P/R@P7 I@!@ P  B0QS/SrpD0.S `FQ 㗕P@@ET@EPP/Q@@y@ QAyPp #)@0  !@2ݑH- .@iPd.@P !@*#Pʑ`.@ A-@ R R  0k )@P!`@!@!R"R'Rp?oQQ2 QQop2S (R R R  \RpQ  " 0A-P@   pW ! .@) @`?0V`p`p 0`pW@.@ Q @.@ @1 _ P* ^ R                P /= #  )@!@⨓ @%A-Mp@.@B`-) @P 0  .@@)@P [$ ! @Q!@X=X!@ 0pvUPЍK-pM )@B@@.@` 0! &P .@iP .@PF 㐐)@P +! @d`P{Y  0 1 .@P,  )@!@X 3$Z P p P  0" P  0 PYT@pЍ@-@ B.@=)0@@0 1 P  R  T@O-M] .P@)@P X0!@  DrP.p@# @P X0!@ @P.@`A 1 0"   V@H.@P8:xX`@P.@.@!@ P$ pD.@E 0P V ዒP  $ppWP@U:ЍO- M@.@PBa @T6P `P !@ pVPpp z `P PP P`PV W aJ  .@P   )@(X!@)JP@0  P P PU" $ <" (" " ! # # \$ \$ T! ! T! ! T! ! ; )@.@ !@0W  QL!@@P * `V  )@!@ ёZu B .@pQ  .@Pi I|.@@I Dpppk!@ p!@@ )@X.@pQ I|.@@I DPPPK| NDFD@B!@ P@ )@ XWD z  0d @ZN.@pQ IP5 0 )@Y!@ Epxy  .@* !@Z 04 @ZLI!@pp\Zp .@PP @ 0 @.@pQ> ?f .@)@ X!@. C x  .@ 0`$ @ 0 @.@pQ 6 )@.@X L!@0ʐ Ѝ0H-PI|.@@I D  | NEAE@ t | NDFD@ i !@ @0^ !@ @0O-M .@P )@ X0E !@ GH.@P4: 㨽_)@X`@P.@!@PQP@U:@ E.@ 1 pW P P  LqZ px .@PU&  m_})@X@.`@!@!@ pW PP  sP  #H1 p$PUЍH- .@P  )@X0  !@xY.P@@T `p P $p$ `@TVx .@@T]!P@/$@TO-M .@.@RQ P  ")@X0  !@P  )@X0  !@ .@ t H.@.@P` Rf* .@!@ )@@!@P` U *pP  0=X  ፏ %0&  pPO!@%e !@  1>.!@ 0]~ .@P  .@ R:ЍO-M .@P  )@X0} !@.@Y`H.@PPkpM@`GP \pP P:] )@.P@0  P  *`mZ:gS*P* P Yq R0  RMl!`@ T *P}  !@̎@ T$(P:P[ v Q@` p P`@   p P t*ЍG-MMmZ P.`@)P@ @P X0!@ / +2@TP X0!@  H.@P':P sP `pV  s@T@ `PU:ЍۍA- .@P  )@X0 !@H.@P8n@P!`@3P p RFP @pWP@U:H-P`ptP! @o"@/o"PPoR  !@0|RPP !@ )@!@ ῍PO-cM@ .@P  )@X0' !@rP}.@.p@F/0! @ )@m.`@ rP )@@㫍]0S/)P@! @᦯p @렙P.@ T( /0! @)@ rP)@@」A0/)@@! @{p @֛P.@ }.p@!@P @$/   PJⰩ(8.@ .@(a`P(!@@/0C .@.@0aS0+ $ C  4<D  堙.@p]ύJ`8 @h尩(A.@,QX8HPUth% @ @ @D  .@0P .@ [eP P:8 .@!@ P H  P 4P"+P.@ j  )@!@㬌 .@P P)@SPcߍ!@cߍOC )@)@!@!@g!@-) @g!@!) @O-CM@ .@PP' UP`p㰐Y A.@P y  _  )@!@ )@!@ !)@0!@" )@0`!@ _  )@!@㫁 + )@K1!@!0@㠁 )@0!@ ]H-M )@P) .@Q$p.@Q!@l.@ P  ЍH~)@H @p ʟ _  )@!@cЍ ))@0 !@~O-LMM@(}⟀9 .@<P' LP PP- d`k Vx L8X h04(P堐t`PT$\lPTAP( P" `.@,pP 8`808h>8 2/ 0`3?A6o5_7<ϿL % h 0p P4آ2/3?70<` 06o؄ 89<` ##,8|Ѐ0<i1xS6o7 5_02/ |i3?xS 8`0Pr(.p@ `"p!pm.`@@ p'`$p1 $@ !@ |P.@ !@| .@P xX.@ !!@ |0 0!@ =.0@G!@{0xM.@.@@.@` V |0.@ X!@{(P- .@P .@Ps !@w o(P  PP(@xPEU@.@b$ .@QV  .@g`Z$ V|.@pG V@Q 0 ;@!0@T0!@ {TPG(@APEUʩ|.@P`P(@3PEUʛ)@P/Al.@Q 8p@-k].`@.P@P QP M]!@!@z@H"@N. @!@@P P@p .@O- MhC.@.@@ptg.`@Q 00Эp .@)@P.@XQ0 U0SAW.@@ul.@P  )@ $8Q [Xڦ R[ .@Q 04!@ 㶿[Q[ Qz  pGW{P )@pv !@0ᖿ .@P P P!@ .@!@P z .@!@ z!@ 0s .@P !@t Pu  l.@P  P Z])@? pR [+ .@P 0!@ AP1P.@P phC.@@Q=..@Q 5Q !@\z+h#. @+{x|'.@. @0 Ѝ %Q!@.@+_g\X !@-zwO-M.@4@0p $,PLPP(`P<8H`@0P@ @(p 0, 0D7pP  @  P`@瘂 , X .@P  &)@!@X y .@Pg P.@P H8 Z?7p  U7U7Z @h x @ @   0 @t .@P  c)@!@X y .@P* .@P  86pn  77Z P@h x @ @   0@ Pd )@!@ 0\ )@P P  !@  .@P  )@!@X Ty .@P 7 .@P-d6p.@ ڴ 㘰.@.@PP@ .@1/P .P@ `6 p6 Ox @& @l @ @ @|Z 0 .@P [  .@2/P p \)@X@!P@`0 xpW `.@PP @.P@P R68O6 .@P @^ "@0 @@.@@.@ x  @ @ @P[ @.@P "7 .@ `PU ᗆ8ᔆ  66Z 0| .@P p$@ 0 .@P  )@!@X xxh @ `c .@P  )@!@X cx ЍO `.@PL  )@!@X QxDwV0 )@?!@0h @ P &8# .@PO  "@#@ Up@AZOV0 )@t!@PEV0 )@!@ xh @ l`Ѝ585j5h @ WU ߅8܅ .@P p!@@ 0om5k .@h @ 4p@-Ma@.`@.@ P *P .@M,HP .@UP @ .@PP.@P  )@P H?!@!0@ PwЍpO-,MM@N .@@A"A `Phpb !@/TAP !@'k.`@P A" PA 0"  p)@XP`P Q )@ QHQ A (2/pA P)@P&Q A (2/pA q A"@9/pA"@9/pA  pAAA P0 pA OPPPA 0"p `PV |.Q A (2/pA"9/p@Q .@Q  !@vQ Q f ERPNPA PP9 .@P x.@.@0P !@vP .@P%!@,{.p@Py P P`+Q@.@ .@P ,ЍۍH-M 0. @ Pʌ .@ЍH[.@P  )@0<!@.0@?vsH-a@.`@.@PpW_!@p  .@MpH-  .@!@P  )@vsO-EM⬽.@@P P )@ X!@ vT  8)@eF `Xp@@P PPz 0 P )@0`!!@uX X) X 0B  B   03-! @& 0B  B   03$-! @ 0B  B   03-! @p .@P 5!@uP E!@ zP !@ sP P !@ 0: Yw:bX X& Xf :CX-! @$X( X1 XV *CX-! @/  Bs-! @   Bc-! @pP   Bs-! @   Bc-! @p .@P  ,!@Y! @ !@ uP  )@X ;OEߍ/p@-MP .@@P .@ 0.@3/ .@P.@ 1p Ѝp .@@P` S )@y!@ 0`t>rp@-M@ .@P  .@0.@3/ .@P .@ 0p Ѝp .@@P`R )@!@ 0`trH-@^mhE .P@.`@p @@PP p MH-M  )@  ЍH Ѝ/ryys{{z0H-M.@Q  13?  Q P *b Qb` 0 @R .@!@@P )@09tЍ0K-M/@/P Pp/P Pp`P 0`PЍ0H-PP !@L@ .@Ps2p ڬ .@P0 )@!@X 0Hs@R0 )@!@ 0Hs0H-M@  Y!@  P%Y>a .@m}ۍ00H-@ )@P !@ss !@sl !@sP c !@s P Z !@sP Q !@s$P H !@|s/ @Q! @ !@qs !@ls .@2!@0H p@-MP@P`P ``PPPy!@ A#3.@@ ! @!0@`tЍp0H-MP .@@P0pڬ .@P  )@!@X 0Ѝ0HsQFQ )@!@ 0sЍ0@-@P !@O P !@H @ .@P0p ڬ .@P 9)@!@X @r Q0 )@!@ @r@-@P I!@ @ .@P11p ڬ .@P `)@!@X @rP0 )@!@ @rH-M`@PR .@P/pP )@p!@.V .@P/pڬ p.@P %!@! @V  )@!@X0Pkr!@ P )@!@ 0YrpЍ MH-M  )@   .@P~$@P ЍH Ѝ/_!@Po0H-P .@P 0@0p ڬ @.@P  4)@!@X r E:P0 )@ !@ r0@-@P H!@D @ .@P6/p ڬ .@P )@!@X @qP0 )@`!@ @qp@-Hb@.`@PU *PQP@ p0H-PP@:PQPU@u: @P0p@-P E|.@@ID``` U!@ `@  J!@ @ >!@ @ 2| EE '| EDP@ (!@ @p0H-@PPP  H)@!@ >q0@ @.@0P 1A-@ 㦏Xr)@P @.p@ #q5Q A  րp` V Q A  ǀ P   nV yVG-MP4ȍ0@`p.P.@P/P 0 @ 㦵i!@ 0Fp`@pYF 0!@ 㔵K!@@0BF!@ #@@ㇵ !@ pBF#@@ !@ pBF#@@ !@ pBF#@@ !@ pBF#@@ !@ pBF#@@ !@ p J@Ѝ!@A-M iP.`@ 8 @@,.@P 0 .@j_ "@ @UlP .a@0P.@ P| P@@P0 Q ! 0) @  qpW`Jpp_Q-QY0Q0@'! @  .@ b$iP.`@WFU;J *.@ Q% r  0p p[.p @  P@  0pM.PJP 0p pC.@ 0p:. 0p2.PЍI!@IOm$@k!@]3!@XH-!@RA-BM`P@&! @0( .@ BߍH-P$ .@@p`m ,pfWHS@-(I.@@Po"@!@ H- MP&0@! @ @ PP $y`.p@ E,P`U ЍA- M`@&! @0$Y.P@p L, H,"@ ЍAA-BM`@PYE@Q*RV  !@ @^@FQ( .@ AP Bލ@PP Q@_!@;@-XM@&0! @P33 @ HXЍQC/Ap@-BM@&0! @!@ 4BߍpA-MQ$y`P.p@@ +P Q `F@V!@D!@@ЍH-P  !@]H  )@48!@!0@nlO-LMP4hT\y@P!`@.@.p@ [cPRPSP TPn@Q| Я L .@LP"H .@fP dP@ .@P .@` .@X .@d .@D .@pm  )@`,hl.@.@` .@P  "@ \+ " , 0)x,p#@epFPE@TP Y@ QX,   ,   ,   @ D .@P   S<A A$A(A`,A@0Ap4AlX.@8  RZ VT WP+3!@[D .@P   pLЍ)P /P  H L.@.@d9.0@ 0   p|  .@00 gP *뀩U.@k!`@p ` P``E@-P5 p .@   P @PP @.@Pw!"@!@! @$@^PP @.@PJb!"@!@! @G`F@PO0@3S `pBIH L L T L ` $ L L $ 8 8 ж  L L 8 D L L $ X ` ķ з $ ܷ $ $ $ L $  L L L L L  ( 4 L L @ pRG 0A@ S3爵 ȸ ȸ ȸ ȸ ȸ ȸ T ȸ h | ȸ ȸ  .@< 0 p@I @< 0Ip@` 0 Ip@ Q Q .@o|ypR < 0 pR  0pR  0t). @LpR  0 pR  0  )@ 6 )@ 0.@.@ +pR  0 x`.@f'pR  Z )@ "|). @G `8 .@@ .@0 .@8  .@  .@( .@@IY.@@`.P@.@P0``` YS.P@`   PbD!`Wxk!`@ ``p .@% aQ% x .@t .@PQ! Qo/op0"0Wp.@`$p PP@P aT gTb cT,p. @.@P(.@P  P .@ / (@AP @R pp.@ `Q  PQU1AU0u QU  p .@Px$ `x@@Ppp d .@P X p.@PV!@p .@Pp  @P @@ ed .@P X .@Pc!@p .@PlY.P@( @P @@ Dd lY.@.P@P X .@P(q!@p .@ , @P @@ $d .@P X .@P,!@p .@ 4 @P @@ d .@P X .@P4!@{p .@  0 @P @@ d .@P X .@P0!@]X d.@.@ `KQ` Pp .@P * ) @`P@`XX X k @ p.@@P  ~'p7P P `7P P!@P`-0!@ `!@!@H!@D3P| .@P np@P| .@P p@P <P RfgPD P .@P?gP) !@" @P 0  #@qiP !@jiX3$| .@P TU 7U U!@$/i!@Ni i !@!@#H!@?i &@$$@("@, @0@4@8@ `p@##@n!@]!@X!@S 0H-U@)P@P U)P@PP0 O-4Mlp.@|`P.@@P,P&,0!  `00 P BP $Pjp0P 9P P00 Xp0d.@P !@yP !@h0pPz U^*` P, R  PyP@ .@P `V:@x  6&pj7P 2QHP  .@ PP QL .@ /Y!@ah0L.@ @P   Y!@Qh "@4?2P 7P P!@!@!@G!@Bp4Ѝ0!@!@s@n!@i"O-\MM@d .@P Q ,@ 0 @!@ !@c!@\ЍۍOg!@g!@g@P4 4 4 4 4  4         |     0!@g\P(! @ )@X`!@g(x!p@ m!@g  ` x@ !@g8!!0@\P/1*!@P! @0P C )@X  !!@gQ3 Q5!@0+!@! @sg\P)! @  )@Xb\Ѝۍ!@[gdAP\  ( !@ !@Gga!@Cg]!@?g!@ !@ !@@2g !@-g Q!@\ЍۍO8Gj@Q:g@P3;89 :0?@ABDPE @X>!@$P(p4fjP8 !@f \ЍۍOf!@f !@f O-DMMQ `!@Pf@}*! @Pxz )p@X`P@`XX  gp5 0W 0W a z0BR000`p W`LYt A.@.P@"p@ aVC [X Z Z/C^hX/yLY !p@.P@4Jf t 0 ."p@A~hXfLYt  "p@.P@{  .04M/)0 .! @0 Bf [J )@@`P@`XX X `gXDЍۍO-M@|.@p`V)@` `p.@  GQ t W W` ` @`P; V? "VA  Pp 0`B V0 a0BSWBA0BS7B0R00S`P  "Pp p P@ P:2WW``/ Wa* Y /P3 W1`x .@P {p"`Wx  .@0`Up @`Ѝp 0  zЍOA/`P Wx .@P Dp4P YIP  " 0e`P9`W  >!@*"!@ kp@-@`AP| .@ Rp .@!PU e0 Eop0!@="!@ 7H-pP.@0000 P<P<OP<P<3?>0 0ASR   7S86S80 S :S40 S44 ? O00H-P@U U pd !@` !@d0!@ d )@X0HFO-dM p4"0<0(8P, $$0pp<P 5P <0$ pڿ<@!@Tn@ p@Q^WyQZY Wy)@Q )@{33x !@ ?!@!0@ !@d xp2 0`CS`0``p01 P@pP% H0 ``bD 0`\  @!@ c* ) @`P@`XX X e@ T::!@dЍ!@!@H-M?x!@ 33!@ !@ !0@  cЍP P Q N!@E!@T!@ @c^!@c0H-P@Q  _0t @ 0Hc/ !@0Hc @ 0H|cp@-M@ .@PQl.`@}eP ..@P  .@, P `V VO  .@@,Ѝp@q|#.@! @ .@0$ .@Ѝp@-M@T T Ѝ@Uq#.@! @ .@0  .@ЍH-(M0!@ 000S  Q:t!@c(Ѝp@-MP  SGP @P.OP `.@P@Tb@C @@].P@,ᆡЍp@-Q R  RR@~_@_ RM0#.@@! @p@-.@Q @3  A!0@.@R$B@@@@@P`@ BU:.@p0H-M@Q P5_5Uo P`P4O T 1PQ U ʕ #P$<.@! @$ @ ,.@UPT# $<.@! @TT$<Uʇ#! .@! @t % #.@! @5 .@Ѝ0H-M00ЍH-M  0ЍO-M`P!,C@!@@Pp-Q#P P PZPP@GQ *C!@@P(PP@Ѝp@@-M@ 0 0 0?=  0@ Ѝ@nO- MP@hs;!PXd㜟㬿㴏!`@.@.@.p@.@ Ob@Q!     D      (  8  L     \  d \ 0@.@DP*.@.@.@.@.@.@.@g@ !@Îp   )@P?.0@.@0 SQR? .0@ ?.0@0S ?.0@0S !@;SQ .@$@ *$@R!@;B Y!@@PB#. @000#. @@T'  @PP {.@` pGW:PV `@` `@T .@.@ .@?!@ P[ +P= )@  `s>A.p@@0.@ !@`빆CP.@@,1P  @ A.@PLLPH pM !@X?^q @)p@PpQJ :P'P@PP!@G ӯP@ Pz 4 4 4 4 | 4 `  Qk@R@>$@ m?v!@p`^o .`@@s)@PF :PP Q UP:P@Q .@<d TO !@@!@ !@!@ᬰ#. @ r s.p@Pq!@JH-  )@!@`&^pC-CP.@@ЀKx2ЀP Pc@H!`@!@ @X`@T @ 0P IEUPKpPܿ`0H-/E!@@h] P@852/m/P0H<" !@@T.@˥  M""@ H_.P@ @0HvG-MM`.@Ps.p@Q a@_%e5! @!0@[@tP @.@%0 pp! @!@ !@`YV.@ !@`%se5 !@!0@A>:<V v<&0= 0@!@0*_ W !!@&!@ 0ᣤ.@ R .@0ᙤ.@tmPP @Eu@@Ѝۍp@-XMo_.`@.P@P Y&! @P.@Q "! @f#!@$ @P F.@!@0.@=M!@.@Ps!@.@P !@m/PJ !@@r!@{%!@Fʾ!@qPQ Yf&P!@! @S `F.@!@!@@@ Qk!@ nC2(.@! @Qn!@.@Qq!@.@Qt!@.@Q @.@Q @ /. @ R /!@ ?BwP!@ O=;P!@VH-.@P/!@gh\H-.@lH-!@8)O-DMg\q 㐷㔧@P!`@0p@)@)@ /Lh@ Q X h (p HPX  )@EQHQ  @ _P PU% ;.P@" @ 0@ ̼p3  P@ $#B p&yB pʪP* C HpX PP@ Dc/!@ #@!@!@ފ!@يH-[  )@ !@;^[O-DMP@n\k v !`@.@.@.p@.@.@ yK`P a@P d \ \ \ \ \ \ \ \ \ \ d \ \ \ \  AP( MP,.@%.@".@)@!@\ &0@. @.@p  )@PP~.@.@pQt&.@6. @.0@ ` E XVp.@pP )@)@X(.@$.@+.PQ PW " 0@q>V) !@]P@ ,&. @0@FP ,fp.`@P  3 0FpPl X X ap@ pGW0.@@T@DЍ j!@щ/.@!@ ɉH-(MJ 5!@"$8!@,!0@ !@!@ )@7!@!0@  ]ZO-TMM4F.@@<04 PLI0.@@DU,@`LceH P[ づA}LP`!@"@#@@V 00 `[4xdZ8(W {V!p@ 8@7D% )0@TH0" @5!"0@T L0# @<.@P)@Zf.@P)@Z+ E.@@P[ XQ( 8PV XP:.@P 4!@.@[XQI!@[ ꘧<)@V|T) [pW/@[= P;8E> (?p2 PP/$.@.@e .@P` !@4.@[Z.@PT L!@.@[U`V 8 <(0 L 4.@.@6/>PKQ:  @ ( 8` ɕ8@.@T P 4@y,P `p@0   ޘp02 - P@a,`pPw 4L)!@.@. @3[KP "@ h < H T ` !@ @![# !@[ @ /!@6!@;!@B!@ !@[@ !@[ 〿P.@@p@pI.@@!@,pG!@,kBv @#p@ppP Y.P@,_P!@,ZBv @#p@< Y.P@,NZ!@,IBv@#p@  Y.P@,>c!@,9Bv@@#p@  Y.P@,,k!@,' Bv@@#p@  Y.P@,u!@, Bv@@#p@  Y.P@,}!@,Bv@@#p@  Y.P@,!@,Bv@@#p@  Y.P@, !@,ߘ Bv@@#p@  Y.P@,Ҙ!@,͘ Bv@@#p@  Y.P@,!@,㻘Bv@@#p@ Y.P@,ᮘg#@,㩘Bv@@#p@T @P+ @ 0I.@@,ᕘ,㑘 )!@. @  ZHQ !@Z( !@Z YX(@ 8E>@@@冗py 4@ .@ 0L8`@@(p E>PP PPqpP P44.@  Pm8P@ (E>@@@]pP 4@ .@ 0#*@P8(G E>   Ip< P$4.@0I(@ 8E>@@@8p+ 4@ .@ 0@a0 !@YPYW_ 8 ` s PP*P @E> pY:)@4&!@. @"Z1@@J@T) J0&4\9B04$.@pPp e.`@8( !   QQ 0"  4p`@W:0,TЍۍ$.@.@ .@P !@@0$  ^.8p<P A pW:<(Q P 40*40P $  40 $<X 0 S-74 .@!@WO-MMp$.@=.P @T`T`?Q`D@` @P)@.QQ_ `(f.`@W)P@P )@ 4f c$ .`@$P X 0ᡓp/ $ Tp P.@P  )@ 00@R   00 S .@P% W,$ 0XNPK  .@PCTP =D @ YPK@=PPE=P .@@P X``:(pPP\T @ A A,\XTTTT$P@zPK P` = kP } @tP W ,XP @@} @P p@  #@PM  !@P` S $@Pc } @~P " $@xP n @rPTt hBQ0          4   $   , aRp p pUTVy 0`P" PjPP~PQ`y @T6!@P] m$@PY $@ PW !@PU U!@PQ Z!@PM T 0 I0Q P!P7 R2T` 0PP P@PUT\PP ` ZQV`p$@ XPX@ =PPR=P .@@P (PP 46 At.0@ @ AXcX ߑp X`X Xp0 `\0X0X `Dp .@.@gX@P[!@!YX X06!@ JXPo =PPj =P = ߴP .@PO =մ(@PP  A 46 Bc.0@ B    rp  X`X\ 0 AXXP\4`0 `ѓp `P?4!@.@* P( `V X0$ L.@  6/!@ЍۍOF .@@XP0 PЍۍGP     $P  PTTTP =PXpp\ "P4 $@*P P: !@P) ,!@)n@.@X $P2@pXW.P, !@eY4 !@R!@3Pp H!@ AQ `Q Q _TPtT:"&PX `XX0 p 4X4.@ # 04!@G<44 ".@!@L.@.@D 4 $@.@GU=+ @4!@.@?U(.@1!!@QW V !@VQ `@ @c+p Zp y P.@@XP 㴓P> P= c  46 ( .0@ q ' P P +QMQuA `( XĔ4.@UPQ`0 `Bp .@.@e@P!@!!@Jw3 |!@q$! @#@ !@P   X`(pQ)@ X`(pQ)@ QQ Z$Q! @!@  !@DT QTQTQ2T/Qza!@!@ AP p   4 `( -PP P )!@ X= ᵑp P P. P4F.@@ 00 0*V P 4F.@@ 0 04F.@@( 0X 0@+ @!@!@ }!@-Dp?T T*h!@ t3/ ;$\RX PPA !@L!@SE`~ !-PP P J!@4a!@1@hPJUETC TP@VPU*% o$ X\ PP$PPXP!@aQ-24 .@!@!@!@!@ 4!@.@M0H-M0@P000 P0P0AAЍ0HЍ/K-GMP AN `XpF 0 `@}p`PV`v  XQ:)X`Gލ Q( Q#`O-$M4V)@.P@P.@/P 4VG`.P@ .@@/pF   9Pᰰ`P.@$ЍO8O-\M@.@`\Dx!P@!p@X: .2P .@ 0/=P P /!  P@*Xp\Ѝ`@0 D!@`@0 D!@ 0 Mp@-Mg@)`@P  !@R.@ R ,.@!@0R  (0.@Ѝp@ Ѝ/@-@P @Q 0"@ $.@.@& 04 .@!@@P $.@.@ 04 .@$@T.@PPA-M`.@P P.@(p .@@0 WЍRWP' .@XW ~QЍA )@X0 ЍA&`P P& PP  X7 W W !@Q)@  "@Q X  !@~Q+ X   0!@qQ     0  @     !@ !@YQy @ $@QQWY @ЍAJQ ЍA QK-`.@P@.@ p .@P0 WRWP2 .@PW PK? )@X0 K蓖P( U+99`PE!@!`@P QQ P PU PE@W W !@P)@  "@Pe @ PWY @KP KPA-P.@P  F.@.@@p  &`. @ 0 V PVR6 PV |PA$.@.@A4!@.@A_ )@X0 AW@3@#T9`!`@P@TW:k!@P ALPV V !@P)@  "@xP0H- MP0@ 0p P% .@.@  0z8.@P !@JP 0 P!@P@P Ѝ0}!@ z}A-M$@.@.@] .@PX0PP  .@.@ ( 0 㦍p pW4 R 4!@.@6@P2& ,' T' T' T' 8' T' D' !@#!P `0 pzp R4.@0& &!@P!@x!@Ѝ&0H-(MP8@  0Op P1 .@.@ 00   0.@P P)@@•0\ #@ O& !@ !@O(Ѝ0}!@ |0H-MP(@  0p P. .@.@  0@F.@@P)@  "@OOP*ҞP  0!@?OЍ0}!@ y|O-LMp@(X.@P @HH !@0BP@p@pap(`@pH`5 P Pw ( D0D`嘌px @HpD (A$PRvp% $PP P0 A$ C P0P @p`@(@ GJg`V(rjap*C Lp PC$( V `.@.P@Y ,(0<* I)@ @㨭 F ( 0.@P  !@NpF 0P!@ P0 0 PN V.P@@p (`Y$olo%LЍ( }!@{O-M⼀` `pW !@0㉶PA@@P P0 @p Rm@W P  0]XWR.@P PI `< vp@P)@ @ 0 0P7`Y- .@.@ 0& .@P  !@MPa㚏@!`@!@pT M M@pT M $Ѝ}!@ {O-M.@`PPV. x x0 NpF  p_@ T  pd_  P8 !@ XPtK` 0 `!p V.@P` V.@.P@㬐  V 0&!@)GoNC `@xp|x3p2"! @d0?0V V#   0`x@|x 3@2"! @d 00  ЍA-M(p`P 0 㩊p8 >1P1 0 ᗊp) .@P)@  "@L `V  ZRp@!@!P@2 pL ` p!@V: L#Ѝ<!@z0H-(MP8@ 0Rp P, .@.@  0.@P !@L g :!@@ 1+S*A;B++ +L(Ѝ0}!@ yO-$MM.@@PP? T9 P `@vB#@2P+ PBV@p#P@B ]%pl Wo QlPp*`!2pPP`@H 0Ép V.@P? v.@.p@L V00 *9o(@0V  "V   *0 @m0  "$Ѝٍ"PW!@P!@ y/w"!@! @yA- Mv@.p@`PPV #  @cP  3 R PP !@ YP^I``8 0`p V.@PCV v.P@V.p@Q<Q  0oM+1  "!  @ 0V PP  0n!!!  @ 0 ЍH- )@  0 @000@0@0^S @CSG-Mw㫒`Pp@!@@`0 T  0 p !@`VT !@@P Ѝ!@"! @-x!@O-dM`@PP T5 9㔁 p !@)@ |'# J ! @0ᮩ0  ᥩ  00 .[<jP pT P ^,!@dЍOJ0H-P @P8PU04P 4`P8U:g!XP0P4PQ8P:^!XP00.@Q0.@/4&)@. @X!@O-MMP`)g@!@PnxК\ @J!p@.@.@@0@ P8TP0U@%P@> @ @ @ @ @ @ @ @ @ @ @ ? @ > ,? @ L? > > @ @ > |> D? ? ? \? > @ ? ? @ @ @ @ @ > PAP DPcPP@Pw PoPi .@P` PZPT .@.@.@~ .@z.@P9  "@aPn .@j .@fP'`p"pW  )@ FP P:  .@W`.@V .@P .@P 2X WW1 @ P !@P  "@PWGPA0A @B C tB C C C B .@PtOWڀWS  Wb  WgH 8Z"@@!P@ pPy `P P !@3I WD @W *.@. @0 00  FWp  A.@ }pf A i\P1/!@ Rv .@P-OQ .@ *.@. @0 00  s=  Jp !@3A<P)F r) !@ !@H*K@ !@HT 0 & P$ !@HmFK-iz\ @P `@.p@0@ 6tPPHaPp-  )@E Q% Q"jP@A.`@eP( P@:FQ@T 1 @P !@P.@ )@P !@ I !@ IxF0H-@ )@P !@HW!@ Hx!@ H!@ H!@ H!@ H!@ H!@ H!@ H@FH-MM@P  g[P/  1P*J " !@_" G !@X"jz.`@.p@PP PP `.@P   `Cp/ !@+@`ЍۍE0H-M@  "[P P.@P   .@  p/ !@@Pۍ0O-mMMZ @!@0@@įPZ !@0@ 嶯P I "@ .P P`堐 ;@ap |L  p @ $PM P*P @x| L ppe D PoPl @P$%;a# @ 0@P*X .@P y!p@_P z!p@p $G@T:>P2  @P% p;" @ 0@P .@yP!p@  F$аX:zP!p@ pP I "@W-PPP mߍۍO-MMmPD` )@8Jgx !@@"p@P_P ZP ZP NP Y /  !@>  PY ; !@ P 5p .@pE !@P ` .@P 1 @Pi ,̤P P {`, p-8  ` zP @opB6 f`V P Y +@`:# @!0@`)-P p  !@ /O !@ )/  !@>$j.:" @!0@ @p .@PU 1 @o!@o 8Jgx !@@"p@l`PDNY @P U !@ 0EP U  !@ E !@ 0F8Jgx !@@"p@ V  !@ 0yF8Jgx !@@"p@P -P   !@ PP CC|@r@-@ .@P @<P   p T !@ El !@=O-M-hMpPH (0@P#`PT   $pR@V b !@ `U U U ld @!@< !@vd @!@〄d @!@P 5d  @!@P P(V oPL#T $` p[B~`F1V $%!@ @P0u!@ , p@ !@! @ pDT$@ˋ `  0P ,XHpP  L?PP 4PP8D0< @D ;_!@$E P8\p $;Z -\p G UP$; \p _P0  !@ Dz  Z!@  ` D@< D084P,8d ?P0 !@ {DdPʏ 00 G 0Dz  0 !@ @P9  0 t .@0/0@op0Q00Wp!@!p@#/@P .@P @t" . @PP/@t .@PQPYpb .`@Q/@PL @ PF @/@ 0   h @0/0@ t .@p0Ro0Wp0!p@!@T#/@P! .@P @t" . @[Ppb .`@/@Pt .@@ !@+YDPQ5 0:/@HЍۍЍH-: .@P  .@ P!@U.@KA-騁/@Q .@Q tr @P.p@.P@@`P@`O- MMPt .@@Pn @.@Pi z.@`Q!p@p`!@ 0>, 0)@+\AP J⌡ )@?P Y!@ 0=!@ 0=  )@+0;APZ$/@@0@!@=$oPaP nP@pP qP@/@@!@@@.@@!@ =t" . @A !@ Ѝۍh / @  1 (!0@! @0 G-KMp@P7`BPO P/@/@ / @Q0 DP/oS0B 0.@W[ | /@ P3 W7pEpHT T  ! @=P P  ! @=P PP 0/@@8 /.@ 0 !@@.P8B r, @ R @]Qh / @ VT9!@ 0)h@/@@@?Kލ  @4@h / @  1)!0@ @0 HO-MMP P >!! @:=P h A/ @/@@ K!@P| /@ P  @8P.@_JPlw .p@ Pb@P ,h Y.`@/P@pPPqPn BP#  dPc  /@P0/@ /@ 8 P P  @4  R.@!@ u<=h / @t" h`. @/`@ pZp/o 0"   @ 1!0@ 09!@7) .@w Q.p@`Y/P@P t .@ Pt .@ ?P7./@Ѝۍ /.@ 0 !@K-AMP2@!@'<P- `P"@ zh+/@0Ѐ``H? q!p@@pPJP  0`<+02?pYK .  .@w!@;/@Aލ3,! @@P/H-P  .@!1!@! @!0@;./@p@-P@P Po`@P 3!@P b.pUpP 36.@!@0@0!@ ;pH-D 1. @!0@/@H-P  .@P .@!@H1./@H-' 1. @!0@/@H-P P(x3L/@!@@/oQ" @@'`F@@PSP 3|!p@LP YBP4x /@  .@ -%x/@x/@@V ,.P@!@ ;x@/@@P  B.@!@ ;m !@SP  .@ /@  .@ !@:H-" X2. @!0@=/@H-' e2. @!0@3/@@-B {2.@@!0@ ( / @Qx/@H-t" 2. @!0@/@H-MP Pv b P.p@.`@ oP* 3L!@@/z-I@P@P 3L!@@P=Pl .@ @.@@,x@@T P F@@ .@l" 2. @p!0@W 0 !@ u:  6.@ 0!@1/@ЍH-p" 2. @!0@/@H-" 3. @!0@/@p@-P Pf P.`@P@@PP 3!@JP WA0p  .@!@-:, o200& S. @P SP.@3&!@ @0 9!@ :QÔ/@pH-MP2 P0PS#! @ G:P' !@TP/@}Q .@P  .@d!@$!@>P /@ t /@ /@,/@Ѝ0H-P /P@P  P  .@%>P0@p L= .@0 /@P )!@/ @9 0H_,!@41$!@ V~0HH-MP PP ! @ 9P !@Pt /@5,/@ЍO- MPZ P>!! @9PQ a/`@P @P5.@FPP <P4 C t p!@@.@.@P! P P Pt /@PP pPpP <pP4P+/@ ЍH-MP) P#! @ G9P P#! @ =9P P!@GP!@@P t /@P +/@ЍG-M`PpJor@!@ᲾP V] A!@㪾G㋓P!@ @ | /@P; VJ <!@ J @@V9pZL!@ 2PPPUP@Up <|` v@  @uP`|P&90@  T%V ЍG .@!@0, ЍG(}V@ V+/@Ѝ<`P R!@P/@O-$MP P>! ! @8P Pʸ  ! @8Px @@  @P|Poh!@@ 먁/@PP @3@.@EP @P@ , GD㋓Y h.@!@@ @P@!`@p @[0P- 0 ! Sp0p [0$P .@Q t" . @`Pt .@` h/@!`@P v3P  v*/@$Ѝ<P R!@jPA-MMP @Q3PdoP `P@tEPB3v!@/D*/@ЍۍPPU*3x @9SP"P@/P᩵P+Yu .@P f .`@P @   7T T&/@0 @ l!@./@4p@-MP  Pʦ$ ! @n7 @P:)/@Ѝp!@r`P  Pʷ!@[PPP@$P!@]@ẳFT P!@[PPP P!@E@ᢳ.`T @oP  @!@/፳, .@8 .@!@0H-@/@@P]/@/P@PP<P  .@-!@/ @600H[) .@!@0% 0HS{0H-@/@@PY/P@P:P  '.@)!@/ @u600H5) .@!@0$ 0H-{H-MP+ P)P<%! @ 6P v!@P/@}Q .@P  .@K!@u!@Pt /@(/@ЍH-MP+ P)P<%! @ q6P !@~P/@}Q .@P  .@}!@N!@hPt /@(/@ЍH-M P P%! @ 86P  !@(/@ЍK-M@P +sUI pE` "@ +sV +s`U/  !@Pt /@ۍH-M P P%! @ 5P !@Y(/@ЍH-MP P,! @ 5P P ! @ 5P P!@P .(/@Ѝ0H-P B  .@@PP !@ (/@0!@P00H- @R: (/@0B  .@@PP !@!@P00H-P B  .@@PP %!@ '/@0*!@|P0@-PQ '/@,H .@@P  &P j2H-PQ '/@, .@P2!@IH7H-N2@-M P  PP@ '/@7!@fY@P@!@$ႱЍH-` .@[0 .@P<&, |.@/@P2& .@7BK-MP P%! @4P ,P p  .@@!@1B'0 .@U!@)p P .@BP   @#0@% , .@P P .@!@% 0 .@h!@/@Ѝ

P<P  ! @0P3 L!@)PPPUP@`3|@ n x㈒ h`/@.@/`@ 1pP!0@9!@ʿPp,"/@Ѝ0H-P&P@p!@ P "@ P w!@ PPPP6p 0P  .@!@/"/@0 .@ 0.@  0.@0!@/A-M─ /@  RP)@0S {V I`!p@.P@!@@ Q/0`SЍAM" ЍH-@`pv'P PP 20 .@0PT .@!@ Ha/ .@!@ HY/p@-`@/`@PI'P PP { .@!@?/pp@! .@ !@p@2/0H-P | /@P B .@@P: !@P0!/@0 .@!@0, 0Hs0H- @R:!/@0|)/ @ R B  .@@PP l !@^  ? .@!@0, 0Hsq !@PP00H- R|)/ @ R B 0.@@ PP  !@9!/@0 y .@!@0, 0Hs !@$P0O-$MMPQ u!*P( ! @.P 0 .@`VQp/P@@ /P pPVpW .@ A!@./@$Ѝٍ< .@)rl/@q P)p@ AY I @<@ .@@p$Q \Q Q@  00iRU< .@ A):l@ P 0 0@  AQ`< . @ B)lݪ@G& .@b&P @p  .@@!@ .@U!@ P , .@P .@!@4/@ Yy .@P f < .`@.@ P @   F.` k .@`<.@ 2/D.@PP< .@)k% <.@.@ .@ @P  P  .[ PUO- MP@( .@;P , .@P }P @%)$ @!)P , .@Pp b Ѝ 㘂 :.@.@`.@P P `PpW  @)P|P PP U`p@-MPi!@ @ϝP q!@ ȝP u!@P y`!@ 㺝P U PP 0PЍp !@e&PPЍp@ y!@ 㚝P F!@0eYG- M p`!@ jp0 剩 P/P:P# 1p P P  ЍPP @p`/@@@cP)`PX\p p$0 j "@ Qj# #@ zj /pP p/ P :㴪P p`// PPp/@@cPPX  !@PO-M-^M@p|xppptppppTpppp.@p|pxxplphpwdpp0pp pp9똲 P.@ p 'p  '|p |'xp x'P9 6; x 0!@ p x-/|d)/h%/Px(UlpP'PQTPQUi UQ / PI Rtp tPP 1/PP x d P P P P ^ލЍ!@ P !@F/P..PPP-J `.@`hpP /@/@pP  \ X  PPt4./@! @ !@5P 5P@ X\ 5  p嗭qWڈ .@P V .P@V!@+  a!@+!@U .@ P `@@QpQ P  @& x @&G .@@Qs.@.p@Q P .@n. " .@|@. @p |&|q$P@P&  .@j6P.  w"peV# ۴"P" W J@ Q;Q @ qQ Q@グPW) p@b P.`@P j  .@R ?.@0  R (` U/? (` .@(.@` R 0s.p@  S 썢Ρ0 %5P ` P 0( 0 pWp  p M#PP   X` P.@x/@P  .@㨒 .@.@P ,P P P'@,P  .@ 嘲 .@R 0ES 2 H0ppT0(3.0@@0P} `#p @P  P  p  R `@**#p0 P0" . @P @ @@BnPPR@@$  j/5u0SeG/ rP@D* j/e5 FuSPP U*p @3P  Pᘲ `.@`@ s.@.p@P  .@5P @?PV P`P @ !@ !@ Sx.P@,*g/@PPeQP\ P^ !@Y @Q!@ 똲 .@  @P |P  $@=P;  @h/@  0 %0&   P 0 '0*` / @`0 P& #   P  .@P  .@ 0!@mb;!@g  !@:"tw./@! @Q PP&Pn/0 pP Ep.@Px|` C0uTpp55505w?|PU PDz$ 㸨!@xP"P R +pHA`n#@P (pAvn_#p@:$P  ᮦP j 嘲 .@Q Q P V:$ AP# gPP(ph/@YWܥ@@Z^ abj_ @.@"`@ P   00 0p@ P  f fPP  4.@!@ 0( rp0 Po2 0p  m[.k?!@9%p $F!@ Z ꤪ0!@ `, `P U嘲 @@hU.@/@ ᏤP UU ၤ P P vtatp:ڈ @a#V .P@|Q<I#t!@W2T3?#P<;# v .@.p@P !@ 'PP  .@P3 x0 !!@! @q'(x| !@p !@~1x!@w1!@s1 !@ !@g1 !@I' !@Y1d .@P &29"!0@! @QG1Sa!@!`@PP ` !@91q!1!@! @!0@01똀!p@PYp`Q`U  .@P !@ '!@ 1 PV  .@P !@ &P!@ 1U .@P '  @$@0p1Pp |"Ȱp)@^* `j?tPPH`L`@@ P: P   D!@Q\" WP Pn QsQ' ! ) @ @ p  0 P ` 0 h )@XB0   P `X)HP n?`@PP0 0   P>x .@P P Q)P Q)0 .@Pha S/`@!P@p0P `pWZPP4pD` 0 p `<@HpD`@0 8P w_!@uP>!@PQ!@P\&!@Pk0!@P A!@Pi C!@!@P!@P !@P)@n? 4P yb ` Q/ @yJ 08P 0P ` pl@Pq *Q/ ph P0/@Ij 0ϊ ÊX+Pp Pkjv\Xf(0  0`cv!@pP[ Rj \`Q7JpPh/@-Q/j K 0QrJPopP @/P *R0 `j -0`QcJP   0` 8HpPP hl(00`8  )@@ 4Pn? P 0p P ` 0  P\ 0 (0)' *` / @  !@@ %P D @PW QPo xpP P !@x-P x`%rP !@l!@ j0!@  p PPP!@Gj|<0KCPo k 8pP @WP!@b!@+!@(괮.@ "F!@Y!@< t.@!@)hb .@<.@@!@f !@!@9꘲ .@x/@P<  .@P7 P 3" . @ P  @P  PѺ #P @  PS Sh/@   00 $.P !@XD7 \0@ R  ! jO`YnύX \0L1/`pX@ir)* !@# P i.@Q !@t   00P 1.@S?P  8 .@=!@# 8px0 @Z9aV P "@㓩P& h G  001DP# D`b!@)!##FP  8 .@P!@r#8pxM  00PD!@ 8}!@`  008P4p  00`  0p Z PPK H 0pI!@ 0 ~!@0  08PD`pL@ P0 HFV BU >` ᘲ PW.@ W W!xO| !@P 00p  08PD`W H/R?!@! @!0@H|O-LMMy@P !@ 0P(P,PPPRP}P  %@PfP 6 .0@ , %P:WP %P (0!@Pp ,P P PP+X !@6UP( LЍۍ`P@VB P@P= /㲠 PQ' P/ P(PQ ;㠠P P!@eP. !@_P5 !@YP3 !@ 4P"@ 6` `PQ  @p .@P! P P``U P 3!@`PTP 3!@``P``v `,h .p@.`@@@P @8+ _ P8@<( @DxB .@@p8!pP P,0 l"P X `X8!" @P :!@n>8`U0 [.yBt8p$@@/@ `P /UP``{ P P +_@_88FP .@P/yP@D .@@Q 8k 8/@@cPm!@a~%!@! @0MO-MPQ RSn!@Mi !@᪑P y !@ 㣑P q !@ 㜑P (Q P PP  PP /s~P @@`U$ p^ P@@#@s#p@W~P PpQ  .@ P#@p:F~P P#@jPg:8~P PPPpU  Q QP P*#!@ 0 P P Pd .@ !@  @h .@PU[!P@#@P "@Q{#Ѝ0H-P@r#n#j# ! !00H-P0S0 )@%S SQ PP@  @TPP 00  V060/00H-hM .@P z!0! @d~P  .@P.@t-H-hM` .@z .@P $0! @d}P  .@P.@O-@-@P P P0H-@P PU VP00p@-`P@:)}P "`e(P %}P!@ )!@ }) P P !PR!R !@l)@p@g)H-Mp .@@`PP<0 N+0SJ  @0C @P 00S  P!@ЍK-pٛ@`@@ P AQ P ḏQ AR0Q  qQ  PO-lMMP@(.@H A8.@P A  A.@D0HTLP@᫡P PfcD,@$D.@@P$.@Q\D /@[@D `<@ P.@"@ 4` _P $\ \PDP  4.@!@ 0 pp 0Po2d'p%F!@ [ !@D/@ & 0!@ /@lЍۍ(U .P@ẠD 8E.@@< D<p# <Q0 u!@,V/P@@,FP/@@Q !@ !@i/`@P  .@!@!PP p-P l-/@%MP 0P2,0P,/O-4MM H.@P.@ @h @4V TvFj .@$.P@/p@/@ `@@Q@0 /@@,4( @ 0P<IQ A  S-Y8Q A  D-@Q :@PQ A  Q A  '- 0!- 0Yk Y  Y9 y"  .@P%|/@Q [ ZP /@ @  .@7 .@P @  Py P  ,5Q [: .@Q  [  )@ /@0@T/@@Q*@[* d@[ :T  @)@0T@ Y 0 )Y T.@@R*@ 0 ()d $@Z-Y$Q /@ $$,( Q ,R*((  .@@P,5P .@P .@P @    .@墎(Q P@T4/@+{ZT/@ P  .@Q 41//@$Q P,1P  .@P@/@Q Q?H.@P  @U PP P.@Ph  @T P P ,0@4Ѝۍ5/4/P`.@@H.@P P %  .@` .@P U.TV ! @.P@!"!@/@/@@-` @.@ .@P  .@ P!@H $.@. @ R@L.@])@-@f .@P  .@ P!@P $.@. @ Rӥ@L.@6) MH-MvP/p@ P$0+ He.`@ @@@  y @卍  .@2!@foPP PP !@/@PЍH Ѝ/4/O-M .@@Pᠲ `.@/@`ptab .`@}u  " . @ /@p@RSp0* .@P  m/@/@Q ,($\ .@(P W .P@P @%P-P  B.@!@ U  .@!@   @ @  (@ԠP |PF p$!@m/44P_  @, )@4PY\ .@U(P (q  .@(Q B .@@PJ0P 0*0 / @00P4i1!@44P! D @,4P84PJ@  P M.@!@ nl!@ @/@(p ($B .@@p $ PJ,P4P ,41/0P 0)h/@Ѝh/@p @; !@ P  !@P @,/@@Q*4 P4 0 { /@P\4 0  pSh/@ d!@[P!@pU j "@ O/  !@JPt /@0x0/p@P g .`@QTZ.P@Q Xz.p@P Ux/p@g$p q$x `/@P  .@R ;!@A@@Q *4/r .p@ `P4000SX*0. @0 phP P `!@PV #`.P@4 4R0B0 p*)p W w9SZ!  Q @P  P `a  .@ 0!0@+0 @P  P  0P @  P w P  p Z$ ` V  @P  P> #P @    ` c4@ !@~0 `@  P !@rz,P ,41/40;(0&#9n'7!@! @!0@+!A-M9q`!p@ PᛞP p /@ !@! @Q  /@pW  /@/@ pPpQpH/@@P /!@PB , .@PB P  T!@.@PL.@%P< \ P.@%P| @ 9.@@@!@Bg P.`@ Q PQP  W .P@Pg \ g .@Z !@x .@ !@q /@ @hp/p@   d0!@zP9j"@ sP2iw   d0!@bPj"@ [P D`.@@ |  u  .@!@ 0`G f AP@ o^ P P; oQ X^.P@P /@ " P p !@JP/@@P. , P/@ KЍj"@ P j"@ PP P X.@@-hM` .@@H.@@t/@ /@@rP sP!@!@@d IU!@d U  .@P<\ .@$!@CO-M-KM| 8u.@hK唲 .p@P.@@.@ g @pI .@ 0 ZPp , .@.@P=  .@P8 ㈒ .@X.@!P@pPY`Wp VP  .@"@/ @P@ /@P @ P  .@!@!@l-V  .@X!P@)Q  P"!@ 0P !@ 0P' !@ 0PP/@dP @ P*!@ .@P 8u.p@ P.@`Po g Dp  pQ 0 p p .@ 0 T Tϊp T( pʲ !@ P PW .@PC  .@P> d 4`3 B  S P, b .@.`@S `30PP !@wUP Z, .@P .@"@/ @, .@PZ Z  .@P  0`A !@PPK, .@P? Xp``PP .@ !@P#!@i @@@'e !@ !@@P0 @; !@H U  @.@@@KލЍP>/@P? @ P< .@D !@/@P @ P .@ !@PdX l0 T p`PF.\0.@!@Q P@`P\PXP  .@ !@dl  00T 0.@!@ppQPl$!(p4.@td,d(hPxt$ 0 P3?( SB  .@ !@fs .@k !@FS d000"T.@!@tQ- !@QST QU QV Q  .@%@X@T .@ !@(.@ `0 C h[.P@0p .@P<l$!p4Ptd,dh(xt$(.@0 3?( PO-LM│ | .@.@Q LЍO,# @pH P pA (P (.@@m, PP<@b`A(,  00S( 0B 0@SCC?7 /Qp P #P !@ P  !@ @LЍ8 .@ <Pp@< p{P w#P   up Pm P_p =P0 p "@= !@ O-LMpp`Pt堢 ǿ@[ǿS.@0PW 0a0@P~@   ppP #P  pPJW PP  @pP #Pf @PJpGPWppP  #.@ R 弅  0QPr" @P  P P ء ?$ R# P #.@W@w 0 08 (P0S4$pEP/pp r^@P@@Ap㌝PP(  P $!P6 .0@  @P  P  #P @   6 .0@@^PowLЍ#6 .0@O-AM` .@`/@/@ P.@(! @Mt/@  " .@. @@P9!@o .@,Q P(PZ .@PPj .@ Q P\ .@g PP@Z W .P@P @P/@p ob p.`@p  fB .@@PJB R .@@P.P@P 1/P "p[-P  !.@B!@~X  .@!@ u Aߍ  @% @![ pZڄ/@P P   @DP|Px/p@P /@Q  /@0 pPu Q Ph\ .@P_ \ .@B P.@@ | @  .@PQ 2 / @0P0K H/Dp1P - P0W @W"@~/ %" @P"@qpڄp/p@P   P\p?P  Pm {!@` h@/@@P XP / !@ d0!@Pj"@ P!@Py [  P( D @4!@  @{P |P 8 @&P  .@ .@ @ @ B .@ .@ )@X P@pH  PW .P@Q`.@Q dk.`@P m x0/@P "  . @.@ R @@Q,*P r `.p@ P Rd+. @0 pP R P.P@`=, P !@`@3R P.P@`.P@v .p@#` R0B0  P] P p]} EMY#   .@@T @P  P `ł   .@ 0-B .@@  P0U  E  PQ P UP @8 @P  PѲ U u U   R0B00R p R 00" . @w .@ .@Yx   .@@T  @P  P #P @ [ W0 p P000Ꮢq<!@R `.P@W 0 P,JPP p ` R0B0  P pP`pP`W  0p;!@yl!@n NR .P@`@  P !@c@@ !@Ze P 1/&P F .@@!@R!@ V R Ph  .@P D @PP0 !0 < 8 @`p,`(p0Pp A.@P8] |0!@ c#'n'R?!@! @!0@3×G-/P/p㕍P @"@T`p"@"@U`v.\N.@@+,M.  V(\N1dp1P.@@pW! u `P9QP0PPJu0QZ.QJP !@@ .@ !@C0H-hM@` .@ PG!@d L  .@P\ .@xH-MV@/P@PF oP  0P G !@``!@ π/@ $pPP/p@ uG !@IX.@PT P+PPPP ۍ% !@3X.@P/@ۍHk@-鮘` @.@ H.@塘@G-Ht@.@P @P  .@T Qxkt.`@.p@PQ dx{.`@.p@㔙,8 /@.0@P@Q@  ,9LA_(JeP.@8PE_ `.@EO*a EA_*EV/P@$!jd@ &/ @j@P(QX/P@,$A@/@JA00  .@,A@4/@@4/@(188/@0 <</@@@/@DDRKR K@YQ/@@ K K@/@l!/@@ l+K+KDW/@@+KW+K } P G/@-` .@@[  .@P  .@ P!@H%/@. @@X.@@L.@-p@-M@PT 0S00U 0S 0100 `PP TU T@Ѝp@-P Q  .@i !@㝷/@F/@@ PJPf !@/@@( .@i !@{O-4MM0,ZZk@!`@%,d 9 .@"@` .@J @h .@"@lR s .P@!@@ P.@|r @倲 @!@.p@p .@.@t .@x .@ .@R  .@@ .@.P@@ .@@ .@@ .@@ .@ .@@ .@ .@@ .@@ .@ .@ @ .@.@@ .@@ .@@ .@@ !@P @ .@+J P* .@!@vP@ .@ !@lP( @!@P "@P l!@P  "@P !@+ 化!@dP  !@]P| .@| .@ !@& P.@ R`Q P !@"@P !@3P@@j _)`@P X .@  .@ P P  T.@ P .@0# !@`0,P e9PE?p@9W{ @ 0\C $E H: $E $E $E $E $E $E $E $E $E $E $E $E H; $E |; $E : $E ; $E < $E $E $E $E $E $E $E $E $E $E ,< 8< $E : 9 < : $E < $E $E $E $E < < 8= L= : : = < @; $E = 4P 6PH!@g .@\ 0@0  .@ & .@. @0p .@\q 0p@( g P.@t( 0Pw l2\q  0p@.@+{I P 0h:m\ d 0@.@ p!@ hI\ p0@p$B$#@P Q pWx .@ .@k .@Z\q 0p@( P)@& ( 0P%  .@Ct .@M\ t" 0@. @d0 x .@=\ 0@X .@  @ P 0  )@.@($\q 0p@(  P.@( 0P  .@ \q 0p@  P.@ .@ 0 | p.@ $!@y  )@!@0 4Ѝۍp @.@p 08G  ' .@. @@ .@x @  )@0U0.@pA0 ,$.@0,   P.@ 7 .0@ A0@ppoP$W w .P@.p@!@@@N}PQ /P .@Pr@P P PQ  .@PQ ђ +.@ OH@ T A.@!@+H P:?Pq I!@@Q"@v P 7 !@@,H  @ GW!@|PP !@ }!p@|P!@  }!p@|P  }!p@|P  $}!p@|P  vc!@|P@ L!@ki!@|sP!@ *!@`y!@|P-  !@ V!@|P 5 !@ L N @@}E @@xu @q0PX,:WgP ,Pu ( .@<P @W$ @S,@P=g@P `P:PwX 0@!@X 0@?Q   !@0v !@`pP+dG,, t.@pv T_.p@!P@ DV @.@@0 V P R P  0 .@.@@: hP Xa0,p=( .@ @$ @G !@ t!@ !@  !@ ?@40!@ !@5?(0!@ 5 P'0 ,@` .@P PRꞋ!0!@ b5O- M F  < 8h < uT .@.@@)@.@.`@.@ P@P P  z )0 p P Pg<.@P  .@p pP U!@!@ز@!@ P , .@P!@@  P. @ rF .@<.@ uT  P@2/D.@PP  @P  @P  P  @$ @ ЍP P @  O Kp@-4X .P@P)@P *H`!@@,P P!@4Fs/8H ! @P.@@ pp@-@P nP)`@P P @pp@-8\ .P@P)@P -M`!@@P P!@d4F+7 -T=IBPJ@ 1 A .@㡋0 P @)70 A 0 Q?7*P 0 %Pk@!% :S0: ` dp! 0!00FB% '; pC5"e! @-c`P/@ R6 .@@X)@&R "P"e! @Y@h/@ R6`p60 A@1kG@ p JT p"e! @bPZ%e! @bP .@ P RߍЍc pPaI*G. e" @bFP"! @?ebFQ%.Ba(/O@b"(r0r 27"cA"! @qdbPꌎ @u"0! @pb  .@P] ( .@ .AH- M  ` A ЍH-0M0P  B ,VPC0Ѝ@-c@_@O-M-JM .@P .@P/ F`{ Q/@1Sq@E  6 -T=IBJ 1 A .@㡋0@T@`p 50 A 0 Q 6`pX p$0 t+@/@! @  #! @ 0 b P@ [#.L! @F K @ P !@1!He0a딹kP IP?㓰dP:"e! @aP(#O! @` pp7ecDpa V 0&U@  `U'p*S0`p:R ?!0@!?#{ 03#0! @@d0'5;A0h' @a`[  .@ pZ@ `/@ Y h / @ P@PPP %f! @sa [ .@P-JߍЍ .AP(5@P #50 A 1KEI > p * P᠟P#gG#f! @Aa@ U:"d! @ 07a@O#O! @` pp7dcGp$aq/@Q `W  0Pp Qp0SY#f! @a`@- @.@ R .@P  .@ P!@㺿@O-mM@ .@pP  .@!@` P/@ p.ӳB`{P!p@$p/@_ /@Pv  PP  P p rPb P` @P_ ` ` ` P p^ P SP > !@P 7!@EP PPJ ?VbP p9 P tPPJ ?9KP p" P ] .@Q Q A   Q  Q Q q 0( . @ R pq@A/p@PQ p  )@@ U Pa/@/@ pP PP0 @.@ `P /@ YQ A  k Q q/@/@ Q Tp q Q 0 1.@/0@  0Y 0YS P Q0( . @0( . @I`@_  p pqP? /@gP7 .^ pP \P  A  qP P .^ R  @ P B  q P  P p LP } !@.@p p .@!@Kxpmߍ .@8!@ .@h!@!@!@!@!@ .@b!@A- W@/P@`  P,PQ A  P @Q:p ("P&$g@/`@Q A  n\P p"P IQ ]p< F@Ddt0$G`/@@|Q A  D[P \PQ  Q P ,P +p D`Fdv!@ @DF@@$/@P} $G!@P /@@@AP PP @k@ip@-MP4 ,X .P@Q /@!@  .@-&Pʊ!" @ wQb d .`@l2 .@@.0@R0P0R  .@P R !@,/@ЍpP P .@P  .@!@  .@j`/@#@ `=//@!@`/@ ` /@=( /@$@`, /@ =L ^ /@"@`/@ = /@#@`P /@ =x p .@/@ Q  Ѝp@@K-M

O-dMPp@Q`PP PP `W P  .@P V 7!@U x !@|  0ppW% $  P.@.@)@ `0S  !@% !@  P 0epPOpP  .@P {P{P p<  @ < <P $p!@R`P> Q!@#@P@ {- !@: P@{"T!Q!@f#@P@{P< !@P@u{`@T-QP!@P!@/@ .@P', .@d0 .@pWOQ c/P@!`@tP7 PpWB!@ @ 65!@!0@m/@@P  PU #{ᯇ P  PU {ᡇP {dЍ< t.@!@)9<s .@<.@yY/P@#CP/@ /@A- R .@.P@`P]!@P\r V/p@.@ @9!@;n P.P B>!@0@[!@ nP   @ nP  .@)/@/ @Q V) `/@!@ P!k!@/@) .@ /@/ @QA /@!@ ;V (!@/ @|I/@@ r .p@ @: !@P  1s0b Br`0H-@Q  )@@QR!@|YP/P@ l!@ 5nP W!@P #@P c!@{P0 0@-F/@@P , .@ /@A .@/@@ 9/0@R  .@ .@ " . @P j .@Q0 .@H-` .@ .@P  .@ P!@( .@ A-AP,h v.`@/p@P P PHo B .@@PJ=#{P P P)P |/@cpXP!@ P)H-P vP(!@N)!@@)H-P`p @aP my@ R. T 8x!0@!p@Rpp`FPj )`@ AQ >  PpT!@`T@-@P!@ (@-I/@@LAPO-MMP/@`p .@Q, .@Q P [/P@P @@P @/@ R G/@@P  YP @/@@ /@Q`@T`` p.@+:P/P "@+9p8!@+9pa/" x. @/@0T00 02 .0@U .@ os R 9Gdp0@!`@ 8!0@R/@@dP:T/@ U.@ oMx /@P .@ .@!@ RqkT!@  @@F!@3=@Ѝۍ0H-0MPp .@P 0P A @ A @P !@ 0Ѝ0HP @ q0Ѝ0A-Mf P.`@刂 |I.@P/@@pP !@P# /@X@PB   R6 1 )0@0 @ @2@U.  (.@ 0!@?%P/@}Pp@U PV .P@/@XP @  @ |pЍO-,Mv P.p@刂 㔠|iP.@/@/`@@PK !@IPQr /p@`XP.XPwP`!@ Pf .`@ !@2-!@ ` P A A BtwPC@ !@`-P< K !0  / @;U6  (.@ 0!@V?-P}PpU# P V .P@/@äP @     .@  M.@!@ a,ЍH-e'0 ! @/@2FP /@!@&H-`PA @@<!@ ,pP !@ ,pP!@ ,p#A- .@b /@ .`@Q p/@ @PvMP/@@ /@WPQpP"QQ 0/@C"Q "R  Q S0:  /@@H-MM@P$7r)`"@PP >P /Pvp` PP /@ooP!@LPЍۍO-M@T `PpdvPPpWPPX/@`~U@D` ~VS:PF p.@@  P@ * aV ᶣQ"*/vP*` @P  P `V: Q* XP @   000S Ѝ@-M_ @.@ 0Sh0DḷQPpXP/@I@ЍH- P .@ R& .@ R2 .0@0  Q " . @  .@ R 2 .0@0R B Q " . @ QA!@t%@-M! ) @@ "   R Q R! ) @ fQgQ mQ kQ Q bQO OЍp@-M@ .@PW .P@ 0pB QQ  .@PW .P@ 0ζp, QQ W `.P@ 0`巶p!@W .P@ 0`婶p!@ЍpG!@$g!@$O-pW% Q" S AP\〒@` @GT ^ *p\W ^p2P`pW ^U1:O- M⠡,H pAP`/@.@@A%Y Y V* `PbY.IP :%Y MYg nY mYb cYP QP !@/@cY.Y0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^4BQ1 堡,H /@V.@@*.Y.0TV* 0R07 2R1|*`.g  * /@ @QPP} V  mY.Pv Rc `Pnꠡ,H /@.@@GVU*% a/@P @PX V  RA `PLV8*% RB:2V-*/   R)*<0 Q0 R937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ/O-\MMp`@Z    7 4uP Q"P@7$4 4 .@P P R PUP $p=  p-  PpK  <.@8HP #  p4  ۳q !@@ M !@ @7 0;w΀0 @   4OuP "@$4뺀@!@ \8 !@T가$P,8pP! ӴH@b0`@@S 0B0@mb`ASCc?; / 㲀upP #P !X}AQ!P<` PT0 ゴp ThVz `_`!@7 \Ѝۍ<0H-@Pl0HYp@-`qP @@|P $@{P P m !@@@pH-P!@"@-@p!@ {"MO-DM@h h l0 čQc 02 0.@@B ӝ4 `p@@bA04P (80 S0 0B0@SCS?8 /pP #P "P  匲P$ pP #P  Q  A<@@  DЍOЍ/ @/(/H-M$Q 0 㣳Ѝ0H-@qP JP0DP @Py0p@-MP`0`3P @$`P ]0+u@ЍpP @-@SOMK@/O-P `YxOP !@ U0sp: !@WD/@/@ q$/ @ЍO(O-MLd@/`@ @{ 됑[)@P, W/P@ nP Ќp!@/@H  [  U  PPЍA-MQ !@/@P ` P ۍL/@@/@@P: !@ۍAQ`!@#P [?)@X,P` 0Q!@! @ @ /L}!@ q( !@ۍA8H-  @w/@H-BM )@` R0B`0p0R8 P6 X 0X0 !@, PQ/@@ ww$/ @@A(D/@/@ ˪%p`P3 Sp@PP PX !@㣅PO)@P : P 0!@+D/@/@ 〪$/ @(HwEwBߍL/@s9w6w@ !@H-BM )@` R0B`0p0R8 P6 X 0X0 !@,PQ/@@ < ww$/ @@'D/@/@ G$p`P3 p@PP PX !@PO)@P  P 0!@D/@/@ $/ @'vvBߍLD/@@,vv@ !@&M0H-M !@ބvv$p @P PT !@ȄvvЍ0 )@0  @t1!@>rvov/)@LAjP z: )@0  @U1!@H-M/@#@ }aG)`@t/p@P@P P9i k!@ f/@ ~nPЍ !@ЍH@-PM  @!@P P /@P )@\AJp !@ !@GPЍ@-@/@ZT !@v !@3\0H-)@|ATPL/@Ph  oKA-M  !@,@PN - Q)P@ /@ @ b GQV3lF!`@@@ cP {/@  P@&܍0H-0MLT@/P@\h@qDP/@@  & &0Ѝ0p@-0MLdP/`@@6h@wq P((  &0Ѝp0H-LTzD/P@@B J 0H@-@Tヨ@0H-@PP PP 00O-$MPPH@/@8\/@E/00/@ ! @)0@Qp \a ~0`@/@Qb pOP0@ Q0* 0@E/00! @)0@,\a p0`@a@Q8笽 ؾ   8 T \/@EP FP3!@ P Z @ P  @pP ;PP`4#@pPn  @pPm  @p8P/@ %/@P</@PK/@H/@P`/:HP0 `=Po    Tg0 0P] !@MXx/@D/@H/@Lp'gP*F "@ Q88/@3~  )@U DTQ/P@}QA "@'pP </@@xDT/@/P@x/@H/@A  @@ssssB0A /@@! @ :HpK PN  )@@XsP!@ @P p/@oB@)@ </@AlPP XP#$PPNP$Ѝ@2!@AU !@<F !@7u !@2 _ !@,!@'f!@" !@!@!@H- @)@0  !@D.H- )@0  !@8.O-4Ml P @4s`oP/@; DrL`@`/@/p@/@`P/ P  H /@Pep Q tQ j/ !@4@P`@rP@4ЍeH /@P # @B ᝧrH-/@/@G-M@/@/@P @zTF !@[@P ] !@[P /Q`d# )@! @꧱`)@ &P6J j@!@P!`@#@ P޴`Q8/@P 8S/P@ @ ᢵp tX/P@"@ ᘵp xX/P@P0J !@: ±P)HhP/`@P /P:@P4p0/@@\/@D/@8/@x /@0Rt/@H/@Q \xP/p@ RP </@P  @: |DdP/`@(/ @QQ P 4nop/@: @m$@[PA)@@F$@: QP!@l: IP @ : AP"@ : 9P "@: 1P @,: )P!@<: !P"@<: PP "@: P @:  P  @: P@: P: H/@@P /@Ql)@/@Qw)@|/@Q s"@/@Q !@/@Q &$@/@Q  "@H /@@!@ ဴp!@H/@@ vpS#@H/@@ lp H/@@@T ,EPH/@@Ѝ !@ !@ K !@u u u p !@ !@ !@G-MP@פ /@q$/@ͤ(/@ʥ,/@>q@mPS0/@H/@PKP/@c$/ @/@  O@ x!/@/@/@  @p0 /@!@  !@R/ !@ p/@a PdULD/@@ PJ pʔ !@IbP !@6&d 4s82 !`@/p@/@!@ vP 0@ Q :p  > 0@  )@EQQ@U4  )@X?)0@ R (`/@p@r R VQ  `RpPwP" L/@ Pw P:P /@p^ /@P @ ?  PP/ !@/@i1/ЍH- )@Q  )@p  /@Q  P:P /@^ /@P @ ?  /@/@-7/0@0S R /@0@^@@@ѠpnP "@@i !@ Q0S S /H-PU* &4 / @!0@\^^O` pW p`WU@PPPPPU `BlV U@`P/@/@O-M !@X)@P> (㐑/@Gִ d p)@/@@^P!@!`@ WP)l P:P @P?P  W P:P @P? W* 0P  QЍ@-DH/@/@@ -/@ @DG-BMd/`@ ; Xp@P , Q UP:Ag)@@G0/`@ S P s X !@ P yn/@ Bߍ)@o /O-MMPll@ @@llL/@/@DA㌗p `/@)@@/@P!  ПP$! /@ ŸPBP SP WP/@ 啟/@ 孟o aM L/@+坟PP>1`/@P   Q: hGP0S* P* U%P @q_Q:|P  R0B00R P 00P U:u qlP 1 & 1H-G)@P/@P K-M␁)@P @PT TP @P\1]% @! @7@!@P! @  ᭻P 4sge /p@ P!`@P 3 *`P  ᔻPPuuۍG-H p"@gPY y #!@"@ `=l?P @=P4 P@gP@?Q?P #P @ 7!QP $@ 'P pVH/@@Pq!@yA)@@P  @ P A-h/`@pG!PZ p)P@ @p`pP @P` XX@X p#PpP^@PM 8 X  @r P9 d'P/ 0)@0`p Q0AQ`0!X X !  !@O  @J P p@]/ X!h/ !@3#Qq!@Ax0H-0SS@7n @!@sP\U  ^U%0S! @0C@#0 0RP00C 0R100C P0U!@00B n@t@S @ T^0@0@00SS S@ 0p@-@`P P #"@fPgp~@pp@-aP)`@@P ifP P bfP @pH-@P # p@P6$ `V @fP' PxYP    ٝP  !@H=x!P P P Q  !@p@-0M@PX O)@P  !@X )@XRLdP/`@\    !@ qW!P@ !@ , =R RP\ ԜqG!@@ Μ@P7  !@y1P @/@P (@&P !@0EP  "@ !@  1 !@ !@ !@ !@ !@0ЍpO-MxLDs YpB/@@!@D /P@` {>   R (R( ዜ0=PO=P K =P    pWw !@`ЍO- M\@ @ix㐡L `/@/p@)@/@PP, K   [P  XPP hhp Ѝ0H-MLTxD/P@@B 㡝f> 㛝$kP# Z> !@  !@0P3P  !@32 !@0D> Dxm !@ ֛8> jЍ0H-Lq/@!@ HH- !@ /@/@qO-{MMPh`@d؉ԹP/@/@ @dP @dPg sܙ!`@)p@@/@  1@ Q*0@cP @dP lP nP @@@p VP   )@PPa@p Up-PP5 @ÜP$ pYP yhP[P⪮PZ  `.z@ ᥜP p L !@*   P  P[ !@P'd!/@P$0pPPJU᠜P` ; !@m !@@Y *`V  p3 `PP % !@" @0< P.#z@#%P-PpY U.PPpP%'!@Ew{!@p !@7X`+P /@  PPPYZPP@ !@cPQ P /@P  㗚P p: !@q !@6P !@ )@@l 0_P /@P-uPӚP゚qM /@P 0a !@Rm9 0`WP^P !@V VP !@0 % # P`P .p p➛P * !@Po !@!@ !@ 0 !P  [O !@ 7 @  /@HH- )@' @! @<@- )@@' @! @f !@)0H-MFp /@P  !@   P 0<q @P@ ᭙p P @TP@dP p !@Ѝ0 !@ 0 !@ MH-M   /@QЍH Ѝ/K-MIP/@@`P !@]t 0@^  @p  XP p !@ @ !@I@p" !@00Pr0`T  RJ@T` `@0d `@Vp@p:O0  }.ca@`1( ! @0.:. P @ @ )@8 X!@#@3Ѝ MH-M   /@QЍH Ѝ/O-dM$Pp9P `H3P P( (p @(p @ @8@@,PP `4``PLH,oZ  QP X ( S$(h(P夘P p5,@,X [  H p $ D < h XXY (QH(, 7z(QQ,H,*(QH,!(H(, P (H,( @ P w ( H,(C( H( ,  P b(H,( @ ,  S ( H, Q(   E (  H, Q(  P 4(H,( @ )( (! @80cP  (cp(8P5  Y .( Q(X, Y Y( Qr(H,P ZkP T d d  W !@8p ` `d ~ Pi` ` X(l84Y[ a !@n !@j`L !@` [:(lusPdЍT&| !@J !@ !@ !@ !@ !@? !@ !@) !@ !@ !@+` !@$ /@x !@> !@ MH-M  hH-rpq#@W P` p P pWPcO-lM$(AP>U@P> !@0P 7 !0@ B )@ B,p+0 4 C 8 < /!0@`@ 8 00  +rP !@p] ,@ テ0@p@P ((P;@202@DTP T)P*)QkH /@P P /@P /@P !@/VQhdE /@@PD   )@@*^P1P !@V"`D\egP%g 0/@q   /@Q)P XF /@@P 1P  /@Pf10/@X /@P !@eUU T>T:@-p4 /@@@4 /@@8 /@B&P [T /@PP /@P )@%6T<&%Hg1@-@T㰫P @H-駫PH-3!@U Q Q/@-0SR PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SG-0MT/@ P X ؄ /@Z/@" PTp$ڌ/@Q`/@ KP P+P;PP KPP P`[`  /@o /@ /@ /@b P P 4 P4  @P>9JPP4 2P50PKP# P, 'P P&! P K P KP nP K P       0@z`/p@0`z/p@ 0:/0@   "  ./O  P0Ѝ0H-Mh DVZP/P@ @ !@ #P u@P / "@8P !@"P u#P) @0@0PՠZT/P@ !@"P t@@ !@"P tP@PPЍ0>@@P@@-@P @t/@P@G@-MJ @/@@R@`                  !@(Q   !@ !@ !@  !@ !@ !@ !@Ѝ !@P /@ !@P0H-@PGP0/@Q 00HGG-M !@O"n"o)@"@F"F/@@P$@ /@FP3 !@PU $@/@6 !@/@9 !@ؖ/@ #@f/`@{"@/@< !@/@F !@B&/ @P&/ @$ &/ @/@&/ @&/ @&/ @'/ @'/ @/@  "@~P/@ P 0@@qK !@@P/@8 !@fP/@? !@]L/@B !@VN P!@/@_ !@Ki P!@T&  / @/@ 7w/0@R/p@ P Pz !@3l$@. '/ @Q /@!@P /@!@ !@$P/@P !@H /@y $@ (/@R PPH @/@  !@,P/@P""@H /@  !@0P/@8g1pPX) @C\Ѝ /@/@0H-OX /@P0 /@P; /@P G/@/@@P /@P /@Pd/@~P /@ /@P /@ /@n /@P /@/@bD p/@/@ Q J/@@P0P %OPU0h/@0HFd/@Ah/@<0H-pG/@@P0X /@P0 /@P Z/@/P@P /@! /@P/@ /@P /@ 0 p/@/@P/`/@ /@l/@/H- 0/@DH< /@P/X/@Q /@/8 /@PN /@,/@$/@@- h/@d'/@/ @Q t/@@T $/@('/@/ @Q @5$/@('/@/ @Q @@-"@tG/@@ </@ T/@ L/@x D/@p0H-P4)@  @/@P` @ H/@ P/@  /@P 8/@ &<t/@@0H-MPpPP' +P@p%`N-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 " |# # # # # # # # # # # /QPB@ Q* # # # # # # # # # # # # /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 bNPJQ004 )@`/0H-0Pq;P @+PP+P0H0Hx0@-M@P "@WP$  +P PPJ !@PJ  !@ Q S!@S[QJ !@zЍ !@Ѝ@r@-4@)@t' 0/ @0 pP@4& ) @  1 `! `@o/)@P !@&M\/@ H-@M@)@P! xg/`@PU VP! P PkM p"@ cP * P! @@0.p@Ѝ|/@  /p@- Mc )`@P P@0.@ ЍpP !@/K-`Rp@O r P T !@Ps Pp PpEUT  @ !@T !@ !@K%Nh @8/p pPw p PWpG8/p !@PTPs K.0H-Sp)P@@p , !@M@00H-C)@@P0H/@ R'80/ @ 0  rA !@NT /P@p  Z/P@00H-W@/P@P =p 0 (0 ?R   0 @ 0O-Mȓ)@P3J/@ 0p`/)0S0#S &ၹFP!@`pQ !0# "  WMp 匌P` UЍO-Mℇ@/@pW% `PJVJ r P@Ơ   0* ) (EЍ %"0 S  + 0 U Zt /p@[p  Q0/@Q '/ @ R 80 D !@?/0H-W@/P@P  ,% 80 r 0HsT /P@p  @0@-/@\ 0 S @ 0FI&0@P@@@T ^0@E@C-@>P ( /@ R 0aЁ@`V p T0!@@Ѓ/@P/(&)/O-M/@Z& (P R 0@0!p 00pS*0H8 /0@ % b0@pFT !0# " 3 @'@ T  ! / x /@P  )@PJ Q GP @0    @@@ @ 0S*@  0 p 0  @ @ v ! 0   W)'   0tP !  /@ p)@q    *bYHPp 8/@p !@P`U`vʎ !@`KF /@P )@PJV Ⲋ/@ 0V .uW/P@ 8Qp H /@P P/ !@KH /@2gIP  /@P#P8 /@P7/@P  00/@  @ B @ @0 P:(. ? !@3KH/@Ѝ@-/@Q" ( R B@ PRPP RPP0520Q @p@$p'p 㰀$PJ Q)@/0H-MG/@@P( P 8PP R 0PPS # 0@@0@(@ @@ @HO!  Ѝ0s !@Ѝ0HJH-M 05OPЍ0H-8/@ 0s0 0@@Q@0A-M@/@P&wP/p@2@` `(`,` P   P000  0N!   &q@ЍAcH-W/P@@T6 p "  `VP   傢  P   @ p@V f /@Hr&/@P/H-PPp/@`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP n)PPPPO-M!@Ω!@%/@[/@ [ /@[y/p@[XPX `㨰@P!`@!@ uP+P H-Q   uQ+P  HP {I :P rIbPP .P bP  wP pP cP  /@/@ [ [,PP/@/@`/@`h)p/`@/ @px0/p@09/0@ @0P/@@SQ!@PP #!@4F.0)@@P/@!0@ P7!@~E0/@!0@ PЍ_!@r@PN 3Pk!@e@P r!@_@P{!@Y@P  !@şP !@㿟P  !@㹟P !@㳟P !@OP ')@/ @0p`P 0p` Vk/@Q p/@/0H-@/@PP/@PP)@P L P/@P()@PPP0p/@/H-p0S :/@Q  /@ /@(/@  /@ SE/@C@/@S@# O /@! @  0@-MPE/@C@,@P/@P /@T/@OC@0$O /@! @ /@ /@ 0Z(/@Ѝ'/ @ RQ L R  000!30 00?!R 000!6+ R 000!9q 000!< x 00!?00 00!<30 00!930 00!630 00!330 00/ R R R R P/p@-P@P `PpP PU:` q U Q P@ RPH- \ *0 R  B/o"SJ0H-P@@P:C D D DD xD ,?% ?? 0? ?  ?P? ?0  ???P0H-@P`/@P QRpW`QU4 U1U uP Uu```0H-@/@PP/@PPH)@P L P/@P ()@PPP0H-^Q R RA 10S* Q1S@-@/@Qx)@P "@1S10S/ R/H-P@`PP)@Q pvNP pQ`)@Q pfNP  pQU!@@NFv@P@O-Mw/p@`P!@@QP8 P0@ Q(*  ?YP U 0@ ?XP !@F= T:  F5P.P bP cP/@T*@y VQЍ( (!/@/ @,/@0/@4/@8/@0)@/,/@</@8/@0)@/O-M@DPP0 ,<p/@/@/@  `@pT*CP P PPPЍp@-M(I/@@@`DPP ` hPPЍpK-M(qP@/p@@; Q2 ,Qj /P@/`@ a 0Q C QQ P `EQCQNPЍG-M<,q/@/p@(A/@@Q( `/@ P0 EnPUP@  AP0(/@/@Ѝp@-M`P@C  0  @AЍpO-M((I/@p/@@ WDP `p 0P G% pPW<,a/@/`@ 0Qz0/p@/@AQP0I(/@/@@x2,a /`@p ARpP@ЍP` w0 I A ZYD!P/ @@/@/K-P3  /@`Pp PU @gLP@᝜ᛜ PpUp W SLP p pp0H-@A/@@Pd)@P0( /@PP0O-MP/@P 8q/p@P QP!H1/ @/0@PQpH/@jPg `H`/@P ~H`/@PP/@`I4q/p@PP V@AL/@@)@ ?oR2R@Pp U 8U pU U U V `OP`P T`P`ЍP ()/ @jP`P`p@-M(a/`@Q0  l,Q/P@/@@ PAPP =P @ PHQʴ=PЍpG-M⠪ЍG-@ML /@@3TP @ЍY p`P P@U>V`:ptqT/p@" PHad@DTB H-tQpa/P@/`@P p@p3TPP P P7P @WP@T @g@@-@0t/@ @-@%@t/@ R  @-P@P@-u@t/@ O-LM x/@/@ @pQ〱X /@/P@/@/@eAtqd /@@/p@/`@PCP "L8 /@P {PPZ ?!/ @>9P P B /@$Pwa /`@P P . /@PcD/@P[P!@;EB`IP } @;VP :G;(;X /@d /`@P@a/`@eT /@PetePjpP6PDʈaP/`@ /PPYPF /@PU W W=WPI /@eP P P.W 0G P:u D eP/@@l X adP/@/`@/@, R{Pp 7P iPP P dP  QP `PX a/@/`@iXiP iI "@UHcQ pz z z t $t Pt z tt t { 4{ { { t | ,| p| ,} } } z ~ 0~ { y p ~ ~ L |    r r $u \z @ ؀ @ p v z z  H h ܂ \v d p z z ؃ y z z z p \z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z k /@P^ o |#@)@`@Xp`%X a/@/`@.MfPC W W P #@Q2:PD /@@P /@P x/@pP `0)@}Ai :P  >@ ECP A)@PH-60)@?]%D P/@@Z WSGQ  s xw \q \q \q y r \q y v \q \q \q w v \q \q \q Xw )&!@{ /@P X /@P /@P P7PM aGP3/@/@0@PW6PP 6`/!W @W *Wb /@P]x!/ @7Q  Q  /@6ak @m/@/@ /@Pd)@` E!@QX a/@/`@l 8 @Dc /@x/@rˡQ /@P%!@(s /@PX /@P /@P Q.``. Q`H,P/@`|)@`%d^ #@JX D /@/@@m/@/@a"6P Xx/@&L)@*qD /@@Q 9/@ @Qb @*WbW !WQaQD P/@@(3 (@##! @08H1@Q* @p P   /@Px 7Qt x!/ @! Q L)@D /@@ X /@a/`@eQO D /@@P /@PX /@PV /@PP_WM-W +WHQ6/@4P; P$ /@ a@P3$ .6P  $Q !{Q/ @ @2`QRP$$@"/@D /@@P keWs!@Y /@PeD X /@Pe= /@Pe6  Pe2  Pe. ?X|+3FHo?pˡN?:7p@j/`@ P>?*7 _\ /@P l <'?(?7pˡ? 7 /@QK PG/@Ap\X@j/`@ P>7 /@P/@ N>7 p Vf /`@pp>}7gN!@Z /@Pe X /@Pe /@Pe  Pe~  Pez >N7?+ep>D7e/`@L ' /@/@/ @0pX /@/@/@0k !@pe JP !@{ RJ0ddpspAd0# /@@ R  {JP 3!@c /@P  1/0@/@0/@0L !/@/ @ /@  Pe P {e9>%6=/ !@pˡ+>6 /@QU PLPpˡ>6R>6P ()@(!@ /@P !@R8n PL /@K PX /@W pˡ Pe s!@p1=|6 /@P/@ P & / @ P /@!/ @x1p /0@ ~L)@=J6"x/@ /@ ra/`@ p a/`@ p x/@rˡIL)@Mr=^6p /@P /@-^=J6qtve! /@`fP 7P  n pˡIP W!@` pˡ'IPU `/=5 X Pe/@H 0! #e  /@ !S=5 p :|H/@/@#/@H/@k>t!@ /@Pe X /@Pe /@Pe  Pe  Pe 4)<q5 /@ *<h5 /@ ,/@0+/@! @1" e`/<L5 /@P /@O  /<85 Ce[(!@6X /@^ pˡF PeH 2P fP "! @p !@ $!@ A/@@]<I5 pˡ' Pe "! @p !@ D !@?}e I/@@  @>Pm P !@~6|)@`^ #@<4 /@c9&; /@Pʠ /@%/ @`0V0H/@F`˱0 Pʠ /@%H/ @/@0ppT& / @ Kc!@*6eX /@A/(!@(!@G-p;;_4눇Ȥ /@ /@ W 堕P`W@/@@RU  f PU g48We 2QeK-`Pxq/p@@  =  P0@  7=`娑/@V VJ  )  P  =`@r!@5T KKH-C)@@P X /@P0 /@P8P */ @0s  H H/@PQDF g/@@/`@PpP pPp@-//@ J `p/@@@ @P$@U@jw@`/@PoV !@jU U^ #@ @`D/@p@0H-:m3Pf @p/@"P.PF#Pc $Ph %P /@PT/@%#!@0H4 P@ P PE P0!P Q/P@P 4 /@P1/@!@P !@@+Q Q Y/P@P Q; "9/P+ 7P7 EP /@P 7!@0H$P P /@P+ 0/@0H!/ @0 !/ @0 0HEQ/@/@/P@0 ./0x/@!0H@I0H|CA-Mx/@ p7/@   )!@  4!@  @!@ L!@  V!@  a!@gS`@x!P@1  0x@T'"@" @ o!@ iD/@Ѝ/@Q/0H-P@U ~?0O-$M@`S   2P `nH@@P @ pT W QA/@Q =P 9 0AS R 1@P P  P *VPp Q:@ P .P ៓p @P JI Z P Y:HUq P@TA$ЍH-/@ /@/@/@HO-MP6 @JP,@ P!pP PB2PUT!P@@P PPV@`pP V@:XЍ@-~)@2x)@E!@P @u # @!@! @0JP  # @!@! @0@ # @!@! @08P # @!@! @0@-0H-Q0P@ P !/ @00!@0H20H-Q0P@ P !/ @00!@0H2A-@`PQ >PT #pP 5/@ =!@(PQ !@!PQ  pPM !@ pWK-MP /@@Q@qP<J` pp3@㐈P-  06p!  qq$ 'WPMP+P PQP@P M@ᚊq@ЍᒊGP`@VEPVnPVdPqU/@/p@PpuP cP eP PU*4vP #PU* PU*@xP@p@-aP/`@ @PD D  0D14 /0@/@Up /@K-PG pA@`Q"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi /@@-M@/@ Pf&PQ  /@QЍPo/p@-Rp@P `rP pW!@p@V1H-M/ !@ O1ЍG-Mp /@`PX /@PЍ `/@P ġ@`/@PQ p p<iPU:P Pe`ЍGW @R d 3  BP`d`3`dV P HV)dppU PAPEP`p@-`Pe@V p#U `U aU B@/@PC@ C@/@PB@* @/ @ R!@#"H/@p@-M`7e@P1JP;P-.P);P&'P"V @U AU  B@/@PC@ C@/@PB@mQ /@Q@#R"H/@ЍpO-MPPFp/w YXPp YP !@ 0@ @CPP Ѝ`wp 0G?@ BPp/w P wp?@ CP O-M@`/pP /PPU+5G)@PWP* 7P Z P@T:4)@P PP @Ѝ0H-@Q P. R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@, P0P0H 0@-MP5 p  /@Q- @T TPP% !@ #@,/ !@ /PP!@ Trp ,!@ /Ѝ@- /@PI/@@P P@P H-/@Q HO-MP/@@PV cP  Z >`{ P /@U Z;  7@U4 v @ P  P``pJk !@.7P !@'7P`  Y` `P  @7pPp)`  @ 7P !@7P k !@7P P / !@.1p/@pp /@PPJ,P !@@.  0"@Z` @ /@   P   /@ </@ p  ( /@/@PPQ?P Bv!@!p@  /@4 0. r- `@ aP X-ZZ P ㌱P T :6@T  /@PUJ P/@@$ /@PQ`  @U6P nP ,0r/p@( "/ @ /@P k,P# "0W4/@k !@-6P !@'6P }@d)@ X /@P P@Ѝ6mpڄ p/@PH P P !@@z. YP 0m+@-I/@@P, 0H-MY/P@P$ 0p  o- P @ R /@/@Ѝ0P/ H-@P`Q p3ޅ) څTHp@-M@qHlOPP Jl /@P'!@@.Pee!`@`UAU DU. OUaU dU' oU -P lS)P@ 01 q liM )@pʩ!@@;-ЍpO-M@/@PP  @`@U +P-*P@P U'*  pW + P*p@P W *@PV3 `; 8@V P ЍOv@@P * Ѝp@-`P  P@\P U  EPpT  =P p@pH-P /@ H*HH-/@*P !@, /@ @rH" /@ /@  /@ A-Ȅ @P`/@T>DpUP W PE` 0H-@P%P PP0H0@-I/@@P @@e@eH-jp g*H*O-M-MP P; h !@͊! R  P \P P:P Gf͊ @A!`@ P*Tp  P `PV D2/P aP PЍЍA-@*D4)@QPP+ 5&P) @0PQ!@PT!@- hP`@`*pPP PW ɮP@PH-T!@ P@O-MPT!@ P@j*p(W/@O 4`5)@)@ PP@WWV !@`P!@`5)@4)@P(/@`@  RP @ pWY P [@'*@4)@c&05)@! @ P +@`(@V/@ p P!@ @W pP!@pp P ሒ@U`PV ЍK-MP@`PЍP)p)pP \+"@!# @ 01 X @jp(j @ "@-@!@@ @G-P@/@/@`p#Q%QWWP P #Q%QP )`Q `p `@#Q%QTTP P #Q%QP e)`Q @p@-` /@PPP)Pj&! @0@ P`n2PᨂP᥂ᣂpG-M /@P ЍT!@ P@ @RP `n!@PwvP!p@p ) )(P/@P !@!@Q@(`@|P4)@5)@&C! @0T PQ !@nP!@`V v@!p@( ͤ`V( @ ä^`*V P P G-MP@P@  0@J.p8 `,hP1〦 @ P/@/@ `P DP  `P mP  psPP$P `V:@U@ލH-M`x @@ P !@ЍH'P PJ(`G(`p+@!# @0 ᣁ!@@ᜁЍG-@ddP EHP  `ᬐ ၁(PpP@ppw W 0H-  @@%1PP k !@1P !@1oR0p@-M@P  OP RۍpO-M` /@pP /@P!@PPz @PT|PPE-PD  @0PJ De  %R R   0%S sS4P-@ '`'` 0p`pV5 U @ T@gP `@!@p(p/@P pp[ :P @!@@pᯀЍA-MP /@P Ѝ`O!@P @ %R R   0%S sSP!@ЍA5(P 'p'`'p 0`Pgca@\T ЍA@H-M hp    @oЍ0H-MV @/P@P |hp(PP'  P# &*IPS`)@ dhPJ  P&5P?P)@ዏ$PЍ0@-M@ihPJx| 08,ЍpC-M@ /@P `-hP "/ @ !  2/0@Ѐ "!q p RЍp@/@-@Z&Pp/Q@0H-$8"/ @@0!P 0086 /0@0S 0H0Hp@-@/@P p<p `(@P!$ /%$oB@@-@P (P@3@/@Q/O-M /@pWP@P`<P`n%@T /@PW] /@PW /@PP\ /@PJЦ@P`/@T(P`%&. z/@/p@ /@ f p/@ W  06P`/@ $@ $@P` /@@TЍ@-@  /@QI( @O- M0p@/@@P  U/@ P l /@QJQ@P pP`" $ /@P 2 /@ h"/@/ @ Q!0 1 ,P` P`DF Z/@@<P /@@P !&% .(''&%(P ('P ~ )@P 2P)@P 5!@$@X[WpW`P,P` ! %P' ! A(P(P+ P`'Z  /@)@ % &D /@P /@P #D/@ /@P@/@@X /@@`(PP` @ /@P (P ЍOP/@ Z a )@ ЍO0G-M@/@,@P(`Q 0/@Qh /@p D /@P /@@ P T /@ P /@Pp $ /@P 1 /@ h/@ 0V R k0Yp@+a`P!&X 'Z~%#@YT Z (ЍG0/@Q/h /@p/D /@P/ /@@/G-M P P ZP ЍG& p 09ЍpZ /@@u'P" /@P W' Pd @P/`@`& 0P@&X& !0" ЍG+ A-MP`C&p@p  0@ЍV 3&ЍA p@-Z@/P@` R ` r `V V@pP/@-@)/ @P )@0Q0S0\ 00  Q 0R0C0L /@  B ||@|)P) @0SQP/P)@ R/P)@ R/L/@/O-MP y`)p@@T ,P2 @M|8f@V[ 0 $ @ P0004000@  Q  L/@" "X* |!|T ЍP/P // a @/ ` A/// ////0/0/0H-P4@PP {4@04/O-$M 0W $' hbD H/ @/P@/`@/@@(+G P / /@ P ?.  * P( #+p P Y  E Y + ` po 0P `pP@ /@P U U`pZ P P @`V@p@DTVD /@@b Fp ` F FooPp V Vv pe P0 P, /@P V VU T& PPD /@@` ) @`PATP@ /@PA Q@P -D P`/@@ Pp`PX /@P`7 /@P+ V V!  P P D P/@@P P`M/@PX (+ PP`D /@@W /@P  P 0E  P ($' WhbP/ @/P@/`@ /@P  0  ` /@PW  p P P p $ЍO  $ЍO-M D@QV   0 (*ЍQ OH 0H-M@P /@ 0Q P ;Ѝ0O-,M$G hp`/@@/@wP &. /@ 0W R ,W2P` T /@/P@P @lk T T g P P p Yp PPP P(` mP` $ `P`p  /@P X  P0,P  /@P X XY `Z(N @TJ/@V@@P]/@PX /@P X X +&XZ`Z`$G h/@@/@P: P P P2 P  P P PZ(, ~P$G h/@@/@$p ` : ''P#$G hP/@@/@$p `X /@PT R  ,Ѝ /@P U 0 PwH-@p P'Pp P P @P@P)@@\`)@x@VP@TPp@-yP E!@p@p j@/`@P@"! p@V" 0s B @"! pp@p@O- M`@ #"PJ@@T! 000P !@ ЍO$ tP! !d0 /@P~  ЍO%P!!  pq V  P᜚/@@XM !0  D &`P Z@XP)+ Y`@!& PXPp /@ 0  @H/@ H@/@0 /@00@ `@D /@P 1Hp/@p{! 0@ Ѝ 0pH-M !{! r   0ЍH-P `!@Hp P *P/ @  BHp@-@P`P1p P`P /@P  p@H-M@Pj`p pP uP  !@P@-Ѝ /@P  /@ ЍH& / @ ~!@ЍHA-P@p!@B`p!&  0PP0P& 0`Vp/ @S A!@AO-$MM@PP!@PP/@`P )@`1 (`)@1,`<0 1\rX/p@T/@/@`P`P )@   @&P !@ԠP )@` gzP ,Pj!`@ P  ᓺP!  !@ ㌺P #nGP  !@ 〺P  !@ yP p 0 S SP0g0 `<S !S <SRP=Q P=S >SHP=Q P P=QP=Q P P B H t W QPQ@ j Q!`@D QX\/@QPR2 !@!@[jP!`@HPQ4 jQ!`@8 Q>\/@Q68 C^Pj!`@4p l+p! @2j!`@ !@,\j/@!`@Q\/@Q \j/@!`@Q\/@QWp Q Q q"Q#Q P Q\Q Q Q Q P PP[ =tYP `P+P60PjT!`@0Q Pq/QTPP P=P P/jP!`@U P PP=PTJ/P P P TP Q Pq/QtQ Pq/QtP P P/pP U U U  !@!@cRs !@!@]MPU U UP ` %P `P !@BdjP!`@ U UPU q=/P LQ Pq-/QP"/q/P  xP* ET/@$ЍۍA-MMPP/@`0X/@^+@! @ Q `0 T/@:ЍۍH-Pp^P' \P1 @aT>0DPz* 0r !`0 B@0TS@0:Q r P )@`/@ `"/ @0P00P0`"/ @  S)@0QkD P00@  , @ Q- `0TSCbCPP @    $ , 4 ZbT eT`/@T  `"0!@q!@@ $@u #@CSDS LS RS +1S BS %US" XS   C^P#`/@0#   ` /@ !!@  `l+/@! @ `!@/@P !@``0H- !@lD/@@P  @ !@pD/@@P !@ KtT/P@ h/@@/@-/@- U@/P@- @$T0/@0P3/8/@/0H-t /@ | 0 0 0 R8/@@D/@@@/@@H/@@L/@@P/@@T/@@X/@@\/@@`/@@d/@@h/@@l/@@p/@@/@g-/@d- U/P@`- @$T0/@0G-Mt p/@`P?  V /@/P@tD/@@7 { p-P/@ #) @ q W-)@ Q Q |P & p|pp0/ @ (0|P 0p|pp(0|PP4    P 0 E} /@AQ 0|pQ`|``q (0P %|0Pp`|``1p( | | (@|/@Ѝ t & /@/@/ @0 /@ S Q/p@-tT/P@` VD/@@!R, `V`@|/@ `pH-pP0U H`/@PPVv@F@PLPGtd@/`@P @Q GP 3@P, P 3P"&/ @/@w 6/p@/0@@p@0@@ /@P A@P@@@-'6/@/ @/0@/@@/0t$t/ @@/@ /@ x/@/t%t/ @x/@ /@ @/@/Q/H-l/@]PH/0H-@PPl/@OPp/@H@P@0p@-@P` hPp(P p@-@Q T5 Q \T.QJ,! @ R  R DoQQ PT l/@PQ/H- H/lqA-`u@/p@P`P  Tw /@  Pn# T!  /@PL /@XE/@@P /@) /@P P /@`PHw/p@P6 X/@P( QU%/P@/ @@ Q0/@2P@ E/@@n/@ ?;/@%/ @P /@@/@ 0$%/ @ Q P P P /@ `P/@O-M… PEe/@ /@@/`@pRP P /P) Ph/@PPC Pg @P} @PuPl/@w/@*hW /@PU L /@QPO t/@ 0S S CgQ/`@Ctd/`@P p n @P6QpU@/P@w@[*0e /`@/@*M*VUEQ@ULu/P@/p@Q/@*@PqNP t/@ v>P T/@P<t$/ @@t$Q/ @ p$ P/ @p  QPA/@*o@@ PQ_W g/`@ P_p_W PpP_PPg/`@ W) /@P) L /@QP# ,t4) @@ l/0@/@/@|p1R0AMQK B1Q0BR @EPW^i `p CpW p!0 2kPQ? PnSj '@P/@p P\@ `  0PPAHA)@@DIn p"`@@  PpGW4@2 T_p/@PPPwxP   0ЍOPP l >P   0)@P@pp@ЍPPCA-鐅P/@Pe@p/`@F2 0 PpW@@-XE/@@P/@O-MXE/@@`P/@`/@PZ/@ V@eĶ z/@LEt/`@/p@/@@/@P|& RDH/@/@ lV /P@ @R    @R  /@QpU/P@Q   0 0S  h  QP/@P Z/@P /@Q PX  B   :h @/@PPЍ0H- /@P#lm/@P Z @!P@p @Tl/@P0\@!P@p @T0A-tt`h/p@/@ P@P ʝP`@H%/@/ @0QTD5 /0@ @-t/@ 0RA ^01 0Rt$/ @(/H-\%/ @ R & / @ R P @ P t$/ @|0S1(00 P  B! ~ L/@\/@/G- p`r, P(p% d hrt@P/`@/p@/@@UP@Pm@t T`pYXP`PpG-h/@pP*k@&kT`V V XmPT Smt/@ !EmCmPPPO-M Pp` APwP;htD/@/@@P@ P# ȴ `/@v+ UpP 0@Q: QBQ* PBPE`` P `pZYЍ`pG-M`VQ &p@  }PP  @  P@@@l 06`F@ VR:B AЍH-U@/P@` pP 07pP tth/@/p@ @P(P`G-頊/@`뜪/@ RP 0!  @u`@/p@K 0R`T@ 0!  Vp@-@PPJ` PP  ,P )@s{Pp /@P,#+/,) @2S/Q/)@2S P)@"R P)@"R P)@"R P/H-P)@CA-M@P`pP P p P@"PPЍ@-& / @0 S @%L5/ @/0@ 0@@/@ P O-MPTD/@@d` @p/@+ U/  0  @9 /@@ p/@RPQ %P/ @0p(#*p)6 X 1h/@P Q' p p0V/@UEQ@ /@ P @ P1@TpW @U tt@/p@ P  P@ 0@VP V  /``L/@/@pQ8/@ # "t/p@P@ @T/@% @@H%/@/ @0QTt$/ @D5 /0@ 圕pX/@@ @T`Q3U p/@$t/@ Q&PR 0ppp0pqq 0R A P F `/@@ @PЍ0H-MP  @/@QP@p2 0QЍ0/@ cR:c/@00/@ P!./ @(./ @ @/O-/@pW /@@`T@`@ `P`P%`&`V pW@ḎP/@`/@V pp`pp/@`VPP ` 0 p ؠ P TP PUV RP0A `pVp0 `0 R A 0O-MPt /@P@%$Un/`@P n/`@ pRpPp` !Ѐu.`/ @/@WU0Rp0^0/P[`РVȄ /@ 0`Gp&'B XV  0#ZUP  ' P(`ЀUȤ /@ 01`p&' X&U  0/@ Ѝ/@p/t /@QH /@  !@@-N/@@PJdP./ @  0P7 !@O-MPPpt@/@Q ` 0pRp!# " /@pDP5 pU"p# pMp R0UPpF*PЀpU 3d /`@  0p + ! XU pЀXd /`@  0p + ! X  09 ЍO-M@`PDpo/t[J/@ Q@`p!&o T@P` pu P`&0 p'pЍK-@P!@S밅Ȕ /@/@`PpP 0 0@`p& / @ R/& 0/ @ P0S/O- M`-P`r^ #@JH!@Eee!]Op O!pUOx @&PPP*P@@UxgN>ON@;Y P !@  HH/@@ ЍOP P [@ X ܹ@+# @ 0 g@TG-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P a !@'@r@ӥP: @$ 嵾^ #@  !@ 5c 㬹h p p  Y `P2p pPwP w P  ppv^ @pw W p pPwPw P  pVp @PUmH/@PK-P/@p@4T 5T'#T'a3  `ppPp f@ P6TH-o0H--P$P 'P(/@jNH.P ^P E /@/@@PPPPnP E!@E /@@P/@P fP#GP @p !@@J /@PE :/@@ /0@0PP 0 f@00H-MPP @ jp Y/P@PP0P af/@ꖽЍ0a@Q/@/A@Q/@N@/'P/@j/#P /H-M !@  ЍH-P q /@Ha@-M p N9/@@/0@k0P6 f/@ЍH-0P7 ^@/P@jTy/p@p  /@` Pff& efP P`pye`P`P@ P H30H-@P )/ @ Q  !@n PA00H-9./0@/ @ 4 0 S@0%@$0 :p05Qa#3Q'H-/@0N A R qG-zP/@@rJP $`5Pneke@D6tO-$M /@P*  @ 'N 㘌 `/@@@!@P r 0 pW>p P  0 p ` V$Ѝp@-MPmPI PP``P> @ P Q `@ P.JP/@UP UP R Q @ QJ 0 S  0 S  B0``S# d `Ѝp0H-M@ /@Q !@Ѝ0H P P Pٶ/@g)@PJ !@)@p   /@( !@e Ѝ0 !@ !@ζZ@/P@P d@jdЍ0H虾*0/ @0@- MP P PF.P-$@ -) @Q, 6 !@' )@0s&ڂ- @! @ g P DP0@0S @ !@$@ 3Q L !@ /@` !@ Ѝ )@  /@H-M )@ R J @2/@0@009  /@Ѝ@- MP P PF.P- @ R-) @Q, !@' )@0s&ڂ- @! @  P DP0@0S @ !@ @ Q !@ /@ !@ Ѝ )@  /@H-M )@ R J @2/@0@00 /@Ѝ@-MP @P  !@@R Ѝ@-MP @<P : !@@A Ѝp@-P Ppᐵ /@p /@P ^!@p@* ᛵrE@P p@L6Pp `o /@ p@0H-MP P P"^D)@sDZ@)P@P<)@P ?c@ Ѝ0H6cD  )@|!@ Ѝ0@-P4 @/@P 0/@ /@"@@0H-M@P P P5d\ /P@lP=P MP hP4Z@)P@"H d /@/@ / !@ mP wP sP@0Z@)P@ d /@Pd /@P@8Z@)P@bЍ0P/| /@僿P/@Q*=P/@-!@PJ)@@!@ !@!@< PxP!@ !@/!@c!@!@!@ !@@n@-MPd cRA0BSA@ 8L9849849498494949498849949 994949498 +mRnR sR uR.dR kR(       1BP O& / @ R, V!@Ѝ@ @p}@!@  Ѝ9 !@O-Ml"pP@/ @0T* P@W@!T*00@ P ? ` 0A? ?*W@0l"X/ @P0T* P@WT ,PSS ,) @0@)@ЍK-MM@P P PCHߍۍKꈜ )@"@ p @P lb[@p,/`@!P@W:+ఀ'!$pW0"@ e @@@)@ !@ /  !@@* ߍۍH-MP P P1P  R! Q" !@ЍH 45)@)@  !@  4)@5)@ 5)@5)@ 4)@Ѝ0H-MP P P/@8:  P 0@P˾@  @P & / @ Q >/@ /@P E /@P @!@Ѝ0@Q*!@P /@/P/ /@P J@-PF /@@PȻ@-MP F /@@P !@Ѝ@-MP F /@@P +!@kЍH-P /@P /@P<pH2H-MP P P )@^R Q )@¿Z!@ 7Ѝ0H-0MP, P P4F V /@@/P@,P,, !@JQ" !@ @/@*0 /@! @S!@@ , !@-Q t!@0Ѝ0,,P @-MP Pc P0QSSEC ^: TBxBBBBBBBBBdSeC ^/ TBxBBBBBBBBBC ^& TBxBBBBBBBBB #RS WS ^S   S -S rS wS S SG 1 CR C0!@9 /@ E  F   K    N    R    W   0 >0@@ 0RQ-!@G /@Ѝ& 6 / @ /0@ /@0R  S0P /  /@/@  /@BP/@-颾E 5/@@ !@O-MP  @/@P Q Q 2/P u /p@@@ HQ~ GEEEGEEEEEEHEHEEEEEEEEEEEEz` V  P@a ERPP3Q Q =QT QQ35 !@ㅁaHPPP3@`T @PDFFGGGGG8G o% ! QQUP   Q Q~ X$ nX4 z/@Pn  Q @0 PT  `R 2/V ^QOD /@+ý5 !@ 0P1 `+P /@P o^|/@-Q ``` KbN+Q @@ +QR  /@ 2Ѝ `P!@T!@ @`!@H-M0S  4#/@! @0*ЍH&9#! @* /@ЍH-M`@P<p-W0A Q:TU xP!@ pT-W` T U _P!@ ЍA-M`P* @pqPQ& /@pP \Q`P \$Q T 9P` `QD !@ i``ЍA-MP  @pP`@W@ f /@!@!@ЍAEW  S /@!@ 7QQW W!  @POLLM$MMMM`MW5 W0 W?oQ5W* W W/ Q QV%WY W W  QAP!@  o  P PV R X2/@PX U@Q *p!@P X H/@Ѝ!@RPSo/Q "@ /oPH-tH !@// /@P/H-M /@ /@D!@oЍ H-MPp`خ@0D QW1 5 aR0`0FR`@`3 0`C V:R` 0bkZ`0bA` `SA` jbah#fd `0+WV x !@`&ЍT 4 /@/@ QR/@-!@{P4 /@ )@Q@P T 2/$@P-) @0S/ S  C Q $0/O-M])P@0S@ ` pW) >P@AAQ:-P X T T DoP堂 p  p$PZ  RQ   Q P   ЍH-"@P#P$)@/O-M, ㈗`@/@p/@P0 /@3Pk p/@P6 H /@ ppP@ /@QF  /@Q$ )@ 0 /@P lB a)@PN iQ  /@Q QB G  NBPP (' U/ @Q8u TP P#P U /@Q0( / @P  AB /@P  /@   /@ЍH-0 /@H-M |H-M@ cP``,! @0pPЍ0H-@bPP1X /P@"@ |}0O-M(`,Pp 0@ 0!W!)  %&9#,@ʇ t'6#z'0 X ppPpj`VP3UЍK-P@p`d0%"W$! y ($5#  W4!00 0dp W2O-M@@ 0pPm` 0*"CU_ᐔ  ' [$5#j 4#Z%0Yppr@W3[ЍH-MbAQA#,/O @" @ 2AЍH-M /@ H/@Lx /p@QP P`@V ?@`PЍ0H-@T /@Q [(ZP )P@/@#P: @P /@0@-(*P ) @/@@P, )@ @PH/@@-@, )@@T /@Q/$@-P@PK-MO  uP`"p@? Fb@  E y-PhЍK-MO  uP`"p@? Fb@  E y-PhЍK-MY pEpiB P`"@@uvaPpEy-PhЍO-$Mp`P@0@ Xa@QW@A@Q7@2XJX 0`  @0 t@P PPT$ЍO-Mp`P@0@ Xa@QW@A@Q7@2XJX ?`  @ ? ;@PPPTЍO-M`Pp0@@ Ta@QW@@A@@Q7@@2TJT  0`g 0@  pPXPWЍK-M@Pp%P PG pPPmP%P cP dP 3nP xP- sPP `pP%{ʷP `rpP 0P `dP p@pЍ@-M@ P @IPЍH-8 @Q 0@ @ pH.p@-PX /@@KP,  /@P붯놯ܯ/@`l@P !@P P@/@Ph /@QH/@p@L p@H-M;%!0@" @0ЍH-@P`pzJ㠯3P PPPP @PP @PZT /@0H-M@PP )@0 &"@" @;%!0@" @0Ѝ00H-@PP @ᷮP x /@PH/@ QTx0K-M@p /@jPPVP p 㚩 0PppV%㎩` /@ /@oQ" .`pP _WX !"@P оRW`WpU KWЍ@-@P @Wo/O-|MⰰPᤀ@᠐ ;  ` /PQ  P   0joP  #` 0V pB `CR JS 0@ S pwp`pppp@@P0S ?`U-p /@ [Q0 02@Q0R0s0Z0PU p0p[X 2@XRqQ 0S @PE T:  ꤀ @ 000![$ "(; 1q0WQ|Ѝ$@/p p p /@@ /@@ /@@\ /@/N-\ /@p/@0SC P Q 堎K-p\ /@ /@Q 1PC00C1SPʁ蠋H- /@P\ /@ d O-Mj` /`@/@P3\ P/@Q Р +0* 0 P Р@+0 p*p BV4@\ /@@P * *+@ЍK-\  R/@*/@AQ/@A 1 0# "  0AP 0$ `%0  0a1X @ p%0  $ @P@0H-\ /@ @0\0:/0@^00N @@\@ 0^00H- /@Q0\, / @ @0P0s0: Q00 @- R \< A/0@01$ P r :0Q P/@@PP@/@- !@ェdL l /@@!@4 /@ 1 !@Ru !@qH !@m0)@ !@g4)@ !@a8)@O-Mp `p /@/@P Y p"@/P@9P:P ?P \P@P   `%P7 .P P  @T `OThaDQ (pLpTp\ndpoopppp\nlppppppopppppt /@Q PP@T u`bDQ  oqqp`qhqpqppqqppqppdorpppdrBDQ. dop|rrrpppppspppHsN !0  0BT DTLTSt /@PN ;! F  @Y?TTDP   @mPT96 # P 2p p /@/@P%/@ P P< /@q!  p PPP`/@ P & / @0*/ @ PRY/P@|P0 \B&L@#,T P  cd Pp'P@!%pᰮWt P0oZ  hp$ p< / @/0@P|@ Qw@Pq|P2 ꈮ ^  r* P p $& :/ @/0@ P0  ?+H /@e 0 R : p P2 P P 0 R : p0    pY/P@G0P=  j 0d^ "@b0p /@p, / @!@Q !@Ѝ0H-@b AR0TPQ0P iRjR tR mR BR bR  /@0 0>S:S Q\S 0SS/.SQ?S/0 )@0H-H d\ /@/P@@4 /@oPB4)@< /@ 08 )@H-@pt P/p@p `/@  RP  ap@-@S0P Cs/o"TJj/`@@T @A !0  /o"Rpp@ox /@/H-@@/@P T T/P@`V4/@P z/p@P@ r ˩e@@T)o`O- M)@q F 4')@/ @ R: @/@P 뜊/@P'@P`p ! &@  [  0!   R/y롩@T Ѝ ЍOp ЍO@-@x /@ T/@ P  /@o@^1"@@@-@P R@ /@p@-P@U `RRVP P/@ /@ Dp /@p@-@`ᚯP   /@0P PVPpH- P BR Q9 bR4Q& ^ RN  Q P@pR @pR Q Q PPPP P0H-P@=  /@0P !T @00H-P@%  /@0P  0T00 @R P@P0K-$P @Yp /@P)@0`#( )@P%`$ ( `U0% 0/@ZQ  %0$  ! R (QY $' / @ R  /@PRH- /@$  /@/@ QH0H-M@ Pp g 0.Ѝ0@-xD /@@ Pp  /@/@@0H-PL)@@gP x /@ 0@JP J$ /@P /@P @0O-,MQP@@P@"PC x /@  :$W /P@P  /@Q T P/P@P01x  /@PJf $w /`@/p@  /@ /@eQ Pg P"@P P1"@X댶 P/@ `p^`p!&WP@ /@P PP /@P@'  P" /@P@`pP`p&'*`p!&!PU`p~ 0m`p !P/@Uj`p!&P & ' `$pv[[# P 000 P' $ /@ /@@oQPZ5 $ /@P  /@P o"@w ,Ѝ0  !   $ 0  !  & / @ $ /@P  /@P H-x /@ ToPG-M`Q `P@pP VPQ:PP p /@  /@Pp 0/@ PQ P  /@  PJP JOpVp ]g^pЍO-M` /@P8r4 /@ /@@p`" /@P   /@ P Po  0pS I084@Р`@+0(ؐ`oP LH$ /@4@P p D, (HL !y  W` HTLY ` HPLY YIV 0@@

`@pp,($(,0 !  PaJ$ 0/ @4 P@#p"`Rp`Oo``B` R  Wp P P&P  0t 0!"P ( /@ !0   (@$` T T(@$`TP  0 !0  P 0(@$` /@ /@P<Ѝ (cH-{ /@ "Qp@-P /@@UPT /P@@T `KV@Ν` 0p  /@`H/@pp@KO-MHP`D@p0SP@ p-} P Q Q) @ @ 0  9 0|E W)  @*pWQ px$ 0/ @00  00B PPЍO-Mp`0 V A@T5 P @V @Р @V @ (@ R Z ` 0(@T @Z @( @T  @TР(p V@ T< . ,,`0@ i+ A + ЍT$p% " Q  p .p, `0@cppP p p Q p@" ' @Kp pP   pp@@ i+ A +Q `X00SPU  p X@ WX  WX @@8p@Ep ЍW O%O5p@-P@U P``㋜P0㇜ Q `PP p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLppH ppp@ ppLP^    QY ? /@ Z   Y I$ЍH-< @,'  / @/@ RHH-P 4 @  /@@ Pu< @qn @Hifc`]HYH-4 @S /@, /@PHH- @?,'  / @/@ RH}yA- /@@T P#ڠbٛ1o0 @ʛH@/@P jz/`@/p@P7QP @/@)H/@ /@PA.0H-HZ)P@@T   AI?I=I /@ /@ /@00H-D )@"@P@P& "@P "@P "@P  @P /P J 0@@@@@0O-MM@P `pP T Ԥ /@VbD < )@)@)@ `LP   /@P bP @ Qc Pp R  0)@ p @ 0pRo Rk Pp`0@p@p W P0`@P@  pW 0`0@ 00RE @`` R> @  0)@ 0S0 0p0@0S( 0 0@ BQ QQ P 0H: )0@ 0   KPg )@X "P  /@ /@D )@`!@rP!HU Ԕ /@` KPw p!P  rP  KPe P P"Q `Q Q Q@P  P,  ^R  R R  0 \R0Q  $ 404 RR 0p$S $Co0?)H: )0@ 0 ـPN  /@H )@/@ApB"@㧽PŽP;`FpV7p  !@W`pₙ "@0`piW [G!@TGXoH)@P   /@  /@ppGP0 !@Ѝۍ p)@X O-M `/@P]   ЍO!@Pp /@K 0  gp!*@PQP@P3 t /@P  0 /@P|`ၺ `0 Ⴚ 0F`F 0zX "@ Ѝ@-P H/@ 0 )@/@S @T0000@0 BR@-P H/@ 0 )@/@S @T00C00@0 BR /@/ /@/ /@P/忾H-P p`Ꮨ@㉘UPUa {UG-̔ `/@P@p qQQ Q ? Q H-P -p3 @-PCH- /@//H-Mt @/p@ Up P`pVUPPЍ/@-@P E/p@-P@P`Q0/ ! R:`Q   E`@pH-M 0)PЍp@-Rp@P`@TpQA /p@-@`PVp`Vp/@-@ R Q Q! R * Q QS@SJ@0A-M$`S R@x0V@"Q^PpP` 00(0,0 00P0ЍO-M-NMM /@  8 /@Z/@ P d /@/`@P  )@ @ @;PP#P   "@%P   1 )@ZM `R 0pp@E  R``PU  )@<'P" @@ {0S 0 SpV R  R 0 @  " PU R|0焯$@0@P| J,R @Q @w `P Q  )@@ QQ @ d /`@P5  )@+P  )@d 0/`@PQ pp@;P }PJ\PPO $? # P @#P#P\@T`Zc  P\p/@ $ȍPM \P U P P"bU 0 @ R*$p$00 @Sr  0SQ:P 5\P&P$p$$P  $@@PPAP @K$rPP$  @ B P  ℰ P @0B \PP  $ FP`= @K >P㨠; PQ  )@@Q $M0Jp @K 0Ip P )@PG `(@ Ab PP (08Pd /`@P7  )@ 00@n P* pℰQjP$h N /@@  PtP\<(8@{IP@ TQ   oIpM*@( gIpE*T`V H !0q1 A" $`((;P }PJp$ $ $ A  `㄰ [P R  P)@ @ R PP1 A R*P@@K D@"P tڄ@P@ℰhQ HQIQ gQPiQ pQ1 Q Q;Q#d  /`@P #|  )@P<  00@ P2;P0P,wQ  )@ R 0 @ JA PR RQJ P@ I /@Q !)p \P ` $0S6 p` p@\S- RV @-  d /`@Q  @ "@^ /@Q d /`@Qe @/ "@ d /`@Q @" "@;PQ @L@,@;P: P: P 2PR2uP  `PM `@  \R R  0S S  `P5 D P@ZP  P'YP /@ aV PP `1, / @  P !4(p5&d /`@+(P /@``< MN /@"@@/@QU pP 0DAWP`V| /@P  /@ /@ /@NߍۍЍ< /@K0"@< /@X0"@B< /@0"@@8< /@0"@< /@0"@< /@0"@`< /@0"@< /@0"@PU < /@[0"@< /@<0"@< /@0"@< /@0"@< /@0"@< /@0"@< /@0*"@< /@q0"@Ԗ< /@J0"@~< /@60"@w< /@0"@p< /@0"@i< /@0"@b< /@0"@[< /@`0"@/!@ ᝖< /@0"@G< /@0"@@/$ !@ሖO-MPE | P@/@qP{P tP rP 3aP bP/`V P p 2pR p /@X PP  ?@TЍ8 /@ < /@0/"@`%A-MM@0 A R * APЍۍ.Q$Q +Q&/Q \Q `MP P IQPR IAo`AP< /@"@< /@"@08 /@ ؕp@-@ )@0PP@ R RQ < /@ 8 /@> "@BP: `OpO-M[` [k \[n p[]` \0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" PP]UW0C0 U \U nU 0p0]Q pRp00Ѝ< /@"@08 /@ ;< /@"@< y/@"@O-M /@`p @\P \Q Q: . AR [Y+ P[R[& \0S! Y IP ]Q [QY[[Y][Y   P R   P R p P` DGP /@ R5Ѝ< /@@8 /@Pm"@ 0ḔH-M@P`pmPn@ P2$L\dlt aP dP fP       P pЍK-@pP`?V ?PV @p`?P VPD`P00@?6SC pppppppphhtttttttHHHHHHttttttttttttttttttttttttttXXXXXX?Q7@?QW@Q?0|/O- M`PBx!@mE h~/@  )@\ X"p@/@0@ THPa@Q&h,<l /@EP GP_ IP /@! /@2@{L  (T*) @@  /@P!@ /@ 0|P {"@^ /@ 0mP "@^ @T*) @@vp)   )@/@APU T*) @@PPU X0)@p 00p"Xj@)`@p pP PU /@  vP /@d@H-  )@@"@0}fcO-M P/@4 8w  @`/@/p@/@/@P P< @Puu-Pz  Q Q!@bfP < /@ 0+ ! @pP:" .B< /@ /@P:@P  /@#QnP /@Vc /@ p0 W8 W @ @P/@@@p70@p0pp` CRp  -P- Q#Q) T  P" TP P ' / @ p @T ЍnQ' / @Q/!@>O-MMLw /p@Hg F <  T P/`@/@@/@)@/@P /@ RPH[ X' !@/ @X@  \W /P@ XP; Q2up P P/ tP #"P "P\ /@P `PP tP\ /@ "P\W Hg /P@/`@X /@P P /@P /@P Qk #P! `P ++ܢ PP++ ។# A\ 4//@" @ 0' P*^#PP ]t\ /@@ dP k 48( PM"  PI" X /@/@P8 /@\W  Hg /P@)@/`@X' @/ @!@dP4/ !@G\  /@ ** g@G D /@@/@?TPP u  E PEP   08 /@Ѝۍ /!@ ?"@"@"0@ @"@ "@[\ /@P"@[\ /@"a"@ʐ@-LG /@@ Q sp  /@P  /@QoH-P @/@pW d!`@"dP PP sp tspWºhs@@-@X4P"@ y@-@P F8P"@ k@0H-@P7P0"@ 0[H-M\ P/p@@P 9 0KU` 0CUЍO-M` 8G /@/@@P  T )@ X|? xo /@/@/0@/`@/@ /@Y Q P# p RPU PY P ? /0@P p R Q Q Q PAnP$ P( Pl ? /0@mQU_ P2 ? /0@3 xo |? /@/@/`@/0@PK?AoR xo |? /@/@/`@/0@PPQv xo |? /@/@/`@/0@PkI /@P5 ? /0@0  M|? xo P/0@/`@/@/@ PPQYQPPSPPO /@P  ? /0@0  L|? xo PP/0@/`@/@/@3 PP/ /@P ? P/0@0PP P L|? xo P/0@/`@/@/@ P Q QQ*P PoRUo DA7PdT \dPPL@T2 P D P+ E  i 8G /@|? xo Y/@@/0@/`@/@/@, /@P  =Q t@!b!@ 0 /@ wPp !+pa  PZ!@  xo |? /@/@/`@/0@P J!@ 0Y= xo |? /@/@/`@/0@P  /@ 0! ᗦ P  <ZP  P0! ၦ Pv  ;r@Td*pj p@P@t:pp@p W\ )@pQ:T /@ 0i "@=TW $/P@; ;Pm>Q ?p\ )@Q:T /@ 0i "@T /@ 0 MP' =p$ "@ P p\ )@Q:T /@ 0i "@5 "@GT " @/@ 1"@$a#\)@PP:T /@ 0i "@٥=`T  pP/@"`@  aPU0` PPU`\ 8G )@/@@P` T P/@/@:0i "@ 㯥$; ;@ % /@ ` VPp W+_ V/P@  /@`PpW  P)@P/W3 P:*   /@_ /P@!@ 0  0 @TW*p] /@  0 xo /@/@/`@|? /0@_O /@@P !@ 0 xo /@/@/`@ 0*b0p *C0 (  A1P8 G PP  E   p _@P ! p Q@P|? /0@/@8G /@@\0`)@p PPvPsP; / p/ @0/ / @ p p p  JP |? xo P/0@/`@/@/@   `xo @/`@/@/@T PT9 Q/@0  p"p!` /@0>`  /@0 P" @!P R  /@ 0& /@0 p[J P/@Q P  P/@   IP P{x}0 /@PP  `/@ 0@-AT  W: P`]y0P @TH `/@ 0@P` T /@ $  (/@0P` /@ @T /@0 0xo pW/`@/@/@ 0/p@  *b0*C0 8 A@8G /@@ PO ` /@@/@0 @ /@ FKP /@ 0{/ ` / @ 0p/@*g0T /@*C0 A8 @P 0! ᱣ P  98G p/@@ P  |? xo R/0@/`@/@/@q !p1   P%!@ p xo |? /@/@/`@/0@P @T  /@0! p P'" p[fJpP /@W pP pp /@P pp  H|? xo P/0@/`@/@/@ ` T 8G P/@/@/@@B !@2PQAh D\P)@[UG臹0H-M@P"@@PiMP$@@ /PVPPzP@.@?PP)@ pPP P"@w"@3 @p Ѝ0PlO-M @)@`2ŀ 㰐TP`P"@/p@"@T   Y 0~ h3P  WPPQP@T Ѝ  3WO-M P/@ :p"@ /@ 7>` 0@/P   )@]$@@u7PD /@`V& Q 0`-QV-QpeGQ QeW kW iWe:)0@`:)0@j:)0@0V`\ "`@ 0@@p xFPPa@Q&THXlx"@DPEP IPK-P>@QP7 SP ?"@p^WP p?Pp^ZP ?P^YP ?Pr "@m p  )@EQ`T'L H 0@@LQ /@/P@ (hD/QPPQ gH5P  ZP  /@/@, ]rP / @P  )@"@ XXP*"@ 60"@ 15"@ , P x @ P P!@"@,PX1?"0@"@o1i"0@"@\  #@rWUH-<  )@"@XUp@-@ /@0 /0@PPUp/:#0@1"0@ )@`"@ W 0@P UP U"@U@ %"@0p@WU "@"@ p@W "@ 0p@薜O-TM R\a p"P@0`@P  EuPPp GP gPP  )@PU}@X X'P pp Z |@pY P@ BVP`@#P@/P Q WO gp azp "@p /!@W /p;"@Z pE"@X p!@܃Px @CP"@@L"@" @0_/!@ ƃ "@ᵃO"@ ᭃH-8  )@t"@WT@-M@%P   p Ѝa"@ ዃ0H-M@P- ỽP P Ѝ0"Pp H-P@P Q `CP <P`P CP rQ <`V@-@Pu P  F 循@0H-)@a1S  @ P PU  @S*Q0Q aD A0sPQ  0 c A 0C0H-KKH@-`') @!R0@T 0RQ ` @ rP   a @0 BH-HH-MMHH- C)@0 "@ښS0H-PA /@@Q0?sP6 ތ뜎׽P  -{ベ$X 0P@עT! / @ӢX! / @r\ @/@@)` P/@ ') @!A< *q000O-,MPP_U.J\ /@P)` /@X# ! PP !rQ 0p 0R )@㰰(zP ث, R P 2/0 R  2/ @P!p0@pp$p ppS pQPPP P `PV` @`Q|l  P0S 0T /@0 @sR Q1D@  @r  1 PUʰQ@ r R  @pPV`ӼtP1S.P@P8P T@PU 㱲PP`` @PV` 㥲pPV `Pp@X $/@ PS`/vQ  Q `@ @`R T /@A 0PȦP? q땼P zh(@  0ద  Q  0@?a A)`@PePP_vQ+P @Q0SP RPG@Q d4p=P P/ <Pi>P* ?Pv < .Ldp Q0r`E RQ V p1 AR#pa0QA ! a R)`@/P !30@S|d"P0A@0 B0!ARQ 1A0C?1Is֍7$pW h 0`@ˠPʠ 0P P#$P/$ 0@ؑ pP`U$ p`P V P`Q V$ 0@s8 "0@H 0C ߿嗧A Q)@@$ 0@i PՀ PpP<P >P dP  P@Q:P wP uP qP!RP SPU PQ  -xP T /@EPT /@PAqP$@_~$ 0@ra ()`@A -a )`@ a r0)`@!pS B  o- k-(a )`@ xPQ zPaPxP@a@(P(@P  E-lQ\r P X$U4R`` ، R  2/pU P!PU   G 0r `P + { `v` `/@1 r P P (Q P`P ( P`qV4 R  2/C PPP = P,ЍuX $0/@t"@  h$ "@a0 @ @[T /@ "@1 @ phROEO-M@Qqp' QP- u `P@Ug 0ὗUP` p` P@U 0᧗UQ p@ 1`VpGs\ R0A0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`P= !VPUrV !   P (q 0% `PqUP 7"0@ K q!A ݽЍO蓥`! / @ /Q/A\! / @ R` /@/O-M\ ` /@Pp*@/@0 T` %P4 `  늠`P   @<c%P   4 H0,!0 S , ( 0%" @, 80@D04<Pp岑$0( 8@Ѝ@-PJ\ /@Q` /@A P ؓP, A A @ @Q/Q//0H-@0@(0@P@U U,fU0/bU H-v%0" @cH=@- Q@%&,&@&T&&&h&'&P0@P` A?P 0@ 8!0 @3 0 @."0 @B)P 0@  "p 0@P P 0@  P,f40 @p0@QP  C/0 @ @H-M .g Gf=ЍQ/ p'''''"A0 @-0 @!0 @ 0 @"B0 @g Q/ '(('(+F0 @/ 0 @p 0@Q 0@ H-M .g Ghm=ЍQ/ ((((+F0 @~ 0 @z"B0 @v!0 @rH-M .g Go=ЍQ/ ,)<)L)\)l)|)0,F0 @W"0 @S.0 @O!0 @K 0 @G"B0 @CH-M .g Gp<ЍQ/ )*)*.0 @* 0 @&"B0 @"!0 @)+ @-Q@d*****+0+h+D+0@Qa A40@ -"0 @.(0@  !#f40 @p0@QP  C0@   y "@0@%  @I @-Q@++, ,+\,p,,0@Qa A60@  /)0 @J*0@  ##f40 @p0@QP k C/0 @ p 0@P 0@  @xNmQ Q Q/"A0 @l@*c0 @h-0 @d0H-Q0@4-X-l---Qa A"@*0 @  P9 "@PP    C0H+m8 Q Q Q/0,F0 @@*0 @"0 @aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H->"@5H-YH-N"@4H-7H- /@H-, 0@nH-*H-\"@4H-:H-:H-:H-:////H-0@,!WH-0@,!WH-0@,!@WH-0@, W//@-@0@-@=@-@6@-@s@-@/@-@1@-@1///H-.H-.H-.H-.$2H-MP< P00@ ` A 0 ЍH-MP!0@ 0n ЍH-M0@ 0\ ЍH-M0@ 0J ЍH-M0@ B08 Ѝ0H-MPL0@@P  0P$ SЍ0H-MP f$0@p @Q  C!@0 # 0d Ѝ0H-MP\0P@@ 0@ P  !@ X !@ S !@"3 !@3Ѝ0H-M0@ 0 ЍH-5p0@H- /@/p@-P@`j0"@ p@gH-M0@ A0 ЍH-M0@ 0 ЍH-M0@ 0o ЍH-M0@ 0] ЍH-M0@ B0K ЍH- /@/////// ?0@@/ @ 0@"@/H-M0@ e0 ЍH-M0@ 0ЍH-4p0@/H-M0@ e0ЍH-M0@ 0ЍH-M0@ 0ЍH-M0@ B0Ѝ//H-M00@ e0ЍH-M0@ q0tЍH-M0@ 0bЍH-M0@ 0PЍH-M0@ 0>ЍH-M0@ B0,Ѝ/H-M<0@ 0ЍH-M<0@ 0ЍH-M<0@ 0ЍH-M<0@ B0Ѝ//////"@/"@/"@/a"@/g"@/v"@/H-M 0@000Q  aAЍH-M!0@ 0ЍH-M0@ .0mЍ0H-MC0@@P  0PYSЍ0H-Mf$0@p @Q  C!@0J # 0d7Ѝ0H-MS0P@@ 0@$P  !@ ㍅ !@ ㈅ !@W0 !@T0Ѝ0H-M y "@  0ЍH- /@E* 0@*J" A//H-M 0@000Q  aAЍH-M0@ J0Ѝ0H-MC0@@P  0PSЍ0H-Mf$0@p @Q  C!@0 # 0dЍ0H-MS0P@@ 0@qP  !@ ڄ !@ Մ !@/ !@/Ѝ0H-M0@ 0KЍH-C2p0@* 0@*J" A//0@"@/0@"@/0@"@////////H-@-Mo~ @P  n{^ЍH-70H-P0p @O~ ~00H-@!p P@~{0H-0@ |<{@-H0@@qP /{H-H-~0H-X@0P@ |!~ {0p@-hP0`@)Q {,@ @ |A{ 0x~pp@-hP0`@)Q b,@ @ |Az 0_~ #~pp@-hP0`@)Q E,@ @ |Az 0B~|pH-0@~0H-X@0P@ |! z)Q ~ 0"~0////"@/"@/"@/"@/"@/"@/"@/"@/"@/"@/"@/"@/ @/"@/ @/ @/@ "@/"@/////////H-M0@ A0ЍH-M0@ 0uЍH-M@ 0@ e0cЍ/H-M 000Q  aAIЍH-M@ 0@ 07Ѝ0H-M@P   0P$SЍ0@-M@9 "@ P C!@0 0 dЍ0H-MP @0 @P  !@ [ !@ V !@%- !@"-Ѝ0/H-M00@ e0ЍH-M0@ q0ЍH-M@ 0@ 0Ѝ/K-@`!PRp  " RrǠ Q08"0@‘I> "0@Q PG "@ma!xR Uaq wRb(q "@[aY `ᝋ80S  3/PK衑A-Pd /@U@& P'`"h /@pPUPWP:lq `/p@P \P`t /@p /@A-MjP)`@x /@p @U@-  p(p' P 0o 0p pP\v(Pu S "@P ]@@H| /@@Ѝ0H-@ &P )@PuT)@A0| /@P:)P x /@P*@H-d /@ ep /@t /@d /@d /@@-@d /@dp /@t /@/ !@@ MH-M    $ЍH Ѝ/M0H-MPd /@@ 0dp /@t /@$ Ѝ0HЍ/O-MlQ @h /P@/@0 }d t p a T/@/@/@/`@ @P Q )P@ 0@ @ @ 0@0S 0p0@ @ P P3P /@P P wzP qz /@]PP ]z Zz  /@ G Q/@@ `Q PD[ p‘W徑VUEPU -za /`@ [a /`@p  zpGW  HT p Q !@pP D/@)P@32PfP偑P yމ /@ЍO~H-/ !@HM@-M@ 03# Ѝ@Ѝ/H-M!@ЍH-Mpd /@`@Pcp /@t /@, {( #  0`ЍO-4MXp/oo`"Pd @/@Ja\ U,@`pWPK "@ `e,@P(`$` D@`@ 0 )@0Pdq /p@3I 0PP@I [@I[dq PtP Q/p@  ARPAKQ,$`(@0 VŐU 6 0@g A店@ `tP~PZZ? Z_}kAZ2Z6 AZXYIbZ` ZO Y)@  AR0 B00@PPPAP @ @ P, `K  ᱻ`Z Z#`u Y', K A❻PIK`j[Y [P ,P \&P`W Z [ )@ ` P D,P K n P`:0P $ 0( @d /@xp /@t /@ P QP ,   ,4ЍOG  "@PM @I, p@-M,k0@!`@(4PpЍpO-Mdq @/p@P`̏ǏHDU

] L= ,)@0  "@ㆄ1= )@0  "@yH- E)@0`  "@o=0H-M L7!@lG#~y]0P@@T !, "@?報O[0P@@T , "@|?厱N /@P )@0  "@/Ѝ0H- 0@Pt0@P Hq<H-<H-!@P OP "@JF!PʾHO-MM @ᶦPP `ڮPJ S P"@/ p  YP; P s$ۻᰰ$P).pP!  [cP  [P ppI  F / ᏮPᾤЍۍH-A-M,L0@@PP$x*P P @PQ upK Pk Y] 0K&Pd GP_Jf% @J'G^SPUJ]~X0P@P~"pu" 0@P8 FP/ @`Fp $aFP"\"#P]L/!@ X *P )P P  <P GP9" ,Ѝ p4P @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p`FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0)pp`W:U `psFP pPUp}@- MP @, 0@d)P= @   P4JH0@@$*!P RQ 1/P $1/$,R @FP J=P  "@?P "@:P , Ѝ)PW Ѝ@^!FP  0@P$H 0@@ 吩\F P Z_ 0$PmFP "@C "@@$g&A-(MM@(P+,{* "@+z(`+"{t "@+zEPP (EP !@ 0 @@@@ @@@@@ P((\C(Ѝۍ0H-MK+z* "@+z P+zt "@+zDP  ;Cۍ0@- MP @, 0@RD,(P @ 'PJ0@*Q $Q ?+pP T+ Ѝ P ` 0C$Pd#%O-MQ   0P  P P JX @PadqA P: y=P Rr pQ %R R"! ) @  @G  hR%R; dR `W 0 p!!+Qp(iR* sR! ) @ 0 ``@`Q \Q`V Q p%Q_p  R P P Q Q )@@QcP aP<0  3/P3 BP$PPpH ` ,PX Q Q  0 yPP$PPP`V: @T0  Q:Ѝ0H-M I3]0P@@T &( "@;奭K!P "@!@;P @ (a "@|;厭 0@@0T  -"@! @[Ѝ0 u )@"@ `;80H-M 3K0@@P ' "@P6&^JP "@@X;P  "@$& ' "@&E bW - 0"@" @[Ѝ0@-(M-  @0@ 0)@  0zp@:(Ѝ@ )@01  "@ 0@0S 1 "@ b8p@--k@Q0 @0`@`P Q 0!@ p@UMO-jMp1s? 0W- !@aO`P7 Z* PH @p+p8 pEZ :[6U4*P@P0  p+pp  P!@〱:P `[ P 0@P  , 0"@" @: pW PIX  0@P  , 0"@" @^:jߍOЍ/ MO-M(@" -PD24 4(@T e @'P P  @'pPp  P Q G0= "@P P * %R@RA* c`'P`V*PLP/KP pᇡ/ၡpX5 并៩P$ KG$ .P  :P ᎩP U <P9 $ @  "@0 U ᢟe @I "@@r u,phD GPQP@ (,$H 0@@P ¥z $H 0@@Xiwjp((! 0p<p ܫ0@bTPH z)p@P  PP ]0P@P `K p0@@P Yqp `P P.@ʭ AА@ B t0@` P $`. `0*` @*@dh`` P pu` W `P,p 0H   P[` $@P @7 ]`0P@ p+r* @n0&  @ oQ ϪW,p | P }ᘌ@ [@` 0P P P& /QP"T@s@P H #@$0@[  "@z8s p"@8\넍 "@2P {t0@tP P~t#@ `MD P  /QPZ )P@(W@`Y V(,pW% $H 0@@W A ~}Y @WZ !@(}&c+4$H 0@@NtGW] )!`}F߄V {! W ʄ@Z !@||ɋP@  )@Gj[ ,tW nzX Wu㡈뤋( PP @ P Y ߍOЍ/ 5``K[( "@ 'd 8"@@P 878 d "@ d "@ nPq BqGP   "@T7M0@@FP  @H7Fy$@4P  "@-P@= @@  0@= <P <P @ "@.< "@.H-M$h P0`@@ZVu! p]|!|? R|/ !@Q3""@| Rʊ布P0 ApljP @Q룞P ]\i{rz ᭊЍ +)@0G  "@y{$4O-M-nM M  /@Qf8 " " @pa㊯PD`<PF @QU@*O @@Ღ qᩦ )@P %s "@"p@3@ m7PpW<劯< iKtY⊯3Y iD t r Y 8P 0 P 8@  0@aPp Y 0o  0u,@P H8/@"@p0@t`8@5F@p  P/@`PD s@a  6P @P4 # P @" @0 ( +0@pP "@ 0'I똂 P/@ @ (0 #p  "@m!@sPt S e lP/p@/P@/`@  )@PAt S e /p@/P@/`@"@P<@ns@P T `q`40iv (@ʾ + ϊL%pc : "@ P㸀] G /@@0 @PS I /@@0 P "@!@_5PA :S "@) { "@%  "@! | "@  "@  ' "@/ @ P  "@ 4 "@  "@ "@ D "@ "@ P)  ⸀~ 0 "@ NP<  @ NP5 8 "@ NP. A "@ NP' t  @ NP  @ NP P P H "@ 0mP c% " @ 0P  /@ "@bP` GP , % "@" @ 0FPF 4  H 㽏/@@,rx 0tw 0oxP㘂  I/@/@0@@ V 0P <P  y/@0 R<P  z/@  /@% / @QP* "@@ /@- " @qB P/@@ :r q  P G. " @[IP0@@ $r [  ϑP .  0@" @P /@<P r > P  Q/ " @+P q -  㡑PP /@E5`P P  /@4A> $ @" @ 0PxJt?Q "@P "@ q% / @{0} 0 /@| 05 u /0@/p@t  @P? Q "0@<0R S E U p/@@/P@`Wp0 pV` `S0 0 4 # !@/ @/0@pe 0/`@S0p 0# Wp04 p !@/ @/0@ppUPM .RrF R  D /"@0㯚p  p*V P"@Po2P|0@H8,\ 8,V  "@4P . /@ a 0@/`@P7  "@@ 3P , @"@ [*I f 0"@" @ /@P  # "@/ @ 㘂 0@/@P  )"@0 @ "@LB /@Pg W'   ! 5 /@"@/ @/0@@k0 "@F0 `+ /@@ A+ jP  0=0P: /@P-  "@+ H p "@ `/@ G= I "@} P IN _ (p"@@Pp PN嘂 /@ (M "@! 5 / @/0@ /@P D /@@&F0P P  "@ " "@/ @0Q: "@oRnߍ ۍЍ 0@0S  ""@ v )@0   "@v/ 0@@T @a< )@[p@-M!I0@L PDP ,1 /@ o0 PDP 1 /@ o `Tp8 PP@ @$ A` /@(`o8(L oPUtB /@ oBP  E `P @/@@ o oBBP#@PЍp0H-BM3PP P.QJP @ /@ Po /@ /@ oBߍ0H-D /@@Ms P/p@H` /@!voPEPQ.P /@~P H /@@"@!1o /@!H+oP !@/X"@/K-!Mp9 P"@APPH Z1 `@"0@` A: 0`9@pa1  "0@-P P/Q/pI/P @a1 "0@PX"@1;!0@Pi! `" @6!ލG-PB@U' 㔡 `"@)@pW Y /W P EQ 0@  ဎP p`T:H-MQ  0@@X600@ /R/  0@" @Ѝ#0 @p@-M@ /@P  @ Q$ P  0@@E0@'6_00P@`O "@@/P 0@㮎60 /PP0@P壎Ѝp@-@%P,0 @@=p@-M0@Pns@P 0@0@ In0@0@ Cn& v@P v "="@0 @00@PA 0@1"@@0@00@ ]00@00@ V@ލpH-BM /@P P R /P@ ]"@Pz  "@/@ 0@P  "@K6w /p@P  "@C6 @! 1 " @/0@@6@P* 5 0 "@ @e /`@P  % "@/ @ "@c5 0 "@P  `"@  N "@Z  "@/@U "@% 5 / @/0@ "@  "@!@M6P9 P65 "@}|d "`@x "@tqc /`@P  # "@/ @f6 % "@/ @`P u ( @/ @V$ @/ @P> "@J. "@SP;  "@/@\P q "@V  "@/@QT >YBߍH-pP@ p `㊸ /@ p)m @]G-BM@9 `"@PP {!p@c P 0@0@X  "@0@PBߍs "p@ PP  P@/!P !P  @/PQ !P#@/d"@/Q QcH-MP  @  QЍH-MP 0p@"@ ppkp( P$ ` 0p"@ ppkp I "@eP I~ "p@4/P YPpЍp@-@ "@ `VPPsl !@@lUPp0H-%@" @"@Q P P VoP P0H-)@ O-M`V! P@p B/P P PP `VЍH-)@ K-Mpp$a g1PFP @H0L! p4/P pP 1/$qp  "@p@1/pЍO-lMP P< 8p@ L03/P' H$ 0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-M-UM0zpLpؐ ,\0P@l @pP$H `0@@㔠~kd )@VWz@P#Q4"ZLpN/ PAxQ0@@0@00P@Q N/)P p CP 0 }ϊ 9k "4k0  0@ /k p0! 0P040P8Q@Z,L1H!A Z@ZR$()!0 `(KHaLa及, 0@0 S< A0@@axQ0P@P[b4^bDLL P,0@$ $ (aP,qP,q048aLQPH!0 ,<P00@0S'k!`@@#Gp P`P@|C$``P;$B@nC 0@P H!L1L / "@,@$p$AB :0<<8<P P,, 8 0@]P  YP&Pw $1/$@Q() N}Pr$}PmK? 4A$ePW @$48aHL; ZXF X ( @! /!!  Z(:0_@p@X BBP` pzoB@B 庠4@N_T40PL zOU`0 0 4|p0PLp`zOq R@  0z Ep,W L@/!@ K,LLpH {!x  0 p LL`0Pp PXJX,V(P { @K)@@" i0@@ , 0@p { ,0@ UݍЍ, 0@[J [p8Pn AlQ#0B"@/!Q//O-CMMh0`@ *Q Cߍۍ)Q; A_i& 0" @r@ "@ P P s A/"@ ^4G"@@0A_! 0" @Q "@ 1P 7A/@"0@\ 4 0@p iPP A/P4`p4@00Y WPp`X:5;x@B!P PP4/P $0P  P ;x@B 4/A/;x@ 4/< Rp B<@R0PB A"@N Sw "@"p@p<@RR} RP00S & " @㶈 A"@ t& @ " @"@pRr 1RPy  A"@a?w @"p@n00S & " @㏈(0S P& " @ᆈ,0S P& " @z$q.M @P!@ P"@ A"@0*v @ "p@@ "@"@p1(P,Q & " @P A"@ x w "@"p@$r "@PZ "@A~ w "@"p@ $ A"@0 8w "@"p@P0)pR00  A:jA?"@ Y   3, 0@P A/A/@T pJ/A {0PA/ A/\0`^K-MMpQ8 @\ P `"@  P- *P &@ "@ワP$ j VP"@0,p W V`!@ >" 0`m@PpЍڍ p p *@  YlEPT@PPJl@Qv "@ 0 "@ 0H-PP 0 S,0S ,\ SH S:8 80S:^3O-{MMHp0@@*QD "@.A @@/`. "@넍0@PU .  0"@(VC  "@8`)QH v ,P7 N.H*, "@ wP$ 䩝ܙZ  @㰮P uPJm@ p@U ᤮@`PFv T:0S  "@ ^m LDPP Tp@ `T6 (P P PS Y v0 xP   @  0 0;5/ P<z<Q| !@@a "@ P"?%@O  @"@@`DP`D<;<@!0@Pv+9ff8 "0@8j "@ tP$ DP P  sg8 "@h$Y + | @@P| x@ @"@@ "@ P`@  "@-0' " @` "@@PY| @= K5) "@!@@" @$ ) @0"@ ") ,09 " @ (`i "0@ Y 0"`@"P@`P@ "@a08<0  "@ DP r8 0"@pp[.: v  bํ܉w/ P`V 8C v/"@K0@@PP @A8PE "@u^ "@qx "@mP  +"@0 @dHO H p"@0pێ? !0@q+! @  !P "@K "@7- "@4- "@1-P "@+- "@(- "@56[{ߍۍO-$MMP $Ѝۍ J P`p"@"@@!PpG`w @ 0' "@" @P`@P @K @@P@ "@hpa E`@!@`@@O & "@@"@ @[  8 "@"@4`8$(@QD@J T pP`"@@<@PP P J "@   @4^ "@ `  "@'4` $(8PEu0G P "@@"@ yP PJ "@ u  @xa ^ `@"@ ` @f "@4` $(@8Kp K@Ps+P3 ` 0@ "@p.P A @d.P A.B @&.pB@a-  0 @@pW #/0@!@ I 0@)Q @! 0" @{ HP2 @P+P@pPT:/0@!@  -T*d0`48 xP  0;`5/P Wr * : "@" @"0@k0z0x0H-P@ "@ @HP0#/+!@! @0H,@-@ /@ p8@0H-M /@ Q! 8 P Qp 0@ xP  * 0/ @;@5/P J /@@ PaPPЍ00H-J /@@P0 PRP0O-MP GPZ@PM  :PHJ@ KTE `BI )@ {O p@P R a?P  [?P   P @DPPP   p)@  @T m Ѝ@-M @ ^Q Q P 5 0@cЍ0H-*JTR0G-MMx0@P, @,T A4^ QP0 `$P P0`AT4`0 P ,Pf - < 8 @0@pA`@ 0)@  0@58 R_ P4Qm @0R 0pW PpRaPVW:( R1/4@TQ* l O@@pp@P@TBP0< `Y tP K? T9P 0P4PP 0`4``N@TV  y P4Q @0( R1/4@T:0} ߍڍ`[H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU 0Q03P  L03/P P `V:0Z `Pq Pl (0$`P5 (`$,q P) P 0QUQPU 0Q03P@ L03/P P @  X:0`V( @< 0`H0  m``` p 4<`8`P$`4`M8P  P 08p<  $` PtЍO-MpPPF `Q9 p @pp  L0 3/P# (,p0 @p`0t ΧP 0ǧ! # "@P P ` ``pY: W `Ѝ0H-@P0P 0Hfp@-P@1`Q*0!@ p@=A-@ PQ ` 熁(0S `V:0S P0QqPWS:1/A K-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMP x`p@;p p6/P  @;x` p p6/P   0"@-oBЍۍG-vM@"@p `"@P JP PN㿫 ``)@)@ Q Q `P# a'P| ``04P A% @` P + `0" @X]P[ YPWQS @qPO fs@P I @-pj `nplix"P @ @ @  @ /}$@0 LPUF@& @P; &P8@ @qP2  "@lP- Sb/$@P' K?n{ !p@p # {8q~ )@ G0 PPB@&+ " @ 0`@Y /@\ boPL @ Q唑P P3 JJPѪ@pT ͪ KXD0H@`L `P\`TrP P" K?k!`@ ` # 8Z p! @vOP3 p167NPEQ, FPXQ( g!0 k &pA0d 0^K?^k !`@` # 7@+ " @p= ,@`70 pP(Q0030SP'Q 0W0'0Q0p 0WP07@&P: Q@ RQK?^{ !p@p # 74+ `" @ 0NPPPvߍA-S `pW WW`V  0B pSW WW V F0\0@P\``vp W:v\WQ Q `&c``aa``a`Q p0RO-dMMpQ :  "@P =P dЍۍ "@^`P "@WP v/t_r@evGVv6 +^/r+^G(P \R R 0S  x0@@PU1 $P R 2/pcQUh0`@+]/+r]PӜ`@PaUn:3aPj+]0@$P R4l @_R'xP0p@[ӥP K? 4P ` R 2/p1/x0p@N_[p2/p p0@P$aV /@;x@ a p@ `@ @@ eP) `P$ [P 8 !@UP g "@OP  @IP FO"@ ]  ]@ ᷝP FF&P  /p!@ Ppppr /O-M aPL03/PH t R 2/(,p0 @0@ P凣 0〣0+  " @&}P @I "@ \ \X @K "@ \ \P᚛ P..@/!@9ЍOo/G-M\ J"@"@V0"@ /@R&v S0"p@/ @`PW0C$s`0Qppp+ A /@@$Q /P@( /@, /@P`0 /@`A@p=PP@p7PP@p1PpP,P/, ;P" @!0@P|4 /@ЍG&H-M !oЍ@-M@ !oЍH-M !oЍ@-M8A /@@ 0  Z/ @ !Ѝ0H-""@}{b)Q @ P@##8 "@0H+M0H-M@ P$0 յ R m "@0@ Ѝ0HЍ/L "@ mJ0H-MQ 0@@e#O _0"@@0P@0@ P{Y#00@ P{Ѝ0O-$Ma㰒U }"0 @`"@0@"P@0p@!@P  "@=  0 P= m ;"@00@'㝰P#@`pP. P0@0@ "0@ "@ 0Pp` @ 뜰P!yP! a!  @$Ѝp@-MM @"@lP  Z@ %7Q u$f @QЍۍpH-MM "@loЍۍG--M( P0TO0L0$0LP$YX0@pP`  PmP 0@0@ Z0@0@ ZPP6@ /@ P @l PoJPm@qW W @ 0@/@dP4i 0@?(  @0@ t @T0P" l 0 PPPPPPp1 `mTCTt㐁! 0@-PW B0@@P  "@ncQUU܍ oRP ! 1 "@" @"0@ῤp@-M @0@P+  +"@0 @P#0@A_ a 0@"P@"`@0@@ 0ez0@ 0@0\z!oBЍp/@-B0@@P "@@-@P `5F 0@@op@-M  ( @P(  "0<"@0 @00@P0@L Q 0@n"@@"P@0`@0@ 0`z0@ 0@0`y@Ѝp0H-MQ L ^0@"@@0P@0@ 0y0@ 0@0yЍ0 /@ r/0A B0 / /@ P/ @/  /@0Q00A B r  / /@  /H-7M(@* )@ 0` 4 /@ $@60IP0```@7ލ0H-P /@P +T A @P,UT @D+U@J@@JL@@ @ @*T,TS0+<; @ 0@ 0 0A-q +R&0 ( M` /@/@ P$@@/`@p0+S ,SR  B0  pT 0T0 @pGp $1 /p@/0@ q /p@p@P/ "@0A5,! / @@p@-MP@Q Ql "`@  g"@"`@-P` 0ЍpO-kM∢@0@`P 0@y PpW"P0@0 @  # " @0Px{_PQ 1/pPtбP  P [ 0@ p@\V[ 0@D Y P "@X   "@0  "@`CpV [ 0@  / !@_p 0@npPp0@P ;  "@ /@p[   0@kߍ@-)@"@P @!0 @0@Q 0@H-!0 @0@PO-,M@᪖p$@wP $(P@` (``@ `@$VQQ P*獖 (p@@A$iw@P&@PE p$p\wP@* $`PA( (```$VPP Z*`H  p@`  R(p@$1wPPpP @@D@P,Ѝ ! &1 "@" @"0@ҡ,) @0*S/ /@S0S 00S/0 *S/@-M A  @"@0@嬀 POЍO-MM0A 0 "@0㙀QQQ 0A 0 "@0ㆀPPP eA p0@"`@"@O%  9 PTtPZV"V"P@g[e "@b`^bIj0`@elQP m"@  0u6ᚕP IdQ`QJZ 0P@ 7l "@ PJ Pe "`@6 P  00Q;Q8Q6 wPU/ P PG "@ ! P P  "@   00PPP]U T"@ ЍۍO-WM@ "@`  0@0S p "@ ] 0@)@PP 0 C*U/@$@X 0S   R *R*U`Xq |ㄽ b)p@"@0`@Qd QaP @L  0@@h$ 0@Vk@㰢0@P  "@@0 0a tV @$XP P P* P P0+S ,S *S#Q APP @$PXpG @Pp*U$ { P  Qw0 `"@ p 0@kZ) P  "@.P&P  "@ "@4 "@P  UB0@@2  NP "@"@%BP0@@i "@(P( ,0"# n "@G "@'P  "@  "@"@PP  "@(A ( @"@0@~Z  Qo P U T"@ Wߍ@H-M /Ѝ M0H-M@  "@!@P P "@ S& "@Ѝ0H Ѝ/p@- )@PU /I `!@@P P  ?PUQppp0H-M` "@uP TH /@@ P Js "@`/>to "@<0@܍0H-M| "@RI /@@ zTD /@< 0@Տz Z % /p@/P@" @0t!@ QK@,<F!  "@ @H0 ` 0 @ 0 P`0P$J_)P@@rF*@0/ " @dt` "@)P  TkFߍA-M` BO dP @ T sP`E<  0@U/@ (0"@!@@ލH-<HeFO-M┓/@@T )@@嘃/@P )@:TP s/p@@TP@@T /@ A}` }P /@U  @ Vl NPb @epeTU .PR  S pJ  )@/@P UPB  Ξ/@P7 /@   )@  P  P"s@/p@  8@  "@Ss/p@P /@঎/@pP{s/p@10@ SЍ@-M@P   ms 0@P esЍMH-M  0 ЍHЍ/O-MM@  "@/ !@P|J "@/ !@PrJ "@/ !@߬ph7pl!@Pe 6prڢP@O#Po p ~PP` {@`႑ P `=P /!@ ` ]P $$VF P *@P!P3  Q* PKP-q#P P /-!@ 㞾 0@UhPЍڍ # #P  H-M zЍ M0H-M@  "@!@P P, "@ # "@Ѝ0H Ѝ/ L "@"@"@-s "@@P | "@ P "@@P@O- MM @͆P2 \P2 k@P# k\ p`P@"@@+Q P* +Q T  +Q TiP P  [o᠂ Ѝۍ @-@ၐQ@"@ -o@-)@"@㞙P !0 @0@Q 0@H-PP$x jP#@Q0p@@U0`@ _{P ut |9~9+W(W{QyQcgH`g0H-M@XP@᜝ )@ "@ 0^ "@Ѝ0@-M@xs x Ѝp@-P )@@*Q `Q )P *Q`@T@pK- M@$pP Pp` pp pVQQP:$pP ЍMH-M00 @ 0ЍHЍ/A-pP`P@V !R P P8/AMH-M,00 @ 0ЍHЍ/H- /@Q= "@0@E "@D0@O "@0@"@@0@ @80@.@H0@H-P40 0 C 0 A AH-P40 0 C 0 A AHO-DM @`P pP L03/` PU:pMP K ` PVF pK L03/P2 剁i(PQ "0P  "P PPPR $04@P0R@ S8p,00, SX 4 T\0 [2Y1:PDЍO-MP  @ @4 A0p W[ Ѝ@4 0pS RP pP P`4P!ip 9 U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P pP` L03/P `V:  D@<08 8<P@ D01/HЍp@-PP` F@ P p@@-@ (@A-@PA pag0 hPUpHpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:EABK-M @ 'p@ Pg`epx @@i @ / U@ @ % @ }$0 L@ T @l K!@@g "@ PЍ @VP Y "@QP @TO-M7PE  !"@ c0e   "@ ` PU p@l Pa@PP# @PU! @p  Dp@ PP eD @T  ߍ0P q @"p@ Q R@T: Q4`!~ a0P"@ 0  pW0p  es[ /P@+` p  *PP k YJ 0TG "@ a0b&(^O  N q Qp @G 0"@  Z!@0 0 Qtt /@0@ S 0  0Q00A B r   " /H-7M(@P`*0 a 4 /@$= 0@` P00P `@ùJ7ލ /@0+S ,SQ/A    /@0+S ,SQ/A  H-M`Vpj@p{PppT "@iVkn  "@"@Vc "@}  V@j"@"@0`@&f@Q4:Ps P)YPP 0 0@P 0@PP X `"@ `X @X@P  @:"@00@  "0<`"@0 @00@~ /@QB@oo)`@ ` g""@R( PPy @*P0 @|Pfp@PPk +! @PP "@0h`oRW /@Pf ""@'ٸPP@ 0@P8 0@PP1 X `"@ `X @X@P'  @:"@00@ I "="@0 @00@`!Ph P"@ 0` "@ ;PUPލ# " @H-MP' @z /p@PbBP ᨇP% `w Z /@@- 0 /@/P@A" @`kl!@ I)@P@T &LbЍH-: #/0@0 / @/@/@ !@-@* / @  /@ bK!/@ /@H-MM` p@;@&p  Pxp @ ` `ЍۍH-|dP@`L P DP p P "P  P zDH-MM @`;P`&p p 0V@`tʾ`@Ѝۍ eDO-AM@ PPAߍP` L03/P  P@U: АԠ,( X*$ L03/P  X: аp  [ ,[( YY( 0@ @ 0 ᭑, (0㦑@ 0@P`$   "@pP @k( 0@0`  ዑp  0ㄑ`P)0 @@@0@P ` Pk 0iO-SMPP@(.XP@1hT㘰mJ `Vj:T 40@ YVp@$pPh p0p8`"@,P<@Y@"@ a LP "@@ RR"@pP8 NRAX;0 "@ 0 a<@ @H1/ @Pp`0dp0 ppp3/P5 e  I803/|P`$|0@!$Q d" @ Q0"@<40 8L0 d3/Pf P @Pp ᔎ4@8@@# @  0 0 7p` 00  @F`r P4 2Ṻ@q: p<@80QU Sn4P4P@ PP03/q8r L0 3/ |`@D0@ X@<@Px``TPH, \ \T<@!a8 RK Ba"pڃ,PT 1 C"у @BtS: q8d 0@ 3/P2 T `Q4P, 0 `V/  0S# @0d`4 6/P P  "@Hd0SB *$ @ e P0@0' "@PZ"@Q, P` pdp``I 7/(k0 ' "@bp0@ 0' "@@0@PH$0 @0' "@O-4MPp PD P9 `  L03/PPP` V:&p@P$0# " H  %  0  "^ T ^ ,0S Ppfp RQ8` 4Ѝ|0@4ЍO}A-@P@ P\1/0 ` 0c`@0C?o2SP* p aP, 0  ` P" pPbH"~P P Ak@ @ " ~@AίO-$M@\1/Pp`Q `V` YWP( pW 50@ 0P  Y/@ @k  00@ 1V0 @  d 5@0@o 00B @S@"Et; p0@@raJP0/@0P `ppop,g< @0 +0Pd ("@`pPV pPP Yp`Vp 8I ΋PpuY  PW`PW:aup0 [pP /P RpP R 2/pW,0ί0Pp(p(p p(,(FWp,$Ѝ" k# 3 "@" @"0@lK-@Pp a`P7 pp  Q h!b"p}hp೎ P bpI"x}P F@p(p崁呮Vf`A-M@P `03/P ! 0P ` 2/ލO-EM@0@$BP B<@.PPT`Pw TPVL-~ @ p@BP p P*@0ЋDgD@L `@ST0 pP`@D@@0 @$ 0Tp 00@@ñVn Ƞ  0o @Ap0  p ֮] PJ 8PP  P L B  ( H1/T@P4P `'@@PPTH Q0P,l h@DP@8a L0 3/0 ` 6/PN D Tp `R  PHX6/P: X \0h l0` 6/p- L03/@ 4j Dh 0` l0,`00`8T  Lp04P合V@P@H8 PU:* "@ 9܍0H-PH- "@H*O-M-ZMh@P}U tP ȴ i)@(P0`@Y Y Y< 0@$LHP ( " @スP ;P3 ( " @u4P3 PM3-`) " @0a 0@X (`p5 0"@ *(`ppWWi2#0`@73L( 0" @?8YK"0@0@0 @P`P P P 䍊`  @  0@G$H 0@@ P`=G E @@& F0hp0  0pPPP>(@ᇢZߍЍ, 0@/ PJwPCQp@-@Pԭ`@ЭM "@0p@A-MYY @"P@pg@넍P0@ `W 1"@`V Y "@S "@Y "@K "@ ("@ 0:8  "@ oTP s) Y9 " @"0@i) 0" @PㆸY "@&ɱP 0 "@ Qce@"@ NPyoЍL0@"/0H-$Y@0P@Pb !T0L"D0@ Q0(P4 0@ (0@-@$ 0@PH DQ "@@t0H-@P@o0@-M@ PQ T nЍЍ@R@-$I0@@P x!/K-$ 0@`P P (NpOO QPP R 0 RR;p@DQP ` A A @1 0 F0PIW# (  Q$0X, @!$ % Q K-0MT`@0`@ PrP.ЀP 0X0$ 0S!*P    PP9P QP P  R 2S  PP0ЍK-M⺛YB0P,`(BpW@T V `VPY P\apHPW :X X# 0q^ B "@q^ "@G "@ "@ 07P Ѝ@-0M@    @ @00( P, 0ЍO-M$ 0@pP  P vo!P0APP S @0SSP`RЍȰU P0p 0  ]((Q $wP,QXQ  /  PP QL * : "@" @"0@eyO-TM@<p4`,$  e@8  `2Pv (@D` $0 R 0@, RRH `L0@8 R P T  ^PP T0TP0P@R 080 P@0<Ġ⺛Y" 0` Q BTPPQQS S S @ hS:@Q@@bTb 0`Y P @ ( (Q $EvY. *$@`T& u"  @ 4QP   v. 1 (p Ps 80  RTЍ0 r/ @ .uYH XL0 H  @DL QG-T@0@@\=K T$ `p0SRUSSW W W P FW:PSPP@U@ p`T`\( p'1!PE Q $u`X ue QP v(. !  @@@0H-@PoyP  0O- M0p4`pppQp@ pappb@Q w1 Q, w* @TPPPUPPPXPPPUP PP@(0P @ 0  T PD" P%00@@P@ pGY ЍH-@+R 2 `PpWpW V ` SPT "@ RPT ^ĩ  p"` pG pPO-DMM@XP \P `P dP hP H0 k-0Pp "@ 8 8pWQ q  80`)p@PPPQ PV`:pWSp"@ a @9 0:W` pQp S0pPPխD` "@@CPk  D `"@   "@`09 d "@\h 0P "@X a "@ P- l\ i 㺥"P@"@!@0)ap" @0  p PP  p "@ @X  X: "@GD@ , 0"@" @0kP0oRDЍۍL ^+ v; "@" @"0@wL ^+ ; "@" @"0@wL ^+ ; "@" @"0@b wL ^+ ; "@" @"0@wL ^+ ; "@" @"0@vO-$MMP}P @$ p;pp e0 D`pTHtPPgL$WXQ  h` @ PE Pv P P  P%q P  $ 0PP  , Q t 0P0P p[::  "@P㨳P$ Q:P a0rD`V `VpWs0CQp$ЍۍpO-M-8MpP&`PK PF ppp@ dt Pps p P s {H8"0@(0\0 XpG(fϊP  "@ `H `|(  B䐄 8ЍЍ/h/p@-M@XP \P `P& dP, hP2 P0 Q&ЍpL , v; "@" @"0@guL , ; "@" @"0@huL , ; "@" @"0@iuL , ; "@" @"0@juL , ; "@" @"0@kuH-R0H #+H-H H-P`/Wk@P p@H PaP:a@P*Q P @ R R@P@@-P @@L , 1"@" @"0@Hu@-  @"@|@0H-$ @0@PнT T猶̶ĶԶĶTT T  T T@ P"T0A-M$i@0`@PP "T*a=PLp0@0p@Q (` (0S0  R4``U* P& P4PP*$ @0@` @$ @ FJpm p倦@ @:* 0" @J(``@pEЍ0H-$Y@0P@PqD  Q "PL0@Q P (0D0 @ S Q4 p0O-$M H 0L rX`0SP\p YPT@QpS 0^0  0p Pp0 |pYp [Pp   ^ T  YP `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP@S@@@`Y```` PZp^TT@ ` p 0pPTp ^P pY8 P  P   p  p^T T` P @p0oPTp ^Pp Y\q:p $Ѝp@-T`@0`@PP`r0Rv+Piv@ 00  S@ pO-$M \0@0 QA Hx"p@ P - LP@ݑUP U [ ` 0 H6/P Ko Fo@P  0H  p1/$ЍG-@P# Q 80Q 3/P41/P D0/P@41/@K-@p Q"@` 0/P``pWV X0@`\P0@  TR!HA  qKp@-X@0@@Q \P`0P@! R 2/`V:\0@p@H- Mspp 0@P UUT @U@00@P` VVU0V  PP@Q e @0  "`@P"@ % ЍO-|M1/H1/40@0P1T!sP 0Y, [(0I4p8P0`0 ` ( ,3/PpoH`P ! @ A A40 eQ  DX 3/ p03/pR H L03/PJ QE pH L0p1/>H@$ $p40 ( 8,  7/P\ 8<RLHdh 803/\  p @03/p 0[ypp|ЍO-M@0@P )`Q(P ЍTP R- c= "@" @"0@qPUa ,0@Qq 0@  x | Fp0 `@@RQ00@0 P``咗p &0PHpTPPP@H@Q@ LPALPJ4P `P TPQ `" R pQ 2 !0>PpW:T`V:P Q TP :@PPT@PT:P($3p P` !@0(C0`u`.`!0l$(0 `""@$徢$帢H`P A P0 A0S B BP @8 3/P P@THH` X0@ @ @ e/Q : P@, oH `A 0` `````峖p Pᢖ@,nP P`cP _ [LobP P  P* pHP` L03/P PU:X\P P`(VR`P FP R 2/@`` 0@0S~ { 2"@ ,xO-LM@ PpPD@ <DP `R@ #X  p@@6/P( X\ 0 hhl 3/8qP  h L0 3/< h4pl0p `D @0fV@pPL[:J0@@}B %,  PH9pCߍ/O-MPQ `$@@`(P ""@pdU $Q p& @ Q "xd@p@ЍA-@8q X R 2/P Q8q6 1S  `@ R   `0SP P $0S``0 3/< QP0`2 P$pPPVP*8G-M⼛0@PP[K0@@㻛0@Y^P㲛0@P^Py㩛0@G^Pz㠛0@>^P{㗛0@5^P_㎛0@,^PŦㅛ0@#^P$ R p`(s^ p`P$ V:< 0 RZz <t+;0 @00@Q  0@ b`8pdp``J 7/0@@P(6' 0"@ I( @0@ 0e`+;0 @00@( @0@ 0}e+;0 @`00@(,0 @ 0 P0le+;0 @`00@y00p@ p0 "@p0@00@ Q 0@' "@ލK-MP1< @Cp(0AS*d`08 6/ 0( 噝08 pp 7/Qh0 83/ލp@-(M@,0/`xPV p @  R 0 @ 0  Ў`p ᏊAቶ(ЍpK-0M8q L0 3/P  ~@P |@1/ P@ p U`0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  ` 0P`PP ҜP p@ 2/Ps` 0`PP 帜P`@-@Q 0 A2/@P  /@gę/ !@@@-M@8q 0 3/P7 Ѝ@/O-MM "@G Ps "@dP ޝPh ( "@WP ѝp#( "@$@+LΝP : "@. 0"@D @"@ $㰝# "@@+'ᩝP N "@. 0"@ŤW "@@+  "@ ᶤPa W/ 0"@" @㭤P O P"@@`+m "@. 0"p@ ᐤ "@+y "@0 | "@wPs "@p "@kPg "@@+ "@\. 0"@ VPR "@t@+ P"@E A "@< "@P6P2 "@U묰+ ~ "@'L  . @`)@"p@"@ 0<(P  0PE u P %RЍۍ O- Mp`E@T> YP Y8PMP0  "p@Q:  ;P  "@ 0'vp|@MPP Y Y  "@0弣EC ЍO-MMP/@`"@ `pWP P / 0" @P"<+ PS*Ap/#\PP `P FQ Q/R ЛP:JP EP+ P  Xi #њP(J/PP% 0" @p;+"@+ P៛P J P+ P:g?g@ Ἓ ᾚg@`Ѝۍq"P /PP) P`P 7Z`4Z PU "@+/ P*+) P* ዛp ዚ`g>g@P`H-I<p@-M PᲛ@PJ  @UPJ PI`a V P: !1qQ0OЍpO-M 0 ` 00 @(8p> DD 6DP  0T 3/P\ P) hpAg"80s ` 0S ФP L03/P hl ! PU:P(P"8PpW: (|0@0p@8 ` ` 00 ,`>a+6! @ 0@0 / X" @:P,T0 S q (p @P`TPG DE +! @ ` SP0|8P` S/ X" @,`:0@4$P,0PU} 0@  "@`0 0Xh`@j(0@0@0HH,!<L`AC p` JP (P7 P Pa(P!p xP* p`@p@@b",NdhR"p%NPp FL_ @0 8@]Ph  p hl@ 4 h lhܲ`o `tЍ///// O-lMP pP4` Gp Gp G0Pp`@W@R $0 000@ pPp0Q  p|P *."@WJ  P:R ,0ST0 S Qp |0@lЍO  a @0@P r $,4`X( ,$PQ ` Q 803/P ,(Q  RR(  (  ,Q P  B p,P P*4Q4$@`G"@ZP  "@ZP GpP,,(($`P P p X:(4,$($P Q 8p` L03/P LPTP P (` V:(8 0 P1 88`p L03/P HLP  08 < P    R pW:H1/` [*k8q p 0@Ѐ@pT 0@t0@pW  0!k , P  0 2p@P@0@ X*S 0pP XW!h0$ [ 51 0 7$P5 X*1h2(0 S&*1c20@00@WP,  QP@p`A R80s@0p @X0p0pP0@WPZu$4p W!*!P: 0` iXg [$0`p@Q@`V0 @Q@0@P [#* 0P` DXY0px /p0S P  2p@@0X0@P0` PN0 @ Dp @P@0@ ? P<0,p@(W :Q*Aa^p q P rPU  P$0 00W* ^ 0@PPWT!g0 lЍO-EMP`0Ud hlQ `80 R0P pQ0s  BYN p PI ࠍpPV p UhP0 lpp`pPW:!8phP @T pPp pUh L0 l@3/h @T:PlE oq-A&KQP0ѦPX <H1/TPL HRP h D #X`"PPT\P{  0+ @p8q hh( L0 3/l0@TpTLT PHP0 @p W\ PP\lp0`Y:[6*l 勑kD\p< @  0Pp P L P0PHT `VPp !R\@`DPR` RP PUP|0@PlPJhpd `0r(@Y0 T`0d H1/0W `PP(PPR$P_ SDX\@& @88P @4p,`pq[m P85 P g\p 08 4 pD @ d`3/PM , tp0 Pp\\PU0U p8 0 0( pp00>/ j< J\P A0l0 , 3/p P\ L03/0 $0 P` (  0P`D @0p#VUd`p@p0T:W P T0Xhq P Dp p @p\`Nd0 S`@ P8q0 lpp0Z: hQ~  0Q00TpP`Q0  d`p ````3/Pl Dp @p00TP d`p  ``3/P p\ t l`0p\,ppX pW08 0pT ``;/ g+ Ad0,0R,P}l 03/hp l L0 3/LpHpP`T P0mUUd`t l`V|*Pp L0 3/Pe l 0`06/PI  PTp0 RP`0  d`p `PP3/P  0`D P@ P  TP d`p6/P t0p p 7/PQ P Pyh@hP lpd`g8p_ 0\ QW PT@@ Q P L03/P  ! #"+ P U: XPT08( @@B`  8p R7lXPp@h`0h(8p[@pp0PT: |1/ 0 P!, 800`  6/l@ P2 ࠍP L0 3/P lP l 0 Xp8@t@T@ `!@#` P0pp  PU:@08PDHl@X岥< `p" RT    8 rpQ p_Pz `V 8 0 Pp0T l`0Pp W `VpP Q P*`0Ep Q `V+ X@` p L03/lPp 0 ` PPX$p PT, P`p@V:l@PT U*l` p 8pep iQPVpp2`2 U1:l@l@ Eߍ 0 "@" @"0@]KWO-M(p,@W `TP(P VPQp0 pWpP<ETPX@p aP8   arpWQP  ` P@  , 48T`XP$T P pPp!E$  V R PX$ЍH-P$`P@ QxpP[Px 琤GxxaV`O-MMP$x0@pWr w(P,$P QqW^ L0 3/P  $ Y:Z Z Z P` K0 @0 `@T@P%@$P S` 0`3S  P  P$00,@ P d`x  0   / @D Ѝp@x H-M* @Q00@ <: (@ @0@ЍA-M@PT0@Q "@ [P* D0@P o@ OP/  P0@P   @ BP{0@p00 @`CPU PUM pW@h0@ 00A<p8`V 4`V HWQW`0`@N0A8&04QU 0QU }WE< G 00@  " @3NC0$ xP  0P05/6+ " @P0N@ ``0` `PPPpW XpW,`! VB " @$0`P("` PЍH-!RJO 0S S %S80S00 80S0$180S 0|1S 00000 Rv ! > "@" @0@mRH-8Qv ! > "@" @0@mR0H-0@0@PxA0@@Q QQ   Qa/PU000H-@$P xQ R1/0H|z$ Q:Pxr$P U:H-0M@$P L0 3/P* UO ` 0@0S0A`0  BR`( 0@pWpA`p'`&p  BR @! 0! 0ЍH-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H--xMx@PP` 0p@ ϊ@ϊ4$@p@F  ϊ ϊ,⏊`ּS$3P [㥭@|xЍp@-0M`@8PP Pc! 0" @'P 1/$ 0 x`   06/U U 2" @ " @ 0"@ 0ЍpH-0MPUJ@$p0 x` 0  6/ "@ P x~ xP@!0Ѝ0H-P@"@ ?P o@ 8P#   @ 1P-  #@ *P. K "@ ƎP0}# "@ ἎPP @  "@ ᰎPP 4!00B( "@ ៎P 0P 6  "@0ᓎP0O-M-MM,pZ/R,0@PZȀ0P@0@P ÜPbrD^㌐0P@0@P 㳜PZ0P@0@P H㥜Pr@^0P@P  㗜PP0@hrP0@p`M0`@ 0P0 @@@Π0@@Hppp PPX        T 0 @0 0`00p0 p x`  0 @P 0 0@PP(0PonppK0@, ϊ,⏊ ϊ `G R @@0@pvp' @p_ JrvP0@$P x0@P |QZ[PPPލڍЍO-M-Mxa0`@Q|(@0@T  P$P |Q1/$Q}P}QAT "@%@0@Pu PP@p0@@o  !Qb  i( RU  80 0S N(/ 0" @%x0@PU  MP QU}QU-Q!0P@.}ϊ( )<,g "bx0@P a/b×bPY [ xa0`@P }AQ  Q  Qa/@TY@T  x0@X Pp k0` )!a `R `?0@ 0 8儁Xs$Pl  @ P`8 U5*L0 3/P+ &P# _[%  kQ$!   8 @ V P `0$`1/``$PPV, @P P L03/P P _[  kQ  @ 8 @  PU:@|  Z 0@P | 0@h0pxtlzh pP0@| \XT0@T d@`@@0@P T| 0@@0H0@4,PD@0, L@<@8@ 0@P 0@| (0${ y|!0"# @00  @ (0@00QARQݍЍ0!0@Q/Ѵ!/O-Maa8@PhQQ4RR$SSTTQ|QE 0" "@ߍOPxpW  R/ 07/P- L03/xPPR 0_{ `0!p@; $p|o " "@P;   P"@IPtIN P`Ip,"@@h!P RP,1U A d `0UP @P 0IP4" <" @#@D$ L0/3/P0T" P  { I"@1 `-BP pP !PIPHRHQP " I" @ 0@#I @pRo"@P   P8p@T 0x 0SU #_R" " @W#R/"IPI`, 0" @E# 0_{@ 0;!p@ $po "@ ` @lRo$ $@᷽` "` I  cQ~`48ڕ00PS `_V" " @" 0$ R FU Ro!@  N"@ z$ 0 _{@ 0;!p@ $p^o R/"@0"@~/ !@@@~I  I ߍ00@/O-MMpx0@`@(0@T! P|P $P 1/P $ R  0P1/P 1/P|QAT  p0@$`P P4C0P@~`@ P "  " @0 Z" @8P  "@$  "@ 0: "@ pPQ+ XQ(0 ZPPTq P0xp `` `7/0@ PT0 0xp0PPH00P@ `7/@ î,! YH "@㻮pPPQXQ( 0 PPTq 0xP `` `5/0@ PT0 0xP0H0 `5/@ ዮ0@,p! W~  0 $V "@yq "@u "@q5P40P@ "@ 0 P   "@0P  "@ P   "@ P `NZ 0@P_ p߃ D`0p@"@D@uP <  0P@ PوP P$PH`YV( 4@0xP  5/ 8 B$0xP0 05/ "@0<  嫈P!@Y P0@P  "@@0@P PO@p0@㐟 HP`  P[  0x BQP !#RN0`(@@`30Q J  P"@ee "@ ^P3 3"@" x" r8`@T0`4@ !(0S $ " @ C"_ !,0S $ " @ C"Q !Cn00S $ " @ "B0 3 "@0P0(`Cpp  R$ 0,0y0," @Pn0 "$ y0" @\Pn0u "4% !0@" @(P @0c "$ y0" @lPn0T ">P 1% " @0B  "0@>P 40' " @00 C"4@CP0S $ " @ "T0S$ " @ "X0S $ " @ "`0S $ " @"d0S$ " @"zh0S $ " @"l$ " @"_0吟   "@02,00pWx`!Sp (@0`` @ p HV0`   08Sa`a0` R(@  R   QxD0@P ⌀C~300@@,QP x(@0@`VG $ Q@  L0 3/P @HXP$ Z:*  = P/P =/0@ @ =  P{0P ,0` =@,=TaV{_ 0匀40@P,PY 0`x A=/  " @0@ c1!@P !@ ,P x "@0 m(@匀0@P,00448!0N "@S` 0`@  "@CP (@ꌀ0@(@@TC@Q 1 1Q Io00FFV "@ $PQ  (M0@0@@P 2PP" P0@P   "@A  )@4 "@VM0@@P  4 "@MPP   "@EߍۍP@-@zH0@Pb P"@ @مp@-MP' @$PP# 0PP `HP L0 5/PP !0@$QH`R UPPЍpH-8MP8PFP @ AT A4 @06 P2 $q+$Q wP  `P``V Q  ЭP I  K P  Z <(0@|8Ѝv ! > "@" @0@mHG-Mp8Q P `Y A A4 @P bP $A1/Q  01/P P1/P$QPH1/P򘀍@ @ W A A*"@ 803/P<0S  3/ !`0````X@ 3/Pm d 0 H3/pc h L03/v @ᬬ  p㭸 PA @` L03/P |Qxp `V:W$:P" @`p L03/P  |Q h l0"#v` pW:v```#  [(0@|Ѝv ! > "@" @0@m6Gv ! > "@" @0@-Gp@-@`QP <$PpP^( 0@p  @D T pp@ӔO-$M\+xp@`#@0@\ 0 PU PPU 0P 0`PU iDP Q` V$ЍO\`$ЍH-M"`A(-0 @P8@Q`V P 8xpP q 0@0@`P   "@:@PPqppppqpqqrYha(0@ @P7$&@ @0@ P*0@P @<:P@(@ P @0@9:p>0@ 0@0|>0 @ , @0@ $T20@ 0@0<2X @  @0@ 0`x0 @00x&8p@p@ @0@PЍO-MP@  `p2f1 8 00  Q7` RQ`V, P&$pW Q 0"  Sp @PF'@au"@8  `@Ѝ uK-MQR@(ttLudu|uuuuurw` CK "@ I p"@PPP XP 0 ,p! WPw` !K "@ I p"@PPPXP  0 ,p! W/ !@܍ P(w$0 "P"w 0Pw 0Pw 0Pw 0 P w 0Pw 0  "@܍KK-HMF `)@@PDPpo 0  0)@ 0(k QL b@vvw$wpw8wDwPwhw\w4P0@Pf74 0@ fP/D fDPP$U'P゠" b@ b@o@PP b @0&p+! @P 0p kyZPWHЍO-4M@Q> `PpPP TL0 3/P X o 0P 0r000"P,`! VU $@Q:P P+E⚠+  @0 @PJ4ЍH-P 0  0$ ALdEG-(M80@-p`W pMp"@@P v8PpGP wppVyyzXzzz {`{{@v0 @v`QP (,0 @ 0V@. @p@`@u`QuS g"@0XP  Qu/)0 ! @p@> P P$1+ ! @p@. P P(1+ ! @p@ P P,1+ ! @p@ P P01+ ! @p@u0 S g"@R(ЍK-MP P@T|||8}P}t}}}}h~P  0 ```8x /P @ ,! " @0a7@/QPPePo_PP[00@,!< 0PMPoGPPC o > PP: P7Io PP0 P-Jo PP& P#Ko PP Pn0p+! @P 0p w)YPWPPލ@-@Q y7P p op @0 @PUX @-@CC4 `I @ 48<PG-MVP`t sVL$P|@pI^ `@"P@P  - )8p@T@)&*@yt 0#(0S+! @~@+,0S+! @s@ 00S" " @h@-Tt 0 "@"܍K-JMF P)@@po 0  0)@ 0zhQ  /b(@pЁȁ(/dP+P)P . 0Pv#n,@1b0@0)p+! @P 0p v9XPWPPJߍO-4M`p8` P`f`AP $$ L0 3/P`8@ V V 4Ѝ@-@P$ 0 @\ @4( , B딣EQ"d b "@@CA-BM@VP`s k V0H`Ԅ 8dԅ3@s 0p@zs & "@Gw5@os`0g6@is`4a7@cs8P`6PV[sP "@ 0XX0SC$ ! @]@8;@Fs`d>9@@s2 \0"@/`0S" " @D@:h0S+ ! @9@l0S+ ! @.@= p0SC$ ! @#@>s 0 "@ ?@st`Qs 0"@ BߍK-MP Pe@CbXp|̆t0HT`lԇP P00@,!< A0>0Po084Po42P8 PB 0u%dPodo\pEb`pFbhpGblp0+! @P 0  juVPWލpP PptPotPP P@-@ Q5Q p@-@` `Pt` F`A@p>EQ"d b< "@p@p@-@MP@( 0@P JDP R ,@! p4m0`@P  TX0P @ЍpG-Ml4 0@@?X0,@gP pW pW (pArr` rePq @ ,0Ro0U 0 00  "fp pahflPJP`,吁!(Q !C A ,R㐁   ލO- ϭ㙷 "@"@P3 DP  8880p W P p 8 P"@p 8"@ pu @  `,`V 0  fPGߍۍO-_MMP8 0@P  P"@ u@P _ߍۍH 0@( Z`" @0t@PH㸃P EDh!@@(P}pyPd `T 0,@${o<YO8`@p4PpHL\Pe`᠇PH P [ [) [TP+T 㖖`0\ ㍖P \&eXePP I "@   PX  sP d! 0  h" `T`p  eP  @ P  @ P  @ P \P!@ܔPd\ @ $ H48@W$,L 0 HPp=eP"@ X\HPL7 Y0 PD` T0T `PP0XԐ4\<8 P 4T P  Q <p<!@Pd"HLPp <@84,0DP<h 48@<80p@Ʉ0`v?(E'_/`;D W/ ,0`0 R 4P @  PPPQ088P`8pZ0W 'PᲬP0Ⴤ@y,0|d[/`L 0pllP<t~Ppql0 [/ `l`P(x\% Dp0X  !`Ъ040 0#8@ 0#  R `xp W:7 7kD@+ ( 8 "@" @"0@d6 ( 8 "@" @"0@[6K-0MP* >`P! H؁P @ "@T`PpX3'Y80!!!1PppW@ ``8 p<0$ 0Ѝ ( ="@" @$0@"6/ /H-0`@V PpD3P 3P `pV@p@-P 0P@U  ̴弃`幃VP崃p@豃 ) 9 "@" @"0@5@- ! @"@s@A-D @PU# 0 4 `X `8T 0`8@D` `X`@0`4p`ZpP@p`Zp P0p8`Ѐ`P` p`ZpP[ 4e  PpPppWPS ЍO-EM8aV) - @BV"@p@#P@ P   `pV 8 0"@|poEߍA-M M( " @oP-!@㆐  "@快oP!@zP 0@{_u`P@!p@łP  0 cPBɀ@ЍK-MP`@S  p "@z0PL w "@t0PL } "@n0PT  "@h0P6  "@b0P6  "@\0P<  "@V0P4!@yP. ԏp`!@"@P P @@0P@@PP \`P 0@( 8@ TЍD` ЍK(P )PP O-LM4p sP㴐`8  000<0尔,`dDEF$`<@"`@ P P Z48 p+lP`<@p"`@P P pW48 pFGI0H / @Jp4800 p,pK`$` LЍG-8MPPPP( 0p @c2P  0p P`8Ѝ(  0  00 @ @ p` P 0 QQ1"2(p`p"`@@f/P pW d I(. 0rp 0O-lMP# 㐟,p"@ @P0  @ ` @ @` ``q  :/pWlЍ0H-MP0@0!481 "@c  0PJ  "@d  0H@T 0 4/᝿Ѝ0O- M0@ .0LQHA04q8ax-TU @ QW X ?V p ?`\p`  0 ЍO/ ЍO-\M RZ s-d{ @!p@0P  P0fG`@>PK P!@@0P  P0fGp@P@0@P HL0Pd!0 PU@P? - 0- 0$%PX@! `5/p`\Ѝ@-PM0@@P 0H-P]@0P@Q Q0T0@ D 0"QP!@ RUR00H-@P *p- 02 "@H) $* > "@" @0@00H-P P0@@P T0@ T TEU P *"@0T T00|00H-MPP 0@@P  ?PPT  bP !0 @QQ Ѝ0QЍ0H 0@Q/^ /0t+ @ S :H-M .0 @ ЍH /H-M P.0 @ Ѝ.0 @ 0H-0MB"0T00    000#P0Ѝ0H-M0 0/  @ 0 ЍH-M00 /  @$P ЍH-M0 /  @ 0 ЍH-M x  @ 0 ЍO-WMMXPt+ @0`p @P $0 @ P$`VWߍۍ刵P AP*[S ! " @xQ@[q w$ " @p0P QH㈠ 娰X\`@dPpg0 O& " @0@0= @;@@ PJy LPep*dw  $`刵P >* R: "@" @"0@J/  &(`(P@ L03/P X( \,0"# #" 0@ T:$`o& " @ 0@o0 0xp 7/@`p@-M4  ?0PBT T TT bRPU 0 Q T TT @0  A PCЍpO- "@" @0@T-:SpX v|_7@P PP-$p 0 Q & P`!R U R RR "q pRp a ` ^ P@UQXp: 0(Pb0P!,Q Q0 p p  F  P$p  0 0"D pPS 0  [X "@F8PU qPU {2<P@P(P P' X40@  ?` $ p6RU UU ` ,+ > "@" @0@l-:b>R R@>  pTЍO-tM8^Pc 40@0@ SD0AQ0R^` "@L0` p@SY PPTTT  rp 0`:T 0WQ00P@,0Q0)0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^tЍQ @ P`P ` `P`  T.^Y:^ qw?10`2plppS 0 pl  40p0 PJlPU4PU8<`Y,P  Q Y  0Q0p 80@< @0RD AQ 0pS 00@@ SD0AQ0R  0@@RD @P QbB`0Dp  W T `V@`8@<`@D 40 P8PP! "A8 PQ o PQ yP X4 0@ `p&0p @Q Q< `V@ & @0D (  T, @% @0DP$00(PP0Q01Q U, $0Y"  PP (PP^ P $040wP 00U* /O "U@@% P($ (0ER@P@D"840 P"5 P`V PV y6gB0PS'0Q  0U @P$ (0 `,0 V R8<V@D408 PPU PU x Y P W vPY U r@@"800P`V PV x 5 0 D0pP T" PpPP PH` R V R RR Q p`@VP 0S`@OPaxPU\x4 R|0@ <+ I; "@" @"0@*A-8R4`U @?x@T:xRP2" @ @ @ @*A-(Mp@`P  B0 H@% @`!PP  "0P 0`0 "@" @0@( t, < "@" @"0@ ( t, 8 "@" @#0@(O-M-CMPK!tP@ hdpt@lVpwY`? " .0`B$4@ S)0 ;PJ,dPD(p` Pp@{V$` P PP P! PPP P`p !R RR)0RH " ?0 ,0O@@B R R R (0"r" " 0 YRXW $@ PCpsPN T `p W  ,, Gp oP" @ g ,4 pP,| !ru `  WU PO `V (pOPauPU\u (p,PJU\z&  P4"P/0 L03/PDP%  0@@RD @P Q1/U P @ @ @ @upCލЍ , 8 "@" @"0@C'K-0M:rP1 @P`"@TPVp pW p`V?0",.20 $R`p2#  P 0τf@0Ѝ , 8 "@" @"0@9&O-TM$H0$P L0fPHJ0H L`P4P000 4<($D @0OP.J(?< PP,(ŇO,t'C#u( p;)@0O!!D0C/R" @T#"p^    0ZP'"X$! `VQYu  吵" ?"@0@p?`HL Q pWp  " 0"L?#"*P%"S ' H0$ 0PJPPL 4p?#"00 H ! `V Q @TЍ/p@-8MPQ20@ "d@A`~ p ; P5  L03/P- ''+ "+p U3CUE0 0@3CC #1@ 0 0A""` #1 11@"" &<",R*" P&018ЍpO-M4@pPo? FFPP Z QPکPW   pP "@7#P JzPP PBPTW ЍG-4pq=pW0@PT \ &0 ?@`RU U UU R, @"0R YLWP  GP:Y=W ᅉP?6"R 22  G4CO-MMPQ {T4AnpPH 县 @P w  ;㻵pp %  ;[@XpZw Y0P 1/ BT _`r`VrOPrPUr rЍۍ , 9 "@" @"0@k$H-MM@0P 1/ ;ep `PLpP p HY}r}YzЍۍO-MATp0@@0@*"@ Q9$ @04`e`P-0 @pG0w@0P@PЍQ Q R8 /Q/ AR/1Q/Q//@-@P 0@P T0@Q @K-M0@* Q@4`$ @ 0mU p:* 0" @(@T P 0@0@ p0@@p@@ЍK-M4 `㾁RAT V* T`TY pP@T U T TT V `PpUT ^ 0 08Q 4PU* pRUUO`n`Vn4WRU PP  4 W @@P "@O`n`VnO-M@㾁p_`EfPP V QPکP"0@SKQ RY  "(  `FpvPP P[Ѝ @- P0r0222R0+080@ R  @ Q" , < "@" @"0@ p@-O@@T  @P`QP?@A@p@P`QP?@A@ @ 0$b #b QpO-KM`P᧨0@N \q 0@"@@0p@ pPePfP lP zP<bP eP "@ 0㏀%0 @ !@ 0偀 p  )@pW@T  Tp/!@  > ZC XAT?  F"@ `/!@P "@ U P)   P% %0 @`p@ pPI A$ =%0 @Sp "@p_m@Z2 I-Up  "@p "@P(U U$AT(?T. &"@ @0+P $ "@$ T$,T(*T00@ %)@SX0 @eS0`@fpF/@@PhDqUp 0@P ;gP3 "@]pITpʒ "@SpI "@K$ZAT$S(S ^ "@6S @h   Sp@P# P( Spʼ Q P 0@T  P tp "@m~ "@(S^OY H` P$Q00P0Q0v 1 P V V >  olP ᪓@-ML @0 !@  )@"@ &ᗓH- T H?S@-F )@@pS0@Pz@o O-M-RM(e0uHp0`@0p@0@8U0P@ST e J KT 1$AS(aP@V0@ @@@U k@ Je0`@Pb y Y5 Pp@4@0@ 8@ ` ExSP. A@0@@ PP.p@ @ @ 4@4@08@ ` @ ERSP( mP% u 0p@0S /)! @0@`PV;k1 A ᠋!e0 A "k ! @  _ dUdP0` 0@Q-pAP pG WE- `" @ "! @P!@2?G kh @`TP@p0 6@ uP[p!E:R :Wp ""@k! @ P @;P80@(A 1$q@DS  -T=IB PpJ 1 A0@㡋0 P @0 A 0 Q*P @ 0 %Pkp!% :S0:  @`  !"@dp00 0F!B% ';C5"e! @P0@ R50@pX(@% R!Z"e! @ Y@(0@ R`0 A@1F@ p zW"e! @PY%e! @P0@ P ZQRߍЍc PaI*G. e" @vP"! @?ezvQP%.ra(/Ob"(r0r 27"cA"! @qecP.AH-0M0P  B ,<PC0Ѝ@-I@E@H- M  ` AQ ЍG-RS PP'7Q `Sp@"@: `T 0@`P: A-M`@P@1 q P@)p@P P:PUPP#-P  U   TP V  y`@P@ЍH-`@PPp  pPPPU7Pp@-P @Pp  `sP@Ppp@-M@ Qp D@ЍK-`P* pP  @ P pA P0 p@p R R  R@R R #R;RPPr "R#R \R! R  PH-MM "@pQЍۍ0H-@  4PP  PU P R iiP  R  i iPU0HiO-MMRR @P T k p`P H`Vp@U,  0p *"@7P #P,T P$ P U p PFP@ R@M"@ "@7;"@*"@Ѝۍlp@-@$`PbP 0" 000` Pppp@-M>P`@+p& 1 0@@pY"@"@ 1p 1 0@@npY"@"@ЍpO-lM `KPo2p, @ p P VPp Op hP Ph" Op "@,L,Ѝp'"@Ѝp@ P P P '! @!@&!@ "@Ѝp@&'! @!! @ "@Ѝp@p@-@8$@8xPU i"`@ P-PUp@0$ p@oA-HM@pPP M0@$2pO"@` 0P ptU @ v"@ ad"@ =.Up  D1HHЍA-@`:6p@$   '1?  6  rD Q 0>P :&P o P P U e0A-(MpP@`6HP$p P< V} P "@"@U LP pPM` 6pP ]P P a/"@D PR DH!Z  !@,(ЍAa P? P<PP@Pd6P   "@L'"@(ЍA, "@"@,/"@gDP $P  gpCP "@U(ЍA (ЍAR@-M@pM0$1p H   "@N6 "@wЍH-MP@@p[P? + 0 - +;P  0 ` "@"xP @P RP 0 0 R r "@B PyTP IЍ "@ЍH@-M@pP Q # pP t 0j "@Ѝ@-M@ P ЍHD  q P Ѝ@#@-@:"@+LP PN@HP& P! @"@@+p@-@`HPp ʴ@P$  P{: @!$@P p "@A Zp "@p@K-M@q ' ` 0 p$P5 PP4 p x P7 @ P O "@> > >$Q$I **DExP @ P  "@/"@YPM L8"@CLp8pB@ Q   x@ Rpx e "@DH!@@ *@pV \ PBQ   uPb rx!gpЍH-P@`  "@pp@ @B U"@P* 0P P:H O-MM`0 zJp y"@"@"@ӽ@PbA+.I` p!@Y"@v87P 4 PP@ `Y "@q\!`1 !PP PxP `@P  T`V+ @P xP ;0@x` xQ@ DH!P;0@ ` `VaxwPx  zx "@%Ѝۍ@-@ xPHH R$ @@-@!@BA-@Mp@PR `P V :7  !@"@@ЍAP"R P  "@0r>pWU% * CP P `*<0 C p 7"@ <08 T"@X>P * @ЍH-M@`8!QQ Q.Q@ Q PnЍH Qg , Hpaq"@"@ЍHQ, Q< Qe%"@"@" @M0 QJ QW%"@"@" @?@p;"@ЍHc%"@"@" @/ 0Pi'"@"@# @$8D!\H1Bg%"@"@" @ P0Xu0p@P  K Ѝ%"@"@" @ x@T 2@"@ЍH%p@-M@ 0qPЍpD1`H o8!@ 0P0@0@00@P 080 P  090 00  Ѝp@O- MxpWC 0@ [ P ` P5P PY P [ U* PP" @`"@(  ( 0K@ U    ~QpW ЍK-xP 7P :  P@3 VP "@@O-M@PP`Р,(p @R ` `0 P    !  "@D/"@ 9 P P @ P@Ѝ0H-@LP PPXLPLPXPTP PXXTPTXXXdP PhXdPdhXhRU P A ,PPRXlRU0pP / p,PPplRXl0@-@ "@@@-M@Q m "@"@b ^?p PQ 00@ @ppЍY"@"@Ѝ@^  "@Ѝ@p@-M@Q m '"@"@] )?p" `PPJ|8XoRP| 1 !0@ @1pЍpY'"@"@Ѝp@y7` `' "@sЍp@p@-M@Q m 8"@"@r_? B>PP p 8 "@U?Ѝp@j!Q| A0S| j )`@XPP `P@` XX  P 00@ @p ЍpY8"@"@Ѝp@p@-@>P PR  y `L0p`> *>@pH-M@pP tqe/P" @(P pPpV P / !@"@QP "@C/"@" @U9 >pQ; `l!R pP 0!P0  "@.?(p"@"@lP >P p *P> n>)+WptqЍ" "@lx`V >P`lP l"@\>P p *`> C>p@E "@F/K-PH S` X]"0"@" @"0@R! qp@ ,PU Q P P Q   PPP  U Pp@ `崑U]"0"@" @"0@GH-P q R 0S   U B !0"@" @"0@A-@_0ϑ@`\```3puVp 0H| p CSRH-M\J C\I  0ЍG-PM PUS @ CSV*$`(pW P P p0pW P 4 TPpPP# SP( `P Q   Q,p,ppp,q!0"@" @"0@q!1"@" @"0@q!1"@" @"0@ H-M0Ѝ@-M@bA̎.à.b@@ 0{Ѝp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p/!0"@" @"0@H-P PT F!0"@" @"0@)H-PTQ!0"@" @"0@//H-P8]!0"@" @"0@G-(M@P "@ `T+ @+8 <PpQ G `P8@?P:; <"1`V: ;Pp <PP A p `8  p <pW:P(Ѝ('0"@" @"0@YC\0@ R/ 00`0@/0H-XR@P P=p @P0@4(@, @@@T0 Mp@- MPO `@V P`q QPpQ   p ;@THTU HLP Q   T Q ,  T(PQ 4  T0PV Ѝp@ Ѝ/@-@@{TO-MP @TP\`0@P0@P @ @R D2/(`V P P J `P  Qp   `UVPP/ pLP*H P% HLpH R 0s qpp 0P   0Q0000P0  Q UP H0`P*y7P3 8pW/ `VPTPP P  `F  Q 2/V pWP,1/4P`4`TP\ PЍ`)0"@" @"0@G-M ; @O P/p@P@@@30r`T`0@ 0N j kCs T0  0(PU @F`pPp*` ` p@W*P p@ pG PU h LЍMH-M  0 ЍHЍ/G-AMv `)p@@Pp `; 0Ep$ : VV@ V  )@㰀 @ DL 2W   F[AލMH-M  0 ЍHЍ/G-M@P` p 0[0!@ pۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ/ )@/ )@/A-MM P$`9`p @ PPP n f )`@/ !@`Ѝۍ )@/ @)@aZp@-PF f )@)`@ ;@㒸d' MZU ;V@pEZP/@-@7D/@&R0H-@K#Pp ! Q:p ! J:PpP0C:@-@p 9p 9Px#@Q`:0H-M P@  㶹L O:p $Ѝ0A-M P`@p  㚹㐀H 2:Pp !vw? PP 0:pPЍ$ /H r /Q@ !/p@-XM>PU U7V*T @`@Q tT TPUA @@P> <0@@  "@}> "P> *@XЍp@-@T1C@A-M`V @P P  TP Q  R0 p =C`VЍ 9Q/@-@TC@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB 20^0R030O-aM0@p`FP @+KPr  po UZn  NRRp$P  PP bP ZT@T P @U @zP @U@Tu  T@P(Y PX 羢P TP UT\X @` 筢P \@T\X,LP P 瘢P L[LD, o U( Q [P"P "@ R$PR$PPLPI ( NP @` , X$- 0 @  pp h @0 DL8pA@ 0@S0,CP !6SR S2 @,WP3RdA(ThQP P@T!P( "@$P,SʇCP%:S!S SX(P"@ X (@ 2T"@MT@, ฒ*> @RX p "D !pDL}D m! 00H X"@ J  "@ @tOaߍ "@ A- MP`Pc` Ѝ@ P P P*:P `  p8W 8p`8  P  )@ !00:P PPA`p ``0Q` iP.P  ` ``Q4H-@MP @P`R ~p `V pT P P `V`@Ѝ xQ/$ /p@-M `@P  {T@ H~L 0 7pЍpH- M@0 P:`V 0 PpPP `P`V R: R #0xP Q p Ѝ5p@-@ fN PP ` `,PV:PWN(`$PP` ` (`,PV:$PFN$(pO-PC $PH UF"@3P [@4 P  P P  @r\P 4@ R @pT Q5  PPT pP}$PTpu[q,(0 @d$Pp[` dh⻲P @4hA4dhP d"@U@$P U`20! !@"@?+ R/ /O`q,PJ`p@Pd@ P"@ Pq hg\ $\YV\ ?RepR B 0 P 0 P 0 0 P, "@p%$\` [` PPUP+ P P0E` A p X0PM 4t`VP P PF : PP@{ p0p! pp pbX0P T"@\ :@ 0Ap i  "@gQ  Q QQE"@Pi@TP P PD0p`  pp ` pX0P 4"@1JPQ Q Q@@@Q  Q QQ=(P p0    @ W0 RM  0P}PG D P  ?1"@s946g830@ g-"@ p / `@P /P@ T /`P `P""@ {"@"@h`P "@m"@T  P P P,.Pf"@ Pp!@PLP #@LPP @"@LP [ @LP B@LPr B#@ LP M #@LP'  !@L@PA ~ #@LP E @LPP Y #@LP #@ L P #@LP $#@LP ,#@LP 3#@LP ;#@LP o!@LP q#@{LP j#@uLP "@oLP Pc#@hL QP@P@Q v#@_LP #@YLP "@SLP #@MLP #@GLP q @ALP "@^VQ  Q QpQVQm"@1`@ PDaL"@2"@VQ"@@@! "@&p ͩP 娥 %q"@"@VPA"@9 A 0<p+ hx`@"@ nPK "@ nPU "@ nPy "@ nPK "@ nPD "@ nP= "@ nP6 "@ nP[ "@ nP> "@ nP7 "@ nP  o" VN  P`PV *V P<L"@ C `MVP"@`4Ѝ3/, `hPY:m7V  `P` Q QQP 'PUP P PEQ  Q QQ@P` Q QQ@Q@ "@ PP "@P  "@P !c!cT` $@P "@Pq`l 05p pP:X "@  @`h)A 0;A p P @h=v!@Q~ Q QP%` P P9P@Ys` "@wPk` P P/P(QW Q QX\gh;4,0@ @:4 0@940@hCL"@?FQQ Q QZFv@,0 p$ ( p EP~ ,PV 0S 8(P  @P   P E@`Y`T`|<P  0vL"@R @P Y P"@r  P @@  "@d  C@ W "@Y V PQ  Q Q Q7 "@P@Q Q Q@  @IP PB P $$ QP `0S0S  ,PQRU, ,PnP P$ % @L"@ A0BW :`@ d`0K\pPM @ PFPPCFPy P PVFF<V1 0-? 0S0,Q! "@dV4 , `p P 0`P0C@8,= P   tP P P\F<Sj"@7 ZP]V /P @ PPPNP @ PG@x iOPT 0` `` `6S0(Q ,"@}TDM"@RP Gh@P(X`D@@U@@U@@[ \WW\\V O- MP`pP@"Py"PP p U [VQ UP X` *`VU\P @mPsPnP: rPXUZ VUPUPS 0P/ bPIUK GtP? xPA )@ p 0pp  @0  P5 U 3  a.U!   0RP P  aU P U U P X: PpPPU [7 ЍO-MP`#P" =@iP" ~U``V? P @ ㈥PL  A Ѝ "@ЍO& "@"@ /<p=8@W jP `VP P p? q7p 4=P       "@ЍO?H-MRP`@PUT' ``:/P p    Q "@pU P W /G`T !-PT`U 2- "@`ЍG-M`P\P" !@AP! !@NP p ǤP @ q @PPP' "@a ' "@]' "@X>>ЍK-@M P`@P  A p A A A IP t t =@ЍG-`p V`1@PGP X FGZ : J 0Qp00@T*H Q3/K-T`V0 TpW5 @HH Q Pbqp ||PPPP DDPQPQP3PfPPP`Y. I+Z;"@" @"0@. I+n;"@" @"0@@- @c"@ g"@@@-@P@H-Q# P" gPP' @ P` TpPW`9P . q*:"@" @"0@3L. q*:"@" @"0@5CH-P TP gHH=. *L<"@" @"0@,0H-P0@ PeP T 0H0@-P @c g@. *:"@" @"0@[ 0H- @EP0P= 9PP00H-P g_ -P @{7@P 0 "@@. *:"@" @"0@[H-P QT. *b;"@" @"0@. *L<"@" @"0@@-P @PT@. *b;"@" @"0@@-@fP S\@H-T R H. *:"@" @"0@H-P @ c_P` pTP#W`p@- MQ @T R$ R* PcoP P+ `" @ 0 Ѝp. *L<"@" @"0@6. *:"@" @"0@-. *:"@" @"0@$O-MPQ pQW H< @ 8P<  X`T[t"P@P PMP IP V! "@ !V "@t <!@"0@0V  "@ "@H0% "@  0"@ Ѝ. +;"@" @"0@ . +L<"@" @"0@ O-4M@ P$"@(f "`@#p P  "@"@$8`a1+P $ |bP Ġ$`@  pT Q  P P T8p' "@PP9PPP [ZTc|X P|TTQ88wP4  P P P P  "@@P TT R8 8CPYP XX:PxxQvpVP 5 "@c_ 2P= ㍌`@"@ p%`PP+9PP'm NPT P   )p P P "@oV P k@p"`@8kP cT pP$a^4ЍS0Q03Q/K-Q TPp Q @8P @Pr"W $@"@W7W, | |TTQ~PtttP88oPP ` p1P- o "@M*P# `tt TTQ88LPx@xQ! o᠒u pP ` "@$`f pP @Y ~ "@ @x@x`. D,K<"@" @"0@H-P Q/ ,<"@" @"0@;H-P Q/ ,<"@" @"0@QH-P QQoj/ -<"@" @"0@}@-P @Q QoBN/ -<"@" @"0@{@-P @Q Q@@oB1/ $-<"@" @"0@^H- MP9 @PP 00Po Pa!PU ` eP /`Pu0p@P `P  A AZP` Ѝ 3-<"@" @"0@ 3-?="@" @"0@'A-PP@'`TpD  /Wg T de0`@Q|P W-e="@" @"0@0H-P2 @Q8 PP QP P 0Q0QQ0u/P@o1Q01 CR #P 0H }@0 -="@" @"0@ -="@" @"0@p@-Q( PR. `@P P pQ  0p@ 0p@&I0#! @%Pp -8 "@" @#0@mP -="@" @"0@nGH-P Q!.  -2"@" @#0@5 -<"@" @"0@,0H- AM"@P!@"@@aQ0O-LMHwpP P0'wpP G3w "@PU @ "@@`@?P:!@PU$ "@PU @ "@@`@?P:!@PUpv H 0PvU PH LЍM0H-M  P0 p @z<p@@Ѝ0HЍ/G-R'@PU`  R R* R3 `PPPpV' P* P a ZpP .,>"@" @"0@nYE R  @T:q .>"@" @"0@TH-Rp`@PWU H0& "@$0@p! @0P `p``P QH RU p`0H-P@p 0H}0H-@Q pPWP @Q@n"`@ bPPOPU:A-M@`PPP]  up+ Vp"@ rbP( !R0 ["@0 p PP ` p8P X @"@E"@'ЍA !@"@QU pE~"@"p@` !qPUЍ P PPQ4S "@/Q =?0"@ "@O-M`Q @U J;yzgOP# P;@ @." @P "@p x "@p Y "@ xp  "@pP, "@P$  !@P "@P "@P $@P /"@P "@PY "@ 7p H "@!"@-p x;@ 0 PP 0S  "@ {p @  "@~p DP Rgᷝp @Y   P{ /@" @  "@pm H7-"@"0@Q$ @0Q  "@p\ D "@pU L &"@pN $ 4"@pG ? "@p= LP pM0$p H "@p*  tP R"@p ;@o "@x`V& P P   P`"@U"@R@Ѝ/I`!@@ip D `R^]"@_p  XP `  PV /I. !@" @_p T/!@ _p  :`P9p "@rP8 "@lP- "@fP'  !@`P! $@ZP "@TP| "@N/P" @ PPj Pf  @ @ .  @"@n"@pj  w"@pc %P  "@pX /%P x`V %P`V "@p?  "@p6 PP 0S~ u "@ p! @ u "@pm"@.  @A-R 0S P`@"p@ zp 0SH-@P@pP'  ᯜ`P.P$ !@P !@P #@ _P HE .@P`_`P @H-Z @'Q)P@(`A p`pP @P` XXpX ^`:`pP @P` XX X ^ #@] "@] Z @]  A@]"#$% &@'( )*+ ,-./ 0 12 }#@.#@+#@(##@%+#@"2#@:#@A#@L#@n !@X#@ "@ b#@ i#@p#@u#@!@8]  #@2]  #@,] !@&] #@ ]`P@`XX X HB^ 60@0S /A+ R 0S,0pQ l2 R Q,0 /H-QM`@Pkp 1&7" @ D # @ "0@ƻ` *Q pPE E *Q:ǖ`G 1 7"@# @"0@᩻QލO-4M$\(P P 00!@5Px O`0`,!@@p@PPc  #@ Q^P#@ J^P@U P PY -P.  E,P P @T,P(@$PT= P  E,P P @T,P&Y# `P$PX  0X  0O!@@P5P 3 34Ѝ 3 0H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \0\0O-MSVP` @ Z7*@p` `V2 P@PF V :QE TCYP=@Z7@VC*^p [@ @@.@ Z:pWA @'*^`^@NY Z:`^ ^ N qVn"`Q V`FЍ`]7ZO-Mp@Q P@)@`X0y[ PkJQp a Q @YQ% \Y PJ \Y V; WW\pG6V0 WN3 !0@pG)  `) P /Y YV W6  0pG)\` V W" pG`` )@@ U:@`V W  P P@7@ЍA-PpPW )@ e`0.Wp@0.W`!,W W% W Up\ 0 -W_W  >S0p P pnXp H"pH-M`P @P RpW"LP p-M0#  #@# @W 095ЍO-,MP0@ \p P(P  0"@ #@p P P* `p P   0 p 0# @k#@A  pG ,`Y:(PW $`    08/P(,`Y:( $0p8/P^ (P $`  R 6 Q S$ 0m(,`Y:$ ($0(pGp8/P-#@)&p 0p #@# @0,ЍO#@AW#@  0# @W0,ЍO-GMMPD@`p. ApJp\ /!@ ZpR T !@ZpI =34pD W  @   *BQ+V42 0=p( P 4p"  JMP / !@s    @  0ppAJ GߍۍqtW[@!P@$@ p W 3p +-36 >@AD h  .0?P / !@~Yp P PH%  @pYp p.   dYp p" p p UYp p  2/ 2/lX/ !@@Yp pW:]q @s@P`TP0PPEuM 2 [3pkSg@- @  QBT  D08@Q Qp@-@ `P` P `,PV:(Pp$P`(`,PV:p 90 JZ9A-M `P+&p@ Pۍ@@P `)P @///p@-MP"@  )`P? @"3 p6 0`)`p|#@#@ 0@ `p#@#@ 0" p#@ `p#@#@Ѝp0H-Q@p }.x0Hx.G-FM@>P+ pF`  -  P `yqH F?`> * F?E`Fߍ0H-@M@Q "@P @ @oQ Q@Ѝ0H-Q  RRL`"2#@# @#0@E$ Ho/0H-@MP   Pp 0H-(MP P@ 0 B C ) L0p`P pT !W:7 `(ЍH-MP@ pP @$` A` `兕8(L p!  P(pPP` @ A fL `p`P``ЍK-MP pP@ G `䰐 F:L (P qЍA-M P`p@ , @ЍO-OMMQ @TPP Z @@o8`tpTC@BLpHP(p@Lp P TpLpXP3pLpYT|  xHHPpt`(P 0T @x Cp 8Lp?DT@x@ Y PⲀ @ @ @  $`  FV@L ` FVL@ k Ⲁ @ @ @L  X @P@@ D$r rpOߍۍ""L<#@# @"0@"":#@# @"0@"":#@# @"0@G-M"0`  ````p< P: &P6 `0 p) pPP-pxPבP"   'P\P  @ EP 2pW:5,`Ѝ0,,`W` "@A-(M P @`Q Pp(Ѝ0'x Bp )pWtQ =  QG 4P   RQ|@|  8  Q' X0Qx x pPTPPx8 "@PTF"P2#@# @#0@H-@M`P@  Pp B B0 B G [T !4P$!T@H H@0@ЍA-p@|0Gx0"PWP`R*)P |bx `EpV w||@-M|@Q X#@ ` Ap | x2"PЍG-]M@p$Pp Uq U`q`oUh`QhQZ ARe*P\(Qz`ZY $` U x5PP   Ek? pF P$  RRRppuQ  RQ  RQ^P0 ` @  @ @ Fᒒ! @Lp(pc Q p AR:QwP`]ލQ QPP1 P .0`PQ qp P " ( QbPxP , RRLa wV`P` ;`RPQN  5 [P W1P \m#@#@P%,i?Z.0 0jpAH kAH-M 0ѐЍp@- @0 Q*P`E`U``@ Tp pp@-MQ @P P R xЍp@'&P6PJP @/PU ` x@ PUx@T@Ѝp`>P* mP @TQ/@-P@@@V@-P@@@VP/!" @ MmO-M(p@@$@D'Pa `@@`@#@aPppp#@  0h Pp_pP =pPf D p/ Q(P% (`   lH p ) p  7/P$ p $`#P #@p )@ЍO-M`"@P    Q4:  0Qp@T WP pP lP    00  R:   q ЍH-Mg H %Ѝ@- M^ @*@@ @@  0g Ѝ@-@ (@(@-@p  p ~BpH-M@Ph `#@p `Px *`"@*@ G gUH !" @\a b `!" @\a b+ G   +X!V/ލK-rP"@`@#@#p@SQQ™\ rǂ`#@T 0R ,0TQ 5Qb™`,p V:T b#`@ %QR,P@TO-MRpЍ @"@"@PU.* U +p `p!W*P%W Q  PPP  0Qpp P  Qp+ppp"G-MMRp @0G`P P Pp / !@pPPЍۍ PP/ !@TQPp /pG`!@W +p kP @QpGpp+@-M  @@T tЍ @R S0 00yP Q:@OO-,M`P h,Ѝ@ _ @  y0RP !@ow 0APm #@PP*P`JP=`p  Z8PP6@P4 Z( Q( . j0$p t$ ( $8  {P`X@: ` P"P ` @v @yht X #@iT`W@ !0PN pJPHP `Q( # Pk ( Q   Q  Qt$ ( e$b8 _ P`pW:0p!R Q 0p$t@P0 iP pP$($ P P(  8  P`W:`O-M P@ᴀP"40$3P$Q``pW pWO N0  #@rp P"0P` $Q:` `N0  #@Wp 0  #@Mp P"0P$P N0  #@8p N0  #@-`p 0lP p$`,I 10#@ `p 0,P $`!@@ @2 @#@ 0p @Q b@R,`@T:dvp@`@ R @`?,`@T:pQ lbp1,`ppW:  QH B`0 P1 ,@`V:8Q pW Q, P" UP 4!( @p   0@}P(P:0P ("04 B@ ("  0P" @势`p0P0 P"P 41("0@0  0@`,@V: ߍO-MQR @cPPSP VpЍcPl,@P`  p YZ*0S S6 Z `  X4S V R  @  S 0W  Q "P X H00 ` Q p @ ^P  rWBz0H-@T P5 PPPPPP@P*("02S0@"PU 0S, 0 00H-PU0@L0@-@\Q[\]\@-@`qN` `H-M`# @p0 P0p p p" 0 p p 0) p PV @    p @ Ѝp@-M`@P3 0hh P 50@ @ P  ##@# @~ #@ rL R#@H% @Ѝp@p@-@`P`@ >P:&PpTx RpRQ TQ   >P:  #@p@@-@T@@H% @p@-`Vp@@PP\%  @0l$L #@,'L @p@pG-MP@`p$ H`P # 0 `` 0  0F@# /@0`P#@HvQ V  #@ `&0`8PP PT:j+  #@@ ` * H$K`(0 #@ #@$K  #@#@H0:HPbP hO #@#@RS"@HЍG$48K  #@j @ `  4P 8P j #@@ ` *  @ ` PdQ Ph $OK00  #@P<PP#@H0p 4 \50@@j=8 0@@cp>0 0@@\4 80 #@748@PK NohH_& P dhHP  Ѝ '"@#^P P P dp`# ? 0@@pY3"@#@ЍG+i`  #@ 0.p #@3#@ЍGJ00  #@t#@cA-MR{ @ ` 0Q0@ 0p 0S  R-  . 0P Q :  PW g 0P Q: P3 0 P 0P: P 0P; P  60^P Q:Ѝ7'A7#@# @#0@r]7'5#@# @#0@TH- P@`O#@\08 @s#@' @0I@ L <  cu<( @`Hk0H-@P@  #@L/"@i#@#hhL0H!p@-M`P@\P Ѝp@ @3P\ 70@ PpY"@#@P  )@y #@ @@  !@#@@  K-P`p @@P'   }P%:G  sP  @  fP%5#@# @#0@6  WP  d#P $0 "  @K= #@a:o #@HKtx #@Kp@-@`KPP c SF Q pKp" @~Q0S/00@0 dQ Q//"@A-`@VP 0A$P!@1 P i P P<P $H  #@H 1 0p p pp HP@pp hpdp  $  cu`AqO-[MP`R L@p@Qp1Pp}Lpm @ P @YN(# @) P @YN(# @(## @## @""@ R 0 S "@ R 0 S T0@ #@ P8` 8 T0#@8`1P@p Zp `P oQp#@z`#@ a<@4`FK `@PX dP IQ* Y( RQ cR R SRcQh > B(P* @  P YY V_0F @: ((!(R `@0p@YYT0c4SFP@ $0B S DpW@Y Ydp,pW hp@,p@pS NP :2 $ @0NS* #@ 510p$0 S D0SI o <Q NQ:6 p <zD Y$`(N0P8 #@ `O*`p @*A Y P  PxPlY0 NP:2 pL0Y Y<Q NQ:30pNP:70pPI P ,0+ <00p @p30p`3<`P `Y`:Q ,p(0SZ p,p@pP, U:NPI+ (p,PJ %0,Q,Ppq`W U:pP( NR8QU C  p(@ p `   p@$`(0SYL  H P<`yP NP (pP0 _-NP:|P00P 8弥 ` NQpP wP($Y@:0 P8`E&JPDK>00Ko8h\ @ >pj PP` p  BD   p@xEnju@ i\P 0Pu2A #@+0@2@P' %: $@ 0dP $P  PZ@* #@0@ X  0[ߍ<@P{:"#DVX!$#DP! r d/ @D@` \XTP LHVDD\ALaH@p #@NvF0<^NP:]p %00@#@G- M`pP@P P1 #@#@0 ЍGpG #W:@Q Q ЍqW:<Q:Pp R:pP P   , p ppP C = #@]Z ` `jov e P 0 /r B @H-P@`R PC0#@T : PC0#@ HpPd@ 0HF0H- @PP Q \Q000HZ#@0H00HO-M@p xPU& `;U PQPUT P> R* .^PI #@t 0Ѝ0H-@PFU TR P(NL@xP0P QQq 9p 3-00H-M@@J PP@ P  R  @>P: ' P 0+' P P0    }hhPZg #@@  0+S:0@ @ Ѝ0Ѝ0HzDO-M Mⴐ@  @(P8p< pK PUtP P` i`"@Hp 0@Pp3@@ ((q1 `EQ) P(  4p 8 0@@wpY"@#@3 Tp #@Ѝ ۍO  O>@tP(\ @((*(>  (P >Q * 0 #@ 0 #@7pFC @L@! @@ _) ` iP)  #@  4*ta<P( (((1pt! #@H #@Ѝ ۍOA #@ )@$PPp U. F, #@# @9!PP  !@ ;@  50P   F #@P PP   cQ0S0SS 0 PcQP $P0 @Pk cQQSQcQ0p i mP P{ cQQvSQcPq n@TP PL P , `EP PR cQQSQcP~$)A m #@\  0<m@Qk qp>0@h `( P `PHP  Hh hdP }y0cSacSPcPfc   <2 #@Aa@[9 r 0 `0 P0R #@ $@ @@4 B80A0 C48X "@$@ Q #@ (Ѝ ۍ890@ &  @"0H-@* @0PUhP00HO-MP@pWQЍP PdP  0#@h/d"@  uP@Q P-`@P  U 'Q $)#@HHP P P%@ #@:``@ {P P  0 Q 00S A AR:   K-M@`p@ P P$PQ9? #@?i@P/  PP # 0UP /"@H< 8 H "x30@ @Ѝ ' @0H-M@0P Q  R:U 1Ѝ0<( @RQ:0AQQp,R| p/O-M@ᴀPPBT1P> R * ZP   0ЍO P( ( Q e0 q W 0S: @?  #@r|Q  0u a Va 0S:  507PQp p WP#@P P #@f #@#@$ PLP`p0   0PP{`VW6p@v   60PPk#@e @> B #@ЍOP` 00   0PPW6VC`V` l 0PPP0`*# @#JPK?0{ 0`QP VZ /"@{ie 0奿x3 0@@僿?#@7#@ 0W  P P #@ ; P" :#@Di.P x30@@RPP < <Q 1P #@ 0#ЍPQ % PP?  P`:W QQ QjP_`@`Q$Dc   60PZ QW:<U;#@ 0  P P #@ L#@lc#@ 0W  ,  0x30@ IP-   P0P#@Q_ Q#@5#@j<`:   P0P   <#@ 0u7~#@ 0m Q*Z P A  :?H% @0ᎾWO   @0 |60@@d& @ QP *' ^P   ] 0@] #@i  p"@`H ``Hq\PPPO-IM p#@P HPLa p` X" <P #@IߍO+ P @]a Po ,0d 60$@@$ o0R03p 40@P'$ R ", R QP $`!@@ @0/ Py<Z!@ #@ `W ~F"@@H!@@ ` Pa<Z #@@ #@A @#@0 UIߍ #@IߍOLH-M0080m@P PU`PЍq P  pq@0H-0M@: 0iP P ,,P    ,< / #@4 0PO 00Ѝ00H-@P  #@1 L 0H.& @T0H-hM M@ TXP PP0 A R CP0 X C ml"@#@U `p Tl #@hЍ ۍ0H-AMMp@Q\P m "@#@`$rp 0 ;pW\PU  P  !@#@ɿZAލڍ H-p@`@PQ ]P P P( (PH= #@qo#@HH0H-@P  #@dhLh0H~00Po ap/A-`@ P:!P P@qP 1fP 0p !R P/H-0S ^Q0 SR 0 S QQ/) 03?#R/Q/@-x^0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUt ؀ @@ P ĐY PhP dPe  "@㻯d P PV `d|Hp  |Hd H 9 dP$  ]P" p8dPP(  `< | s ApP tp $  8P Hp`Hd8dX G1p  P ` a|xp |dX{ዯP x2  `P$ ؀@PUN H"@ P P. P* 8 P% ̰p @oW W  P P 0<  # P  PĀX  㦰P@$p<` 5$S`h0O Pe pttXX 8` X`dxQ XSh07 Y` gP `ᵯH VH UP `Hp᢯x G`P5  < v 2#@5  < j #@\Ѝ -=#@# @#0@*p@-P  #@㨼@p1P P P P -# @  !@ּ`V  R 0S `Vp0QP   aU dPdh@-Q @ P  #@㠼K-Mp@PP# @PP`V4d P ` P  `QxV# #@m@OT  R P` 7000Po @ a," @$p7G9 0@ @00 #@ 5p  ``@P O ##@#@!@ ЍH-MpPWp @P $`PP3( ,0eP  h d@ LPHPP #@>hP EH2 R P` R `V( R, R a #@kd R Rhd`PH[PЍP  RdP   / Q /PP  Q  /G-MPPU @ `xqx 00   0 TPЍO- MR0x!@<R  ᷼P PP p`PP!Y Y V& P PB 1 ЍV P PP3T? 0S= Q4P7 0` P0` ` 6000Po, a " @㒕[P: `Y ЍOy `` #@ ЍOɺ@-P@TQ   c P@] p@-PA `0@0@\@  )@0@ Q(  P:Q0Q` 0@PP@\Q @ @CQ:Q`VQ`C`QpE0@@P  0@p  pp@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0   0ЍO- RNT C  0@}Ѝ///O-MC 0@P Ѝ K)@!@@p&#@ 07/pG%#@ @! @07/@1 B 00@0@0*( Aa S! @!@0`@*1(P`#0@$ @  *?p!@$0@V0S#@7/"1  00@&0l0@!a PS# @#@0`@!lDq U` @!@0p@/< {' Vp"0@ @ob |7P#`@!0@W05/$ 0@gv\ [ofvF\L!`@R Q5B1/! A  @!r!@!@#@ 0 Jp`@ D )@@5#@!0@ 4/@ 0@P4 hA 0@@P 0@Q Q  0P@0@ @P@P @Q P 0@PИDЍeP 0@ R@) )@/ )@/Q/P  P/Q/P  P///////Q/ 0S/Q/Q/ 0S/Q//\/0SQ/0P/H-^0`SQ0CP1S 0Q  /1S 0Q  / )@/p80pS C  S \ 00 / i# p)@/ p)@/ p)@ / p)@/ p)@/ p)@/ p)@/ p)@ / p)@ / p)@@/ p)@/ p)@ / p)@@/p@-H`P@#`@sP @ T@pQ QH # @//Q R !R/ R/ RQ/ r)@ P/P/ p)@ /P/@ RRR/@-@R !ᝤ p)@/ p)@/p@-M[@!P@P@`E: K4 )@"0@V0$@ "Ѝp R/QQ, )@/. ! @!@3P/H-0A Lr RA C 2r R 02 |s R|s Q Q$@QR#@/ )@/`#@Qg#@/ )@////MH-M  0 ЍHЍ/0H- P)@@  @lP ҫ !@! 0H覓MH-M 0 ЍHЍ/ MH-M 0 ЍHЍ/ ///H-M  ЍH-M  ЍH-M  Ѝ //////P/@-M UUE3333C@@!??@!11@0! S Q:P @Y@VЍp@-\m@P#`@ P P UppQ/\-# @/O-MpP `@ ờPP:P@LY pP TUAU$* P$  P$p`ㄐ( @, Wp T*X @@@ h @ 0pP0 0 PD00 0p4p ` G E$[@   P * @ + P:P 0@  $ A  Z\`P Vpp@ P0pP"=SM` ````````<```< [Q< Jp0p @ =Q P90 p @4< ["Q<"Jp0p @" `  >#Q>#"R RRW<0 [Q<Jp0p[ Q P0p @  p0 @>3S<P[; [P,4 [8p ` >3S P:/V `0@` < Q:8@TY ` V` < Pp` <`0qp`[kP  P A,K Aq P ` P8 @[  AP, 0 B P *PK0pW q1Wp! Sq:0CR A1S0!A1 R PL*Q Q: Q:D 0aqPWP1pQ Ap60 >#R R0S0CRS 0`00HE2 er0@0 p0  R`0@` V \ppЍ`8`;;P`p25`1A-M@``>Q$A QI th 0 (  (e]Q?Q" [Q \Q(V:a 0`@P`>Q* <Q-&'^Q {Q |QP<9P7 4V:P 0@ @`@` V $P*)P )  V LP*`)P P 0@`Q(**0@SpP p@{P0S * 1 )0@000,R Q  0@VQ  0@>P *PW +P0@ _?P` {P`0P*0,Q )@< 0VP  0@ Q* }R X b. `? $   $ uPh0  @+0  @&0@  @P!A>#" P   ?Q^`!p^ ]@#  x )@'Q`QP  P  }RP P  0@P* *0BS p` p@ P  0@ {R P* )@ЍK-M @\Y P:P 0@```JY0JIPB888888888/y`qPLP  O$  F*YV .Yz [Y]&}P 0@ Dq{YKP2 / @`@` V $P *Q*\P)P \) ( V LP2Q1* \R)Q P 0@3&. +P a 0`@P` `QHV x )@'Q`Q| 0@ {  P#*0*SPh 0) @0  @Q*\S{Q $YЍ*`0Q* 0,R<Q* )@ 0VP  0@ , RQ1*0\S0}S+ R *Q * Q\R }R P P^ ]@&`P{P  0@p @-@P*^Q  $   $ @-@P @ (  (p@-`P pP@P:APp   !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QP 0@tPo u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AM  R0@0 @1>3 " :]P P 0@PP  1 B>3 ! A ЍO-,MP@Q *}#@ P> #@ P: @  VP& P 000 P  A A E @ <P* ^R 8 P *]Q -Q- P  0@&  ]  14  PQ  0 Q0P@ $  *0]S  R*-S]P$r-S! [S'R%* =R9 :R Q:PPP ]R-R 0@PP PPL7pPB*0-S>Q<* ]R9 -Q0-`/Q: 0@P]P-PPPP==  PN*Q* =R]Q P`W  Qv: )@Pd:WPPP WW w   )@qpPPWP UP  Q p0P@`PspQ*1 )0@0 `@V:P pp\ #@lP? p WPP PPB?p`PPPP pP `Py  Q yQ0P@:_\  #@P`6/P u   P)@PuQP TP 0`Q`00!*Q P0P@* :R]P!Q 0P@P q P e q 0)p@p00B[Q 0P@IQ 0P@P   - QM*]PHPK8 PP p` )@Q!1P35 PPPP`pvPRwP(q/P) q7 (P `P  @0 A@@ P H A  APPP,Ѝ,PP  J@#,ЍOP<P(p@-(M@    )@   )@ )@rP(Ѝp@`] q`(Ѝpp@-PPp@`|a!EA(0S0"(0%P0S0"P0% q 0 !Aapp@- S* )@@`PPP Q PP@ U0A R  Q R  ! 0 @  pG-P@ S@SpP@ WW`P   ZPpGP P@    x x x x x   H x x x x x x P F 0u @ P!A># " P   Pp  PpG0H S@@X@P >F 08  0 @ P!A># " P   PF 0  @ G 0@H-~ `)p@@PPQڥ  , (RP+ ,( , P<P!  )@0Q1 Sr1`! Q) @ Pr0P  0@@-@ P*Q* [R .R. Q 2R1:Q 0@P 0@0.S ]RA-@X 2R1 :P 0@q`0pSWp]W `00S: s#@P#p@ PLP pPWVPH-@pR P` P 0!՘p@-@PP* `4RP `PP  0@pK-qG `p@P># RR: -'R:0dppppp$$$,pp,p >Q>"P P P Q`qQ` O-lMPe"@Q` 0E P  lЍ )@,0Q : P  ᖒ,0  X8P= ᆒ,0 ; @Z:,p$QX 4Q8P Rp.*$pJ @P< [:$/,0P pKZ+pP(P0 M,0 .@ Z:, p$P  4Q8P \ p*$ p J @P< X:$T/,0P pHZ @P$j:,P Q 4Q8P$PR* P@pp@P< [: %/,0P $PKP<@ pB$ W B*d@ W'*P p W:(P0P``@CPE@T`VV[0V 0A`1T@1@(P,0p W: p <@ pB$ W Bt*d @ Wj*P p0(P`@P@0C@T`VVXVN A `T@10p(P,0 W:pD#RR>p&A Q @*--@*@*--t*-$+-++,R p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpH/--l///000D1---------112T2d2-----32 Q@  0p@ @P>  X@: 6 #0@P.4344444\5>S 0pm `Rd\hA^c p @ (0PW@[ >># R0^B* )@ _Q7^ ^/^*_Q',0^! 0^ ^*! 0) @  pp_S0^0 0^0^ _S^   0^* Q )@_Q 0^ ^)@_P ^s  )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >. ) @ `SRP 8010 Cp <@T6 P )@P"  @- )@_P# Q@P`Xx:?^  y_Qv )@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R077\748<8L8`8p88$:$:$:$:$:$:$:$:$:88888\7\7\7(9t7\7\7\7t7    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ. >) @  s(RP 8 7  000>0HpW2qQ@, B<.Y PPB ()@ PP ()@PPBPP  @T" ,ЍH-@ )@PPQڥ 801 ,P  ! )@) @ (0<pQ ` u`R* w u`R# 0P4P 0 QR RP$P `p vP$p`W:88oO-DM0@h` 3 (pP* 0lP p Pp  P Yl P   /$@Y p<<p@h` Sl @Q~@Q40p,@8 Q$@ $@$$@<(qQ@ @ Q  (pP8P@PX y  X0yp Q@Q#  )@8P 8= )@4p 8_P @P <@ p_R 8Y  4 )@r  8 _Y ppr \ @ R < r @_QpqQw  0pY@P"Y  <)@q@_P4@P  4)@q_Yo#wP' < )@^rP4pr o w@ $@  w /opP"Q~  R0(, o0` PPP SY @V#RR>p&A Q BDDBBDDPBDCDCCCR p>#p!>3 S @ 0@I`8  0A FPP @   0 @p2PZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp$GEEHGGGG H IEEEEEEEEEIII0J@JEEEEEK2 Q@  0p@ @P>  X@: 6 #0@PFdLKKdLdLpLL8M>S 0pm `Rd\hA^c p @ "0PW@[ >># R0^B* )@ _Q7^ ^/^*_Q',0^! 0^ ^*! 0) @  pp_S0^0 0^0^ _S^   0^* Q )@_Q 0^ ^)@_P ^s  )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >. ) @ `SRP 8010 Cp <@T6 P )@P"  @- )@_P# Q@P`Xx:?^  y_Qv )@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`pT@ QV,ЍXP 0 0"$  ~(p-+Rq0dOODOOOO PP,PPPPPPPPPP@PPP`PtPPDODODOPLODODODOLOL> AGE !0 > Q  > 1> Q@4>  >@ PA*^# $p!P$P P(Q qP p  zQ ^J @`∀Vc^J. >) @  (RP 8 1 >083@8Q` <@Y PP ()@ 2PP ()@ 'PPPP @ O-DMP, 04(`  *   0Dh  lP  2 8P PU8l@ Q ! U <<$l@PP  P@8(@p0S S@  @$@@<qPU U  (@hpp S4P0 @U,0@T {B  0@T?{p Q40P,\$  )@,0P^ hp(4, 4)@8p _^ \ <_\p ^hp( 8 )@r hp ( _^ @qQ?@0p s0RtB  0(@@ p0P 4(p^\!^  < )@r _\2\  8 )@r _ ^ o"pP&! <0) @^ s8@s0 0otp0P0 hp0 0t0 ?o4 2 Rq B 0kPo@p pP4 @ P@Q( $@[$P  <@0h tB @@8@@ @@P\a < r [_\fXlP h@P DЍO-M8@S*P`  >#RR>p&A Q X[[XX[[Y[Y[TZtZZR p>#p!>3 S @ 0@+`8  0# FPP @   0 @pPZZp  0u 0 `8  0@ FP @ @ p0P  0puO > J"I > J? A p 0p`  0 FP  >P@ p0P p0!>#@ >"P @ PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp]\\]t^|^^^_\\\\\\\\\L`l````\\\\\db2 Q@  0p@ @P>  X@: 6 #0@P8]cbbcc ccc>S 0pm `Rd\hA^c p @ 0PW@[ >># R0^B* )@ _Q7^ ^/^*_Q',0^! 0^ ^*! 0) @  pp_S0^0 0^0^ _S^   0^* Q )@_Q 0^ ^)@_P ^s  )@^ ^  0_AoR _ C/o"Q 0^ rQ~ ^x 0^^*^^ j 0^* Qa^ \0^ >. ) @ `SRP 8010 Cp <@5T6 P )@*P"  @- )@_P# Q@P`Xx:?^  y_Qv )@P  @0P+ @`PXZ:!P@P^ >0J @pp @`4Pm@D @D`@pZ6:^0Ѝ>S 0 N`@ 0P`>S 0 N?` 0@ 0P` 0> P@ 0P 0P0 @!># R p!>#`q@>s"W0` `0PP 0O-,MP`TQX PX p0@0'$   |(p-+R0,f|fefffff ghhhhhhhhh g0g@gTg`geeegfeeef    000>Q !0 >s W  >3 01>s W >000 0!># R  {\q upri$Ph lPdh(Q cq P[ _pW [ ~QR V\OZS\QJ. >) @  s(RP 8 7  000>0HpW2qQ@, B<Y PPB ()@}PP ()@qPPBPP  @T" ,Ѝ///H- // //0H-Q @0P@P 0@p Q0P00H-Q @0P@P 0@oPTP00H-P@PP0|@P/]@P@   // /////@-P B &0@@0# @P]F#@@P P/O-,MQw PQqT/Pÿ"/X@ϑÏ"ࣟT @DpTd`@# bqQpd`p$ (O,. 0w[* !(  0w@ 0(@ 0PE }wXP! d 0sw`p  0lw@吶 PP'v! 0Yd $   000  d](-Q ,Ѝ O-$MP Q AQ`#dP p W1Q``dP 0L@Hp#w[* !* 0wp@ 0 p0 wX d 0wP`  0v@ᐅp&Re!P 0[  0$   @\$Ѝ @-M@(2<FPZdЍ@x m<  *4>HQT Y<D T< , M< H<  A< <<  5< 0<  )< $<  <| < d <T  < wЍ [ " : RYw " ׵O-MQ`P@T ;P p -P P nPoPoPa@PThhhhhhhhhhhhhhLh  ԃP  ΃PZ U PZ T ಃPZ Uhp ःPZj UZ< PE ( P?  P  P  ~PhZV U4 pP'  jP!  dP | ^P h XPBZ6 UZ UZ UT13TTTT TTU  ЍL,qu @ " 2 Q )* Բ p@-`MP0 ` B@ @F?Q @@@@@:(0"1P p$ 0H p p  ݹ@p@@@HP P P ȹP`ЍpO-DMMp yX@@? ˹p FDP <`չv P `e $($ ;q$ P@ p @ "@q⨱8`pp tpW1 @ 0ឹ?X A  =p P= ߹PݹPᠹP gp vPX*o@ @ pTP  @ h\Y @ 6 @U gH ᲺDЍۍ1  0H-MP @ 00Fp 3Pp U 0i PP &Ѝ00H-p @@煺PT 0P p xH PP\@@PHUD  @ @P0!L!IP P`@0P   H $ +8``0@PP X 0@ @l0? A0? ?0@ @(P EP ȿ 0X\ WA q *   0TS dS S Q  QTQ tQ "h"S"b .R  Z    zRLQ @I T !pLP=LHX[p zQ \!~ ? ? ?(  ?$   ر  0pv6P XP\QH RPQP@PRPj LP 0p/ /"l@P}d`P```3V@EPp3W@VPW P@`@L̓PPP !$` AlF(!@ `L0$T 8R PT "0pP PT@P$ b(RV@ ! $QQ0!1I3QTРPS "baZI@0Bu!@H@ 0!$ < "i$ PRZ 0P $#@X  V(PU P C@AP @,ߍP *+ TP/PxP`E T PXP @` J wyGPL  \p2g'o0Sr"y/0S!0T 7 0@G}l'0@ 1 "p'# !D@R!'p`%Px )Lu@BLt#(|@r@c1SP8 )|5@rL7 7 0@@`P@3ÂT`忂P |`QŰ`wSH @!)4  L!HDB@GP! !BFP : :BRSBq/Dr AC!/@2 `L"HS p 0! MpPPPA HP>e@ Ѐw FPB v:  ;K!S-5:0`X/ |Tptp`VzQ p@P@%g'E# Q "q` 2pG`Vp, @NPJ" 2"pq 2apRp T@P4/@!  mFP! !BeFP * *BSRCq?Dr0AB1/@2 `L"HS p 0! , @P|xO-M`2ᜐ嘐@P p P ` @P8p,00@8L@DHXPPXH`<Cp(d$4T@Ud aV$uʘ ~_P `PP PN QJQEaV 4Vi F3Phx$L$DLXp @   8 ( D 0ll@"0 "eK p  02p;0s0 0p3@P@ 0 L   00 R&@ptp*#pRp`p $ L @$' r0'$0S(ʁW@@CR@dB¯ " p!" Z"@"B \0 @p 0@l 0 p/"?'P:@p`!< !0 @3$0SʁW@@CR@dB¯ "@O!" Z"@"B \0 @ 0 k  0/"?#P:@ p`!< !0@2a ppTx QpQp tp pT\$P ?/?#/"pSp"B"r"BB"r@@Tp:Xh?rQ |BfTBU:(AB  q N AcH6 r }?0H-PEaB @p キ|U:ᬬ00T0P0 P <  Q/0P  Q/ /(/ @-t0 p0@ R @P  T@@Q 0P @T ƖH-T  P  ! P  0S p@-t0O0Q O O@ PQ0 P`VP  pdH-PP p@ PP `QP`H-d`@`P p P` PQPPH-d`@`P p P` PQPPO-M`hP6 PdP5 @p`P  P QP{ @ `BpPY W 7k f`P Y```ЍNw\vH-P@Q p`^P `Q0Q   FK-MP@Q p`<P `QQ4 Ѝ FQU& Nx pPpp?x`Y``!"P`V Qp 06/Ѝ8Q( sHDl$YpY@-@ @ O- M`pPP PPQ0PX @gPP P G P `vPD `nPoPo@o`=FKP PPQ P Q0HQ  P S l<`PDP @ Ѝ strO-MMpP@w` ^P:JPr  ]P /P P Tp fi◽Pl .80p pp)pf 儽P| p0 )pU `P{ `嬒  `Pn  P 0p z Dypu  rPY *E 0)p#  *1v `* vl `*vP/jr *vv` *p@ v`Ѝۍ 0p B`P    0 J`vX  0J `ᒩ0u b% hӌ* (fH  H-M  0 )pЍH-M>  0 )pЍH-M?  0 ( p ЍH-M8  0gS pЍQ P   /H-Y0H-@)PP :v? $  0 O-M@P@Dp  ` @Z t@ 04@ p` (4 8 4 0BS  @4P*# 4 4 R*004  Q* <004 @ P pFP4    44 R 0Q: Q*=  4 4 P 0@@p @p {GP 44(P< RP 4080CSK:04 R*>(4 8 4 0BS  @4P*# 4 4 R*004 P*< 4@ 4  44 R 0P: (Q<0S 8 @P*s`p G P'@4@&40S*>(408 40@S 0@4P*# 44Pa*``4\PDJ(P< RPQ 080DS:R4 *>(4 8 4 0BS  @4P*# 4 4 Ra*004 \0@ P@0<08 4 0@@@ @F P 44` Q@`<`84`A   @yF P0@ PP@0<08 4 0@@@ \F P0@ PP@0<08 4 0@@@ >FP 4 P4TP @<>,  'FPP4 4Pp PyP@1 @4Q <P*4  PAP5745@@ 4 !PA*(0S0 q04 R*#004  4 (P: 80pBW  @4P* #004 4 R*004  0R@0<08 4 *04  PR!4  #  @P:4 R   @P 4 R*004  PR!4  #  @4 P R   @4 QBLЍH-M00JЍH-MPЍ<O-MR @ `pPJP/ 0 @8PPH MPHPJ Z@  0 @ @AP  0 @  @M@ 0 @ @M@ P t  0P@@ 0   0r@Ѝ&%O- M@P H@p, pWbDP0 Q@`p p P    ?Q Q$ v , A L@ P| 0  (0  Cp/  0p P:pv , pL C@KppW,0 Ѝ Ѝ`$@-4 @BQ8@8#@-@BQ8@8H-M0     0"ЍH-M0     0Ѝp@-M 0,(@0P4`@ 0 P`Ѝpd"H-VMP`@s@ ." B")#2 `K *` K0*@0!K C0," `K *` KB *@K Bpa "! `!*` K *@K BtQ "X! `!*` K *@K Bxa ~" `*` K *@K B|Q hc"  ` *` Kh *@hK Bha @G" B"+! `(!*` K@ *@@K B@  ` *` K *@K B@h 000 B/ pp Vߍ!!$! H TO-kMP`Q pP  *a gK*B A" `K *`K @ *AVK P  *aV fK*B A" `K *`VK @ *AaUK ݼP  *aB eK*B! `!*`BK*@ QV AK 弼P  *a fK*B8! `!*`K*@ aU AK 囼P  *a eK*B  `*` K*@ QV AK {P  *a fK*Bx  ` *`K*@ aU AK ZP  *a eK*B! `(!*`K*@ AVK :P  *ah fK*B  ` *`hK*@ @`0 A3@KHPh p x  h,    <    0   0 @    D0   @X `@A   @ P X! `pL@pq@PdDT1\!V` H儑 B 8I( 4$\埻,PPCX>\0` f`V3 A1 Pp PU,P\0  V Y封:8@4p"P" pW     p$\0 PL`!!rAD |  S@p , @QPJHp;,pTPpCX  A[1C 0 AHP P P嚳UX,  [  Aq(P: P`㻭P `V     L` KX, XS @!PHa@D | !  ?p ,PEH U  `F dpZ$\  04巺p峺P 寺`p嫺@ ᧺PCV`CUTPCW8PpC@T @@C V(WP@`H$\pi(pDU,!`EPAD |  ?p2 ,`H V@Q T8` PAHXVTHTXpV,!dPFA`D |  Y?p ,PdUH @a Q XQX800P \P䰝 XKp,`Y\PB  APXY@,`pgp W5 ` P @|T,` W఑PP: @㟬P [    X$ PUDg\pW A4@ P P8UX,` W[\:@ P\P\ PU   8Q8` 4PA`$YFX,pdh  X9 d Q P @TX,pd  Xd ఑`P:P@$P d Z     DH `V(0pL WJ⼰ `XKP,` hGLPU6 A P `喱VX,` WA[:` 㷫P X    0 8PJ┰ XKp,` ddg8pW5 dA< P PDUX,`d Wd[8:@ PfPf d PU   TpLWXhl XIP`,` `dGLPUA dA, P `VX,`d WdAY: P d Z     `PkߍXP\xp@-M 0,(@0P4`@ 0 P`Ѝph Xp R@D 8  ,000S@H/,  P q RD @  40#@ 00S @H/p@-@t RPS@D   000R/#@\H 0 R ^,@PA@@`0D``PU`h``@epT 0p@-q RD P S@P 000PRP@\H 0 R ^,@PA@@`0D``PU`h``@+pHH-H H0@00S 00@0 0S@ D`(O-,MPh UPc |p80I$p 2P<`CP D V PE `Q: PpApW `  PԩP+ V S<@C@?3p  DPPP`|V  HLpq ;;P ,ЍQ``VP,@PqP@U  ; u,Ѝp@-P@P 8`弶PX^@pp@-@PP `᧶PCIPpH-H ?30000S p0@0 0S( D0 | Q 0!0Q  RDH-H ?30|000S l0@0 0S( D0 | P 0!0P  R4 /K-Ÿ`P @T3 ! !  !  !  ! 10qpp! 100"! Xp\ T `hijTpЂL@4P$p0  `hij Q (   ,\d dH, (|4A-MpPPdJPP `ѫP @ , ` `   #p)`PX  pT upO |pQhPG PP 0PPP+)P9  0PPP )P. p* %p&  0 )P  ](TyfP P |P ^PpW Wp倭~@Ѝ p@-@|PP ^(`V (V`)@`\^Qp@UH-MRp[` `P] J`` j@j@j@j@ j@j@j@j@ j@j@j@j@j@j@j@j@j@pj@`j@Pj@@j@0j@ j@j@}jA j@j@j@j@j@j@⏊@J@o*@f @#:_of!|0S R 0@T& r`VhSaW 0RQ  00ElP *Q!!Q b  Q BЍ '###|<>*><^v\l P  R*11P0 c0 P C/ᔇA-M @`pP+`(P UpG<\P>3FKdP`Q >Ѳ<β^˲vȲ8#Ų:²0'㿲#㼲 #㸲H#㴲p-㰲-㬲`_㨲|㤲o㠲p㜲r㘲y㔲z㐲{㌲M|㈲h}ㄲ{` *`.J`j`/` ` `pH  %  % C % % %80@01/0 !Af%,ϪA 8<% `# # (% P$% x4% ,% %   # # d" j*AnJArjAvNϊAh`M ez @| R 0S  pW) sPU1PPQ1W8SpU0U0 SQ  00D 0C gC*gp(KS0 GKp*C0 Pl0Ѝ fghijklmnopqrstuvwxyz{|}+,-. 7 { 7 H-D 0   b*`(K @ Q*BK܃$$0000000/጗G-8MCP@p8$Q  BQ   BQ<`QP (cQ $ Ab8Ѝ Q  A AbQ @ @0G P HoQ[ 8< r R q p 8R r  p, cp* ` Z p"  `p <PJ p 0 P; AV+P5 AQJ!Q@ @u@" )`@ j^PSP #` m @ p0G Y " Q P  AVoR!Q Px0H-@ ,P"@p 0H080H-@P@p 0H0O-MvᘴTp    E@pPe|Z p 2 P`v Z p  `!BZ P ! $E! `@PQ.F P EP p P`@TQ p   `!?!>0@Q QJ q" R R `!0Qw  0㯯Q`Qz 0 ᡯpwAT `Ta  0可`pc @Q` ᘴ/. A>Z P  E P EP- p6 Ph`@UTQ & p(   ` 0on`0C10 Ap;@`!0Q J`C! @Pp$ @)!Ab ?>0 B0R!!`p P@P`Ѝ/. @@ <0!D̒t % O-M@$f|P `R`P Y0 R ^LZ 0 R QLPk Ex!(0$0R  Dlh<p$(DP  KTDP  PC XR$T0pd` x$ @ld00PQ\pP PP QoPHP QLQd_TqP@〱V,@P `p PS @Wm LATj ?NPd P``p$V <P>/PVNáP P`@`p$V <P>.@PV @ k iT [  WPEQ WP E W  WPO L `C@pP `P@ \[ P UP&  ZЍ\[  VPP@YVP@PPV VP@Q VPP @Y  VP@ P PV VP@ p ] &$$,0H-H@VPI 4VPC [MQ08QP@Q7 P  P*mQ+P P PmQ 0 A R;A"o!!!0Q 1 A R:;A@o;Q 0A@ P3@00谳 p@-"TX@hP`@`000  xpPl ,0\``0PD00 p@3W؄Ԅ` th(Q  X//Tp@-P@`` V PJpQ PPPUp@O-MM@l``EP _ }|D2@@"0 Gy Gu@ Gq Gm Gi Ge Ga G] GY GU GQ GM GI GE GA Gp Gp Gp Gp Gp Gp Gp Gp Gtp Gdp GTp GDp G4p G$p Gp Gp`b` G``  0"`@T( QU 2L V#_ )LpP`pGWP 0PU"`Ѝۍ$)H`O-M@PP LsPp8$Q  BQ   BQQ8& P #P  0 P 0`0Q 0`0h2`N  cQ @8LЍ Q A  AP +ԡ oQ8<Q q ] Q* q.)p ṿ P@ x"@@; XP7SP2 YL&p  <PJ!p VP  XYm X PO@`<{l@- $@:p@ @-@v:p@H-M08 R   ЍO-M(@`pPP U PJpQ Q 0Q[ЍK-Q1Q+ PY# J@Pp@DT P` 0`V"p 0"K-`Pp Pp W PJpAP P QO-M` PE@蓟 ` QPLU V V Pp ၾppp@ WP\P D<!0|  @Z p\ w q!  P( PU upB =p P~ wb U pp6 0,q/". @@" 8" Q3! !@10q! PQ  RJr0"1pW XpA0S 10S0p1\\! Tq0poq&.  C 4R p@ VP`S`P tlx|`Ѝ |0 a dz0`x\xxwww(0L zzxx(x xO8w4w,wvhwPwp@-Pሽ@p p@@ VPHPcPP 0(&LpDH-PPQ @0 R `ᥠsP0  A A  CSD @DH-PPQ @0 R `ssP0  A A  C!D @|H-M< R 0 Ѝ(Q  T//dA-pqP` q@@P| P      @a@VA`N VQPT _ } Ay Au Aq Am Ai Ae Aa A] AY AU AQ AM AI AE AA A A A A A A A A At Ad AT AD A4 A$ A A APtt0T <<0   .`4K-@, !a!1sqaq P P4U pGPiV *  0 c00 FV:VPD0H |-p Q`V 0@K @- $@6p@@-@6p@0H-(M$ P@2 \(Ѝ0(0H-(M P@% O(Ѝ0p@-(MP D@6p ` :(Ѝp(Ѝpp@-(MP@6p ` &(Ѝp(ЍpH-M   ЍH-M@  ,00   ЍH-M ,0 0 1 00 0 Ѝ0H-MP `@d6p  ,0 00  PЍ0Ѝ0@0H-MP@I6p  ,0 00  PЍ0Ѝ0$Q/\౮@-@@@p$h i |0K-@0P`P~FpP PtFP \#  e0Ja*e CJA*ChPPR aP*c20Jb CJA*EF c4<iJe?OJ@*a @,*A   PP@-@@P d 0 T  "4 ` 01SPPT@-@@ P X `2P01S\` PP,`@-@@P 2l   R0 @T P` PA-As@P   # R6 ``: P P 0 02;8 PYQ0"`\@ r8PT ` 8PAP8 @-t@@P  R  8 PPp@-@@PP"``P   P 0 `V P` P p(P8<@8p(l0H-PPQ d@Q%  "+ 8 PP Q H@Q  ,-  0\@-X@@Q ,Q ,-  |0H-PPQ @Q% @BK@8 PsP Q @Q  ,-  0@-H@@Q Q  4H-pPpQ @Q, @0`-P,@P@P@8 0`PP Q @Q  ,-  ؿH-0P ܾ(H-0P s蘾J-@@P b R㰊0H @ H  pLPt PPLPP PPTJ-@@P / R㰊D0@0@ L|PD00@00@p0l (00P|P舽@-@@Q Q,@0A,@1A@0L $00P@Q갼0H-P@PP  R0 T, 0P,0P,000L PP0 0@-@@Q Q,@0A,@1A@0L $00P@8H-M@Pu8|`Q DQZ QP1DQ帖PP@DQ 0p  pPP050  5:  < 005PqЍĹ x P/dH-寶@H-@ R/PBPH-D QPlP̸$ Ro/|$ Rq/L4 0S o/(# Rq#/ط#/ᤷp@- M@@ P` `` `嘂 `` `厂㬂 ㆂ ЍpH- MRPQ  R Ѝ ЍoPBA@P*OP rOt! Qh gOTLA@P p$ 0  Bp(qp|P  5P: 8  5@@ 5 X5"7 0@ @0# PP ЍYYYpYXY`Y|Եp@$A-Mb`Pe A@PNPP! 0 C00NhD PNp QP3D<@4PQQ   QQ  0P;A P G0 ]kЍl  0S 0S@@H R 3PP꠴WWWPTWHW   h@-4@@P$NxUXU@-(@@PN,UU0H-MP@ PPhD㿂pP QT  LDPP  Ѝ01/Ѝ0<TH-M\P ЍHPD 0 C00NЍPT TTH-M\P M8  Q, MЍSS|SSH-@ R/Ph@PH-0 P1PȯH-,/0PI@P舯@-hQ |@Px@P 0  4$#@5Dĭ0H-h@#@\ R |PxPP0(  3#P0Hk5Ȯ80H-P QP @ Q Q0t l0L0Q00,  3;50@حl@-@ @P P P tPl P H  3@5$ PxH$H-p8 8P, (@0`P0`` 0C`V@`V0PpW0H-P0^, 0 (P@PP 0PUPAU^0 S,Х/H-0QJ`VRJFP R,!(P@p`@pp @DpWPPU@ QH-Q;JPU8R6JEP R0@@@Q(S,P(@ Q  Bp`pppW@ @PU , (@!P`VppVp(@ P`VppV@H-0QJ`VRJFP R,!(P@p`@pp @DpWPPU@ QQ/,0/0Q   S/0H-^, 0 (P@PP 0PUPAU^000H-^, 0 (P@PP 0PUPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-0QS, (@`P `` `V`@PF`VP0SpH-(, 0P Q00H-Q\( ^,0 @^ A @ ^0, 0 (P@PP 0PUPAU^0P/  l>P/0H-PX@|tQT X0 P#P/l  P3P/&8 P#P/  P3P/Ԥ P#P/ꤤ $P3P/ 0l@-xP |@pP @pQ 6@1tP "t@8$P#P/ 갣< R/Q3 0S 0/| PP/4PP/H-4PPp HH-@T' |`pP @tQ h6H0tP |Q pPpPp|Uw tH+褢0 ءO- MPE ZCp P=S;pR0@P @Qp @<`p 0လPJEP  `FPGP  J0  Ѝ" , PP/ꀠO-MPpW! @`  0ៜ* *P  0`哜p   0}PP ݕЍDp@-|"PP E|P @`ȕ|`0@Vxp& @P@0|wP Q @XPPpDu X|$pp@pAp488p@-@P P P`}`0PVp@uA-P @pPP  X `b0@ PS S'0,01N0oC0000\L0|X, 0cl00`S00C`VXP PUPP`np`P VO-M  p BT P P;`p 0APBJr [`Fp P bP P P(@ PJ J P QP@U  GJ@W  @ J@Z   G @ЍO-TM +` R TЍ|"Pp!R @0 0t s4TЍO.tATV |! BR8   `,P; 0TЍ 1€ ,ppWS@4`  pʀYpt 0@  Qp `ϛ t1 Q 0 0+` 罛 Y`G-` PPp ᴛ@PAA@Y ZXT  8PP ᡛQ<K-P `P:@WP3pP:qP,JmP P$p @ @ WP`W ` @$ A` !pPX@ @`>PW 7PW 0P0@-p0@ SP 1 @  !0 b D *c *A  $PK 0H-@Q P  R!4xP PUXP R P 0S0 0S  X0V,T`Q Q QP ?=0H/ᄕ8  R/P@0?30Q@ ( /ሔP/Q@0?30R@/Q/ R/Q/ R/R/p@-@,P?` Hp耓S/p@-@?`PHzpHQX|2@ 0(@ 080S03@@/PX|2@ 0(@ 080S03@@/MxK\0H-@xPU X|TP@? @48P@@$0<0H-@PP X|TP@? @]08P@@0p@-Pw @XP|`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP  @pX0|b@ 0(@ 080S@pp0H-PO @XP|TP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@    @0(8Q@@00褎P@/0H-TP  0R  QS\ UA ^ T (!R !R 8!R !R  R0LQ0\p@-TP&  0R@ S 1T S1 AS0 T4! S`RQV U@@^\(!R !R 8!R !R  RpLQp蔍0H-@ P7 0Hb0H-@PR J 0 P  S 7 0HH0H-P@~7 0H>0H-@PQP J P  Q f7 0H&00H-@ 8P&p S7 0H0Ȋ0H-@P&p P J Q  P057 0H0H-@P&p (7 0H0p@-@ l`P&p V J P  V p7 p@ȉO-M-MPl@P( p0T`$, ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2p! p Š ϊϊ ϊϊϊϊ ϊ$ 0ᰀ @D PT ( 0cpP ЍЍ0O-M-Mp`P(Pp U$0 ϊ ϊ0ϊ@ϊPϊ` ϊ Šϊ4@% p ϊϊϊϊϊ ϊ Šϊ$ 0 GPE`U ڨ 0pP ЍЍO-M-Mp$P@P( p0T ϊ ϊ0ϊ@ϊPϊ` ϊÊϊ2`! p Š ϊϊ ϊϊϊϊ ϊ $0ᰀ @D PT ( 0ᡕpP ЍЍH-M 0 0Ѝ谄O-M-M@p5%pR P( ap0V$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ4P"$p Š ϊ ϊ ϊϊϊϊϊ 0y `F @V( 01pP ЍЍO-M-Mp(`PP0 ,0p0U$ϊ  ϊ0ϊ@ϊPϊ`ϊÊϊ2@!$p Š ϊ ϊ ϊϊϊϊϊ, 0(帐PE`U 0 0ϔpP ЍЍO-4MP, X q\@Qa @QB \(YIPӕPK X@PzwPX @ X` T@U`F8  PV p pf `VTU8P   DꟕP X@ T P8P  +paX@T P,P*  @T  (0 p0Q Q 0jPPh @Uq0,D 0|@ 縐Jp  HLPEpG @U(0@  X@ Q#ZCAZNTQ8P ' (0  p0S0 RP|Dp HLP`P 0A( @p Q0@ TP,X@` (0 P P  p@ s@H@PPU㰡080pP:Xp@@ PQPO pW@@ ZX@PpG pG0?W P P  Q%Q{ `Vjp,@Qp_|Dp^p `HL V!PMP[PT R 8P R P P@0@(  pP0@ TP,0(  A% GPPP Q `B@0F(  Q  IP4Ѝ,, a zO-M-M( PpP H@PX4$$x Q A wXPTX`FP8  P4 0P8  `,p,ϊ (ϊ0$ϊ@ ϊPϊ`ϊp ŠϊB@!,p Šϊ(ϊϊ$ϊ ϊϊϊ0 40 ` pG @W ڸ 0PpPxk  Q_ T P 8 O H, X@ $@`p0s@ (@ po0`@p`S0 p`S0 XD0`@  S1 HpQ! 080! p0pp CQ =ЍЍQ&@48!R!RQ@@/Put48!R!RQ@@/u0P@@/tt$Q@@/t@|"X(!R!RQ@@/sX|"(!R!RQ@@/@/8s@/A-P8@  `@Q srPp fT <P  G P@@qrHr R/A 000SQP T/$rQ/A0SRPT /$QQ/Xr$QQ/(rhqO-MQ @pP\PH@X P\T \ AAR `hPVTV[Z KQ`K V @ Y+ [  0@vK[ʔ P 0!!^6FPE V`,0pW!,!I YQP`,D | p   }pM `PVᰁH P PHV 0!!6`V,0 S!pppppp!, Y!PUPp`,D |  㰑 5p `pVЍPU 0@PXP lЍp pH-^a^ 0S,P@ Q( ,APq`0SPQPQ RA/Q R  A//// ///lO-M@P H@, DP 0 p@Y* !Xaq | Pp pW:0@  LЍЍk@-T0 0SQR,@(r @@@ÃAT$$@-(^^*,@ Q 0+0N,2*PA 0r%r@P c`0Sfffaj(bb 0+ 0NR@0S QR@@O- MP6,`p@蠟 @T*Q QPPaBHQ0 0A  P !(R p(X! 2/p < 0 Ѝ Ѝj xi< , A-@(P $Pp(pWa,Q Q 0aBa,pPq0 p,Pp@-@(Pp0P`(`Vpp@-00S S* $pPPCP @P `ACfHd$b`kk@k@k@@ PU`0K0CP`V P0Sp   G-P pP% 0P 0 R@ C 0 `0 V `` CV` V`QB   P BPPPC: ` P>`PTPHP@ U PU`P V `V`%P P0 S0 `0V `` BV` V`Q R @ R RP p h $P P@ @p $deff8ffHfePdeO- M@ZX'PQW Z A(O 00!,PP`,PaE`a0ZpPppa Pqp5, PPPm 0 ,jGPe Q,4;PY !0H!0p4,PPpZ P4P0PJTPP*`pPY, PPDp`)| `Gp ⰱPZPPQ P ЍPU 0p S0G0$ p  `0GVQ 0QPC 0p0WC R R .PU  RQ/$0$\/ P/bp@-`@P#0P`T0p$ R Q P8UPpa_G-P@Q訡 $ Q P P0  @`$ VQI0S R H@p 4  0p$` WQI RPUPH p P I p$ 0 `S R0 HSPU P@p x@hT @T :q@p@aT_h`___0H-P0S 0@@T@PU @^8PtVx 8P,0 00@ PU @P@U@S 0A-PQJ@Xp0$`SRJ p`V` p`ApBX 0S0P P YPU   NPUP0 P =8 @ #8 /0H-MP @0@0Ѝ0K-MP P@Q E0Y  `I  `V PЍp`^p `V`4pP `0pD QH0 P$D H0` 0 R Q B(P,0 qB,0 0 !0PU(pl\0H-MP @0@0Ѝ00H-M@`T0 PPE _oPRP PP Ѝ0,[ZO-MSP8U[SZЍ@<@`PP p @p8 V0$ @  AY  bP ӊPDQH `$H(PPPX`@p GpW ,[D 0`0S@P"  PYYX8XH-M  @ 0ЍXP Q/H-M$000lЍXO- MQ@pR Ѝ`P7~P @-~P, 㳁P0w 4|`P# 4<0EL0P00 `8|Q@`  P$pH* P@lp\8 @ぁP4C `}P< 0@0(Q?  Q8^U80@@8 SR$0p@8pSV0 @8  R  R{ !R$Ru RdQ8ot rpn@e8(^00 4 U ``  y 4` 0, @, `4U" 0 `H-MPЍA-@  Q@(0`p,0 Pa B,0 !0P P 0pW(`p@-X |R80 @^_O` P8`Q p$0 T8R0Q08Qp Q !R$R RdQ8p:/p@-M `0 B 0C@ P  L 00N```ЍpO-DM`@tP¿lVPFSA@?Qh`0C@C000 Q PR`F@PVpK@Uppo0K SpC0 SppVDЍxp aV` , YPPYZ |@ a $P   0 0P  Q:QPH-Mp@pQo : 0 tx P`a'Q89 D 0` FA/   Ѝ4Q$OH-M0   ЍO-\MX0P8  P0$ G  `RPR0J J0pR  0pPP CJ 0P@  8 @ 8 8@88 ,8 80 8 : `v q`R 0z S(0sp pqs4E R :[,@``v@[P PpP,0PE1PPP0PP 0P0,p0C1@@@000~`P4@4t (@0SK$,p(@,04q0 ,p$`Q(0 pR ppW8` p@(p@W@ ppW8`(@" p BR`p@@ F` 0V (0  B0s`Tq t@A@T00T@0p 0sP8P9X /  Q.,  ! ! B0S0 S0BR @ P  L@ a@a$$V P  QX0@ PQ P08 0p  `q0 RQ(X3N`P e8$/  PA (X` P[ !qPQ@Q  QXT`@, 0 ``V/  R@X0D,V    LA(Xڣ, 1Xdr ! ^ ^Pi08 8Ԯ`    W G, Q PPPZ,1СSYS PPdPN D `  0e  0p   0D W ,ptV P / K 0_PP X @ #@ $/ 2 @@0T, Ql `o ` N p QU @T 0Pu X`pP, F0GUT pp p A B po`  0vPH `u௟P 0 B Pm d`Q / Pd"P #@ PU PUDPP P{ / ooPdP / eQM aP@,W V   0@ `GQ@ F@tQ , Q E@GP3, p0q0ppspP'EQtEF9P\p@`1,UW   0D/ R/"@QQ<, ?> U :k ` PE U k`;+0  $0[AK嘫P D {p00  0PBUPp R P $1A P -A$ P  0+ K`$0 P v2p>=<>=p=@=(=$`0,pC(Q,` ($0 `V1V Q 0Q.J V, 0 ,PQpVP p Q pAPP pW P ( $ ,$PU :Oq  ,b%PE |GU! Y%  0A Y 0,V \`,Q8<:P Z$ ,$,px <;P:l: :P,p R,`  02P (  R P e' "wp$`0 PQ eY|9@9P D' US 0 (W@P @TD89$R$R$RfH%R $ sf` @  0@ p 0@P} T& 9PY @u$`,H8878$R$R$R3LQi $` 2븅 ,@ 0@ p 0@P e% 8`7Px $  0qd@` l@To87p8P tup?$ \X9 0娴@  N@T*H $ FU 0 d@` H8@T`0 A# ' 0pf# XZ 0S@Pc`, @T$`R|6HP $P 0b@` H@TD6454uL"  * 0R@P L@T`d0 AQD"  $0p, "  0H53LP?  Q9qupyʼ! Xs 0報@  L@Td$ R 0  Se4t4$ R 0  S.$e ! 1 0I)}* 23D2011L1d1/8/L0p/X0.,4,P-,l,,**/|/-$,)&&'@&h'l%-))$(( %$%$h$t+h('&@%P%##,*d+&% 'te e e ('O-M@`D0ʿ@H\[p\h`l0pЍ ` P0 BpH 0CRIpS   0pP`Pp94@  A@ 0H-P  oRPhAU@@, P H@_@ P ,0@   RQW@ ' (  @BT<[S8P%  PCAlP ' xP l `PCAP * '00@@ TAWgP ` lP PG@T*lP  PZP  PCApPJPP  [-FVf@P`  [PJKxPP XPCAEU@P|Q A T PPZ@P> 4up0@P9 e`  7 @pPUpG/@TPP PCAx J4tpD@,Y```T P \@T`pppJ WF, $ 0S!`q 30S0@?3S P  P PCA W# @<# I@ P    Ѝ@PTP D" 4P ( ]PCA  @T(QpaP` ^ qpWNGxPP 0PCAp}p2 ̻   d \XL 0 ( 0<( ܹĸd`H4  (ܶ|pضXHL<صL̵T@ IJddH 8(lش\P(thгx@(PH-LP @8P4 C Bدԯp8 RDQ/lPh%R/!R!Rt%RQ/ P/0G-鄤@ 80SDpW lPhPPP ,ğ(Pq# S < ` TPpP\0`p000 # Y P # Pl"0@p @lPh0P0P h"0d"00l"|2Tp w 0q0T0p@4?0SHJ\`nvpV@@ǡ@S?V@AǡO @S8V@AǡG@S1V@BBB@$@S(VOCǡ@0@S!VODǡ<@SVODǡGH@SVoebb@T` S 6p0``p`` 0@W@p@0pS p"0 p`p`0V!1a 0`(0&wtalrZ``0. LD ~ Z% PP H 1\0 H `p,0p W !V@@@ @ P RXP@0P8Pt0P 1tPP ̖ddp@-0P JhA@@TPQ PA@@TTp41hB0@T%@AT0A4 (40@BT0A4 (40    1pBl lR@Pq`VnRr`PV nR 0pDG-d"XR L #@8XE 0 S S' Q@,ZT ap@pQ@@T@@@@PU @PUZP,P U QAp@`@0SH@`pWH@-^8J00`0S2hl2@0T0'00CS@1,0 0(0AS@1,0 0( p@-M@P&J\ Rڀ PrfQ 0pfnf  R |"P 0 0 @ )ЍpH@-\JD\@ T،nF@@prXH-| x l0S T0/0#'l"0P $HH-$!h2 0S%0@S 14 (400AS 14 (40t p0 00S P0/0#'l2 0P $`phd/K-T"@ R @" @  " (@hX P8 PvlQJn2pP p! X lb@0@qP |qld! A nZQ6?lQJn2pP `  ! lr@0@qP |q   n]Q |2q  \  P@@ Pt(,@-@`hPPDP,   @@\</0H-h@ Q pP QpP U  ᜔P200H-@ Q pP QpP U  ၔP00H-$@pP 00H-@pP0@-Q PSZ`000\^@, Tᒷ!@@ij@@\ @-R0QSZ\^@,0T ᓷ1@@ij@@\0p@-0SpP 0S! `0 @0P0SUPQPJ^@ T`,V0A ``Ƴ`@^```phO-MxQ  qPCZ @p@P1DWG ЍOP E@P p"TT8  ,!aQ!R1'rQ@ AZ0 0(p0@ 0@`S0p@jp!  W ` P @.iT |DpV HpG W[:  aQ  G*pP p?㰡  : @`@7cP- `Vpp Z 0p` Q!p 0 B`p( 0A pQ0@ Ѝ 0 0H-@ ,Pp 0H 00H-@Pp 0H0 @  O-TMQs p`pPC[ bP @P G PPR0@[thTЍP$0 D R pB 0 N @ P TU8  P PP P P P%XppH$poPCK $ opp WIpC 吇(+$ PoPC P  Q$ `$@P@$Y@I XHoPCJP3 @Q! ||h po@P$pP~TE@Ct!)* $ $XoP C A PQ`F $0,(p!P@PPQAQP U!A@'r 1pWpp P/ @gQpQ [p|D pn HK [ U: `PP K*Y$ p(@P $P ,@ 0P,00 ( 0@Yp  0@ P$P @T @PP ` `P( A Q PQ  p"g TЍ 0H-@ 0Pp  0Hl00H-@Pp  0H^0p@-P 4@`p  p@Kph0H-@Pp  0H=0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS H`Pp NpOOpq0Pp0.Qp  pP0000pEp` 00`B/Q *Q@`hq Un HD 2/`P$U<P.X@>P [.Q  >?O  D.Q `0000F 00BH/QDp *Q@`` `Q PQ` Q'qr PP@7/@DTPH`PDp PPЍ P qpP@7/@DT<# dQ H-M0 R!R Q L ЍH/ $ R p\PH-M<<000  0ЍH-M0@@ (Ѝ蒌t0H-MP@PQ PQ   PЍ0dQ\QD  << x0 0Ѝ0$Ћċ0H-M@Qqp@P> P 0 @,!N+A2"!K``!a  % a!`paP `V $Pp`Vp fPP@ @Ѝ ,  H-M  @R  qp P= Pk 0 ,,k,'@2" C`` a   ? @pazP `V $Pp`Vp nPgPOЍ+  K-MPQ| PPV ` 0 +-( ?,DC2" @ pA$` $a ! "*#E"!`qP* aV$ @T $P pp@T WsP P`V X PU as` PЍhn* X 0 O-DM4 lW^Pj P @ @ A4@:3@P2 `4:P) P Q5 21=Q< #Qr Q+1 80 B+8q<N{A''!K0`!a$ % a!`pq PPz =:P p"@kPi1I 80 +8-x ?|D<S'' @ 0A$` $a# "*#E"!`qPP5  HPx-1  80  *8k|<w@'' C0` a# ?@pq PP \ P  P1  P- x P) d P% P P! < P ( P  P  P   p Y  P P %aP6V, r`Y  r `U b`堀,=@D t PpᲐQ7qX P`qP `DЍU bDЍ'  & P 2'  M yP  ? + L + + q+ ǀ O- M` \P @0p     00.R A*R 0Sf Pp%p+c p  00SB   RX%S ,S  RQ p00\00000+0AGS`1ppppp  pppppppppp$ppppDppppppppppppppppppppppppppppppp ppppppppppppp  R P       0  dQ00  00p  d V  QP` `0cp        p)0iQpp0pppp6 QP 0p0000Pe Pt%0Bp %/C0  `%%G +%|%+%+Ccp  p PB  p `*`  A0 *@ P,pD Oa0@@W:P\Q P^P  P \[$ `J Pa @ $< po/> Ѝ<# # 0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q0E   C ~0 % ,  PP ,S 'S\S/{ dS :) aPP0P! S :@bPP%aB0  b0PP%! N0 00}0:S ' 0000 0$O-Mp@`PDQp$ %QpPp1@ Q:;PsPplP T TX . @0@@T`ЍMH-M00  0ЍHЍ/O-sM`Q pPP  Z ;Z|Z 00`4`P@+ZP, 0@@PP @ P A`K QP$ %QpPP1@ Q:sPPlP [ [ 0@[ `8 P00V @ @ @D Ax @`Vp Q Sc ,Pf  4 @`@%T TRp%W`40 P:P,]PK 4,0P%P 0 T-p@ p0Pp @@Q* 0G@XSe Pa0d.Y08 0 AR Pl00Pp0Y \ !G]P@xxTxxxxxxxxxXxX4`xXxXxx P @ aP @  Y` PR&GVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888`4 P @ A P @ ~W !Wo@ Y4 `0 P*,P Vp,[P 4,0p 0`p 4P4) PP*    P 'PP'PH P @  P @ A ;R ?R%Q Q P* @a@Q OQII/P88P@@ P @@ APP  PT*1@P OQ$80p!! !P  P @ PpW  P4 10 P*,P P @ P 0 0p0@   PQ*    P +@`>`@<V9 `6P``2@ob.P``*PV``$``!` V o``P}P}PB~W OQ  ` OPa  P &A@Q# OQa ARI/A AR @40 P*,P b`,ZP\ 4,0`T @4 @x APT&:qm%Q Q  ;R ?R eRP$ P" @PT*Y `,vZP 4,0`  09p44, 4 ,`'`sߍv`vp MH-M  0  0ЍH Ѝ/ MH-M  0  0ЍH Ѝ//8QK-Mp`PQt`P# P WpPpYP  @TpC Q& X.pX,X# T tXd P XG X: X7 Ѝh DCpP Q  (P P  }p(P  }pXЍ@8ᯱ, ᩱ!    )  < LO z @-M0S C@P  ЍA-P`P p N@#[T  DpW P  P  P  P  P | P 0AR p( '   O- MM dpP /P  0 ЍۍOSP= Q/Q9 P6 @`ZV.`P& @ZT  Pp  0`ZA V Wg@3 P$ `@Pt@:PUppGTP:PW g U g  0PF[P P9 P 0 FP 0DP% @`P@t@:PppGTP:PW g U g^  0PF P P ЍۍaU  $ *  U " O-MR `@P pP P!  A @%WP P   !WP  P ( WP  GP WP   rPp R  pPpP ?@p  `p[ `Q'pQQpQpQ [ P `A0Uup  !P 岐$ Q$P   $P` PPR _Y$PO\Y$ WP$E `YC [ PP0 0Ss0  r0P, psP nP fP0p pSpp1[pp2Xpp[  `Ѝ/ p`P[Aqr 0Xp`G-MtPp!` 0 P 4@P pP+ Q@P Y 0pp R Ѝ P 0TP  0pP Pp p4Z# YYYXH-@`MP! V PPP` |P p@U /oQWU oO-M- M@P  PP,PRP  `,`3@:XPH p|P  倣P  Pl @@P,P `KRP  P`J  F PPp@-VPe  0W[ pW P  p及WL ` P(, (, `pW> 岀PPUZPUJ  $Z @TP UP &P!QP ( $@Z㰀( ( PPy@H W@xW @ @及T3 Pp`sV nV fV   Pe  0&  rP @T pKW ЍЍ+ s! @*  A-@P P|``P,PPcQP  pPb ^  & A-@p` PUP ;UPP6QP !Vpఀ  O-M`8P. LpW @@fP@pW PPr @sP nP P@@  PZ  0{6pW: 0Pn4sY nY fY  P H DPUP @TP'@P#PP H @DP pH@HHsY@ H  nY fY+H @(0H0$P& ,Q@?H P00@H 0ఀH @ H  vH@H HHLPLЍ  n 0H-@ PU0P KTLPP!0@- \ s\ 0@T sR nR fR 0S00 A- pW `@`pW P`P sP nP fP` P` `M0H-M@P 0  YЍ0HЍ/K-P>p@P 7@P 2` `(8 H0OP* `p Q`   p@Q  p岐Q   pP p@ @,@P ,@(`  `<@P <@8`0 |`L@P L@@HP iPA@-0@@@@ @@0 @DS @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B tA-@pP `VP SP!P OP A pP  H-@`PpWP RPPNP `  P  O-DMp @ P  ,P ^P00\P`00V I<I|mP@|P@P: DЍZ P: 0 T P:d 0bPPQP `< P`P,PNNPI  PLT<`P$Z5 @ PA ` ,P> ^P00\Pp00W `F2``P,PNP  P<`P P S<@SSS@SS S0SSn `FYP S nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- @P+ PP.P, 2PP(P! K P P"P PP P  @PPPP P P P PPP PPPR0Ѝ0H-PqUp@@P1 Q|,``ǶP | p` `Q  ṶW|`pQ  ᬶP|37`2`F``66X6\6@-P@NNN N$N,NN Q`5L5/45Q/ 5d @-Q R$ R R 0S4?0LS 0 S00004p@@4?PT <@$0@-Q R$ R R 0S4?0LS 0 S00004p@@4?PT,04 <@$0A-P@P P$ RpW P`4@Pv0V&`v`fVP8Q(P(` (2/(`8 P $PP Q4/AQ 9@Rp 0 4%04? ,@0@4@ @p <@@@$@@pP T @@@H-`R @1P8S T* 0PS(00 0$+P$(3/P `p8`@4nP P$ (2/`,h~H-PQ @1P8R T) 0S(00 0$+P$(3/P P`8P@41P p$ (2/P8~t}H-^ 0S$0S\ 0S4?0NSq Q@0 S@0<0<<@O-lM`Yph P $PPUhPlЍw P`4@Q \ Q + 4 / 4% ` ??<P B, \ / t ( X  p  D @@P  D 0 T$@L`\P4 @RX !|8HX|$p @H ( <`$ | P P XT*[ T 0KT*S T0@K 0T0T*X[ T KT*R T @K T XTXT  X T*X0pS T` CT*R  CTR  CTR `0CT`X0@T:X[6 T KT*R T T K Ry T T K @TT*X[ T KT$*R_ T @K T `lXQ.:`Q08< XA p w:l(X PpA`G P 0QL`<88l`H@LTXP@PR H0S*` V p`F0S:8L TX!^ PNHa Q TX0S T 0CT*S T0T  X00CS T0T  X00C{S T0 @ 0T0X@Xr XXT @+X z!P2B@PX`P  CP`V XV`V`Vk T  H@@ p PTNHH@@L`p?L`XUP  @ p"D@0?,PQ:P N@:XT[ TKT@  AG pPp0`Ph  `T 4 p:X``pp@CL`Jp\T8 1`T*XT0[ K0 `S:<<0TX@ 4@@X@ 2&q@pW-pT P  @X@T p 2&A@^DQ@D⪡QL`<8XH@p40G:岀L`0C:@ /Q>Q    Q 8P R R 0S/$0S\ 0S/ 4? BR $0/A-M|P R $ R\ PЍm R 4?0BS0S@@T:SRl.@ <00<  P0b 0P!@ l@PE`0,@p0WfV03ST*@Q`: l,0 @S Q@`PpV@PaQp3WPT*U:PlPU  0A  PKri @,P Q0P04P4 PPP``0?pPPPTPP<@$`P lTQ R/$ R R 0S/4?0ASA?Q@o/K-Qp 0`S@$PPU P4@PT (+3/pP 8P ( 0( 3/P$ (2/0 a *b ga Jb+*AJA AgA4P@Q :o-QT04%A 0C PT pYA4p ( 8 h8Q R/$ R R 0S4?AQ/ / R 0S/$0S\ 0S 4? BR/ Q P /Q OR/$ R R 0S4?0AS/ 0ȠLQ C0QD0D0A /Q R/$ R R 0S4?AQ/p4@@@/O-MP`80R 0` C C<4 @P0PU0pppP[ 8PQ0 Q, Q( Q$ Q  QQQQQ QQQ f U PV U@PV6p@Q/@Q+@Q'@Q#@Q@Q@Q @Q @Q @Q  @Q @QQ @UP1vqQnPQS2JhQ6QcPQS+J0,`QQ`PQS"J($`QQ`PQSJ `QQ`PQSJ`QQ`PQSJ `QkPQSZ Ѝ(Q0 4o,0$0 0R0000 0d <0@0R pW p`4P P Uqpppp 8 $p 0,(`40P :W``0C`00 Dp, ; 0`@ D000 04P$p`(`F`0@ 0  TL <@T` V \ D T*0 J pAQ 0 P:0  0@p  P0%S00 018C!! `Pp[ @ 8 PPopD U@P [80P b  O-TM{ a04P Hp0C,@0G0GX\083LAP,` Tp P@@<4 8D0(`$T 0P @Lp a @D1V @\&qa@D1V  PU\* ^:Y< Ⲑ T040@22@D 1T 0 @00D ` Q @D1 @/%aQ@D1 `T *PPU*0@P@P@6p@D N1W10`GV, R 8 RI Ri*0F$  B`40YVPp`: ^ 50G0 0 0[1:0 pP` k R N 4R80 NPPg` 0p`FS PPYm pI0WPbc( Y40 B<VPp]: ^@ 50G0 0 0[1U: P p0`P k R N SKy40 BYVPpg: ^@ 50G0 0 0[1_: P p0`P k R N SUX pY : I Y    Y  Y   <P< p0P ` PU ) p P804 `V  IY#S#: U 0[1:  k R E S P p0P ` PU  ILPY: P0 R0 L8 IY*?/  <PpH Q/ H`0Iq0E 0P0C @ <TЍ< ( H-M  00ЍO- MP8@P 1P<8P  Ѝ@U p 040S(\20 0$PL$xwWpGwpgJQRWWXJ XYJYo(&3/W@ pP `* 0qk  (40p2tP  P`,L0TXp=<p@-@T Qp$0SQ Rp`9 F8R;P!"V*V R (3/D R $0(3/@ R $0(3/8 R $0(3/$ (2/qVpp@-P2@P pP`,L D< `6T `l`t`\`0x h`` H`0|pO- MY` Q Ѝ$QZ  Qp9 A8R;0!"Q*QV R R*QtQ0  A0,PtQ,P R L D@ @,@\@l@G` `5tQ:8@A@DH`TXl04P p@T,"p `H` 00l0t tQ x `    l 0th0\l ЍO-M-M, _t@ B l<0CQV:P8 E 0l\0Ap @S\  BLpp D W, l* 0 PBB `&`OJe`V""1bb ("TH*EW 0LppW p1 RpC@ P *0 P `B0B p&`OJfpW""1bb ("TH*FP 0CppW p1 RpC R8 8 t0 z t t R!:lP8p`EXTPHPp{' PHPQp\A4['D0 P@ HP0pp ``PPP , c < Ql t0`P *PA8QQ#! R PBA8 UP   ЍЍ0H-@ R 0S0$0S0S PU0 9PB8U; QRR*Rlt , PUPQU 8  @ TP00H-@T Q0$QPU Q09 A8R;!"Q*Q,p`P* 9 40(0H- R 0S$0S^ 0S9 L8R;0!"\*\ RH-^ 0S$0S\ 0S90N8S;12^*^QRK-PQ@ R $ RY R9 A8R;!"Q*QUp R:$``V` $ & #PUTFK-P`p P$PX PP@9@8Q;P*PuP UTJTʈP ( ! P (pPv PgPb PL0D,S*,gp| `Px\lt AprL D0 0C<_,  Ap`A` `OJb`V` ("TG*BS  L00S03Q0B@P*_, `pA `A0 `OJg0S` ("TB*GP  L00S03Q0B@P 0|0 `@  O-MPU` Q $Q@TЍQ9 A8R;0!"Q*QV R  R 0S 2QV ЍP3 (0P(`! PppW   0A \Q R *Q QpPQ 0(0/OƂ Sʄ0S@ S)lp W  B(@0"!$  000A0#22C0!lP 0 00"<"(000 0 00"4000  *0q=pWpW   0 LQP9Q pp  0       P  0$,PQR S0Xpp  00   00"$   00   00  Q Q R 00  00 Q  00  00"$ ,P  0 0E pS p0V0SV Ѝq  p  p  p  p  p Q Q R 00    qLpWpW  ! 0 LQPEA"P                     \           P^ pA Q> @ 0   ,QP @0< 0  pWpW   0 LQP$ IpY  , QP @0 0 IPH  P- , R P0 @0  0pWpW  ] 0 LQQ0 p 0 00Q ,P P  [$PF  P- , R P0 @0  09pWpW   0 LQQ0 p $0 00Q ,P Pg,P7   R! pWpW   0 LQP?00 0 0 "$00  ! 0q pWpW   0 LQP PtPg P^ Qe Q>P tPtP9 8l 0` 00 00t0l C 0tQl\ 0R8UP @C l\V pWpW  + 0 LQ$VP_ P t P*)tPV P P`l2`lX- 80 pSW) W W$ WgWfWeWdWc Wb Wa  W^ X%8 00 00 00t0l C 0tQl\ 0R8UP @C/ l\ pWpW   0 LQk      B! R R` :0000B p0uppp 0uppp`  tppGl0tp p`Ql-D 2/4V= V\0l P8U BP l\7 pWpW    0 LQQQ P<V V-  0p V L D ptP\l pWpW   0  QLP7 VQ60Q7 000 "$00 #00 3 00  00  "$00  00  (ЍЍ  00 < 0 000 00"4000 `u pWpW  J 0 LQP`oЍ  @0 0A @0 0P. \PJ8l 0 B l\+ pWpW   0 LQPQ(Ѝ@-\ @T$@T^ @ T9@L8T;AB\*\|0 p@-1"!4P#4 P%0U $PU^S p@T9@@8T;A*PBPP% P Pl@ T@T PPU `V$PU `V,@T0@PPTU T0p!&!'pO- MP 6, 0AS00Y @ *R:1\lp B`pGoQo`1V` V *0EV ?o 2 RiUg Ve&%o ᠒ 0v `@&@@! @P @T@T   0 LQW W8p\  r`F\ P \, C0 PV  z 0  B0t@ `R' , V&*<l@P 80Al0 BlPP8 0 C3l, l@V` l 8A ,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l lP ,R@ T@T 8  l, l@T@ p *pP,0qB\5/WA 1R0Q*pEQ0o0`r0S?U= 00S9Q7Q@@`U0Qpp0o`8 0 kp\P\@T@T   0 LQV` ЍA-Q`P P$P@T P9 @8R;!"P*PU 0 b *`J` gb&*@J@( A0 0gA3/`P p&p 0 (,P3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 , @@ L DD  | `0 90 B$;`0;O-MP tP tQQ P P:8 lH` X@4 TP0"Dp @H p0Q , @ BPp`Pr: @l0`pp`0C0p pd```#d` C;P<;p0 S0CR @ B C`V @B@^ X+0=r<t@`T !`FRPQ p^ N p尀PX%P@Dp^ @ @`pPRP`b` PRP`b`1P`Rpc # `Qsq1#!@TcJ$ Q 1 R `pPP`P `F pVPʰ DЍO-M6v`0{Vp | @$@p^*@\" Pd$pAඐb@ᰂ`dW3`p p!`` $`pf@@D9ᰂ q@$PbpEB`gU`PP@P!`@@`$@Pdp@G 00H-PP @m"P/ 00Q/0H-@`"P" 0@-@!@L@-@!@m@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@(@-@{!@M@-@u!@o@-@o!@~@-@i!@@-@c!@@-@]!@@-@W!@@-@Q!@@-@K!@@-@E!@8@-@?!@Y@-@9!@sp@-@`P P R!@ pp0H- @P P!@ 00p@-@`P P +!@q pp0H- @P P!@^ 00p@-@`P P !@J pp0H- @lP Pu!@7 00p@-@`YP P @# pp0H- @EP PN!@ 00p@-@`2P P @ pp0H-PP @(!P 00p@-@` P P @ pp0H- @ P P!@ 00p@-@` P P i @ pp0H- @ P P @ 00p@-@` P P B @ pp0H- @ P P @u 00p@-@` P P  @a pp0H- @ P P @N 00p@-@`p P P @: pp0H-P] P @f P( 00p@-@` P P @ pp0H-@ P P@ @ 00p@-@` P P @ pp0H-@ P P @ 00p@-@`m P P @ pp0H-@Z P P@ 00p@-@`G P P \@ pp0H-@4 P P@ 00p@-@`! P P 6@| pp0H-P P @Pj 00p@-@` P P @V pp0H-@ P P@D 00p@-@` P P @0 pp0H-@ P P\@ 00p@-@` P P @ pp0H-@ P P6@ 00p@-@` P P @ pp0H-@v P P@ 00p@-@`c P P x@ pp0H-PP P @P 00p@-@3`F gPtGPPPpp@-`PP @ BP pp0H-PP @Pw 00p@-`PUP @ Pd pp0H-PCP @PS 00H-@`p aPaFP+PPTp@-@`P P @& ppp@-@`P P @ pp0H-PP @>P 000H-P\P @,P00A-u` g@tGPPSP p P p p@-@V`i gPtGPPPpp@-`P$P @ ePpp0H-PP @P00p@-`PxP @ APpp0H-PfP @Pv00@- @P $ 訃A-P! @ P Py`` `pP $ p=  0 0X4Y oY Y @-P @ @Um 0 0X nY *Y @-P @ @?m 0 0~X Y X MK-M$P $@ 0p(PJ` dP  0P pЍK Ѝ/E 0 0JW X /X H-P`p" ;P @`P!T `@ h!@$!p5, LOXO ON' p@-P @Q p p PP `pP#\\"" P @@` Ppp| 3H-@P PQ  pP `pP#\\! P @@O`b@$ 3~Q/ 0 S /T~Q/8 0 S / /R/(~ H-^ L0 SQ 00S P J#}X Q/ 0 S/`}p@-@P PTQ p ;P ` P!#@p,} Q $ 0 S/Q/|\ K-M@P, P`Q%V# Q  P pX XP0 S0ṛ@ Pp Ѝh|\B  K-M@P' P`Q V!   p) P x pl0 P`00ᆛ@ Pp }Ѝ(+$ $0 0{A  4Q Q Q P , 0 SQ 0S /zH- R 00 S R oTz H- R 00 S Roz P P 0 SQ 0S f O/ P Qy8 P 0 0 S f O/ RPy H-M$@P 6 PP  P0PP, 0 P# p P `0 P  PL  P Ѝx H-$z]HFTFwH-P Q Hc@a< <0 0(b$ $0 0M N N M N N H-P HDo 0 0TM N N @-@l?P X9H1<0P XV0EEED0H-@ P PT0P P 00H00Hꋇ C _ H-P 0 S ,  PQo"T  //p@-@ PP ` P `V:<P P Pp P P>p@p0H- R PP @Q!P  ,  @00d` `0 0LH H0 040 00 0'L bL L L >L wL K L pL 0H- R @PrP  R000H-P<@P /P P PpP P>P  0H0p@-@ PP ` P" `V:<xP P PpoP P/gP >bP  p@\pp@-@PQ@ RP> @;Q <Q >Q&E`P, g&Q&:`P! a4P m/P p &'`P l!P tP ;Ppp`p0H-@P<pP| P P P Pp PU:<Pg pPb lP] iPX sPS tPN  PI vPD eP? rP: sP5 iP0 oP+ nP& =P! "P 1P .P 0P "P >P  0H0I @-<@P+ /zP& puP! lpP ikP sfP taP >\P  WP @Q0H-t @P  \n P P 0*0'K-`@Q Ჶp@0 PCU pP<Sp0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP` p(`>PX` P\ ESP/Q PY $>Q; $>Q5 Q PQx  Q&  Q@ P A=R(  P R0!,PP"Q qR  PR "R  PP>Q  0 0@ A B p@-@P&U U[ <UT `Q TT*P@PaPEUL`QD(((((x((((((((PpU% mU3PpUP;U.&P`PtUP;U&>P`PtUP;UR``<pP >P `G Ѝ`< < << O-GM  EF T 1/  0PQ aVk Q 1/P@>iP pf T 4/ 2/pT 4/W iW WqqW) @ i@Pp Q 1/P`iP P  2/P V 6/p V 6/Gߍ 0 0 0 0  0 0p;l l0 0XET T0 0߾XBT T0 0־'8 N:  7 v9 7 R9 b9 7 : 9 8 *: D: s7 9 ! G-Mr@PP`P>. p   Q:u?EqA Ob@@OXpw3  $P$Mp Pp K iqA@вP @Q/Q 3@2 k-@ۍ/Q @P*T @T P/Q As Pp1 J8 G-M` kP8P @,p pVp E0e ``V* @Ѝ    0pfx  Z 0ep @-@ h@ H-gP 0 0ؽ{3 5 (5 P/ O-KMp( P@$U QTFGo  0PE5/P JI/ 0`P $A(qP P7 1P$!( P Aq$A(q Q U JI/0P @J_Io($  2/ 0PKߍ 0 0Z1 \3 v3 //@-@@ H-M  Ѝp@-P$$~னP `Jp(&P @ e AP `, pppѩP\pLH H0 0 ''t'`'8Y,'4'&&&V2 2 2 H-M  ЍH-M   ЍH-M  Ѝ@-@T  RW /Q 0 S / !@  ! Q/ q3/@S"# Qr3/lWP , 0S0! 0/VP , 0S0! 0/pVP , 0S0! 0/0VP , 0S0! 0/U0H- R |0P0U 0A  t 30t0 00 T  0@0 t :U0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('R U0H- R 0P0U 0A ! R 30t000!T  0@0! R :`T0H- R 0P0U 0A ! R 30t000!T  0@0! R :S0H- R 40P0U 0A  U0H@0 S0H- R 0P0U 0A ! R 30t000!T  0@0! R :R0H- R |0P0U 0A  t 30t0 00 T  0@0 t :,R0H- R 0P0U 0A 0t00'R?O 0T 0 0@0'('RQ0H- R 0P0U 0A ! R 30t000!T  0@0! R :P0H- R 40P0U 0A  U0H@0DP0H- R p0P0U 0A  t  30t000UJ 0@0 t :O0H- R |0P0U 0A $0t00%(0R UJ 0@0$((%(R`O0H- R `0P0U 0A   t  UPJ 0@0UN0H- R `0P0U 0A   t  UPJ 0@0UDN0H- R 40P0U 0A U0H@0M0H- R `0P0U 0A   t  UPJ 0@0UpM0H- R p0P0U 0A  t  30t000UJ 0@0 t :L0H- R |0P0U 0A $0t00%(0R UJ 0@0$((%(R`L0H- R `0P0U 0A   t  UPJ 0@0UK0H- R 40P0U 0A U0H@0DKP , 0 SQ 0S /J0H-Q DP@PT0A  USSZ0$%o0J0H-Q DP@PT0A  USSZ0$%o0LJ0H-Q DP@PT0A USSZ0$%o0I0H-Q DP@PT0A USSZ0$%o0I0H-MP@ P AV$PPR0Q -Qֺ  y p/:Ⱥ"P+9xP   c p:"P  Ap"P ( gP Ѝ0V! H-$G*G0H- 0 @  Q@ PRP0 TQ @ R*0T300H-0 @Q@ 0PTP0 R Q @$0T*0R30@-@$\0H-(M@|0P l   ( PPP XP $cP(Ѝ0 I N  PH-P 0 0@TP0T`Q URSU!P&PQoQQPPH-THH0H-@@P 0PP,

HzD D0 0D0, ,0 0;>>  L    O- M@P Q04Q8 4@T ,p`PP ᗳP5 `P@D¤Y@PAtlqP& ` P04Y0p,sP# @P" !  ,@0pQ @W3c#`,V,6<V0<2FO,@0p 4,@Y Pt 8pUC PEp I!`4,< 4<a@+<@@4@<$@V!P  2r`P `p P;* 5|@Z Ѝ! 4,< 4<` "Y( `^z 0 0G 0 0> 0 05 0 0,tUp p0 0#=    ;`0    X    m e y   P 80 SQ 0 S /88O- MP @D`Q Ѝ8.4P* ,婰 PqW& YP PIQ0 S `C!w4<@4<:8 ЍODz@ @0 0ᤴ,I( (0 0ᛴ8q W  M   P 4 0 SQ/ 0 S /7 7P , 0 SQ 0S /6P/ R/6P/ R/6P , 0 SQ 0S /}`60H-PP @P  2/P P PP00A-`P @@P"P xp$P,<P Ap P 0p AX5G-Mp@ PP 08! 7P (P 0! )P (P$P  Z`Ѝ0 P P*  YP  `RP H 0` P ,K( (0 0៳ [ Z ] 0 N  H-Pp@P+ `SP  2/P P pW Ч P 51,P)(P0H-P (@FPa00 p@-M@004 R;P,S Q R& `V8 P)  0Q Q 4,A4P. `ЍpQ b 0 0Ѝp`Ѝppl l0 0XqT T0 0@a< <0 0A d $ @   H-4Q , 0A40Q H^@< <0 0β($ $0 0Ų , H  O- M` 4P H apP P C@P  Ѝ   ЍO P P`P < " *xVj Pg<PC4PQh,@qW:  P0U. 㥰PC P PPEQP@T^  P P  bP  2/Pp P p@ P| @T: Apr(z$!$1 0c 0 0 0 0 0 0tp p0 0| |0 0 x/d..T T    8 M     l   H   t e  ( K-P? P`VA@V U1 U1 44P pP 5 , !$ ,,P  Q,Q 0S pu s Qp D}@ @0 0p, ( (0 0gH+   }   @-@K @H H- H ,( H-$ ಝ*⾮Ữp@-@P ``QP P Q `< R4 Q ,  a ph{d d0 0PcL L0 084 40 0) Z   H q  $  0H-@P P L R< 0H  0 0˰T(    @-L@VP*  0 0ᱰ    0H-P@P dSP P H0H0  0 0ጰ8    7 @o/K-S" pP`@W  @P   0Ki.+ 0 0T1 4 V H-PpK@P `W  ;P  `;`H&H-P@(`P oop,W@PP @%H-P@ `P oop,W@PP @<%H-P@PpQPP T@ p`P  @ީp$A-@P PQ P`@V pPW P  PḩPP (`O@P `$#Q/ 0 S /|#Q/ 0 S/P#H-0S L RQ R0SRq#H-@P  R  `PV U UP  pU@U D@ @0 0B,( (0 09", e p  A s Q/ 0 S/!P , 0 SQ 0S /G!H-^ 40 S 0S Q@ol!H-M$PjP@P* !0 >P P\   `p "PL  PF"P 0,!,1 0ͮ 0 BP1 `pP+ `0 2P Q IP Pj` pPP \E` pXЍV QP-X  O-Mp(`  P@pW=Q@10 A Qh U P V T0* A U UP V P * A!!  P V P* A!"  V T7* AP y-* pGZ@X$ pЍ R U:0p0@ `BV  =R p0`0@ p AR<Q Ѝ @-@P {yG-M PG P VPx Z%:܁`p@P &nP7 $ fP/ % ^P' ? XP! JZZF pZpp:0 S 0P1:p  `Q CZ  ЍGP@`- J0Q0@ p@P`' P % P Z=& P = P ( ЍGSЍt g XH-0S RR >oP P@< <0 0($ $0 0,   0H-@44.(T$PPP0@-@T  RQ  0 S/P/pQ  0 S/P/8P , 0 SQ 0S /0H-P 0$PP @ 0  P |PP 0h  P XPPTTP040 00 0p& H(\D } p@-@@@P@P ,``p/0 0 Q % $ R ,0 S/Q 0 SBo/D0H-@.@P 8PPPPP,

d K-P! PpW2@W U1U14`4P`P , $! ,LH H0 0ᯧ 0 0ᦧ   @-@@p@-@P ``QP{P Q `< R4 Q,  afphZd d0 0lPBL L0 0c8G4 40 0Z ! B f  p@-@P ``QP2P Q< p@%D]@ @0 0-,Z( (0 0$ F = j K-S' p@W PU `Q P U  Kz}  0 0 /A-`@PpP P P @*QrP@ TBP P0 0ḦA 0 0᭦ 8 E * d @-AT\ T%@QARS ^ RDQ B@R S ^  Z 0 0m G-(MRP@U tP0  ` p  8P ֵPT(Ѝ      /     / 2/ / /     / 2/ / /     /K-(MP@`PP(ЍK5T$$P-P (Ѝ 0   0 B  ppY P QPT T (Ѝ蕛PQ @/@-@aTp00Q@-@P @-@PH-P H-P H-P xH-P LH-P  H-P ڦH-P ϦH-P ĦH-P 㹦pH-P 㮦D@-?^ ʎ 0! @T 0 @S^# 0@T 0 ^# 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//-~x` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@P8UUE@33C @ @ /  ଘ0H-@PQ9!1 0ྡྷ  @  Q d8@HHPHXHtH|Hpc? b Aa-lsww!- r- Q-QxsSw- r- Q-QxsSw-r- Q-QxtT  0G { & G-P >!1 0H ьP( peP5  p-P-*Ȁ@Ռ`qPό`@pW   P =P qP굣Up@qPT: 0H-M, (2P$R0H PD@P<80( P @o@pn  hp t|d xtCp PPP A P\oBK B >?@QPs-P-d-0-뽍8 0 Pɍd-U .P L@ rp$P L  d L@Ѝ0;a 7_ D^ 00,O-MP@PH?D"D2 0YT D "P XptЍ`P+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0塐@I" 0ꩢ 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q6 _00O-MP@PH?D"D2 0ൠT D "P IXptЍ`SP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0@I" 0 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q _p@-M0`(04@0`,@ 08PpЍpO- M`80p<@4P *dK`!`1 0DVDM@!@1 0됡厡PWP 0~@p‡@QpzPQ T :8<X *P"P VQWT :8 <0R 3P@   ЍN " l A-Mldp`P@|@@@P p@ R |0RЍ |C\[ p@-M,`0@(4PpЍpO-MP@PPL#L3 0gHU0,#,3 0\P[ # 3 0QLX"  `E@۠ pPҠ"P Π"ˠx" oPi b ARE0!X    t            $w t!/w' %w' u*w' z wTp!w' qPQ( xQ*Q@  0D L R0 Q'! P! ` L0StЍ P p  @pD0 W T  0 ЍP $ [ r / R C =  $ mD9  /XL/0O-MP`Q Z U Y Z + @|T@@h ``P PV`0 lX P+ @@@4P `V 00T QP-P`V p O`P+P -P j  `@v/ l z PJ @ 4FQ  .FQ`@/X\ P p0 R ``e0S AA@ _)9 0НZ_(8 0ƝUWa(8 0༝YO(8 0ಝZG(8 0ਝ>h`瘨 z Y(8 0J @@ EQ EQ@/X\ P 0Q R``k0S qQPq`PfG@' 瘇嘷B ``S0q q@-VPPPB =KrPPz `@{:V pP+@o7r P WV;Q :Q& Q PP:PE|`?`v````Ѝ| z pFY@d`&`6 0J pE EQ EQEu.X]\X P 0Q R``k0S AQPA``PUy @ppPU  P̐P? t  0S 0S Q@Z, P :PL  F40$ Bp``d`iPI P_@00t RP$S"  @P:POQ -P+P_ZP :P?`. @RbSN p0V:P@@T @@@T|t"P :P\`W <4P:PL `-P+P:`:Q :P?`P!$20 P P  `P``@P@ `P:P Q 10! A-P+PW  Y 1 |pv ؎̎ Y " x ldT tv 8|,p  \(o Dp 0u $1 r   (T(X L K-@PQ1 T9 4P> ,0(0 P!-Q ``ppW8 -W2 -pR<"2 00\DX"X2 0T@E<"<2 0,pW @`<" p`::W 1b-p``-oP poP! :Q1Q `:P  P>a!1 00`PHH8?PP:P  P  0:P:P ?PP  0꽺 ƹ Ⱥ ̺ X@Tl tl k 4E tpplL|<k (T(j ,۸ @-@P,/( (0 09 @m : k ( @-@P(/$ $0 0%@=$ U V H-MP`QP3@qP P p0P 0PPP PP2P ` PPꉛ`Pꃛ`~P|`ЍhA-@` Q0 pS P1Q*P pE| Pp pAWp ዓ Q  1 H-Q Q Q-s& 0 0isAQ%T  0 0RϠq  0 R1 R010 ( b m ̵   H- X o80 X|}p@-@P`P844 40 0<o0 p@M' \ @-@P0A, ,0 0% 0@ M˴ 3 0H-@PP864 40 0o; 0HL @-M@PD0@ @0 0 02PЍ螴 Ѵ մ 0 H-P@P`/\ \0 0٘pp0UUa V`qދr  A-@`pQ PTPPT P  ?D 0PpB,@AO-M@`pnPU( ĠT (VWp` @ @V@@V P \/ @D P $(,ЍЍ4r!#/H-R @P`pw0 !#3/p pW@T@ /0H-@PU 0H/0p@-MP@P U% 0`P ,P  $P   foЍpD;@ @0 0U(<$ $0 0U - ` d 0H-@P< 0 0P {0P @ P t0 P  QQ$݊0a 0, ^ 7 p@-@PP T# 0`P ,P  ㇑$P  】*LopD8@ @0 0T(9$ $0 0% X 0 0H-@Pl7h h0 0xP@PPz0 !  MH-M  0 &KЍHЍ/MH-M 0 00JЍHЍ/@- MP @Q o  @FPJpQhLHV@  D !~ Ѝw f Dur u P,E@/A$Q// t tA-8Md`Vp@PW4 T 0,#,3 0T U #3 0ޖVi`5Pu /Pq )Pp #Pl Ph Pd |P` h P\ TPX @PT ,PP PL PH PD P@ ۓP< ՓP8 a`<H< QQ `1Q `2 K)0!0PWR ZZ Yb t@ ;lUP9tP6 0 pST x0 zpJxDpHPPL T | tf@ 0@@oPЍۍf p lC@(z$#$3 0&Z {#3 0Y_"2 0@lPJgpڄT^p|Xp\Xx|~Dp(P$tP" -P# (Pt$A@Q/@k!P @ 03t tt /P/RPPT P LsGX X0! ,! 10  0 8  l Ҭ l ҭ @  (  1 ˣ` 1 Ȫ h @  e k U x 1 E 9 5 ++ Nm {4 D r u O-tMMPF`pZ@p W V TX U 4P @0 @HDLp A, ph`,$ @@T  "pPJ  pT뒕0P ,@,ꉕ#P<ꁕ=PQ0 zp 4  hP $/Igp@ 4h  P $I$ p @X Tpj@@꜔,Y@,h , @T(J<,0`P# (i᷇ `ᰇVX@崅Pp PP P dq"2 0_W("2 0UV "2 0K"2 0BU"2 08 pK ,` @PX R TK }` P`P `@ P  i` P,P pA0 @WpPtЍۍ h( ~xxiPP( h0PP`╨ P ,@ODp0$  t  L v $ \ H آ o 8;  L bN ϣ ' ? [) l @-M@P@ЍG-PMȁ`PpVL: UB pZ!1 0fx@Y!1 0[t!w,pp0 g P 0  @(@双P @i M@' 0 00U 0 0&t@Q p,p~Gp 0@@ALPPЍ9   Ȟ ؟ d ɟ 2 L @-@P,~( (0 0 @꬝  K-M@P`T !1 0Б Pp B`V AP A@ A0 A  A B A V&UpppUp  a @ `xP:JVPV Kp ڲp)./$)@(%@ `p /p0P @ P #PЍ P8 A-(M@P`pP# U+ T3  P(0 @ @ᒋP2pW)  0@5P# pW  0 0*Up]l l0 0 TT^P P0 0A(Ѝ蠚 9 = x  # P 5 O-MMR@`XP"2 0Yf [n T^P  0@pWf `P] < ;pPv<Ps  @+F+EP[< < <#P/ @@p,H  P-ᣊ@p*\P<P/H$ X+!1 0|[ 0 0rpp p  0Hpp1 xPPPЍۍt { y 0{U %L [ 9K x X @- MT@ P@0 0 A ! Q ЍD|O-M ` qwZ@<%<5 0BX0 T8 - 0 P PP@  R PK - 0P dP  0` p Ppp@@K B@[ TpQ880p PK R R`rQrQ  @@ T-P +P,!P- @P-P P  0 o !PP @PPP Pp  0 Y`   %-P +P&TP- @P,T" 0`5*TP! @P3T" 0`"` fo `WoXP p x XP4 - 0P =P `K@Z Pߍ\1X X0 0T@< <0 0ඎ  a m q А I { < @- MP@P@   0 0 B !  Q ЍdG-!M⸡`PV <!1 0{!@ 4@;D@@嗄PI@; 4p@鋄P=  P 0 C0@4@ pp@嚈P)P:@;`pPU  4:``cP ᓋP@ ; \0\P00@S<P!ݍK & xqqi Dp K-8MM⠁`@pV4@ TH P3 43TP "PI P0Pp C0P G 0 P2P6 `V0 2@3pP`V%  42pppPP (P P|x x0 0ཌྷT`:\ \0 0್ Pއ4P8Ѝۍ  Č O-M@`PP4C0"02 0AF0p P  0 WO* 0 A Ra ARWAA AR7A Q P A BR:P P @ 0aX4@dL\LLLX 2 0 0 @ G Z :` `0 00 0GA Q:} 0 0 PGG!U@ : U:HD D0 0 PЍ訏 ڏ 4 f l  @ ʍ  K-(a@`p?PU ?U` ?`# @0 ['`P >U.:W$ .P p?0P V*pW:V'B71@4P1*p@@V *p`ppQ:,?V35uoIonW qnYnp@-<`P@` (00 }@p 0H-M@P`3\ \0 00P4@4 @P PbЍ0G w mDp@-(M`PB 0 0b 000  @PP@(@Q @` PN$@ 0`P@(Ѝp跋  ߋ #mO-dMRXP` YY"2 0)0p`@"F  `@aZ @  0@Pn ,P`p  ꘍  0@`PU IP- X!1 0ߋ  0 ?P,@p@PXXY Z  \@@]PP[0 pP(P$PF (06P,X 9,$@$P; |PP v2PP `RdЍ(X$ $0 0YWN꼮; ӊ /   9 } L p  D (A-0M@pP% T- X5  000  P``P(?P p 0`p0Ѝ0Ѝlh h0 09TPL L0 0/X40 00 0% ؇ y Æ * l O-UMR`PP?V` Y"2 0}X P 0PPp 4p`@( $ ꀌ| 0P`PW 1P/ Y!1 0NJ O $ 0( @>P40HP@Dp pp@ 0PP0P,p0 0P4O 4,&,P!bPP\PP PRUߍ($ $0 0iYd[4Ӄ { : 7 ߆ 4 S2 K  ܅ /HeA-MЀPpU W 4 0 0<W! pP `ȗh @"2 0 P  PЍKp  < @ G-GM`PU lDN@!@1 0⪔!ㅾP7J\+`xpP P\@ ᱔+kpPʀ@|W@JY!P \@hl p"2 0 P  lPGލ& e j A-pM䀟`pPVlh 0 0ࠉ@G ^W!jpP \P%h @"2 0 P  lPpЍpꐤ ;;@-M8@ 4@> 0Ѝa 0 Q/p$/A-MЀPpU W F 0 0=W)pP `xh V@"2 0d@ p (PЍLp ʀ D O-EMM R@P㎽@PjJ<`8u pZ xp|X  0ƂqG W+  RUP⠰ W+  RL\@P  WpW fPebPTP@P(JY)P @ T p"2 0g@ p  @( ?PP@P94PP@PEߍۍH\H-M 0  jЍA-xM䀟`pPVt 0 0k@F aW)5pP `Ph U@"2 0d@ p (tPxЍsp꼟I} } %} -O-M@Q T 噹`傺E,10 H0 0b'8  PTp pb>f b L@ @\ c9f hdf PgX`c!`c! 6ot`ea@ba ga&4_`ga&c10`a@ ba&`lP4_=ba&gqpaa 0@`a&pP4_}` p`a&b! @-P `c!a!"4_ `a!"$@g!c!"P4_ c!"a f!(@ g!" xP4_g!"c1 `1 ,@f1#P4_-0 f1#gq00@=P pa1`1#4_0fa`1#4@0baaa&P4_`aa&`=ga 0ba&P` b&8` 6oPa

Fn1a1#@#0p$l'_'pP?P`)lq0 0o&Pbq᡻nq'=o&`p'پF_`,t@a`q 0bq'o&P&|Pp'Ona@p@ `%  xo&}O&@唀 Ob!@@cqh@o,`q' p'o&@ aq-cq' &p'O` @ @ dnqaq'o%p'o&_&`` |POc1<@o&@0bq=nq' 0o&@p'o&``Oa4@8@ `o$l@b! !o&O&@o@nq0`,` pco&p@`! !o&@o&`_b!( $P/"@ `l/"c!/" !_`(P@tP g/"xPl  /"/"_c!0 ,P/"0 P n/"g /" t ?`l!80 0  hPan ?#P ?#?#0_@g1dPP b1bqi10p%''`p_aqhPDP0iqa'%|P!'_'Ponq`l poHlP0`b`a`o&Po&pPo&`Oial@ga`agA@O$P O$P$cAob!D`caga @@`-O$ xPO$O$@o` @` aa ac o Po&o&`gqx bq bap< t''pc1< pibi104? ?#?#0a4 @nin1|P00?#P?#\ #_Hg1ob!0` `` gn$0?#`?#?#0oi1`` a1`ag0(? ?#O#@n1( b1ba,0?#?##g1, f1 pfbP80?#P?#P#l1_a8P P lfd0?#?#?#p0_b!dP @ glg1tP0?#P?##|_f1$P a1 agPh0?#P?#P?#t0ol1h` ba 0ba l`o&Po&t&D`嘐Ogqjq @bqjA pO&` PO$@`$OacqD@jqcApO&` xPO$o$`Ob! `q@@cq`A-p@ O%PO$P$ O@jApaA} aq`qp<@O$PO$O$x@_c1PP04@bq=aq'_$p@ 0 p'_%O%@_``A 4PbJL P0@lqO$|Pbq'p'O$$`@_a0PP pcl!O$!O$O$@_b!p  ."Q3 Emp &P z(QЍۍLP z."Q* 0D04*00>cwB B - y0H-,@+@P Pz@P0 O-lMPdH`!`1 0xPP'%< [P?Ja@@`uP@ (pu$u @`@P%JPPup(~u( @yu  tP T@@@@kuPgu&`lЍSA A $_ ##h##"H-M @`taP@P`P@U Q P, `P PЍP ``P  {`PP!p?pP& PV-PV+P`  vQ QPJP+Q`P!EPP#P._? P=_?QL Q 0 !R/?Q 0? R/Q / ^ @>R/]0H-MP @yP(JDU ?P :y ?P:yh P 1 @ P 1  TyЍ0L] ]/ Mp@-M@Cy`0T` P P SMP J 0`0 ?MPL  CM@@`Q Ѝp@ Ѝ/ m&P]0H-@PPb!1 0wI\ @QX @R#0!,,,,,,,,,,,,,,x,,,,,,,,,,,,+P -P&@$0QP U  @@@U @@ 0; .< 3< O-LMPP @0<8 40に&`$ xD Dg@x@xPD00@0@` ppPaIQ dddddTdddddddddddd\8' +IP =YP|@ @ `  0 DP`X@ PI[p  @\* p, p @1I GP#GP#|#꒰IPpH H?gwwPDH @D  0 |D=Y@+Y @V \*p,H H gwwPDH@Dp\ ]% @5 0vXWD\F:H H`f@w@wPDH @D0 @[p=YT p(=Y@\* pH HpfiwfwP|DH @D  0 DV \*p/H Hf>w - - { M# S" DxlH-pP@etH`+pHP V 0PlPZrhpPl   V` }p PtPѧϧtPP薢>p@-`P@`V 徧`VrP嶧P }寧+Ppp@t妧P mp@螧pG-M@pP 0# T+ P `P= @ P PXp! PN `rP- P+($!$1 0rT !1 0rYtPP #PPNKtPЍ p> `| Q @ dЍ b  ᔨ) ) : ) ) I XH-MPP,(!(1 0lra`P A@T P p@T P P sЍp%W Q  lP  _C`psP ȿvЍO( ( ( G$hH-HMP`P> 0 0r@0 ˷p pdP" @0 ίpp)PpsPP PPPT zPHЍ5' i' q' O-DMl@`P@0H8D&D6 0qppthP$9 & 6 0q0 ?&Ɵ 4U PTgJ0 oT á_V] [@ <r4` 0ڭG( QG@d`㙰",S HOYc0㙰(0` A",@ $d`$,  yd$, @ `(0Pp 8@we < QDЍZ IQ 6p@lPUA ` @0  mpEWp#W  0mW  0 mW  0mW  0lW  0lpcpQ d  0 @#:2`R@2`@[ lD DЍ P 0 lP p2  0lP p'  0lP p  0lP p  0lP p  0lplZ5 $0( S !P@> td PNgfffFEUWdEH!00 U00 02?,pE8ppA4 F* d 0TlP,`U U6 ' 0  2d 0@l,`6' x 0   80 4E PDЍ[& .# +& `& & _& & Y& ~! H-MMP` @pPV @5   p R `P:0S\0 90`P* 0\S S Ѝۍ$ 0 0o _  O- MM@P [#  P :cq{Q}PP/ {Q`"2 0o["2 0oP `{P[ V PFp kiE  ЍۍO<8"82 0|oV`pR p zR{R }RP @[R 0]SSSppp  cVQSP@`` ZHzP ,P [P ]QQQ  {P }PV `FV Q * P: 00X 0Q1: @0 @M a@TM C@\  R: R  $ Ѝۍ  X o    $  O-TMM<[ P Y# [+ Y3 p~P `  P0S/S, 0Qpq$4 0nY$4 0n[pl$l4 0nYTP$P4 0n pQF P ;HN ⽵P1HP. XP  0S  0 R! R  b P 0@0 BS`Pp `pm;HN ԵP `p `W PPTЍڍyp*`V*Q WL @ @T   RS QUQ pP0E EQP ?Q [Q@ᰀ!XQ 0 ]\ \!X[`Fp  p qp1P!X @P  P0]R r ` -Rp- ]W `P`w  3p`p pY% 0 0mP 0N+JpPgP P  p P\  pVp S @`X0 0#I|9 9       L c     m 9 p@-@Ptp p0 0~mPpPU aPU` P p   H-\50? CR,0!|Q 0SS *SO-MP`P U   0 ZfP ܸ!1 0mU!1 0l ʴPK PP  m@@PpᱴP V T G 0 0lT  `W XЍ     P DnЍ[Ѝ        r 0H-P@P U 0HsJD@ @0 0lU(E$ $0 0yl G M  F `O-MMp`@[ F TN ؔWT Y\ ܄Q$ /p@Q 0U.*qq0 QP/Q S/Q@pT*/Q Q[? YG [O  -  Pus"2 0lTm"2 0 ln"2 0lYo"2 0k @ ڡ PCL"L2 0kY4E0"02 0k[G"2 0k$ 2/Q!   Q  :_m/T/P     0 \$QЍۍ   P0 P[qS!1p 0k!1G 0k 00   P @U( 2/P   PT*//7       _   7    ! [   3  n +    m O-MM,0H`[U V] ,tP,('(7 02kDW '7 0'kTT&6 0k@(`@lU$@ **`PP< PU:$` PW DTdE`&`6 0j 00   Pf%5 0jV%5 0j @0⹠괐Y ,QGP!  (,0 pkP3 $ 02/Q*8 Q&DT/ % 5 0jP    Q 00+ @tI 1/pP @d :/P H` P, :/DP   d R00*  .RK   .R R .R R (@ Y RY$P P3 (, P I@ P0/3!1 @ P(@d, P I 0 P , .RPE"2 0i0    0 S @0џP}$ 02/Pw8 Ps PU#  "  PI` @GV 1/VZkP6  1 ,Kk5/Q$  (P0G0 $PI(ob$'k`/($QЍۍ`D`D*g " ? b h { 6 8 O U [ 0 ( e  # O- MP \ R " @2 0Di P\:U Ѝ]* p `@ 00T3PA@uPT PFV:U`?T [T % p<P pP5 /4pPp.p@X  q`V 0  P/VP  p/P Pp$Ѝ *   `@-@P PT TjOP T 0`OP .`|] R 0H-@lP[P X[P ` T0T00 ] vR O-MBp` @0 ẓPP u_`-Pc`` PP `  0᠓pQ  PM PPG p p  ` <   0@刓p) XPP1   0ptp @  0YP  `Z:p@@ `L@@`ᇫᅫ P ߍlO-MBp` @0 )PP ud_`-Pc``ᒥPP `  0pQ  ㄥPM PPG p p  ` <    0@p) X[PP1   0pp @  0ȒP  `Z:p@@ `L@@` P ߍ4pO-MBp` @0 ᘒPP u^`-Pc``PP `  0~pQ  PM PPG p p  ` <   0@fp) XͨPP1   0pRp @  07P  `Z:p@@ `L@@`ki P ߍ8Tp@-X`@P`R JP` RP p p@-X`@P`R P` RP p p@-X`@P`R 2P` RP p@   MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S! QKHЍ/rMH-MPP@  00@  @@@ @0T 00@MР0    R    QKHЍ/CMH-M 0 00 -MH-M  0 QMH-M  0 cQ R /xO-,MZ@TP( h*: 0[ ;P8JtJf@\ R :R|R  P :     PJ PYP XP pWX X.: PPX X\aPp 02 (0Wp 0Op ,Gp 4PJ PU(8 0T[xPp hP` P P P P P lP| XPx DPt 0Pp Pl Ph Pd P` P\ PX PT PP |PL hyPH TsPD @mP@ : p7\  P2(& $"  $(,048< @ DHLPTX@@x%  h S,0p0p`D  8`G40p8p`  <`;p 0> 41p 00 4'p0P  P0  hP0 P DP0 T  p 00 0ppbfotᔐ&$P"a``圣 pTh*@ @@@!@%@p  p PP   p V  P`  P`J [|"|2 0Yl` OP `Q< foF  -`p_qvP$@p d&0%Z `P \1%N P `2%C P d3%8 P h4%-W VHPlPP(P,Ѝk   ?  ; X.r  x  m[ؠ `'fp, U t ZȲq^6#h rpabN :p6p@-@`T' PU$ MD`p Q/R DP@Q Q/RP @@`P PF/R SVP@X/UT@@@P4``T ( ;,p @$ S K-MPLP@ @`t,@5Z` ڨ`P* pPP$@Q#Z"P$T *Ѝb@ Pd88880888h8pZЍ !Ѝ p@-P`@PV@ sLP @Q/Q /VpP1 R0r/S@CPU@(P ;Pp # ̲H-@M04 $ (8 <p Q@Ѝ@Ѝp@-P`5@p T&p V\@U pph @kp P@FC@Upp܍ v -M ЍpFF|~pqUQ1hpqpq1`pp@-  /oQ 0?o? #'S @c\ \ ) p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#  pp@-  /oQ 0?o? #'S @c\ \ +  p(CHSScP`S&0c0NEUFQPS@ Pc0@^1Q1SP10#   pH-   ?!/Po? So?`'P @`Q Q ? , (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +  H-   ?!/Po? So?`'P @`Q Q ? .  (@HP! S@``pP&`2TVfWQ`SP ``2 P&T3$Q30 0SR@$!/ @b +     0D ` p1 A 0/ A0  0D ` p1 A p0 Q/A0@ ZH-@ p A@ ZH-@ p@ ZH-@ p @ ZH-@ pPH-W`?0/R//R/?0S/R/P/R/H-@W@-MP ㋡@T   OЍt@p : @@@P@@T4$ g| ӻ Q ͋(H-(WPH['00O-M0pᔯW q   Pϟ Wb PU] @l%Uq@ P%EUPL0aXXXXXXXXXXXXXXXXXXXXXXXXXXXX P XXX4XdXXP$h$XXXXXX X X$ H X\ X  Xx @@pG@@TUy  `8h@\IP H=P @RIP >=P @HIP 4=P @>IP *=P @4IP =P @*IP =P @ IP =P @IP =P @ IP <P $@IP <P (@HP <P ,@HP <P Z p B`@HP <PI @HP <PC @HP <P= @HP <P7 @HP <P1 @HP <P, @HP <P& Y `p#  0@ Q`/^0 `6R  3:^ 03  ϟ0Bp5Q p UUptzU3pG @)0 @ R0`/SP` UPP3`:SP0ϟP3`0 Cp0B S pApG@7T 0@ P[pl  0 @ R;0`/SP`<UPP3:S0ϟ`PP3` p0 C;R% "[ P0 @ R0`/SP`>UPP3:S0ϟ`PP3` p0 C=R Dp2 PW0@ Q. a0/RP06UPP30:RPP30 p0BA4QP8llW 0`@ V_ 0PUR0SP::SPN* 0PA`0SE0VC:9VA 0PA0`V80S6:9S 0PA1P0@ Q a0/RP0dUPP30:RPP30 p0BcQ^ 00@ S Q`nA R0V::V * 0 B0nAaPU0S:9S0 A 0 @ R0`/SP`UPP3:S0Ο`PP3`p0 C R  pt 0@ Pa0 /QP0 UPP3:Q0 3 0Ap@ Qp0 0@ Q `0/RP` UPP3:R`030 ϟ0B Ap R p 0CBp`@FP :PW @FP :(ϟP MJ P50`@ Vp` 00Fs Q1 FR0 r0%pc#tBwpp#4#11C r  0 @ RR py P? 0Uϟp g 0@ Pa0 /QP0dUPP3:Q0 3 0ApcPp P 51ESr?dp0C+0A/S@`!0,t||`0@ V:T@`  V@0A`@ T T.a0 /QP0dUPP3:Q0 3 0ApcPpdl'@ R  51ESb?!a  `$@00C P \ \L @PUp9 0C\0@0S0/ $0`0pC W@B C<̟P@p u P k˟  0  Sʁ pXEQdpO MR`0 TR R XK@@@@@CR 0 R (k`` @ ˟R w 0``@rQ 00@ @R @ R @ R @  8P7 p  8P2  @8P, l  8P& T  8P*   8P%  @8P   8P @D` 8P @D` 8P   @ɟ A0A S *@0A  p$(ȟ L`AVJ*MQM0a a$p( +'# lpȟ  s    ̧p <ȟ  [ǟ VRA 0``@( JQ> %P Ul lWEXǟ p< 0B0S  B  p.ꃳ x %!ER2?d a;QP.a! @QH \a $p( Ɵ Q JQ@ akt `U @ Q` ` 00@P*Q  FP P@ PX$(Ppş 1 şzU :0@@@A.ap$(@@@LA >a $ 0p%a ! Qe  Q*%!ER3/>bK/)<b!qp'qqpWQq ""q R3$40 #0 A6Pu4 `l0pEPQ0"/dqaQ "p Bqpv AqA%)b8/0!bB$I"IqRBq/!B !b B AQ>%!ER3/>g 0K5)lB6#sP%Q7sP0UQ>sp'r6sp0W03b4p`gpA W B R:4 b0 G B 1 \@%!ER3/>bK/)<b!qp'qqpWQq ""q R3!40 # 0C +pE0Q0"/dqaQ$ "p Bqpv AqA%)c Rx?1CqJ 0Q0 R00 "QߍzP8 )l5@bL6# g `@cr0W03@P8 )l5@bL6# g `@cr0W03 hȾHpp<XZؼ'  |D P< 8 ަ Ʀ z b п8HH-0MN@;N ЍO-uMM|p`w  W %N@F8D4!41 0}L @p7 @P: N/@PU$E EǦOWdE`E \EQ;~0  C p0x pE匥EEv0@PJW5P@Puߍۍf$֗ z L0 4MH-M  0 uЍHЍ/MH-M 0 00 ЍHЍ/O- M@P Z ? " 2 0LZ `Zj[hJ>50P @ P 0P` aa`` |\PZC> >[P ` X ᚓP4 `P [[Zpp{p 0 0K  {ʠ 0 0Kktp> Ѝ` [ ^`P * ] ޔ   Ք ٔ $@-M@>(P 15 " (0 1/`p) p 0`VQ <`Vc>L`p eP @`O>ЍЀ`G>p@-M@=(P 4  (0 1/`p, p 0`VQ <`V>LeP @` > LT`ЍЀ=0H-PP4K0!01 0JeBP M ! 1 0JP% @T" E P0P Z P Q P0P (L  HPU* 0 ?,P ;4P 78P 30H0  ~ 0H-(P@Pn[0HB@- @@>[@BL0H-,@@ڤ ][PӤ0|BO-M@PF!1 0UJ `P0V ` xP-`p0V,p0 V& P`pV    ("` @P 8 B/o"k"0PB` @p0V`W Y$*U".VP@ЍV @ P  BQR Q Q QЍЍ( _ i 4  R  *4 8/} 0X\S 040:8 R РS /JxBH-P`@,KH Dp V  S 9sꣵxp@-@P`+K 0A-p@`PP/ T7   pQ @ Dl(p \Vh h %VfpQ:pP P j '7 0JIT&6 0@I FnP{ 08DP\ht0F3-V ^V?V0P 0QTv (v _v   W@v P P} v z  v Q Qo =Q v#P)v;Q U 0@0 ̠ ^ Q+W@%0vp;pWpcSXb`a0 `XV^"w Q" `s dR0dS 0@ hf $ &V" ` Cq0 0K0A\  =V  9 20` ` P  = ( W Y `ؠ,8 ̇ ̆ O- MpPR 7 X? @TE `  0PU> PEP:((U- PE@T P&. U PE} 0 00GX 0 0&G`U FH L!H H0 0GH` Ѝ , L  x ] 0  00~  Z{΋ A-qPpW1 /C!=QdaV P $QPXDP* V(㤎`,1/P- V;  $P#@`@`P=pWpQ 1/xpV@V T  0 $P-X@`rq\qqx3(qq4A-qPpW1  HQdaV P $QPXDP* V(.`,1/P- V;  $P@`@`P㞑pWpQ 1/xpV@V T  0 $PX@poo,p1XoLo@2G-@P_ `0:PZ qPpW  U` /C"=!i QU ZACPB @P U& P0=4pWpQ 1/U(㍍PP   1/P $@Z $41/P n nm$n/mmP//G-@P_ `9PZ qPpW  U`  H i QU ZBPB @P U& P0㵐pWpQ 1/U(PP   1/P $@Z $41/P l,lk0l.kkX--G-R`SPP 0/` {O`V @@ P ``@@T p P rl``` \0Xp T@0p`@`P,|j@jHj4jiii,,, ,K-R@SPP 0/``V ppGw P 1``ppW `Fv P l`\ \0Xp T0P`p `P@+,ihhhhhh****O-MMP `Q $P P/P P EE~ ypu c8P PPi ``p/P PY @@/QQ.P`T T.P  PU P/ = yp@  P /Q P G Z P z/P P P? #e cxP"J @P 8  P0 p =p'p/P  P Z/ .X ЍۍRE? Z/ HEhEE>eBE?bp@-P Q @"yp@p l@TC ypp'E9#E"P/RPP- xppE"P A`P xppE"P0@P xp@pp@-PE `u7\H\E 88 Q,  Q' P:Q0Q` 0@@CQ PP@\Q@:Q`VQ`C`Qp@P 0,  pD pbbbcccLA-PpP( U0 @R5 Q `p:Q 0S R p 0SRpGS@R :XR :R\X X0 0BU@< <0 0B@Pz { W z z z p@-M`@PP T V  0`'Ѝplh h0 0~BTPL L0 0tBV40 00 0jB z Oz W y 'z ,z y y  O-LMM܉P`UH  Z ptY )9 0FBtDW )9 0;B TT)tI@T% W` \)\9 0(B R 0S Q:Q |Q P @Q:Q |Q @މP 0PS @@ ,VJ 0;(H`  0P jv`VJ(H` p$0P4``Jp [ :H+PKv@PeH P6W4 @0pP@pP 0#P pTU|x'x7 0A0 R 0S Q:Qb |Q` P@Q:Q |QpW4``9P P P :P \PpVp ``p,Z:0P,@K8P^ ,J0$pW u(t4@0PPpt ``0SL%5 0?AZlBh%h5 05A4($4` @` P @P`X,<P ( @(UtPP `@:PtPp p0SRS@@Rp =R R@ @Rh @:R  RD( @40 @H$0vH@[ {{:$d 0[  F B 0S:S0 Ap,`S:V:p` A`V Ap puP , Dp@ A I` I @#0  0@'@F$!B ,@\ 4u  T K CP B  XlHP LЍۍA@0A@`W!1 0B@@pn4@8P pD 07/p P 8p@T <@p@1/P4PP  /1/pDoᠲ 1/᠍$ @P tA@ᕍA@$P 4t ው 4凍$P t@t<u Uu Cu t -u u *y qy ty x Ey Z _x y  |[x q q v 0v w  T[D[`Պ h/0H-@PP T(  R 0S  R:R |R Q A R:R |R0D@ @0 0?T($ $0 0?Zn n WK 2n n 0H-@PP T P T0  0000H8D@ @0 0[?T($ $0 0Q?~m m {J Vm m m TTTTTH-LP <00,,  000SSSSSO-MMℴX p Yx plDP@ \$ XXtR pH P 0P $400Sa 0$  P   AQ 30000@:R#R)P\@o" S`PU ាPl#  P TCP DP 8Q R  R\R   "2 0>Y|"|2 0>}2 0 ` Q pAQ\Q hA PTRPU :Q ?P N  V`N:7  PBa 0`P  R :R|R  0@P 4P ` `PЍۍ4lzj k k zj j j @S4S SSS LPRR0R ᷈P {d e A ^d d d 6d d ij d >d A c d d K-`pP1 V9 XA WI VQ @PP 0p:P R Q 0 RQpCR@Qj =Q`@Ve dd@qPK pP="!1 0<Vh#d!d1 0<XL$H!H1 0z<W0,!,1 0p<V!1 0f<`@T @E d/P$ Pd@`V:VT Ep =  P WlFh h0 09< щJb b G? "b b Wb a b a b > a a a ` a a A-PpPG UO XW W_ Ug @Qm `p:Q 0S R p 0SRpGS@RV #R @RP 0R xP 0/p0`C V:a`CVpV:A`C6pV60S30"q 0 0;Ur 0 0;Xs 0 0;Wtp p0 0;UXT T0 0; >_ _ ;< _ _ K_ ^ _ _ ^ ^ ; ^ ^ ^ O-MM`@PV$ E"2 0{;P //P,D 0d  4 p J%눒KP$`N p4 @YQ:Q(d PD@`@ ` I P o o o(d:K$N ;K/$N 05,D(dWp o<P @P9LL:P 4P+<P<  P ⤀ pAР B`4 poh$PK4 :Pm e< k^ _ Zp l,V 7^ ^ a B@-M$@;0@07P@Ѝ=@ /  +` @a p  / = @ /  +` @a p  /=@ /  `A ` p  /=0 A@ /  +` @a p  / =@-0M@Q 0 !   0 T :PT,0 0#0ЍH- M mP ЍH- M mP ЍH-M  mЍ n n0nG-M8pPW2 U: `@a$A AXOこdA`A\Aqpq-ppN 0 08  0qtq@P!QލHGD D0 08U,H( (0 08aT T ZT T T T U T /0 $ap@-P@`<+( 0@+p`H-`@Pp(+ 0@+O-MؿP@pU e Wm 0 @Q@($8p`Vu   4@P Q AQᕿP 3P%Vp@` p@WzPJ!                                                                        ,      p,  |8 D   Pp0`@y@pv@ps lKpkKphJpeJpbpPݾPVA%LQ AQP "3P%`@ @x@u,``-^[ @ `8[ p*0<0-< 4 p-Q*-0][ 4 oO`@@PJpp W  p3p p+P-<Q ]Q0  $$    I @I 8P4P  2 2P P@PZi \PV`]Ps  0 ㌭P iV`Tr -΍D Q %  0A D`V P @ڽPoQ  0D @B D `VD Q (,V`T @ D@ 2P0D A````SD PᙽP DHD((FϠP Ml#D`V +@MQ llLLLLLLL8888888888888 QeM*M8 8"@Y @@8  BRM:M  J DT(0 QDL88QL 8M MD D P@kPj * @@F₉ϰ T@l# 04, , T<@Y*<@`+Vd -Vb Z $4< <+VPIF%P:$$4  1P 0P0VK0V_ xP<, 4<@, @8Q V VQ @Q,@, }P?04P aQMdVEV PV" M P0P @ _< < @ UpV eV74 @PV 5, <4 @8 < <, 9,)V @   /P@_V ~ nQ @  w(V, @r4 @  `0P < 4 _ /PX < `P@`PG,`T<@:B pFp @, @ ,`pP<d @ d4,`  4  < @V`F@击P T@->QI @`  R  T0A  QgP /@P@` /@`PtZ0A  QFP @@VA P[ P0 0H0`@ F `  F0` F@`p FP` B F`` B Fp P ` p< ` <P<P @`FPP [< ((L l@<,PK [ APH0@  B B0 B@ BP B` B Fp B< B pp P p| << q<`p k-P 4P,`<`@,PᠺP [UZe 4쵟P (< 77@< .P4 4P<((倵 p ,`@K,`V*TYV:@V 8 0  nD  mD 8e b[ ϠPH0A@  B B0 B@ BP p B` A< B A Ԇp P p <@< ᫇P4@P<@F<P P n.P~`Tz@q pl#l3 02@@D ~ @PDP((  S(QT4 @k`V@T+Z (( <8Dq XRD,D 8 0-8 0/     0 0 0 0(0 0(D H$$ @T @kZd@T [ & 尀 D Q!   0 02W 0 01@ူ $P( QADQ!x ( Rߍ2I 9 1: 7 9 : : hOEL< < < KJJH  lF HJT%EO-M@Q- y5 PT!R$0PP`  kPZ0PpyW `PB<`8!81 01y? QR@0B#+@W PA}P( p C+0pPpQ /yP #JJ]$Ѝ8 8 5 E0H-@P# @G$0H-MPp$lVPd8` `0 01@0 4/P @2@Ѝ@T7 N7 ^7 H-MPp$lVPh8d d0 00@0 4/P @2@Ѝ@TBm6 6 6 A-M`P$|WPlph h0 00$@ 04/P @Y2@Ѝ$@T5 F6 Y6 A-M`P$|WPppl l0 00$@ 04/P @,2@Ѝ$@T,A5 5 5 A-M`P$|WPlyh h0 0q0(@ 04/P @2@Ѝ(@Ta4 05 A5 A-M`P$|WPpyl l0 0D0(@ 04/P @1@Ѝ(@T?3 |4 4 A-M`P$|WPlh h0 004@ 04/P @1@Ѝ4@T2 4 )4 A-M`P$|WPpl l0 0/4@ 04/P @z1@Ѝ4@Td>I2 b3 u3 G-M/8@0 4/P @0@Ѝ8@T/ 2 $2 H-MPp$lVPhd d0 0/8@0 4/P @0@Ѝ8@T;. k1 |1 A-p@Py0p l`XT  @ 0t$ EᶣJ:0!0;cp@-Md`(P`@ @$  00  Q CQЍp9 O-SM`PV H )9 0.tU [ )9 0.Y )9 0.[ @@T:0 @2yP<\ ryP8V 4RyPL 4px,(PH0Pp`T AP A@  A0 A  A J @ A0 $* <`HpX T* T #0PJP!PpPTm:@TP`@P`8@<`<FD@[@! 8"gyP PPp A` @P @@ @0 @ @ @( APD0 p R,0P P! P@P䦟 8DZ Z:: U 0Y15:@0 p ` R@`?0 0 C%)T/P@0 8`\&\6 0}-$ & 6 0t- z&6 0k-Z p 8   a @ xp   / b/*b:.Jb/jb jB A^ *A~DH@ J@p@ p p p "p@\$d@ p` ``[ <p p! P6/P [p @ P4,P p0PW.@4`0PZ:. rPpH@ AZ A @$ @ @ @ @ @ X p%0Q,* Ap GpRH p`P W   P* &Pv pbQ*0 Q: Pt*!p `Qi* pI 4P0*00QX* (P *  QK* (]\$!'`";)|{}0S** ` R#*@T6*PZk Q*W0(PxP  8`yy<-ؠ 8@4` Py y<yyHPSߍr 0 0, 0 0,8/ 0 0 / / / / / / 43x < d2(18/l/<5+ , X, + + Z, , 6, , Q& ~& & -& Z& & H- Mlp r 0H-@PP T 0HFDB@ @0 0!T(C$ $0 0! { 00O-MP@PH?D"D2 0!T D "P O#XptЍ`YP+V -V ` 0V xP p0VpTp0@ Qa@"Q#P*p`? P0@I" 0 # 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 Pʑ7Pe!`"0/Sp `qpVpX SЍA@Q  _p@-@M@ P ` 0P @ЍpP 0`W@Ѝp0H-@PpFl l0 0!`@UPu  $P0"@U"@0 z p@-P`@`mU@t  Ppu"PtUq"PpG-MMd`p 0h@P# 8  P hP() {P LVP J  P  p:"Ppns@ P p$p=P P)"P'"PP (z(n nn"@PPЍۍ h 0H-M PkV@p   P  Tp  @!Ѝ0O-M`$p@PK Y  PP@hP Y pPP pp`P`&Y P kP= `E 0  Up `FP!PP m 0ePPuP TtTp   pM z!P^@ Z p`*` pp W * IQ  Tq`Tg@P&0 0r`V `V P P  QQ/muXT T0 0` PG pP$pPЍP 5 0H-@ m P P mU 00H-@PP T  0HD:@ @0 0RT(;$ $0 0Hf > q O-TM@PP w/? 01 TP@ U Jx/? 0 UX< 8fP\ @PP"/? 0 LPR@W XhPPo/? 0 Xe,; L`Z4 L ,Y @, Tp@P 2/ PL R* 0P  eV*c C*EL V 0 Rpp00PLO#/?@ 0/|?n 0 X:HH%$PPo/? 0`eU@@,`0L @pP,`Yp& @P  2/PL R* @@ 0`  cU*f F*CL @@U 0 R``0LP@U.Lp@@ pY$P  2/PL R*  0`  cT*f F*CL ,`T 0 Rpp0L@Y.L p@@P p[$P  2/PL R*  0`  cT*f F*CL ,`T 0 Rpp0LXH p @WP @ P( 8/ZP4 H @@`㋐`Pi0< J `&X* Z*@PD`4 pP 2/D`PQ P@ p@W: T00HrLWH H0 0- U0X, ,0 0# 0X 0 b Ԡ 0H-@PP T  0HqDg@ @0 0 T(h$ $0 0 꼭  ׭ H-P@P# U+ T3 U; ;q`PG  >qP@ p-qP: P. `P4 H/w 0 0 Ux 0 0 TW 0 0 UlXh h0 0 nP Hn贬   d ū < n 0H-P@P U pP P PnP 0Hn0TP P0 0j U84 40 0` 0HpL $ p@-MP@P$ U 0 0E vnP `pP P p0 0qЍpЍp$ 0 0" U, J T H-P@P U p`P  0 0 U 0 0 $nP ?pP nP nP Hnꜩ I t ! * p@-@PP! T) P/ P9`V; T!1 0 FPD <HTp8I4!41 0 T%!1 0  `T V Vppp  0 0 Vp`p  p p p p<   ۨ w e q @-}/ 0SAS/0-O$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/H-p`@Q* W; 0 0 T@T,  0S  Q@Q  0PU 0UR   @:< <0 0 W@5 j  ٦   O-MM4J`pQ00PߍڍHPP*\*X t`X`X\^Q:[pZUY iYi# @[Z|q0(  @TJ T*0S? (I PWJ X3: Q:[ZPQQ Qs QQ}:@ 0S <( pXo'p BPf [`2Q Z, p500P ǟ B  B4  @ ``   |P p9 P0!00p& *p P*0 Tn&w00p  PppAQ :`&  x60gPnJ Pl*T&@pIH6 0WP^JW\(&@pG6 0GPNJWL%@pG5 07P>JW<%@pG5 0'P.JW,%@pGt5 0PJWH%@pG<5 0PJW % 5 @G0PJpTppZ @ `X`4 \ 0pP0PPJYI`pZa0pS\ ?I#s0p P}J| PI:y 0 q 8o  h0`2(P P$0"R0p0P01P PP P p PP0 Q0P0UpY 00 0  P @ZP( @p P  pB@X10  0PppU YpW W WApX5  0`pPp!0 0 <eP 0 Qp @0  PJp P:p p0  0dP py  T dd H8( q` ؝Ŝ ̜ \#E m (! Oš  ςE  O͠ G-1M쑟pP@`W % V- T5 C/ 0 PP @?@T 8p_P SV@ `P SPP0O0P @ 0 `*` B QP*BP3 B p) aPV' pㄏO @  P `SP7Q `V P @P: c 0 VP @ x@ lP`*l@0 A *A<Ps d*d F*F x `*`O @@*@,Pq a ` *` @*@5 Q9Q Q P   P0 S p SR`pV P,P,PVWPSR VWp4Q4 <@0  P.Q QP PE 4P%Ph `EP F$ @< 0Ph ,PPf $RZ 2:p8PM<@0  DPE-P PQ;   4@< 0 2 ) P P <@0 PPP,PQVP `P Q `< @ 0P ,PZxX%[ ( (`P% `[ PQp u,< 0(P P P P  P l B(S`dPP P $XQ?P @|Ԁ8pL[PP +ލ Ѝ{4P $@$jxp`P pP a*a  A*A `5 P9Q QQ   QP0 S P,P,PSRQPSR <@  0 PGP xp,P[ [| @4!Bdd)d9 0 v@xpP"@ ||||Q< 0xpP'PU PPP@@QUPWP pP P@wZPp 0Q0-PP[ `9NP @B? PJP JP tB? p(@@`P H ppW@/ HP U,PqJpPP$ Q @@)PQ@P RRy QPQ1P. PBP$ 74 0[1 @4( 偒 @<0@P P> B a*a @*@ B/0 Ê及B܀X& SX `寛I L 67P,,1 (@`0X$ P`V NP Q @@NQNR@NQ U9 N6P4}{|^ ƒ ww@w.# ؎ l@-@ 9LPt  @ H-P P%0S PP$ PP+ SQ R  R RRQ>/R RQQ RQp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^ 0S D0DPU S K-M`p@P W RTP!P1 0WH PPD PP9*P   OP P PYJY'yP 0 P P P X QQ P P(PЍ ܁ L~xO-\MMXPTP300X00p B 0 BwX@p P W T"2 0|W"2 0rTv@P| *0kPPv  *0aPPh #P P DP  0<P p``W PP P P P V`&P pp sP8 40 `*` @*@8 dP4PU3 pPU,  P4PU r!1 0LVP `P Lp@Y  YT4pT ᷅,QhX Q\Ѝڍv D|}  ^ }   Y`{`{ { } yO-M`XV  P@P @@>@ YNp7P P PWJ@8P> P  @ A A4 @@  AP A6 TH 0UX@P* 0, P JP  0 A B!0 0_P t@P@`VdX@ KP* H 0P" 0\ PJP  0 A B!0 0)P P Kd1St`)x@d1#^*t R q PZ?[oXp @P R P P pt` @Vj`Pd P 0XPp E EP E E0S S SK0d00 Xp`0\@00`@X0` 0xP` V @ N`( dP6:0,d` X**V  Z[O`0  `V pWp Pp R ` =gV `Ѝ`,`` .Vwg@Q507ЍcG{ xz y K-XM,PtP @8PP AP A,pv<004   tP 8PpXЍp  ` *`4 B*B pP TpPP8P4J,@G004   tP W pXЍ4 pP4TpJWgXЍw w O-YMM⼕@P `4DPT pDPL P8`4p @Q @`T0PPQ U(`$p*%5 0YfQ @ .Q@RPP`.@oT_ < P`@  $눔P $p(`Z*JfdT(:$Q :f  PZPp 0@p.P#_p P  PifV,  Y U R ,DZJ _`H U "2 04"0  P7f,,  PJʺp)f=W Q Q Q    1  Z  Q  ,TG*$Q:e=P 0@.P!P_P x  cP)x $p(`0  0 PP TPP4Q 0  0 PTPIIGI!@t e@ P e 嘐P $p(` e` $p(`'I%IP`PYߍۍsqr 0u nu sp s >s r lOLl,m4pO-4MMPd@P0,p Ux $ (  , 00 S `PU D 0 8 `PD  0  8 " `P50 0p D(  !$PU*0 #"(0? / r | |0 0U`dX0P4Ѝ؍ s `V$P`2k~k m n p piO-M-]MMD〉p@Q l h*h: 0W Vb Uj DP D @*@: 0刐PP Q @ @ * Q Q 7Q !Q3) `vpP(  0,  8@0cPJD ,1/P p&PRR0@P$ldPhdP]ލڍ Ѝ~r(8 0FU(8 0<p@&@pR &pP@ 0Z*o0 (Bo`P$@Bo ( 0@8<`/cP[J@D ,1/PQ @4pdcpc `WH oP*0!80 cP1J`D !,1/P& ! P!pP4@! $<`p$@aP$pX X RX"$pX !Xd X4@InP? \@&%0 tOp0@<`4pHP 9<uprp%4pL%0 HO<`XV 4p<`0@PZ*Q@@? @<`4pXDTB  NcKcHc0`!80 ZbPJpD !kbP| !Q Pv@Pr !@$w<`V Ą  P3`4p`XPPH U(p$X  `*`h A*AlXP QoPPz^ P0 S t W0 W^ $R  R t Wpi   @4pO<`VA PQv <P@Hp ⏊0 p D Lp娠TpP PP P P F[ `$U) P8P Qp pX ! 1 0K`W 0 0@ FbP8@@;b@吠P E3b-hj ,m 2m h pk k h Hk j Vj l B Th h i 4N[P_` Cc )c ` c ^ 00@AAQ3 S_0@ 3?o20-0@?o2  .0\0/.P0 P/.Q RK-PP" U* X2 @ 5CpP i!0 At @@D P i C@@`lh h0 0UPL L0 0X40 00 0^ ya ` f^ Qa Ta >^ )a <5 O-LM@Pa Ti (Pp @ @a`0 ` *` @*@P YW  P|PWPH  Q Q Q XHPPUPU  X 0 07P Pdh` `0 0"THiD D0 0X DLЍLЍV\ p_ w_ .\ H_ ]^ A\ ^ | O-M@cP@U`a [i <pUp#3 0  0PpQQX 8pPO `PtP{@xbPp`Pv PQ  0`PH T "2 0 gP] PKQ!1 0[xt!t1 0 ~R`P2@daPp`P- P  0`\P p.p T  0 0W P Pp```PЍpnppCT` @P CY Z <] 9\ Y ] 1 v[ ^ ] F4^ X^Z \ 0 W*Y s[ WO-Mr`@PVp"2 0   */p )p EP JP Q pAP Q[ 6P pg@P`[ @PV XQp 1*   0 P8Q4:Zp Z.   P&P# pp Wpp Q  p WY ֆP 0 \ppDpp Pߍm0V@\ y\ Z STST@-@PHD D0 0I ` D #EgܺvT2Y Y 1 K-@`PP' V/ >! Б@piWp  D  $)P*@pP:D@ @0 0V($ $0 0~X X s0 VX X X O-MP0 $pp @R P x$ j'MT0H00 X` 0 V7 8N p\@b* `0`0p0p tB0D7`p<p`pn aLpdgehp p|uO0P8p0 p *v wD lb*,P0P0V0XJ0Ppǂ( `P` Pe FmOPteL `  ` h iFx`4 ` gDkH @b ` `  Od  B|@◊ pူ p  w \yH bu `  `"akFl PPQ]O aZ 003y6J7@p@p@!x yD@Hp`dE`p`buvO`PpmPp0P@s @pLPpD[0p@0Qz^vB0p8c9@p`@w yN@ppf PPލh(<$ $0 0VBG 3H I ?I 5 0 (AMH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/@0H- M@P@@t0 @DX@ PU  Ѝ01{@A-M$@! P(&p p` 㯥L I&p$w P"PJ`V PPU pW PPPrUmPPЍFhP?0H-@  "0=(P0P=(P,P= l PPYP  88pgP  00TE 5E m@-@     v  0H-M@ PP0^= P0P {A   0PP0PЍ0K-@0`P\ PPU p P Pp`PH `Yq `Pq  :P4 iP% ``А pp P P P AX   ,;P q FP ``PP7"!g!0H- @    v  <0PPP<(0P<(P,P00H-P@ U 0A-M@ P( -`F PCp`0< 0 @   0pOP0, 6P& P "p  $ $ 0 `P $ 0$```ЍO-MP p`@ ,(Q*w:P (,p z(`W:qqW  Q:0 0 0S $@L @@Ѝ `Q V:pP,  pV`9 ` `pW* W:@V   3P    P !O-,M@P]%5 0!(0 ^PSJ(5PO Ph(0 MPkJ( @P$Ph  0Q^*0S0S S0  p0p pCpSpp0R 0S 0 p@ P@EU@@@@P   `PFVPPPp 0pCSppp@PDTPPP @`DT``P`p  Q $_5P b@B(@P$P0`(`V*PP. P   ἐ7@  pᝰ- @PDp @0 pZ P|   p@  AQ     @P   @P     p 0   @P @@ p0 @P  @P @@p 0@ 0X$ 0$P@e: DQ* ]: ,Ѝ $> X> `> = = @-@P$/ 0 0@@:<8 8 :"H-M@%!p/ `"p PU+!(%!@ 0@ @`Lp!w <00 @PJ"@ЍO-M(Q:x p}P @Ѝ<($4@` $V` $(p&PppZ,p*P( -!% GQPUW P:P P!*9@ P[& [ P 31PA21PA21P1A2``p V S @0V08p`FV8``F9`Z Z P 31PA21PA21P1A2``p V S @0VV4:p`FV:``F;`ke7 ! /@- @T ,@T  T  Q*D! @ Q*  Q:@Q3 A K-MP$PP (@0 t40:p  A0;`0$nB11 a#@ I2'-02&S㒐d @ S 0   ! 00 009p 8`@61`R ,0S SQ*#Q*Q: QЍ0 A0Ѝ@-0@S 3/@8H-7I) QN: @p @D` TP p `P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'"( QO: @ p`P @D`E Tf&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'",@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T : T80T:  T 0 T6  T0 T2 T0T01P 1T000000000p0P0H0H0 1  F@  c           /  0H-@X'YP V'p0 S0 Mp@-8M`HP`@4@IPH .07Ad00. }(@U PE ?04P8Ѝp@Ѝ/[  O-MP`PP@p RQP QP 0-P0+P 0\@.P *@q0Q00@C000A.Ppp  p!p >?O p  !.Bd0 p#"0f 0`@@@ Q *PP00@@UP:Al) Q 3T Q*``V 0  3@ V`:A@PR 0@ 0@1`00@`d.T``  ``i O   @ Q  P*z P B `V  30@PV:IU< VP * Y 0  3@ Y:@R,  0@@.T P,@1`00A`d.TP`` P ``  O PRJ!.@P!.A` Q  P* P †P@T  30@`T:EV T@ *PU 0  3@ UP:@R  0p.W p)@R P90p1`00A`d.Wp`` p `` O p!.A `P@ Q  P*p P @PP)) ) + + + ... P @Ѝ D O- 40`00pppPqp@0pG``rg``p@@@ @PA@p0@D```R PP@ BpEF2X<`Q `bfqoq' 2X c `bfqloOq' G2XY`pQXXXXXXXX\XXXX\XXXXXXXXXXXXXXXXXXXXXXXX\XXXX\XXXp!pPRq `0pF```.UPu``) `dPP@]_OY PPBpp@  @ P iaࠔ` KP0EP E`PP@ 4 `PP@.8O-DMCQ @@R  `*` @*@̀ !scp51 Bcr !51Aq%!E"d Rf@ <8 $p 0P a@)bpE%!Aqdbe #p 0~P a@xp*bd%!AqdRf#p$ 0]PpW& @Z4 Y 0,8gObA00R0PQb$8cs D(01<000!pa `f 0EPW@#?n`H0UaCQAWU"/"bAY DRBZ/ NP@ 2/r!" bSPPVFSo.eP`U2?2c1FVR0FWo`P2`1FB /OY U-Z Q-W M-DЍ   k |  fHT p@-M`P; P:P( Q@0@P0SP?83j8V3jaF``P+0;  0@P.U QR0*A0oPPB P.PPu ,( (0 0bPЍp} K- MP"Pɥ lG00@@04 P_ `ܴP% Ѝ\ H-M@PSPK SxaP`F tSPB `SP> LSP: 8SP6 $SP2  $`pP,$ pp .`PV3opP $0<H`pTvpЍzN t   d V ,  H-M`@P^SP( Q PpP =pp W.P5P U3opPpTupЍH NGC p@-P@Pu`Pu` V PLV`yp 0R0p0Rp \ 0 /3V0H-M@tPt 0Q PEЍ00H-!Q  Q  P@@PPHP0@@=P!0 P @-@<p ,X0@ 0H-P8@p0,00H p@-`<@Ppp 0p@` 4 H-M`p@Pp 0@<8 40 0  p0ЍGЍ H-M`lp@PUp p 00ЍGЍ\ $ / /  H-M`Tp@P#p p$ 0ЍЍ d -< H-M`lp@Pp p 00pЍ1GЍ H-M`tp@Pp , (0p0Ѝ GЍ 0 H H-M0  0Ѝ H-<p HF  4 x G- M@ἠD`Vt@@P,0 @ p   H Ѝ}O-M M@ ,{Ⰻ[ Pl R!P W  (@@G$ R `P `U 9!PiP `\P P .PP `FP V& V*  (@3@pG{UKP! P.P! W(@@W.pG{`KWG(@@ @ @$E.PPV5*W$ ':f a 崋X   P?05/`FHV  P* {K|WvG$ K {K q PcJ`W [ * ?007/ @  ,(nK`[EP0`G`G`GL@ X0 @ XLX`Gdx`G <L`G`G`GX`G`GH  dd `G`G`G\ `G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G0 `G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G`G$ .$ ;P Z ' `V`FPT*o` Dd ? 0P Pr  P *l hp?07/ @   . ?#PJo`w +R 9   P 8 4p$?07/ @U   Pm . ?PJ>T{*o `6T*o`1d ?0N@ P 7 P *@ <p,?07/ @d     >0@ P  P *| xph>07/ @    Cd > 0@ P}  P *  p=07/ @,   @T , (o d @@T    d 0p P. z P*  0Pd 5/P  Pj*o쟟N `_ @   PR* 0PJ  P* P  P4 0p7/ $@폎^. pk 0PkJ P   P  ?007/ `n@`    [  | $pTR d =0qP P Z P *  `=06/ @   `VvP J P*X@P i @(+;4[q@ P* P?05/[ @V  A  .$ ;PCJ P   P  p?07/ @`  `  @ @ K @ G [ @ PY*p>`0IT*n`t  . ?PJ  `>(0 d @ P  VT*n`K TL;+4[@ P* p=0 7/[ @  E w@P  p@ +( (=00P1P P0  P *  p<07/ @V5U5E   H!R/0 SNQ:H,A b+ 'B  @ < .$ ;P$J,Q* p_   (QJ  W< {( [; P  , ?d 0` PC  P * @ll?04/ @  Y   (,Q:l ?H , kh$D '{  폎⻞.$P pk0;PJ P   P  ?0p pp 0d @ Pp  P * p>07/ @T  簋k *V):d PA 猭  P P p \ 07/ @D@T    P*- kⰋ  .$ ;MPJ HQT@! 0R 1@CŸ `+ d d 0@p P  * P *l PXX?05/ @  T ` ,L XP npT*o` T*o` t 2l  .$ ;P4J P   P  p?07/ @   =xl? 0d @ PP  P * p?07/ @   =@? 0d z@ P c P *X TpD?07/ @   =@  z=P  s=>00T*n` t X@ q@ PX   P * p?07/ @    @T1*po`  ~[ h 4p  =p P  =`  > !0d `` P   P *h dPT>05/ @   P8: <Q= 0d P P  t P *  pt=07/ @   <= 0d SP P  < P *  p<07/ @   Z<d ? 0P Pa   P * p?07/ @  .$ ;P3 JX : K'P  P# :   P  p?07/ o@`  b &d , ; + 0; ?0d P P:  P *\ XpH?07/ @X :   HPJP P:   P  p?07/ po@`   ? @  O $ c;d > 0%@ P  P * p?07/ @  d D?0@ P  P * p>07/ @d     >0@ P\  P * p?07/ @p  p  P* ⬯_ 砟 z@  p  Pq*d 0n` P  X P*p@  04/ ( >d 0@IP P  2 P * `?06/ @W    p_l B.@pW     d 0@ PC   P* 0`6/ o`Pp wp  :d ? 0P Pg   P * p?07/ @$@ p  폎^. kqw  ;+8-[@ P* p>07/[ @ > 0+d  Z@ P  C P *H Dp4>07/ @p,  p  PA*ԝ _ m`Pp  #Is 3ir S ?9P  892 ?0XPP P? X  P * `?06/ @   . ?K P J +R : `P  P h dpT?07/ @p   . ? P J@ +R :   P  p?07/ @p   ⻞ 폎 0 P J@N +R :   P  P?05/ @  .$ ;U\8 w(H  M8@  F8P  ?82 ?0X0P P X  P * p?07/ @  .$ ; PZ $` Q 78T:K8 wX P%JP PI :   P  |pl?07/ Po@`  $o`Xo`U, P*Xx gJ@  p∀  Z P  ) )@@  d 0D` P  . P*8 p@$$?04/ <\ t  Pf:(  @@0 )   X MPJP PIX  P *  p ?07/ @p,   p Q"* o^NP:@  ⴀp$ ;` PJ, Q:P9* [o` P Z< X 0@0PE[  p P+  w P *d 0@L4/ @0U  p0p P X Q P*  0@ 4/ [m` P  +Xľ 0@0PE[  |up P   P * 0@4/ @0U  p0p P X  P* 0@4/  P :)  P  p?07/ @  o`T:  + 70 oT: ?0d P P  P * pp?07/ @d     ?0rP P@`  W P * |p?07/ @d     ?09P P~ " P *p lp\?07/ @   PP  `   PE:.  P  p?07/ @  Vܹ   Pt-  P D @p0?07/ @  3U  PN  Q  p>07/ A==+=C+`k0 4~/ =pSo?`:k0ShPAx<@A@@@A@}@PA%S@@Q@@@@@@@@B@j [@PA%S@@Q@@@@@@P@%RR@@@@@@M@PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@@@A@*7ж @PA%S@@Q@@@@@@P@%RR@@P@SP@@@TA@@P@RQ@@@@@@J[UJjРKPEkS[ZKV:J`0CkSVZo`쿟 P \| k2&0@0PEZ  -p PE  P * 0@4/ @0U  p0p P X k P*h 0@P4/ Q @4* P: @  P  p>07/ @  . ;\ܲ o`?Tt/ 0H Fd P P O P * p?07/ @   P"*lo,`e h 4d{@    P*?d 0 pHZ Z 9pYP PY @  8@pU OpGPF  P * P?05/ @Z  t P!)  P  P?05/ @.W  [ⴋ.*X:.gq   P @pp>04/ O pG@W  $ P*jꀯ LX  P  p =07/ @  =d 0 ZY0 0,  PP .pp0S PupWZ.pXx ,p@Q  P*( P?05/  @jv 㴋[`[<Dd [# PO:   P p lp\>07/ @  >0 n`[n`,ꬿ` Zu P:  Q  p?07/A h꿿XJQ o`฿P Ⱦ 0@0PE X  Ⴛp P $ P *  0@4/ @0U  p0p PZX   P* 0@x4/ 갽Ъ ( gp ϼ_V  P  p>07/ @   Qn  A 0+ B 00+ Q+T ) )@;  A+U PJ@ P *  p?07/ P@T[Ⱋ*U):d ap 眯   P p@ l 04/ `F@V  p P*  [Ⱋ,VH* p_   ( RE ( [; P  , Ih?d 0$ ` P  P * @?04/ @  Y   (`,kV:;+#[-@ P* p>07/[ @  )Yc;+p#[@ P*P Lp<>07/[ @   h 4Ф (H  . ;sPJ P{*FV5U5E!R/0 SX @PrJPQ P:   P   p<07/ l@`  .ʶ% X; P:   P $  p<07/ @  [k` P  [0@0PE[  BDp PA  P *X  0@@ 4/ @0U  p0p PX  P*  0@ 4/ [ P?*i Wp 8 < { \ӲyTUD  P 4  0p 907/ @   Q"( A;  h* C ;.+ Q+ ) )@;  A+PJ@ P * p807/ P@T[Ⱋ8*U:ķd ap 笧   P p@ | 04/ `F@V  p0 P*̞ \ $t Ӱk>. U  P  p607/ @  Q}t2y:@A+ 0;0r5F0+-+ Q+b ) )@;  A+cPJ@ P * p507/ P@T[Ⱋ9*U7:Xd ap @   P p@  04/ `F@V  p1 P* 1P   ߭Tt U  P H Dp4407/ @   Q A 0+ B 0W-+ Q+ ) )@;  A+PWJ@ P *8 4p$307/  @R+  P  p207/ @T  尻ⴋ8*X):hd PA` P  P P `p  07/ @D@T  `0 P*Q 㴋ⰻ;곬 SX1  P \ XpH107/ @   P: @+ m B +X lPߍ ۍ:"BPp x @ ܎ Џ l $D \< ؟ W ߝ$ cT gГ ` (d éؕ d çs=G $  O-M(`,@ P0F+P:J@ pQ pU `Ph Q p\Q Q .QQ pG0`,@Q W UQQ.Q  R.p Q*{p.@p .QQ& R * P005/ BwPL L0 0ЍQ pWpGꠘ DO-M`P@V:"pP D @020|!|1 0Zd?`!`1 0LQ*0p@P`qP  Q8q\JPqP    0PK` U "V PPP`|`PP |PP 0`F V``3 `Q ` X:Ѝ42D؇ r q q q A-P`HpUg 0 0਼VX 0V@P`. Q p`0V7@0@3&b`7@`` V0@3```@V@ õ0p/oo/Jo///,qO-TM.L%)$Bc`$H P 0"  I J㢕  @Z :M F32 W0!P PP`` KP$g  A$`Q 2D0p2 @ Pe KP"pIX 2H02 @ PIKP@aAV 1M02 `@ P)KP @JP @ZWXV a`P10S02 @ P``"eP``PP  00P ppWJppppA EP QTЍ3Lo Dtl Dl Pl l Hm H-p@`ᙯPP(#U  E PE Aq 0 .S R:0pS\WR: S\R   . A-MMx`P$`@P J$PJ/oBPЍۍI3j @-Mr @ 0᠐PJP*Ѝ #+Ѝe3p@-RPPp@`PP  p@p@-RPPup@q`PP j p@0H-@PyP  0Hp@-Q P@J`P @pP > p@U0H-P @PP :Q QP h00H-PQ RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0螻00H-P @PP  D`P @00  f O-M-M`@pt@ PP P P P0 0 00 0 |@x@D`@P DQ:*T T T 3+T -T/@T 0T+ xQdP 0 ` Cp t0`p;` P t R h5>tsp xh0hw@0T @0H Q40, 8<00 Q ! 0B ``0 H R *Q! 00B0 pX R `PPU `R ` d@0X X' @ Q ` (p` I0X  ` PP0X  1`H Vp`(3*0H P+0X  ^P a P p0 aPp PPU   `P0P Ѐℰ (p(ppEWO@VR $```P+X -XP``0pH W 0X ``0^ `F0T㄰1pNWppDP0NP 0pE W q0PH0N UP:L$`DpLO^^pWDpDW$`i <V :VP p@ PQ U S/ !R a@ p0K\ IRk80TW (PV IH%PS@DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD =P$ @=PG0K\@pI8V/W WW&`Z` @@DX ` Z` ЍЍ@8w `Z`@ o% fW_ F$``4 R Z , R,[V<'P / ! a0+\ PUG MU4 P  V:_&B`PP `T@  a0+\ v, )pfP $/ ! 0K\ P 'U,   vWn'Rj `|/, ` ^P   a0K\  , 0 $ <P# `iy<@ P(PT$ P4` 0, @P ˟۟P4 | Pw q 4D2 00 -ݬ0P D0!   PhKPt pP P,lh p@@0(6 boO0PPS o`FO B S060000L@`C`$0@@0C X ``V`Q #P ҭP P֬tPPHQṮ@PD Pt@D Q P JQᣮ8 P{8DQ @ᗮ4` 0Pp4`D (PP  <0Qp^P e;I C X /GJ `O`A A5?55?pg N;K  KNN @ `   Q @,P |G@PR<B0k2@`pVPtP.  vPF ፨@T'B 0 0মYC 0 0P@F n + @Z 㖡QQbQQ*p@-@P@ <`%U   p@H8 p@-P@Pu`Pu` V P)&`Vp@-@PP6L L0 03ˠ `@:O+Pk(H-M ? r ЍG-MP`0彯P% @V 0 0   0 P pḯ 0 PᮯЍpЍ~OO:O-MMCp`PW@X0tBp#p3 0̭`Z Z PPPP\U XS/q. PP 0 <Ppఀ Y  .YQ  .Q P.PF :Y  :㍂P:YY   :Y.Y Y Ⰰ  P.P%`Q,P `\($ ᅡ!1q 0 p  lAQ@0!QMߍk% A\`@P s:\p XQ\j ` AXXab:   P! H`X `Xa@PXN:  ` X  H V}D5 NO94 2 % M% 2 K-M@`p4厮P P0 0@@ᖮЍЍK- Mp`PP`\!\1 0ཬHWV W /@W 0P 0S+ R)PP( p@P 0 0D@@ @[Q  Ѝ@ Ѝp P`pP P ^JJ " J" O-$MMܒ`[ "2 0Q PM Pip0t" pفP^ pPX ` 0p@㺹pY--  0`[XT P p@GP9p  PU R QBὭ"Xq`@Pp 0 DP `V *PEu$aP t  $Q$Ѝۍ#gክ @ᄭ QQ n T/ H-IIHGGA-HM<@PTD !1 0`PP"P  .0 P p``祟0 U  "Q   PU D QHЍ~#L, E_FF11\1EEO-,MP@Pu P(p `Pz  0p `Pf p  0 pPV   aP   @P1 PP ` @QLCMHH3@0 03N 0 0 ?O@0 ᛬`PP PPP P PPc` ]P` pT RQ,Ѝ4`P% ` ` P P P Z: cP8 J `}``P  R @*P@`  B `JR:BT @  @Hኞ@T*P@` F@(@ V Y @@ amPX:  H@Z` P rO*ClDL"_ K-MP@P<8!81 0Q `Q6 P( pᥫP" P  0p`9p   0P }ᠫX  `P`P`o `Ѝfቫ`? @@O-KMMXLp`Y@(4 0,0< 0னTUV ,< 0ࣩW[WP(nP H` XXe`zDp@PpP\P p0  LPJ@P @1/P L RDP4 D0HpP p᎝LPT0 p0`*Pp@TT$P R*<@@D ppfP0@J`D4@8PooLPPHP<@4 P$ L@1/LP `8 <@ P,HPp@P RLT+GoTe<@( P%,P8'0  PzJ@ 0p@'1/Pj (LPXP `V*L#0pHP<@D PWA DWlWWfP 0% xg P @P FL`@ `֜P2@'@pG͜P.`P+' P]TL0pHP<@( ,P8'0  `P J@ 0p'rP (P'♜P@ GT']PL( @LGHPP0@DO`L0`% @ ( L0p P/W ,P,P,p 4@0pP@P@$ Q*RX*,@$   LHP@wL0pHP( J WTHP0P0p `% L( 88G, @PEJ` #P= ,(LPW4P7  Q : `  P A`L ",L HP<@ZDTB8R?*0` @G p@@D`PZ3, L T``ƛP@L( 44L0pHP( WSPL pC@L4 PLL04P `$dPV:4QSDQP4 Pp b00pS QhAlQPT  V Q S PRQ& 4Q#P@4Q Q0 p `Pڲ@0pG`0CPW@ P P0 `TUP `1PO@ JTJ\\ `   @i F @JQ* A@   `ᱠp$ 00@PBJ@ Q*a``(P KߍۍP0厠.ᴧ$ ">))=((h$   o#8T ;  O-MPp@P8^4%45 0Wp W (Q`P  ` `_\P ` _P P P ` P P`@@\P @ @oᠢ@P ᙣP Q : P  A  ` `ZNTY ` P%H`Q* P  @`\[P ` `!P#XN#`P  R:0 BpC0R*E A< ߍB@Xp` `pP R?f APJ@XPp᫙`Z*PP EKU@ X@JPqᒙ`Z: 7JAP@[ PP ` 12_jH-MP@P  0 0-`PppWP' pp K0 U   Q  hP U ЍЍ,-,$ %p@-M@P`,0)(0 Ѝp(@-M@ 9  ЍH-M@PpnP P0`L0 @tЍЍx0H-M@@Ttl@@T `PPP @D  9GЍ0Ѝ00V VVO-M@P`P U T P P Ѝl6h!h1 0fUPaL!L1 0\T4b0!01 0R   Q `pO pp P  D `QI[ Y xMt t0 0 Y\NX X0 0Ѝ)*)*() *()wu',) ')O-$M$T@QP  Y T Ti P $ЍOI#3 0YJ#3 0֣TXO YW `Pp V @ :V:P\CPX@ p  oP  hP  WB@p `V1:VcW P pPlp p P ^"/p[HD"D2 0zY,("(2 0pW @pT?QpP: @ P+ T: DQ(Q:  0 pSpDS=  pBA 0W0@ GQ .V@T@QpP pTp ` @QP P$ЍOPpPPpP 3PpPpP 0p`C0`V p5W1:PPpD`0*g0S G*BQ |(( T((&.'t&'49(B(l D  T | A-MPP: XB @ `Ѝ  00T @ xP `9T pP 0D P p@qp` 0D P:.TQ*p@p`Ѝm 0 0Xn 0 0T @ A Q  ` V3VX  0ЍX##0#o# O-|MV`@QPx V$ T, TaYg Vo 0pX&: wPTPR*: WtH%5 05VI%5 0+TY%5 0V`%5 0P 0 @ @@Pp`0SwpQ 0 0P o0Rꍣ/ꊣ`!h$4 0Vi$4 0ءQ P Q s `pooPpbp0Ps0$ R q `pooPpæbpPq  (0S 0r `pooPpæbp Pr00 ,Q s `pooPpæbp0Ps00 R q `pooPpæbpPq  40 S r p0oP0çr0 Ppro0Pr00Pr S  UrpJP.` Y:ZC y Z ZZ @TX*Z:YW W P,P4P P 1@F! vP9P7P 0 pD!: vP% FP"*:TVPy [P*:Q* JAP `J 7VPPli`tPPxP|ЍX K""`#"W"  >! !"!I"!" , O-MpP@PG%5 0P.+(Y$ `V$ V, VTG + 09/p ! 0XQ <X5w1P`PpPPpPTP^PpwP`pPPᓑ Y  ̡P &P   PL U PP  Z   09/ p 0 0P@%0pp,RP <X8 0< BS0 @X0 pP ) U& 0 U  EPA0u0 !1 0டPP @P ? ]La? 9/p 0 P @ P "U ? &PP'*8P ㅒPЍ 0`9/p 0P @ P 0 P $e@p XT T0 0A@PPDvX -O-MP@pPh#3 0U `᭑p@Z xX]pZ@[V Zl T Pb PXYX H QX 0S H R6V  AR:0S BR* X P* RV 0@S : pW0C S*@ oᠢp @ rPZ  u@pppZ㣑@> @V[; sP6 p @ W)  0WPpp_oWWRUPU U@@ U@U @ U UQpPPp W }@@P@ ЍVЍp@-`@PP T 0 0GFkp 0ap|6x x0 0T`7\ \0 0``@ TPp1  H-M  2/Ѝ/p@-M@PP T 0 0`P" P P 2/`\X X0 0ȝT 2/P `ЍpC%dp@-M@PP T 0 0࡝`P" P P 2/`\X X0 0T 2/P `ЍpW%d0H-@PP T P P P0 d` `0 0WTHD D0 0M0 0H/<a0H-@PP T P P P0 d` `0 0$THD D0 00 0H/pHp@-M@PP T 0 0`P" P P 2/`\X X0 0T 2/P `Ѝph[up@-M@PP T& 0 0ໜ`P" P P 2/`\%X X0 0࢜T 2/P `Ѝph  hsp@-M@PP TF 0 0{`P" P P 2/`\EX X0 0bT 2/P `Ѝph %    p@-M@PP Te 0 0;`P" P P 2/`\YX X0 0"T 2/P `Ѝph 0    p@-M@PP T 0 0`P" P P 2/`\aX X0 0T 2/P `Ѝph I    p@-M@PP Ti 0 0໛`P" P P 2/`\X X0 0࢛T 2/P `Ѝph V    p@-M@PP$ Tq 0 0{`U 0 0pP P P 2/P ``\ \0 0XT` 2/P `ЍpЍp@O e p@-M@PP$ T 0 0-`U 0 0"P P P 2/P ``\ \0 0 T` 2/P `ЍpЍp!-hp@-M@PP T 0 0ߚ`P& P P!Q 2/`d` `0 0ĚT 2/P P`Ѝp\ p@-M@PP T  0 0`P" P P 2/`\X X0 0T 2/P `Ѝp L{NA-`p@P* 0 0]V4 W# 0 0PPPeP P# P  03/P U t0  03/P U < 0 A/Ty YU,K-M`@PP T! V) U/ V7 P= PD P~ 2/Pw 8^!1 0T_!1 0V&!1 0ݙ!1 0ԙVpl!l1 0ʙ 2/P; p` WP5"P P P.W$ X` P  6V QP`4```X , ``XX`Ѝ|T0U_fr10H-@PP T  ;0HFD@ @0 0ZT($ $0 0PHm  H-M`@pPP" W* T2 V: UB W !1 0/P@ PG P\ 2/PU ;PL!L1 0W40!01 0 T!1 0V 0 0U 0 0W 2/P  R Q  R 0S R 2/ЍЍ8]^s6WHG-MPP Z' @T `TY_ ь`pT) T TO` 2/oP KP/L!L1 0Z40!01 0} 2/P* `P-V+@T T! T$! pY@@P p  pTPW  ppp pЍ,,Bp! Ns0H-@PP T (#0HnD?@ @0 0T( $ $0 0T y,xH-MP@P# U!1 0`P5 P P P p07/P  2/`W 0 0ڗU` p 2/`P  2/P`ЍHmH-MP@P# U!1 0੗`P5 P P P p07/P  2/`{ 0 0U` p 2/`P  2/P`Ѝ!Xc0H-@PP T 0HND@ @0 0ST($ $0 0I,Q0H-@PP T 0H}D@ @0 0/T($ $0 0%toS0H-@PP T 0HD@ @0 0 T($ $0 0 10H-@PP T 0H5D@ @0 0T($ $0 0ݖ|Tl3@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / /0//0/O-MQ p\ Q* P0 @ P*.000@@P PAS0P1!0P*@P1AQY YcY !P*\ `x@pY: P PJ`EpUPGPP` ! ~S p@"0D:SG`10S\*@AQD!0D^S:0SO*)0d`cͰ lX #V#6Fnea\`D0~Pv` e@@e`P3*@ P|`  -P$J`p $PJ@p \ pQ PR . P* @Ѝq(Ѝk i 0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  SP sQp P HPQ ` @P Ed @ F!p W`` X*p@]iP LQxQp   (@QP2 U1*@0/R# ]R* PbS````  P0R| z ^x@T " @` Vh* Uf* 0pS P[  `N]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Qo(Ѝ RЍQ X* H Q@(@U@R jNA-R8P0U9  0 PU. U'*PP`@V VAU`PVQ!P`V*UPPE`Upw`VJ@@@@@`(C H-MPЍO-MRB:pR?* `V? 8@ G b P P @PAV'0PPQ!P0[0Z1*`   Q*?0 0P `T@@X`V괔(@ @ <00P0 B  t@AЍO-,M`S PY 0SPP  0S*p@WpAS@pTq!pp P SP@ P@(TYTpQX @QUAPT Pq!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$AK^AL 2P 2 \p R$ PR@PJ@p P-*@ ;(`W(p@pPP Q* H P(P}  ( upؓ XYϓ(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P ,pPP Pލ- < H-BMhp`@P 0p(p  0!QBߍ Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0SF(00S00H-Q 0S AQ:Q B)&(G-@pTWo᠂P` P0 P1*T`P yP@pTW(H-@QSP`p R fyPpGP`W@A-PA@T  ϒQQ*ƒ(Ap`PJPQ`@貒?@-Q 0SAQ:Q @(@㗒@ MH-M  ЍH Ѝ/@-M@ p TЍЍH-R0Sb 000S 0s 00 O-M`PP$? " 2 0ಐU @ E @"PFXЍpRP+W -W p0W xP `0W`U`0@ Qa@"Q#L*@`pQZQ"VeZUP@@D"p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PRߑ@pX QЍA@Q\hG-MpPW$ U, `@a$A AwO O | 0xdA`A\Aqpqep@!Qލ*HFD D0 0U,G( (0 0l 0hH0  MH-M 0 00ЍHЍ/MH-M00 0 ЍHЍ/ᐽ O-MS @!1 0ஏZ@YE@@`ЍpP0Q  kUAp/W P%p@ 7P@UT@p`*VJV:@V@3D    @2P @`@V P0dWH-`p@P 0PR0H-x@x@P ddFX4PP P P0!P E@0@ l_ hp@  0H-@Pᥐ 0HH-`p@ၐh dP`W  d8 0K| HL̺ 3dPG-CMr@PTp,a Ui @ PO  `0P!0D 20|" 00@P5`P Ar@P+ P4PD (", 07d P:,VP4 SP*  03/$P QYP@,PCލH~D!D1 0kU,(!(1 0a"$!  #P  !0P f!0` B` 0 0 pD@P ( R $2/xP Q D0 0VDD nFz \ 4$[ O-M@Ptp!p1 0`q`1 p0PR0PD 4Q0a0qP,`(p$ X0*P    p i b [ ЍO@y8`VCZxH-@P`\!\1 0LP P`@qp%P( ` PV: ` <P  pdP q0G0 PP Q `ApP V pdE'lX8O-TM`R  &#3 0xX+ Y3 pPX pP3 HpX,puLQ2 @T PQ$$$ ( ^T&a"2 0Yb"2 0܌pQ t"$0p $( 05d\ 0LH" PM ZR P@p@ [J VAQ@@0! PQ 0 400P  (P QHH0S | 3/@x Q@Z@!tpP $Q(( AWpTЍ6Z+2 W  V V 40U XLHH@T ̮ DT $T O-Md\ p D@ D 420S$Pq QPP! ``V*AT pW W P xuP pU k\pXppHDQPP `4p`W*V RP  R  2/P kU > @@ 匤tQ 0 0AtKlЍxS \ R \8ȭ Q <<0 P Q  0H-P@彈P00H0H-@PP T   0 0SP@Q0rsA0DA@ @0 04T(B$ $0 0*ˑD @-@8P P 0/d@0H-LP@T0  0 3/P VH-ph`@P PT@ A  P` K-@pPPF 0 0Ɋ U W G 0 0༊Y W T&9/P pGPP`Vp@H< <0 0W])]mp@-@`PR,( (0 0 p@p@-@P`R,( (0 0n p@hp@-@P`P 0 0XT   B0S0S A#qP LL  @@DP@(p\nHT O-MPtll\qpW9 PL@  `U P P#Q P  1/1/Y Pp `PW:#W*`@@pW@xxp A D`PT PjU@Ѝhh(d|p`0H-@P 0 0ఉ  B0S0S A#qtP HPD  P4P(0ptp4H-|pPpX@|`P`u`pPu` V XXPN`{| P  `0Q`0pp0Qp \ X0X /X1h MH-M   X^ЍH Ѝ/ MH-M00 0 X]mЍHЍ/ᜣ O-M@`S=!1 0p!!WVP Yi ZQ!1 0{P pU$.Q T @J 3P[p IᨅpC{0W  ᨂpGPP  ᚂ@q ʀ| |0 0ೈ@{p{InpЍx.+$.q,MH-M  0 E^ЍHЍ/MH-M 0 00lЍHЍ/H-M@PP> 0 0qpP- `qwP) @!PJPppp  h00`\Xpp@ p$0(,   0}pЍ<mo< ( H 0H-@P<;8 80 0'zP5{U0\;p@-@PQ<!1 00QQ yP p @QnqQp 00 B Pu`Q  VVqQpp׏H-A-RM(P@〈D@, ` ( L 0 P ` B` '᪽H-lH- RC/A 0\R#R! R/p@-`@Pt?p p0 0xPV P PVPA`P  @p!UH-MɻЍ@-MP @@P:@ @@@@ ʻЍ0H-MP@P\;X X0 0- 0 Pf;pЍ06k"0H-@ 00: P:P|P P! ؀|@0000 0S P/!C/H-P@Qb||@P `Q P QpAGxGV f1 O-M-MP`d0@pz  t p l h`Y NR:*^ ^ ^ !+^ -^@@x^ 0^ xRQd xl00Ph@xh@xI@x0^ 0 H 0 C R`\@TP X ! 0B 0x000 C R *X! 0PBP  @XSD R p`@@T `R0  x 00S S B0 x 0X pP@LpK0S p0pxpp0p0S p1 CL R@P2*0 C R*0S @ \` p1 V P 1V VpW` ` p `pVPV Ёx0P@Lp pPppEQPPP x0`+Sf -Sg`bhPr X0h\ 0 P 0P0a0^ hx0Zh@ P@@X T P a@ p0kP 0kPLG`P05Q ph pQ[ [[V`{ 50DV h0 p AX6PP px00C Q0Se0x0 0R C_pxPPPH0^`? T: IC%P7llx P x@xx PpxTx\@BPd p  04PEpG 1BpQxh@0pB@@`0D Q`x`0 0C0pB Q@:`F0P{ p&@ h p%`[h`!K a `pp  p0d 0P T`\@Bh@0S)   a p#W /#C HSDt0Ctp P t`1VW0A@p/ps0c    p#W /#C HS`|0Ctp P t`1VW0A@pKt`0# tVPpAY 0RN   a `0OR F~h@Q@~QpgPcxP Xpd0x (Px qXT\@KxT\@t`0# tVPpA 0R   a  ||Pl | `@ | pAW6 |@ | XpB`00VpT`\@l0F"XdWO HP> lPC@@`V pBW>lw{PlG D IpD h 08@@)y{k Y. DP ``,($@˰ ۶7l R0 @"[l xTR Jl>yЍЍ`W L0y .yh,y *y$@x P  ! |lxP lP PB PUAU9E P49aQ `pY "@@U!@ 0"@PP!@ br eP X!@@@ Q @Q pq}"P@s K-`p@ R 9C P0Q qP*  YppA PI`V0 A qP PUpGpHY pY @D` 0 @qP @Tp`0H--M@P t  t ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A0PP@Q@@ P :Q```F `F`PU PPR*  T:  @ Q`Ap bpW CU P(PࠁNy{0S " R10\  R/ R /@9+-A357A4013Aa 00A /A-`V 0K@R!0 R1*@Q c@`@6`V: `0S00CC X* 0# 0Q0!p1S`0F`C&11T&11210Q1:(`Q1!ppW a DX 0R: SA@-MQ @ R @P:@ Ap@ЍH-M@Pp U {@G(E$!$1 0zP3 ` @㌮P3JpQ Q& p%   PhP @`  lhP`  \00@ 0$( ,@b{_{OЍ,^0Lf 8e f \e ㉯0H-@Pl=h h0 0yAlP@PPl08CV@-@PHID D0 0yP@@vUp@-`PP0>,!,1 0iyaP rP wP9,/ < 0e@CT0APx5 S +S4 ; pzpHy~p@-@P8!1 0yP3 k P0 QQ bP Q 1/pPӼ 0P @ P 00`aak`O` pxz p?qS@-@P`;\ \0 0x0Q QA PR0H-@PJ!1 0xPbP%Pi PP+}&!$P  5/PP0 @ P0:?Ra _ @-@P8;4 40 04x P@a8toPH-M1?A yЍ0\ \ \6@@ EЍ6@@ 3Ѝ6@@  Ѝ  //O-OMPyYPwpBPP @[Q    ᮭP jyPfyPay[ 0  p x|Z : `,DpP (8 4 E]x[  vP P : `X P 1 Q P4P PQ Q$Q4@:tP3  P!0! P$P 0 @, !P2#(0<  R5PX Q [0$4$ P P"Ÿr b 2p `0P @XA/QX ᔫ123P7` 5 602 p37 $1$(1(,1,010414818<1<@1@ D03?D0 @Q0?7@6A5B4C;D:E9F8G?H>I=@ J<` KC0P ``  LB 0P` 0 `P  MA` `0 0PP   N@`0`0 PP$ E O!0"`#&P`Fppp DPE@G``G`@Pp0`@Q0`A/ p APP`P@U 8Q 0,`ΠP ލ:uO7u,ލ7O-MP@ ! `2/,V( o0Q 0b Py  @ᰀX]:@ `YTZ :FW P*Z 0 pPy@[P1   0!P @ `㲀VoY ) Q] QA0 PP ;@ @P u R  Ѝ NP  ] P  >P (@Y TP ( B  ($ @$sO-Mp`@S [2`p PW , P  A P,  &sO@T p @Ѝ 2$p( q"e, ssPs  +P ` +P pPD ` Br !- ~H LI ,I H G F  "Q@Z:Db@!@1 0f% Aq R* q{@ K@00SOJacRa@HVMJH\ /0@S000A@ "P "p pPpPp Ѝ#KWK]KJ;JAJp@-@PQ !P    h"Q `!P    Y"ppp@-M@PL5H H0 0jf 0PЍHHO-MM`p@PV?"2 0EfTUP WJGO PJ Pg? F @Y:@/5;P g@P ЍۍB @XP>$IY*;F  @qYFG    U -pp JT$ pDxgP P p尀? VP P0PpP⢛P! POg /P HX倛/P   P 7g{y1g@oᠲs$ kHH GFL @-R@QPTPT_H-XMppT'PP@ ` A  a@ *` @*@@4 < U TPXЍ}෿ h H-MAq@pAQ BPP< Ua Pb PЍZᕿAP'P PPp @ @ A5P U0PR`A?qRD   ! P;ѿP5AgP aP 0 p  PšpᷚPֿU= P 5e@  D ( O-M-xMs@ Qpt kP `P` A  a *` @*@z^@ v  UJ`PP p` ϊ0 a@ *` @*@ ` *a @*@Q  Vw HϊpGZ `D?&S$Uu!1 0]dYv!1 0Sd? P w!1 0FdZ*Z @V*%T^P!P1 06d @` K `^@V:@Pe``  :T`@`d`P@@p:Y @` + ]  @  tpptPxЍ Ѝ)c  KAAA#AzAA@FAxA@A]A O-M-XMԠ@ Td@<A}P. p 0Q  A  @`P    4  0!@XዬTP@` @~ Ѝ+G+M+K-`pP@@U:!1 0^QuQ P@U:b!1 0^ p 0 R0 U:,b(!(1 0^@!pPpB W:b 0 0^ p 0 R0 W:b| |0 0q^    K<,e,j,())?)s)y)(S(Y({(((A-P` @0@p00 P& P@p  A q  M {P!    1  CppM    _O-$MH`@@ T :$4 0] P@U:b$4 0]  t|p` w|Pv*Lz^@0^{ 0 Ri* Rf ^  @p 3M pPU:#3 0] {QT PC     BR0!@d000000000000` ! 0 @` ! 0P @0@ !``@ !  @pJ@zP :\X"X2 07] H`0 ( QwP"!p R*@z^PP@w`|p VM*p@ w00@pL`@ppv P- uV pP@P7@Pp      Wtp p0 0\u Q$Ѝ]d((%%%%$''$% &##$"!O-$M@PpQ `o` UJ EP*(EppP=$88PPS^p#p  0p p P !0! 0+ pP `UU U UP U, P{ ($gP @`p   xPP p@W:b 0\ ^ p@W:b 0\@  ZP:<b 0[, ?pP صԅP @`@V:b 0[  u! 0`a` 㴐0 PPtprP]p pgUU UZ(Z@Y:b$4 0[xQEU,`\\ PuQQ U E U P0 `PU@Z:b 0g[PP@U:b#3 0Y[pPq(PW @⼁`(`pW%Q`P ը (r =Q(`   p!@ $Ѝ 0pu 0 PP1001   W`P  Q`U-,`QUE E  ;P `UP @4 ` PU$  "`Py PU  Pt `P@U: b!1 0Z㥀[pbp㼰开  !q0P0P0 c P> `P@U: b 0wZ7=?AW p@-@`PP  (aP(pO- Mp @PP} `PE  cp@Q  @崀X  QO R   oPQ p@W:XbT!T1 0Z@   P( 崀@@T:b 0 0YX @T  P5P! P Q  ᴀ@ ЍQ o7=O-MPp, @Py ` n{ 0 @㴰1001  e  `P[ `@@T:b$4 0uY @tᠰ ἰ} P P@D@T y[I  (/ @@T:PbL$L4 0GYyQQ @P  AG Q0  뼐 @ЍQ wP @@T:`b\#\3 0Y  Q9   @  弱 [s 2! DP `p[@@@T:b"2 0XpP/ @弱0@[/ @  q Wu  2! Pp `WP6 q@W5 [@0T1崠 pDz! @ᴰ@f PV `W pG1 U@P@T 01崐 ( ؠ @Tpq洐 y p4 P `@Y:XbT 0 FX @/ciw=o0H-M P,@( @ @Ѝ000/ P LP(  *aJa BH JA $8 BX *@ B @/O-0M p0$` P (,pp `PD@$,  @$0@  $iA`F$iK$Pq (e+@!@ 0S (p  @,@0(Pp@pAq@$ ' sdy'A'pp@eC!E$L$   (`0Q @ $@ @) @ p$cAF$ cK$ @ ` pP@0 ` 0Ѝ@O-MRV `@Q @Pa(UA 1Q(F`@D @T,:(P@0p *g `0J` j` j@ @ *@J@+@@D` ?Tp@T :@p@@D ?TpT ( PЍH- M- `@PE РP  Q (p7Q7a(WP\X(I @9 @) @?Q ?!(WP 4 @ @0 GD(@(P ( P2/ PPd @@ @0 @ @` D FP LP(  *aJa BH JA $8 BX *@ B @/ H-'H- P# PP  Bp  B 0 B  B  B0 *c  B  B ϊa0JcJA jb@ AjA`*@ B @/ O-MhX P< `T 8 H4L0@D(< P40(\  $ `L,0|0 00@@\P@TXp@Pl ` 8$pxp,PP t `p Pph @ @堐` 吰l 9)7+g i @ @ ')) #;4 "+9 70&kd0#`0 ` p`0t` d@` @ ` `0b  t%n0! 0#?'10&l@(c0#`@'.`$O%A" "LC "t@ ` 0|0|x 0xZ@t@@@tdd `hl @ ppp堐0xP!p0||@地P#t_b@p%"T\#'P$,0 %P@@1@pPA琰A&pN) "Ay#3%#"Nv=P@P@'p0$Q0t@P+7 P I)GP w)y 9p$KDp'+I G0#KDt0# @ d  0@p @ p0@ @0 0 0xPB| (NhpP%Pp %_&Q p"P$LCp% @&^p'OR(A@%\S@$P@ p@pሠ@@@P0x@P^PP|PP[ @PL@ ? PU  `pPO- M@ AhP- Dp@ X PP1  >W   X X  `APp  ЍA- @p i P  Pa`FW W P PpGW G-xMr@ᤂRpptPm8PPm`4Q 壖PP8a P 8 @ ` @0 0 @@ @P A A`04P PF U㪪J 8> 8 @ P:4P1P P)8P5 L10"` 04 4PB  P80 0Pp80``V08800`XP40R:PPtPxЍO@8O@8 ,PP8 ` 0P PO@8O@8P8@_ d H@/O-M0 , $ 4Q 8Q  PP QP 8P XPP y @ (P` @0 @@ @| B4 BXB(@ŕ`  0/pO P(pT*z@ 7 J` 0!C`W48:\\  0P@T( (0S`P\h`WE:^?  Z5*Y3* 0S@"8@PpU(p(PUS4p04p0P0P88PW pPPP @p`PW: Z: Z: Z * L 8800S P`Y* PNB}`@PU048`@ X@A7P.QBXc/iy[P  >"P `J V  0B  |!P*N@$@ {G`NPP p$ pP ! R PP3P@@3P8`V( p 8`V 4@T U P @ 7JP @T``nXPX@c/ c/ pX@X c/U Pc/ `Z( X sbpX 0RPU @U p X@P*N@Pߍ X @ pP T (!JF4b@V P p0BPTT y@`,P ` P+F@P@8@ yPM0BPT$T& yh@!0BPT%T? y0BPT*T, yT@'0BPT)T+ I@& yxP M"~ y0BPTT y/@ y^PMf TPM?\ yJ@PUꔶ \ \ [ [ tZ X F B-~x` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/A-M Q$ 0S) @0A   Q `rPV*`V@@T Pr`U*PU"Pߍ 2RߍA O-TMP`pPYVUllh/h? 0I V ofY@&H`%)<#"mqr0Q#1'p0#2r pPnq3Rnq P V: PD P@!gQ VQH@, 0 & V4* P `@\oIHP% V&: P+x V,:E)@P"d cspgG'v2br r#18?Oc0Q ?H@ 0 V*P `@\/ H@, 0  Vp*Pl `@\ B/H@Q 0@ P ,0  VO*PK `@\H@, 0  V7*P3 `@\H@, 0 r V*P `@\PH@AIIP(@!, 0 O V*P `@\H@ `P IIP@!, 0 , V*P `@\w$RE)PP"d cspgW'v2brpwY1(/Oc QTdp=H@ 0V$*P  `@Q` PJA @p Po P V*Q `R`Ap=P8 V8:u$ H@, 0  Vc*P_ `@\ H@D,  0 VJ*PF `@\H@,  (0 V0*P, `@\H@,  0m V*P `@\ B+H@Q 0@ P , 0K V*P `@\H@, 0 2 V*P `@\} V* 7 V* P$Q `\h$C  apH @0 D pX \0Y)2@  V*P `@\D V*  V> H@D9 P 0 V*P~ `@\# 0 W`kH@8  0 V^*PZ `@\$ HH0 1`HPP=)pEQ"d aq0cw#6aq r1OcPdꨈ PJH  `@p *` Jd @JG*@ p. JdP `*` @JG*@ I!  p P# /0$8 V*Q `\P d0p"sgb {tgYP#c  sqRdP d0p"sgb {tgY#brpwP@dp 5H@ 0V:*P6 `@Q`0 $ V*Q `\3$h V*Q `\%1x0OQR0d Br Vj*- Q 0` V 18 ?OQW dpGw V*- Q 0` V $ V=*Q9 `\18R?OdAP3QH@ aB0 v V *P `@\Qd@RQ PH@H3`B 0Y V*P `@\kW  PCdpG; w9ʠ V|*-Qv 0`Vq o {l |2Q 0 Q!00C -Bo R `V*02R,0 R `W`H@HR2/3 !Q1IP2aB%d   , <0 V*P `@\0hhw `81H@ W0 pgBp Vu*Pq `@\`0H@ W0 pgBp V]*PY `@\ `S `xP|ЍC{'l 'f@NVhs {3q G-M@p猗T`^>P P  0p pP `P FG>PC>T@>"PcЍq 0P  0p PpP `P F>P >T>"P+Ѝp Xo p @-0Sp& h@RT@ @0S\ = H-\ l60 R0\p=@-@@@ O-M|BPP@ J0 P`3P Ln9PЍ`PJT ؃@T@ P X,%A@T㸑!  TI PUG` lph00 S h,q`p-p0p@P R PUR& `V#\hR 2Upp pq00c00-0@S5 R `V  RTT Ѝ T@ x$H- %HFŨ@-$@@*%<@# 0H-P -@P  P P<@P0 A-@Q `P(  P P:P  _P PP `ph\FWJ/PpTPh Ph bPPPPUC@ D UPPVhpD@_@E +Pp`V ۪0 O-$MРP `pP @Z Q"  P R @Z 0p T !"p P xh&t2p0 S ( P $Z6 IZyP`pO 06 h !0 v Z@0Z0p00S  P  !!R;<SP ppqApZpppW RBRh @a P pplh&X (' P "ap 0MP .0"@0pZp S p  p1p$Ѝx$TX 0H-LP@PҔ<@$00, 0@Ĕ0p 9p@-L`P@`ᷔ8%$, 0@᪔p ͢8H-P@ppP 㨁`V`  oP x `X 0 P <h&800 S ( ̯D( lL@-@L  P4h600   0R0T 0(0ԮHH-P@AppP J`V`  P  t#l0h 0 g P Ph6L Lp p0W0T0(0( T̤ ȭȭA-`P@̀P pWp  P  Lpܓh 0 ! P Lh6H Hp p0W0T0(0 h8 ج|p@-@P  $౓``P 㺀P|UP l P T <44  0p@, Dȡp p@-@}"  R 0&m``P vPUP  =P | dO\X 0 S@DPCp \ 4|` 0 Q  rP H-PP@ "ppP +`xV` h P P t80, 0 H ةP4 `tO-M@PU8V pP 90 07 @7P `0P? 0 @7`P 0P0 R/JY( QN@8 P-@, $PN/8P(ppph0@@@0S0`Vb`` `V0pP@`g9P8PߍW\,07`$l& PR Sh@p@@7`8P  0Aop,l&2 0Q S h&,?o 2B(P p 0 0`J @7P 7 0= @7P 0`0PTPTP@`^ x[ T[ p@-0M@$ P a` F 0 $ 0 RJ 0 eJc0*e DJC*D0Ѝp0H-X \ @LA@RP pR0H-P@ݑPG!xP X8" Q `A B0U0pPUO ໑ Ṳ O-pXB`Q ЀA`FPR PphoXPQ @APE`\ `pXP\`U`pX@P\_`Q`+PQ@APE`\ `RPR pX@\OR `\P @QРA@DZB!% \ !$ R 0H-Pd@9XPL G@P  0vP@ %0 `Ŕ< O-\MHR@P@`$~P7 T@:Q@/P# l*E?PO  E `noB @& .; P PP/Q.QQ/Q@lP*7*@jp & @j+Ppʞ7j@jP J PuXt0`h hp<- 3,$HX2&p" PsXX*X)`Xd%@XX`+PXT!QX`0p'`840XpĆX0BXp0t#pX Xp!ԡr X0X(0p0@z`$ p$!8 !0r 84p0pDAV 1P\,`J0`\QJ}QUJ1UTJT80S|JSzD@0@4@@p4#@0;#00,@Wl@KOoB  $@ HH2 0@@ Z,HPc [k:_D R RQ8 R RMQ PLi PT 0 PqT@ P0 0T= @P[0t@ pP8`PtP40?`P8pPtPA4P0PPhd `V8htH p4P'<L0p@U@ @Eqp`Z` `XpPPPT0PX0`\ D@VT  R P 6D@(0` XR02R T 0SS0R8p00 R W 0SS05Ⴡ \ЍXX@V Q PA PP  P   Q5PhPXD pLHpW'Lp[`"T h@ `0P `[ `H'1XhUDT`PZX xT  YP`.I 0p0pW0@PX &  P\ BPX(Pp8 `І X0Pu0p@@ @0pP000` V& X1PP@p2T@D0CU 20P'O0'PJYP0P}YPTpXPW h  pW `0"0 BP  R"0S  Rh&- 0 @Q l&20S \60QrAWP 2S P<O-|MpPQ <Q ` RY >R `0 A R+A"Q#:Q`@PF@Qx6P AW !P HhD   "l, `  p1P pHD x㰡Rp"X8h0@Q@@ <Q/  R >R3 @x`张张  0hp%,@Zt P , m0 A R+A"Q#:Q<@<J@QZ80Q ,Q;QKxAt \0 RP) ;P,PA`$04P: ,Q7LP2 P/x@84 t0dc 0> ?O@pd@EW.Aox% /O,,Q JHpQD@N T@8@P )@L!(<2@a!Ra  @P3 8/+0+QJjHPDaT0@ ` (0, L, ,P ),@"L#(,"@c^ ' c @Q3# ! @ P࠱0 ^@,R>( 0GR08 O?+ @+QJHRD .(@P @(80( ?+ +P JHRD(0,0  ,(0<^@a88+ +QJp\n4S0ukHDiP$0l&0ppr@T 0St4 c4 P|Ѝx1haxPH(0@l40 @0Rh&aHP p RH A K 0˿ lp4p$0t k`8 34$0 ` A)@ LP$0ɡ WЅ؄@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s 11T@^ l @- MR JRQ@@00 C Rj n! 0 B Rj00@C T:Ra@R 00 C RY ! 0 B RV00@C T:RM @ .RS00 C R? ! 0 BR@00@C T:R7 @ P.R=00 C R) ! 0 BR+00@C T:0 B@ R* 00 C R n! 0 B R00@C T:r  /R@1>19161T ,@ K-P8 )|5@rL7#(lb@cqW w c2p@S30S Sr10@x\U@QEjd0UnJ @Vr`: :BSp?01D@COR@_gf0@pPcVp@CI?4I2ISCA?1CB@X@BY(1Pi02@ 1P0I`V0S@@\@-Ԁ`LPV:P[P;2Pp@JcpW*d d`V;0K0 p@ `rqP`V0# > q?Op@;P7&0^0QQQQ`{{O-MR`Xx0" Q A B@pT pQ0 T  P< 0 0@<倁@ 0*`.LHn౪lW@RG8?hgBh/ B  -) ,* -CR BབkCBx/ (( BSw?*f 0*p)` O0Pza`*."b@(97dd 0%.0`Q[/!@ `@ *),8"L\?H\_UO!Q8 5@!.+N 0#q"!? 0U(<2@0:.+NQ( %@!".  pCP  @  3(@PMSK@P@ᠯmP2 ʏpYPyd 0'.0@Q@Pyc p0 y O)@.0)@P[p{}P{c p0 { o)`.0)vl[ & &J/0 !!0@ [!iIIQ p@A!AP{d 0L(.0@ADT/TЍp{d 0'O3@D.0- pI>@HII%Q 咓cAs AB@  @C0p 0R00p Z *) 8L\?H#" # N Q @ ao"!/\O P( @  : NQ @  "2p C>! Q  @ 3l0 0W ` ` @ 1pG@W$`  @Ѝ(xsO-M`, $  ( P $00@S  YJ88H32 z?8 8HP206jCQJH2p z+88HP20p"jWJ J"* *BP@!jTJ JQU%U%MP P@ lspzk.TЍE@P@[] CP ) 1B n@7( ㏂L@0@!Kj[ Pp%pe!Re" Rpp3VE>dPP"d0 ␨aoQ  /o" q[ K \>zlJ PjP<Y'*/! [ JZjPP( ) %@L (( @h!R  h"@R 3EP;I; Pfj(phA``/00b  P P圀Y@,$ 07/P |PxPt PpPl PhP 4 q 0!" (  P !0" $ Y @Y\P@іP8 q0@SQ/0 OS)CP&ʘ0@ p"/" RJ08@,$ 0(p407/P XQ \P LPHPD P{ PJ P0 8<,$ (p7/P 0  Ѝ,PV ,PQ\(P,TH@,D lR,Qh&ppGIW Q  0$ P8<,8h05/P |Px Pt PpPl PhP P8<,:@P< P{8Pw dJa*d J0 40JA*J0 iprp  0S S/P/O$(0c03?c00 R  0 0 3??oP//O-sM0`pQ  WP!1 0*[# v+@PA$Q QO+VO | 0p`FdQ`Q\QqpqaxaTpP XQT T0 0*v,T!Qsߍ( jAjJjTiiH-M0 0 Ѝ( MH- M 0 0   ЍHЍ/' H-MЍp@-P@`( 0@Mpt' O-MM@P`[ 0 U" 0Q~pP "P + l 3/? 0*U/? 0)8` PIPE Uㆀ/? 0)Qnpf,v(v>Oglvhvdv*>6x60k,08D Hvp& ffpPlJ1PllX@@| tQ垏c dH$,p<4dh0pX(Pplp@@D`UV%VT- lppW Jd BQP :[ P  P |/|? 0V)P➏0lpV EP۰@ `t P *`@0`@0D P:$Ttt @ZPf    l   X`dx    < |  ddxd   @  $@*T 0D Q `PP@0D Q:xh`Prxt ( @p ph`e[ P _]8@ `|}|Q QPMd D`@0@ Q#p!`0@ Q:+31/ @@@)ʌ'  ˌˌp$PQxt ( P p  Q PQ h d̆ h  h {kP@0 A R1P@0 A R: $QR xt ( `W p R PR h0h0 0h0P  p    P h p䯟P  h hl hR  @  P h Ph l0 h 05P hhl hl /aTX0 x0P p Q0TL h `^`C^D`V㐯`CP T h  0bpPW LXАP t$PX Id`<`J      @|  Pq hq `   ; ~ QL hL`1 XP @tP h M  i " e Q4 h4~p `\%P hP h `P hp  ,  B  > P h>Pp B`P AP A@ A0 A  A B A hT@ LPD@Q\E`{P+ h偡   0d`PL pY@<AqXP (tRPXA #TpP-hhPpX\NPE`T/ ` B&  0GP<  P rY@L 3 P+ Q-Aa P\` gcPfFQA110@000 B0$POB@@$ D``T\``P ghgg AR  P\V pRPn Wl@0pG R` @0Pa W^dgg80EQ$0Y AP\4 LD@E@j  P h@d  P  h @^  P hQ h倡Q h倡P h偡P h0@PpL d`D0@@X`0`SP h  ,eeZx ~0`ڀ^@`.Ppp A` @P @@ @0 @ @ @ A`80.pPyQ:pP!xʌp P`Q80."yp LhhPD@Q`P hOP h HP hR`P hP hP h p@ p5P h qp-zp>P @ @ p @0 @@ @P @` @p A A8ࠍx`pJ \lPE >Pp @ @0 @@ @P @` @p A A8ࠍxp' 'Po hoPp hpPq h qp0`WXp`p ^\ J` P `@\Z `Up&/? 0$hhLPD@M GR, 4x  -8% p-`p& p 4^^ R  @ P @ 00~ <T\ 0 ^ L dQ R R Rj  *2 !2 @!S`+  0H`R#H`S L 0dH p@ ' `T[H`RH`0Q l d Hp` T`H``@eZ-h\hLPD@ ` Y  RQl [ TJpK]W[ W?P00 ;:pP: QC pq P= \[ D T@X/  P :pP$ / ? 0"Q㞏 pG P t/? 0"Q➏P*    Q  :pQ P p P C/? 0"P➏P     0 Q :pQ^ Pg p Pa YY[_pWm W?P00 ::[M QV  PP XX D T@/  P :[/? 08"Q㞏  P !/? 0"P➏[ p|/|? 0 "Q➏ IRGR0?P00 W:[ Q  P P W D T@t/  P :[/? 0!Q㞏  ( P .0 ` Q4:`[ /? 0!P  L" \PQO`   0 S0刯 :[xt/t? 0 d lPvX<``L@@PT@T`Q@:pQ/? 0K!P p P~ T`0 %, `00 00%Q. S0娯 0`.:[/? 0!\`OPg  { 0P00` /? 0!Q➏ G e@\`@G/0  S 05:[/? 0 \Qr  > 0P00l r@ p Aၮ!q @WS`0Rw 0sqP@LH`` \L0<S` A   :[/? 0 QO   P  @ <FPQP'?R0000M:0`[/? 0j QO7  0P006 @F V` R :[/? 0A QO  P   00@PuPP@0`4S:[/? 0 Pr  rP|➏@< 0! ` J0 s% ` ``pT `0 R : 0@!p J00 ``0bP0`S 0TS V  0Z0L  g 0S ` ``p➏P @RR$>P00 C:pP.> 0Qc pP] 1 D T@0.  P :pP -= 0{Q㞏 pP /00㞏 c, S :[ -= 0IQG   P A A➏P`dP @@D0TST 꼰 H tKK? `\@D0@@ T0CdST`@@d @@RD0 d:pP +; 0Q pUP KK 㞏dL` `FV`VR 0`:pP@ <+<; 0Q p#P V`  LJJ 㞏d@PP*: R00 u:pP *: 0Q `; p\ P 㞏\ F V`  R :pP )9 0`Q㞏 pP   ꔭ  垏&``d\H0I\L0V``` `pDHHGtH0, Q %Q.0 :[(8 0P  tP q➏lD ث 㞏0s`cs'ڨ7R00H:[|x'x7 0PB  @P< tFtG D T@ R :[&6 0Q㞏  P  GLFF  E$Fs ➏ X<` @@ T @TQ:[LH&H6 0wP  P @E|E➏ JRPRȥ 5P00 F:[%5 0CQ1 HDD D T@<%  P :[ % 5 0!Q㞏  P CdD F( B W@W|$P 4:[M QV]LCCpD T$$@  P :[#3 0Q㞏  1P 9Q+ [ #3 0P  P O4BB#3 0Q  P垏Tp衟 X@JX |AAGpX@P [ "2 0tP  P lH pX@"pX@0 긥 TlX@pX@p@ pX@ؠ @TAp@㼠  lT i@lPlxP iPlߍۍUpX@@p@ @@ H l  <t= 6$7s( P77 =<>8 \>>'; <o:X;8 T99 :: 885,6{ D 8 X44#4\5 @ D223323k1 2oP H-`@Ppb 0@O-,MPPp(( @00 @pWP  %Pp R *` A 0`B0 @ R :$Pnp `BZVU AL L L L L L L L lL L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L hL L `0L 8 L L L @*P2 0 @ p R0 @ R:}`0A P2@!`0A P:$Q?V*:vi @@@ca [ YWU`0A P:!p`0A P:$QJV1:O$Q@V :  p00p (Vp^7*^ :  `00p (^ $QV :(  00po (Vp(^*^ :( `00pV (^ p(^*^ : @`00p8 ( ^*^ : @`00p$ ( !^     c^*^ : @`i00p (^*^ : @`V00p ( L : K \  ^*^ : @`700p (   , = ^b*^ : @`00p ( ^O*^ : @`00p ( ^<*^ : @`00p ( ^)*^ : @`00py ( ^*^ : @`00pd (^*^ : @`00pQ (  e ~  @ ^*^:^*^ : @`00p( ( ^*^ : @`y00p ( o^*^ : @`f00p ( \P^*^ : @`O00p ( E^*^*$^~*^ : @`400p ( *^k* ^: @` 00p (^A^R*^ : @`00p ( !^(^9*^*^1*^ : @`00p ( [^* ^*^*^: @`^*^*[*(@PTTX :``PI ``X:  00P0( !R0!hhhh0 P0pp00 0 P (@P(@e,Ѝ@H-R R RT 0p Sppa r A`PqQPBVS0U0 P0a0p , ,L"!1@00a$gF fFF PU:PR0^Ba/a`E0p`pf pSW Ua0`V0K-MP`pV`U @a@_Q Ѝ p@R@PP L@IeH@Ѝ g*g @*@F\`ЍO-MP Y p PE Q  P  G#3 0wYH#3 0mЍp`@+V`pV v,0 !# 3/P`FQЍVP1  AP`FP V`pV PBB QU*PA PU:bP 0   EPPP PVV*  P   nP _Q O Fr!#  ,03/PPN`FPH V Q `pV    @PV!PP1P@U   +P U  @A ,P 5/@PX P @ Ѝ9l{DKp@-P$ @ * `PU) P`AV ,0 3/PP`VDQ 1/`h@@q\Pqp `\ p`@` \p@-@PV 0 00PUpP`@V ,0 3/PP`VDQ p@/@ppk_p@-@`P/  RUP TPpQ@-R@yHG--@ VP  P(0,&/O0dL &  */O ( Q!UPUpp P `UGc P G `GWP  !G@Q@W"Ppu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P:  `%O-M-HM<Px `@0pP P> P@ P0p0Qq   JG R    @ P qWp0    HЍЍO.0p00W0H @D40 P *ʠ* Q0  L D @0OSA$  8AC@ 0+QA 0p1+A; q+ `+b p r a @  0C  AR00 `0BBD (q`a`pS$@Jp`Fc U@PU  BU@PR80, ` p 4X8\<`P<Q<`P<`C|P/ 4, [o Q Ѡ 8V \   !,H "\ = l0 "Q h( "2-  pQ0   `t   Q T-0  pS  +a Q:a  ZVQ@L ` @ Q +`q1 R %B1 B +PP$ ;P+  ;r p0a :Z0 (p$`yPD?aCoc?`(?+ pa @ (p@$` ; p@  b0  Q + ` ; p@ *0 P+;qc $.+QA;KraK#JP$ `@ Ka0 pa Za@a Z (p$`H ora ZPUPE0P 8@(p$`@P%J\#ʜ (p$` <pQ* A + ++`b+x@+;pc+NAB000@@+\ RJ " BQ D3$6PaQP P @ P@QJ ``1P8@ P 0TRT B@DPES Q"  P 0 P p00p, R[ [ r``P0 pP  P  Q P 0p,Q!4QX QI o  pQ `: `  `P:@0P @ <P8MT; ZZ FD3P0P @QP$  PPN [  PF  P**0P/(p$`Pp9Q^018E80 8U0PWPl pR0P PP' T` P[ HЍЍ,P,P0P@PJ (`?  (pP$`8pPP`@0pd0EP0PV 0  0P `FP  0P 8@8P    PY6P p! Y c P 0@P`  @ P~ p4PQ @P<@ 0@P `0F,[ @o <4PJ,P P PP,PeQ `[XE4   qP3 @  j0@Z Y'   ^P Y  0@` j @ } HPpP 48 Q0@ (pQ$`A 0P 0 K P18 04*(p$` PUPE0P z(p$`@3Q? [=P 0 ) P2/ 9Y 1*9Y(p9$`E'% 8 0@u9QS1 8 @P ?<P1EQ 9Y 1E p@E,@P h D | @ , H-M  0ЍP/0@ 0A0SB *Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0R/q Q/ R0/p@-@PP:L L0 0+XPV`P  pLH-MP`@pVU\PPP Q:RZP PpЍPTP@-@P< 0 0Py 0 P @0P k\0 $0 P    a3 O-Mhc@T`P|L#L3 0P DPJ p @Woᡒ  PLp(P{TPQxPMژ"p0@ PJPhPy FA/Q^ ppppp\pppppppphppppppppppppppppppppp\pppppppph'PUPA XuP! <8!81 0 pYP PTPp*   6  +PP P U C   PЍx  gL 0 p@-M`P@P& U. V6 P Cp*AP/o" . L Q (  QЍp | |0 0 Ud` `0 0 VHD D0 0v   ЍpǥvN4 p@-M@P1 0Pg0TahV `h0TP Ogh~h0UTXa 0UXX \\\Pth0gЍp 0H-@P 0g0TQUh0U TPP Mh0 TX!0XXPrg0 @-@LP0eg0XQXTOg0@Xg` 0H-@xP00PLgU 0\Q\`h0XQXTO{g00H5g RR:S S/*/*/H-@-0M4@@, P, Q0Ѝ΄됰 0H-@PP:P PQ;PP@0H-P`@Rp:ppP$P p@Q   R@U0 12 VO- MP QepB`  @  T@-P 0@` `0V00R@P @ `PA ` P @PQ@JP@P}P J0 `P` 0`PU0P0W Q @ PQ@J P Ѝ P /0H-@PQ09, ,0 0 ,D 0HAl   0S RP/O0?c0 3??oP/p@-M0`(04@0`,@ 08PpЍpT O- M`80p<@4P dK`!`1 0 DVDM@!@1 0 ' % PWP 0@p @Qp PQ T 8<X P"P VQWT 8 <0R P@   Ѝzz~zzXzp@-P`@PA 0 0/ P B 0 0$ V|Cx x0 0  P?PJ% 0%p/pJN1wyH-M@P`PT!1 0 P U 0 0 UV 0 0    0Pp d P /P ЍH?ЍwNK1#wxH-MP`@Pi 0 0  pP |jx x0 0  0Ppa 0s * Ѝ?  Ѝ4@-@P\{X X0 0h P <|8 80 0] P@>l2@H- a@`P d TQU  t RPU P d xtPtPEQLUPP $zd蜦 T M L l 0H-P @!P:0HWdPPQ T^dL0!S A0,0HQd ! A0D X̥ (@-  #"!rQo"(r^2"$^@\""0"!0S    O-M?Y a_ pA pp\0[ `QY `H8P `! \!P : W6!P: W`3Q% c0!S  cPPQ c`0!S  `ch! Ѝ$`! ܢ ` 0 D P31P"0"11P 31P 31PA/A /0H-@PPP@0O-M` @R@` [P4 P[ PA@ Z   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` L P@P &Pq r&apW!RPP  cqpW EP` pqpP b똡 猁PP$ fPG pT !P:VQ b1 0RA b  A@[ p`WP bpW3P pPP HPQP LbPЍ hP p 4 (  K-` rW WPl  V:RUP0`! fP@VPPS5Q:UP)p`V AA Q*pV` `F`FP`pPp0p2V1 :0!q1P fPU @^pS:YL! !P: QUlPPQ \bT0!S  4 b$! , @  0P/00 R @A P/3/G-P pR 0!p`VpA BQPJ   pp3WAPAP0 /0A P`p`pPpVpp PpW: p P*`@``PVP@0@P T0:@ @R p@- P`03P@P3H1T"D1"1T 3B1T 3A1TJ  R @b@P SP b 0A5 S>0 R N+b S 1@2@@pK-- |P kQ Q*Q&V  KL&a@R% 0_G"!0Zv@T0Oo&8RspWB#4WB\@#2p@#1#pW. @`T+r0S`?o"hBvpW2&dWP2U0&bp0&apW" 0 `T @` `@  0 @ 0d302$`R` `Q 3$A5d# 0 @`` Q20DpQ031Q""11Q2 31Q 31QJ ```C R/  R/)<@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A00Ȕ O-M`PpP?"2 0U E"P X Ѝ@P+T -T @0T xP `0T`U`0@ Qa@"Q#m*`@P?U  p 0*됶kU[ @pI" !@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" Sʐ @T "/P  P" Sڎ! @T "Q/@X QppЍA@Qꔬ(bA/ᰑ //x / /@  // //А //ᘐ //` / /(  / /  /@/ḏ @//ဏ / /H  //ᜎ //t / @/ /H-M 0ЍH-@P`p%4# W5#P0 0H-MP @/"%P?#/R?//" !PЍ0O-M(@Q [ Z" oo A R;:TZ+ T Z4 X? JJT :o9zwK!T[n ;o 9 8dT   ^ 0b*RooA! ^ p0)T   ?8ooAP*`!18.9~^ 0n#9~8.3@n pN!879'p@p /`P P ` _ Ro p?^@ა(Q Ѝ)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGOι@- 0@ Qp9l0 / 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO///Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0CS 0Q@-Q0@S Q^ Q0C@S@R SU/Q\/ R#%U#/!0Q0 /0H-Q@0S PUQ P0CPU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-Q@@S T 0C`PUQ P@DPUU PS T`PUPPpPQPp  ///H-pQ@P`T\X X0 0 W QLcs R US  R/ /p@-P`@Rd` `0 0Q U T  Qp< S#%U#/!R  Q 0///-R/p@-M`@P P`h @X @H @8 @( @ @ @|xA6A6;6=6PЍpZx  A-MMpRl@`hdP@`R P@SP Pp o4SNH-0 O-MM│`xpKlBPh@PPAPP AB+Q8 PPPPPRD@V: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/H-M   U3dQT  Q 1/T  ?3K4z @-0M@P @,D?P:XD" 1, 3PC0Ѝ@-0M@P D?Q B , :3"0  PC0Ѝ@-@4@4/x H-M00 004Ѝ`w MH-M 0 00ЍHЍ/P /v w H-@-D@@4@@p Rh@p//////( //O-4M@`QPPX`@sP!1 0s딑␱އq A ap@`P x @lPP: 0@PQ  0S0 0@ 0R:,`(P A Ald X    (4/4ЍH}|lIpX\88 /Z/[/O-M4pP`@Q T +; 0U v(` 0PUP %P T4 $ pxZP00000000x0l00000000000H0000000000x0000000(00000000004(000((800dH0X000h*XO 0H Q 0H Q: P Q 0A0@ Q:   y$$uyri$$m$@$i$$e$ $a$ $]$ $Y W$ $SlQ$P $I/F$   p, @ #p$X 0p(?$$n  c pl$9 $ 0fPp``R`bJ%P p@Wp$k  `  pp`T60&c0p(( p$0$_  T p `pu5x$`0pp i50$U  J `pS (@p%ppQ `-`C  `o p$E8ppV%5 0 @zp`$ @zp`  @z`$p r $0 RD W W% WL *"&"@&bR  0 1ᆮ!@aR$ 04 0Q0  Z:p  0! J0  Gc z `:  0apN R $0$0  p p$0s   $Y  R$0 P 0` T`F04V 0Q $0` T`4 T4  R Q T0` 5 4 RX T B`4R ARd T B`4R< W` T 4 4pW$ p X T@04P{ppp pp TK \X X0 0vSrTP Ѝr4t #]Ja`Joj 4j A-@P:| |0 0lPX P`ppGX`WڼP 4/P贸h K-@Q" QK QH 0 Q0B pW pBqW s`V`PUpW`W+ qW' `V$P 㹋P pP`V QPP R R R RQ O-MM  pP' @t P@IY  0CcQJ`PU(d%d XP  >P $QЍۍ&rf e O-MMPa@ PU`p Q RЍۍ r ' 2 ' 2, qpqpQ&`0HX& 0bPJ`PUcc   0 `qP`` ``e dd Td O-MMԏ@`Pxt  PP Pd`a @ Xp0ᕵ 0D Uh\d尰[m PbpPX` R 0RSR R!RKQ F!RA ㌊P; p* J.L/P0JP P  Q#Q Q QQ  QX ^P  P Zd܏Ph%dᴏh P!?` QP0QaRpW p g @ d`p  PDQ `U  dVXT `J @uf【 D  a @ DJ XKQ U  As`FU  kJd `T @ XἏh\QP\P,dJ(<$ l_P H L Qp @ Q Q 0lS!S 0"vD!<8p4qpl@x`W )Pt  07/PU qPE_PPd` l  40DPX4 0|o\ @DPS@ pP p8PsxP<`\tPPPPq `\ 0p P P``p tM0 / f\ 0pPD, PHPa8P e`J(V0`J ЀTt$4J  00`XT\P头PPdPpЀX 0TP pd 0d. |#DQ@ (A)/"|+P P u&Jh0 +P Ph`P\p% aL  _PX01 JP 0 !\h ,09P`aL  P_PHX0 aL x ^PX0 <X0hY Le! ,p `  +4PJ`  X0 P0jv對+@P  kPip` YL0 ``- (nZpf\`'LFNPL``8 P<`` ,IX0T  j-`< @{ &QߍۍkdO̜L S /KޞO N c$U R \N .ǟQ  M N 8Y -!Y Z ܪ`W Y jϨWwXPY ©[ ~,[ «W F4V V W V V d[ 1#4Q hX pO K-8MMp`P4@* X  3 4ppSP 3+oO `*`*@ A3HP30p <sj@4P8Ѝۍ1kJ IK / /@-@ J 0KCR  FeDL 0  p@-@ R P 0@R^`C `@^`F@BpP  QC/Rq/0H- M P@n(P Pz(p  ? Ѝ0 e D Ѝ0PPP Ѝ0 /0H- M P@I(P PU(p  ? Ѝ0 e D Ѝ0PPP Ѝ0bA \L/O-$MM@H Pp  x D 0h  0  P`PK D L ;`P8   ; `P(L  0y`p% D  !P$ p  \ P$Ѝۍ jP  !(?/  pP 0 h/#xs0?r wps0pxhPP`P`2tG LE E LE xE bO-4MMp0D`` [ R 0.RS  Q`Q@.AobP/ 4P@ X 0\ Pd(ppP# R(  0X\$  $PPp$ T @ @ p@V pY (`U DPO $ @H P .PP@X 0\ `P^=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(PX  \0 PU q [ ZP0P4ЍۍhpPPP Z Z<P0$ R D A @ @ A O- MMAp`@ s&P P Ѝۍh4P $ hP `d+0APQ1 P@Q$ `E+5P  @Q ER @ R` `PK L` `$wt@ ҒL@ ? K-AM @0Pp`  W 0  fW p p 0 PG P%ZP 0@.Ph p` p8 40 $QAލ#h> 4BO-TM`刀xp A  P x 0f@X YPPPPp W OQP/ WA WkYi ` I0PP PXP^JPxpYz`YWP|PJ A QG A0XP@J@ YYpYY P@!` I Q&x p pp~Yz{Y{YvuYPOV | (PpL   @ETЍ< ,A-P`@p p@ Q`)`AYXp;Y`Pi1YP-Y qE t?jA-p P@` f` A0Rp RQ$YX` P`EV:0=, ,0 0GvXE]9q~O-M-bM0P  X ]UH |6  \@ `@lVA lF5 @ p@@@^6P P@@ / *` *Eit@@@,i6B( Xd d  PQ `` J\ H@0_D`S0`@`P)*p WPq0 @0 pCWS `4@ @4pp eP v`+0?P , \8H` @P0($$+0>P #P;P  0P&  )PO  "Px | P | P P P, H)  P PX,p P'  P PX,p P  (( P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@P( 0 @  PhP  Y;Y yQJ@@ P @ | 08Px 1Pq4 l0 P0l4P P   おv㏊@H5 |40j1@ <0 PI X PA H_bP& 4 PA H _pP `D Q 0 Q Q0S0 Q 8PP:4] Q Q QB4N< ,R G1S (< R(P2(P<FP(P.(0P x|9dd  p |r@P|!p @  b @ @A"x!x#%|3v5 0uuup! P`P vdPv.P H4P1p `HpPP a .PpRW :P@.PPV*GWp DQ PH@P@bQP   &Qbލ Ѝc8 9 ~wz1͈41/ . ˆ2 0 1 0 L  ( K-䁙PJ `Q vP@PU*p AX xp C6!Tx|p 8P 80H-MA  4PTPP!Ѝ0萁p@-pM|``lQ `@U@@P  }l QpЍpc) (G-@PJspQ voPPU*p ^Y2 b  B QP #0S1S  b3 C O- M`@ܡ P DaP  $tP p  P P  bPr   bPs  bP  bP  bP  bP}  bP p bP X bP @ bP} ( bPy  bPu  bPq  bP~  bP P bP  zbP}.PdQj `fdd` `[ Q Q `MId `H;:    Z& PF ?P? ! EZ P2 ?P? ! E(PP P P  Ѝ*||,|yy{y|yz{7X{{~{O7_6{s "{# {zA-MDaP@`l#0h "$10!:p Q6xq, sVW qrxM0x#|T0%0P00HHL00\X` _xp 0 xTPT f DЍUT f DЍzz4xH-@PJPQvO`p`V*p q Q/v Q/5uH- \R p@P P Up@U1`S``VÁS 3 c L g L@-0@@P @u:0` q8 @-@P @d:`- @-@@Pso @-@Pio/ O-QMP@P|$4 0tpWlh$h4 0hXX_P P`20P ,  P$(`#X:zP(`U#Xt*P  P<Px \P PP `\P PX $$ P8 F P U:$`  E Z #P P `0 V:  F ZPHQx* Ru, (`PE P$$#X:ng @n @_nX` 0 WG:1pGWB:`GPpR;~ Qp`FPX V(: jPP FP `Y:  XIPP  5Qߍ(In 5 @Qߍ @4t(u9tu$= p@-M`@P 0 0@ P   ^P ` ;P xPnЍp Ѝpm Ѝp$php4L O-Mplxl hp @T \[ {ZO@@@0*t@hT TafHDP\h@@@@DD0l5T pU yU <`V(QJ 4Q Q' !R4 P PPk pA\[ @F{ZO5 #$%@2  Ao/o" VP`F`@DA4y V*P U*&0(PXpE  XPE%0 ;85,%!y|%Q ` P@48@Q DR\[ {ZOԄpʫt@Pp$\[ o3{ZO !34010SxtpaVhq\q X(:HP P'Q〰1Ȱ@ a1P PH@A z1P A \[ 㸳{ZO @@s吃pQ 'Q 7Rば1 |P. P'Qwp1&Ȱ C1Pz PDAa`:1Pq A \[ 0,r{ZO( p@@`^p 1PR @ E@ Q01PH Ap  TTqT pHA@P\[ {ZO P@,ЍP PgQ`1`Qp,P @@0P `A DpDpЍЍqtq|qpqiDiHilpn8oxkVK-Mp@P 0`opW# `Pl*LP00 -PPPPP`iP5 `P  Q N  -0iP P` Y C $ 0Yp P(  @cP P  dPRx|\ xCbPG \ @P!  !@V89& @  ㄗP   R @  W ! !2/p @lY `@Ѝ  * (0  p X 0H-@Q PȗP!00K-M@PQ `㱗`EPp$444hH4\pW[`K($p (?! !`2/p9 rP W! # `P- W+G gP P( ( 0$p`!@` Y !2/`P$pP`ЍA-M@`pQ P;PW `ЍpW W !` !2/`PG P p 0`!@` O- M@!R*&P4 r  W W( QbUap `V NapV "PP 0 PpU W 53 3 5 ЍO- M@ZF*ȁQ apowb W U Ql&P' H\apapowb PE WVH P   0 PV Z Ѝ Ѝ   ЍO- M!R*Z&P/ b R ["*V&*P !@0p@@p@W*Q0`P "  0N P [b Ѝ Ѝ   ЍG-MbV* BR P*pQ pTpG  0 P ` VЍ  ЍЍH-@P`Q ppV VP PP2@ P. ` 7oP"ѕU'(P $ @P ` oP"᱕U $@$ P K-P`p ដpm  @>Vp:|!|1 0P `FQ01P`@V:,b(!(1 0@@`V: 0 0uF" q R* q`K{@0 0SOJbcRa@HVMJE\ /0@S000A@ACI|IIGIHHHp@-`@Q P PPp   P UP  @ p_PPipPpO-,M@P`Q pݔp U,ЍOj P Q !P2/p  0P ,Ѝ !$#p(  $07/P0    " Pp  07/P p  07/P   Pp 07/P p$  0j p 0^P P H-MP@S  `QpE$P: q `V P! @ #r_s 0ÈQ Ѝ1Q$P ЍЍO-M`, {PG p  jpP4 <@@T:XbT!T1 0  @q00r@qP0U0 P @TQ[@ ! q [ [ r[P@qW kPp FЍ`[` 2! P W!000 ㍓qW#CG-pPP GR`  QE@AYt  @ttQ ڰ 0@T: 0 0o8 00B8E  00B00B Qʲ`0V0B0,AcAiAO-dMP 0` 0)iZ@Pr p 0iPi @  ( R p <:,`P `Y 4 A8(<4 7ⴠ X&*PDYzp G,@ <b0P 0F GpwY `@Pp`P ` BpPvU#3 0@F`  dЍ P  {0`@,`  000($ AQ7x RQ 0/P Bఀp@p@uTS"2 0E 0PrhP @Q@ Q]@0($ 0D@PH0 S DpW LP{ (0$pP!Q#*xQ:c 0R @qTrPAt p@ `P\Xpa0PQ:  Q$(kP8 P\T C(P Q:  Q$SP P\T +$P\T &(P\T !$Px0S* Q*@@@Q @=>>>(??A-p@ `PRl 0 0 PEuZ pPuRr 0 0 PEuEp`P@uT@z< <0 0EP:r;v;P:;4;9::O-MpPP% Q *QPO  R Q  0ꀠQ @ `Q< 0P NgPP/ pQ: Q pP PQ: 0  Ra  0kPq\ XWph | R 7ll!d1 0 @p pR !1 0 @p @ 0 @0T 0 00sF㴠 Q8 8 (4@pfpP ЍO`Ѝ769>978p87j88O-M4PP34 p `Q `$0@ D`32`A6r6S $^ `` @`F V^P僁 @@PY 8P P ` @KP 0, P@P Y  0!Y `$0?=2Qa0s `Qڿ` p`R pR  @?= 2q"! $p@h# P$ TDp aP T R @C Pe(7R 1 `D  B P\ WD1 ZP7p/-"1@P' t 0eP p  尠`  PᲐYHD!D1 0@᱀PIЍ@P(  E] !8DVT` !DAP @P`!`4t222G-MP @Ppx(Q`P` #"2 0Y P @  c`S <V d@< Z d@e ? a0"! 0Q#QSS p-`p0 P P O(,P `P ` V P1P $`Q   PQ/ @Ѝ ``P$5 0 00Q1X1.]/d/O-MM`pP  @TOzfpg PY6 88"m[ t Q    P2/ Y <WP ;d@#  PQ/ @ܰ Y< QU d@u ? a0"! 0Q#QSS  ,qQ O QЍ؍{J /x G-P P pJbA  A  ഌ8qK-MP$ Q @p@P$p7`A8PP$ P 0,PP p/-"1ЍKe{V 0 0*|++O-MPy ,p($b$4 0@`te#3 0@p@W:k#3 0YPu @@`@Yl wY  p@w"qp`pwAP@U:0y,#,3 0zpP  P Y)`ಐY  Q R@p P p@wpF PP B  App@W: " 2 0/`@p@W:!1 0TЍu`TU wPTPTPu@ `p@wqp`pwA@X:!1 0Ypᲀ   P  @`p@W: 0 0ЍЍ+3,<,++#,++)*+())'n))'((&(?(&K-@P`pVP& W Q" Qp  RpQ R  0P ]b`U Rp Q: 0P0  A P0?CAX : 0 0Q PVrᲀ !UU 8@8:&&P$O-Mp (P @p` V P P@P saP" 0aP p PEP @p` VU SaP ЍЍЍp@- @P0`Pa P 0SQ 0`V 0S `Q`! p pO-M(`P@Q  0Pa`PbQ 0PaPV 张`Ა# 0S 0[p0G ) R-$p q(9 ᱐0㲀R ἠbaP/  Hp 0,pp% P  pQ 0p?aP  (P$p q$pЍO-Mp` @PP @R'PP@P P> [+ (P  0PaP . P$ $ 0P`P   0PP@P P  Ⴞ Ѝp@-M`@ PpPЍpO- Mp` PP @0P0P Z @P. 0 0P% 0P`@P 0 0P P  @'@ ЍO-M@P 0 `p  @*/{;*/|8*/#5*/2*/)/*/=,*/)*/&*/"#*/ */*/*/*/////^*/ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/B */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/J*/G*/1/ B*/?*/I<*/9*/6*/3*/0*/-*/**/'*Q/"*/!*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/*/*/xGtps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrooteeJ}-r"3 GO$K&$P;  eexe,bl!} eee[ $"$"e@(e@s".eL _4e@i0":e,;" $Ee2 !Net'"Teae4V"ne0{e,fZ!ee e x"d_ " YF! fF! el el !Ю 3$ e B! e= %"Z 9"4 ̎!x ex ." e e !h eh u|ee( "b0$ "= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written `X/n/ o/so0!\0@@o0tA! 1o1@@o41ox1n1 #1 %o1+o2@@0$T232@@1o41unblock and -DNO_CONV?]@^^cc^,s]\]unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted onUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory ././@LongLinkFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.Link%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %spaxXXXXXXXXXX/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-p] directory ... B N dv`!`!ø׸EZ+A#K K_]^]F]<]>r?PATH=}-+?=###%%%} $##t^"͆f `dg`s| ͆ct`mm`l{r "tp"n`v lb    !"f" #*1tA!5:?DJ2z"οp"^K#EOF reading here (<<) document}-+?=0("п!ܿӿֿٿN&#"@">GMSY_fp@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'+0+1+1$+88+0L+0M`+0Tt+0[&+0dH T #  # ϔ!E!!L!!i!*o$ d""<$P$ D!0 :'$ ${ rF!jl!9$ 9# !P""!!0("                 e!\j0y$11<]&&Tn"%"l -&$s ? L$$bl!:5y=|"\nS$DJ! , @LR,̑"F#(Y'!pk!pk"kaDljl"L"mm"0&f(%c!dn#k\n4Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set:]not compiled with history supportCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguousCannot fork (%s)You have stopped jobs. && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c option";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefcinputrcgetoptsfdflagssetvarumaskunaliasulimitwordexpevalshiftPPIDNETBSD_SHELL20220122 SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] : file changed ( 4".2""(7A$L" =J" }k" ) $ pE:H" < ! U ,l=#"u"#@?!pq#0}{ #8 @y@'#3#3233#M \@cUj!pw~  %@-@ 5 @!) 1?C$>CDC$CC-M!K @VU^]discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:group   $   "ky n"%4@P@@@@@@@@@@ @@ @@@!'/4:AIOUZagnx@@#"*18@EJbjov}@E#U.5:AJR!' $59> FKQW]dkos"r!yn" }!! -^o"-2!Mq"4*X!55Z%",6^p6 #<"!=CtD=Rf L"!d=pq= $59> FKQW]dkos"r!yn" }!!   $   "ky n"%4@P $59> FKQW]dkos"r!yn" }!!   $   "ky n"%4@PMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfsflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] @OHQ#@Vi!V !0XX !Yk"![P\]%/^i unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:*   $ : [ n    5 ` |   [     F k       ! # $  & 1 2 3 4 5. 6 89 9? 9F :_ ;y < = @ A B C: Da Ew F G H J L M N O P Q  R S8 TA UI Va W{ \ a c d e f g. h. i. p5 q s t uK v wQ xe         ? _ {       2 I e }          ? G 8 T w           . ; M g w         # 8 U m       0 K f     "  - @ p       9 0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:" ,    $   "ky n"%4@PN"@"?ex"~"@"[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!returning to single-user after filesystem check pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/HEAD-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@> > > ? untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedgeometryPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-w * E L _ j  ʁ ԁ .$  ͅ X f y … ))4)L)d)|))))))))4)L)l)))n *   $ : [ n    5 ` |   [     F k       ! # $  & 1 2 3 4 5. 6 89 9? 9F :_ ;y < = @ A B C: Da Ew F G H J L M N O P Q  R S8 TA UI Va W{ \ a c d e f g. h. i. p5 q s t uK v wQ xe         ? _ {       2 I e }          ? G 8 T w           . ; M g w         # 8 U m       0 K f     "  - @ p       9    $   "ky n"%4@PSFH0eC  SFU0eC Hah!IdontNeedEFI  (s*K>;`" |nQn- q+# / |nQn- q+> H |nQn- q+U ^ |nQn- q+o z |nQn- q+ P=rGy=iG}䌐 ;Mt? mWC 3KOO Ð yD<#*=(ΐ ؐ 3Dh& \ M}-  @Mjy֬ 0 -чHkA -чHn"V ZIчH@"p IчHx" IчH 2IчH S'@ )Ѹ *1@ )Ѹ֑ 41x )Ѹۑ [-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]o:/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u 0 > M     ū ѫ ݫ  @     0' @0 9 > "^$C N T Z @'"" zi)$yiLLL8) D)!LL8) `) )m ) *L") )` D=8) d)i \=8)s h)z h)r =8)y =8)ճ G ճ C  " $'" ve"* )/ ve"* )ve" ve" )ȴ ȴ )Ǵ  ve"8)! !T) " ճ "`ӵ ۵ @ӵ ۵  "C UlU VlV VxW V|] V^_\`Hb l8) ) )  ) u!¸ ) L8)ɸ )ȸ ɸ hx8)  ) ly* 8)ψ" )θ H )Ը )Ӹ 8)") "x* 8)y"H )y h )R!к Ӻ ֺ ٺ   Dͽ ͽ H H  q"  %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI"  > ($      $ ? 3 @? P ^ u @ N"` ?ex"Ze ~" ` 0" ffsAadfo:rwt:uvOnly one -t option may be specified.from_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@realpath `%s'getargspuffs|%s on %s type %.*s: %s already mountedrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]asynchronousautomountednfs4aclsposix1eaclsextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount arguments%s,%sadosfilecorentfsudfefsnilfsUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node mount_puffsX b   "| "@"m ($ s  K J " @t {       bnorripbgensbextattbnojolietbnocasetransbrrcaseinsegG:jM:m:o:rU:getmntopts%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsusage: %s [-G gid] [-M mask] [-m mask] [-o options] [-U uid] special node unknown %s id: %sinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.X b   "| "@"m ($ s  K J "@""W 5! @,"@  mount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %sreloadusage: %s [-o options] special node X b   "| "@"m ($ s  K J V _ "@""W  ,"@5!d " @k  softdepX b   "| "@"m ($ s  K J  @kernfs on %susage: mount_kernfs [-o options] /kern mount_point X b   "| "@"m ($ s  K J "@"" @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorGsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath X b   "| "@"m ($ s  K J 5!" @' , "j:#6 < @E L T Z _ u #c  $@C"  i     @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXwsizerdirsizeleasetermreadaheaddeadthreshtimeoretransConflicting version optionsIllegal value `%s' for option -%cconndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsgetnameinfo: %saddr=%s, port=%s, addrlen=%d, sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d Usage: %s %s %s %s %s %s [-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeUnsupported socket family %d%s: error = %d rpc_callrpc_getport%s: reject, astat=%d, errno=%d recvrpc%s: short write! (%zd < %zu)sendrecvno : or @ speccan't get net id for host "%s": %s"X b   "| "@"m ($ s  K J  @  g:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point %s: can't read disk label; disk type must be specified%s partition type is not `%s'  $ \   ' > T      5 H i     / d      WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@ B C F I L N O!S9 aJ bZ ce ey f h i k m n !o!r'!s8!uI!1м|^t0 Non-system disk Press any key to reboot I.!@@w!@h {!p!p !p!p !` !!@ ! $create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] =.! A.! F.!ė ȗ ̗ ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). |NAMEFND|MODECHG|REMOVED|TMPNAME|EXTRACT|EXISTEDdfLnqSsTtv'!A>!k>!>!MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGUGHRBD M@dmCLS1@2plbatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname L!$ L!% L!L!% L!L!% $ M!% L!M!% $M!6M!% CM!IM!h' XM!( fM!) ~M!% M!M!% M!M!, M!4/ 4/ M!2 M!% M!N!% M!N!% M!)N!% M!;N!% GN!ZN!\3 fN!% GN!sN!% N!N!% N!N!% N!N!% N!N!% O!O!% )O!?O!% ]O!eO!% ]O!O!% ]O!O!% ]O!O!% O!O!t4 t4 P!% P!P!% 'P!.P!( ?P!`7 `7 ^P!% iP!% pP!% uP!% S "/L!6L!;L!BL! = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)hw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node j#*X!A`!^ ^j!Z%"H`!#P)/v|!|!|!***************************************************************************************************************************************************************************************************************************************!e!i!m!q!u!y!6E!n" #l!! fl!Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20230516%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/HEAD-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/HEAD-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Reading `%s'Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defginN:o:pP:q:r:Rs:tT:u:vVx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16K)4:#̔@%# ! !eb!#&P$!s("^ ,! "q"W`X/HX/PX/\X/LX/TX/XX/%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... NetBSD gzip 20240203123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name" $#!%Z^\`[_]a/!5!:!>!G!9K!9 SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. :?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t!D!0t"""LESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sD"D#D%D'Tab stops and then {}abcdDgGhHilnNpPqrs tw xy !:#=\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] ߘ""!(0""0"!!0 "!0"""P0ޙ"3"O0D"L"N0i"t"0""0"9"M0"!k0"!j 0ɘ"!"0Ҙ"ژ" 0"0""0"!00 "@""0"ߘ"0"-"` 09"v%""0F"v%"0W"$"0`"5"0n"v"0""0"9"0"!0"!0˙"$"#0י"5"$0"!%0""0"9"&0"!&0+"!'0%")"."2"m#8"<"N@"u"y"""9"J"T"   $   "ky n"%4@Pƥ"ʥ"ƥ"~"x"?e N"NAME=    !"#$%&'()       !"> <8>>l????@`A|A1LB_DBoTB     $   "ky n"%4@Pcdth| ,\ԝT@pȡ̡XD4 ȴ   $   "ky n"%4@PSCSIfictiousH""#"@\1oT----------------------------------- - --------------------/boot@//tmp/usr/var"0\(ԓ,\ԔDĖ̘DП(,ءģĤ̩@"   `"`" x"   kn"  ֑ ۑ  !"w E  _ ʁ .$ Details for index GPT part -   (g!\"a"f"@"?ex"i"o"Ze  t" ~" n"kx"Y 0" n"}",֑ " SFH0eC  SFU0eC Hah!IdontNeedEFI  (s*K>;`" |nQn- q+# / |nQn- q+> H |nQn- q+U ^ |nQn- q+o z |nQn- q+ P=rGy=iG}䌐 ;Mt? mWC 3KOO Ð yD<#*=(ΐ ؐ 3Dh& \ M}-  @Mjy֬ 0 -чHkA -чHn"V ZIчH@"p IчHx" IчH 2IчH S'@ )Ѹ *1@ )Ѹ֑ 41x )Ѹۑ 8 0"C"["?  Ð j"Az" c """ ""H"$"$",T`pP|tlt4@H4< DA0B0B0C00D0D0Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.10 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.10 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.10 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.10 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.99.10 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.10 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 10.99.10xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-30s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES ntpdatepasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeselect(2) failed but no child died?-s 115200 -l /dev/tty00/sbin/slattach /tmp/ent-mnt.XXXXXXfictious------------- ------------- ----***************************************************************************************************************************************************************************************************************************************!e!i!m!q!u!y!b:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...]  Copyright (c) 2006-2023 Roy Marplesn@"b%!c^$d!e+"fd"g]"hp"iK!jߘ"k~"l m"nqo"p"qn!r#s"5$t"uvP!v"wl"x"zYF!y"A"B"C"D"E"F"G"H"I J "K"LC M"N"O("P5"Qk;!S̑"T="UG"VQ"W["Xe"Z6"1t"4}"67!""|Gy~"}"""""""""""""" ""#"""#"#"+"3"="J"T" #c"l"j"r""UL"""""""""f""A ! O"&#" "0 y"h"/$ #"m$l""define 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt Ͻ +#1#5#B#:#A#PT@P HEPT$ @CDHD###Yx#N# #W#_## #g## o#%s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.0.6--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.0.6 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.6 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGEXPIREdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclasswaitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigureread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %sinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemporaryoption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sdhcp_bind%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: if_setmtu%s: VIVCO option too big%s: DHCP message too big%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_readudp%s not founddhcp_openbpfdhcp_readbpfdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s%s: deleting IP address %sipv4_deladdripv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cinet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route( Duplicate address detectedPPllVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B##K####A!0)##PC##p3!/###;"L##5##BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~<##)@####I######K####A!)##C##3!/## #;"@L##5##U$R$P$##|xxK#x###$yA!\y)##yC##y3!z/### ## ## f!######## #######!####$# $#"$#! $#!#;" $#!!$#"0$##<$#$H$#%U$#&_$#'j$#({$#)$#*$#+$#,$#-$#-$#.$#. "/_%#/0"1$#2$#3$#4$#5 p6$#7$#8$#9$#:$#;$#< %#=%#>'%#?5%#@C%#[ "\W%#\g%#]|%#^%#^%#_%#_%#`%#{%#{%#|%#}%#}#~&#/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumcntrlgraphpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%s%0*jusnap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZE[ sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Could not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank 5MS7) bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n^Gkbskcub1kcud1^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@ deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist