08Pb8jh'&<  'b8jhI%P''`'+. +.b8jh'&P@@<@T 08Pb8jh'&<  'b8jhI%P''`'+. +.b8jh'&P@@<@TU b8jh`'+.yAb8jhb8jhb8jhQ$f b8jhb8jhb8jhRAb8jhb8jhb8jh>Ab8jhb8jhb8jh?Ab8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhmK$ %b8jhb8jhb8jhX`hpx$b8jhb8jhb8jh (08S$\b8jhb8jhb8jh@HPX`hpxP$tb8jhb8jhb8jh;Q$b8jhb8jhb8jh <JAb8jhb8jhb8jhCb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhmb8jhb8jhb8jh(08@HPX`hpx\$b8jhb8jhb8jh$b8jhb8jhb8jh$>b8jhb8jhb8jh$b8jhb8jhb8jh$sb8jhb8jhb8jh$b8jhb8jhb8jhAb8jhb8jhb8jhm b8jhb8jhb8jh$b8jhb8jhb8jh $b8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jh$Qb8jhb8jhb8jh (0$b8jhb8jhb8jh $b8jhb8jhb8jh$b8jhb8jhb8jh$b8jhb8jhb8jh$b8jhb8jhb8jh$b8jhb8jhb8jh$b8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jhAb8jhb8jhb8jh:m]"90Q šTR00&fx2 ߝ~b7Z W%$(ֿ%g%Rd&B3C.{ ,y7DO>69+N 7fGT ts4UK1N+. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4,%4 (@@ " "mm $ - - ,, $ - -NetBSD8nAPaXUSR&ffffUVS1ʟ(8,-9s 9r[^]UWVSÚ(]P PLt,1t&tuAt[^_]Yuڅtft9s1u+z 9suփ 9r}tt~t111us t0#t&wfuUSQE$uԋ}{̋CE29sSU]MȍXE9s1u\tED u|E9rϋU]u9r09Jt*tE9ǍvuUWVSU(E@@9s{*;9r[^_]UWVSé(E u -M !8ME @E 0-t/tu} -9s 9rEt E$},`$o,-9s 9r"$HED$E D$E @$-$0-MD$ D$ D$$1ɉL$H$;[$SWD(5u1ƃ5DtЃt^$l_[SW(4uYƃ4t|$^<$ktH?t<$k8tЃ_[UWVSh "h "h- `%1t:PR-YxOvh-j XZ3h!%h-Y h-j j1UEU MsMU HE]dUVS1ۋ%tVPg-ZYu %C܍e[^]US9Ph!"h-h-h!"蕃@% CtsPh!"h-j{UWVSE tuh!"URhc@5- t5-h!"jua#!#Ma#!#Ea#!#WVSQRP5-h""UE ta#!#RPh/""0 u5-h=""1e[^_]U5-n@XUjhc 5- t5-hV""j1USRj EPS– xU:t Shd""j貌]UPEU Ph}"" JtPh""EEEPhc5-K t5-h""ju1UWVSSuE H1ۃv>PW +ZYtC%uދ%Eh&"W*ZY1tFEEPhc5- t5-h""j1e[^_]US u Sh""j蒋]UVS1%tSPZ*ZYtFSh""j\%e[^]UWVS ]u} Sh}"" } ~Sh""K1}{EFE} t!v""B1UWVS`] u~ uh""Uȹ1Rhc@5-E 5-h!"j-DPEU Eu>M9Mt66EE1EEEK>tt,uh#" 1}}}}}E뺉t9Wuh#"jLU9Uu\}t }uEEEqEeEEVEEċ]9]}t;$}t)}t(u9ut8Eċu9u}l}uE EEEԅu.u9u<E4%5-h#"t "}t}uuu1ۉ]EuM9~VQuh#"jFk]lS qEYu h#"j(1}E1҉Uuĉu܋UUMM]]}}Ph c5- u EX@1}Wu%y5-h$"jEuPE4%h#$"CE rh+$"x3^ElU9U|-h-hX$XZCtCPh3$_Xj ^CtCPCPh@$" CtC"PSha$" Cts؋C4%h$"{ C$Ph$"bZYuwXE\1e[^_]UE-]UEd-]Uh&"j+Uh-&"jUhD&"j UhZ&"jUE E EE]"Uhjjjuho&"Y_--Uhjjjuh&"._l-p-Uhjjjuh&"_--Ujjjjuh&"^--Ujjjjuh!%$^X-\----u(Ujjjjuh&"w^X-\--u(Ujjjjuh&"E^--UShjjjuh&"^Ӊ‰؉-- u j]Ujjjjuh&"]00-u jUWVSuX-1\--1->WXuWh&"j=SY_u Sh'"jxxuSh('"]hjjh%EP$uu뺋-#H t uhB'" P-WPZ_-t/#=t --tt hr'"RX-ƒtuh'"<ۣt?%t4!t$t -ۣ -h'"jǀ-e[^_]UVS-uX-D---H-L-;X-\-rgjD--H-L---X=5-u-E -)EU}t 13A}uke[^]Ë-- t H-L-Uh%hX$jUUh%hX$jUUSË@4URs(PZYts$hX$jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u+8uK ]USQM9s SiZSPEPljƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h("j~C4WPs(Xe[^_]UWVS]uVh-j/C4uu s(P(D+8jVj/$0+8؍e[^_]UWVS@-}t H-L- X-\-EUEUEU}uH- t?11ҋ}9׋u} ytEU--E-- t(jRP5h-t-P Bu@u 5d-h("IuSh@-Ɖ 19|4 u5d-h3("%%*8t5d-hX$jp}11-E - tKE- -5\-5X-QP$----1ɉ - -5-=-9}u;9uu6E9\-u E9X-t--|--l--9}u9utT`-t%=-u-5d-hE("}XZ`-t5d-hi("j5|)u}H-L-+EUEUH-L-=X- \-9}Er }ME EtURD-)P5@- H-@-D- -- t8----SQRPe! ujhK%jf, e[^_]UVS]M Eu fft3SQHtlpCQSCAQSCAQSCAQSC AQ S C A Q S C A Q SCAQs[^]ÍL$qUWVSQ- -t/jh"jh+ - -tjh"jJ+ jEP輘i]eƉߋE׉pti$-% -Ɖߡ(-׋pt)ptZYt puDžp1t5-5-5-5-5-5-5-5-h("jd]S,S$SjM*- - t7ƃN% tK#QRPh#)"jdSS`$Sj*$-- t7ƃN% tK#QRPh<)"jdStS$Sj)$-- t7ƃN% tK#QRPhO)"jdS,S$Sju)$ --iቍhltpRPDƉ׍xPjhtp$ WVxPhlSQhf)"jd]S$S/$Sj( eY[^_]a&Uu#j)#UWVS--5- --u3jRP5--P B@;1S00-v[H00-S5-5--P$ t-u:5-hX$j6w-uNu<)u-h)"jvt5-hX$D}!XZe[^_]UWVS`-l- p-u?j X-\-%X-RP5h-t-P B@4tAfEEEPhm5h-t-P tS5d-hX$j>v11;5l-p-5X-5@-5h-t-P$ ~fEEEPhm5h-t-P @t;5l-p-s>5X-5@-h@- ;\-C;X-7벍e[^_]UWVSƉ׉ˡ-҃Pj h!#WVRuV'"VSh#(e[^_]UWVStÉ׃=-t%tPh)"h Vgh PV誁 =-ssVPh)"vs$s ssssh*"Z0sxss|3Phy*"((slshs\sXh*"  } Dž -@-H--=ta=t=t+e=@u^-*"F-*"- {)"=-t)"-P_-U-*"- ?= -t -m#-40-h-h-VV-Y^-40- -5-~6? 40-$40-9} 40-t:h*"jr9 40-|t"u5-h)+"XZn=-ue40-h+"Ph+"P5-Ph[+"hf+"T(=-th+"j h+"j h+"0h+"+ XCSs{)׉+C(S,=-= -th+"h,%hA=-h+"h,%hBh+"&Dž(% t1jj@Ps=-9Džsc11WPWVdWVssH1ቅቅ11KcRPPh+"(=-=-t s1H- -tP=@5 -X1҉ -YX18-@-D-1UH-t*PA -ZtP?5 -X1 -ZYuUjh-h-X2 yj$-$-(-$-1 -@=uUSUE L- -L-M -Ћ] Ӊ)~ -@[]Ã06w $@%1Ã1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HøUWVSӃu]1d-2x-d-@ujjhd-hd-th."hX$=Y^d-h-x-|-`d-)p-k-1d-2x-d-@ujjhd-hd-Rth."hX$g=XZSjjhd-e[^_]UWVSƉӀ:0BZY1=p-Cue[_]UWVS`-9\-1ɉ \-ujjhd-5d-=h-jjhd-hd-<th."hX$Q;XZ1ۊd-2x-d-Cu5x-=|-u\_uk-v7h/"uPY^#~h:/"hX$:XZ th_/"`-=`-~\-P\-d-e[^_]US]=\-uU ]`-1\-=`-x\-P\-d-[]U=\-uU`-1\-=`-xU\-]UWVS hp/">Y18]E }=l-u>؍}01҉U"%]BuʀEt@9uSYth|/"hX$|9XZe[^_]US--9--RPNZYu[ 0VPhg#h-"h% 9-H-ua-tjtJj]-- -u -ųu١-P--M 1]UWVSSU-=-CE;U tM-119~149u1ɉs19~H -9E~@1Aˉt-X[^_]UVS5---19| t!-H<u -1[^]UWVSfEp E}u.h"5-$_Z]tjEP_ Y^uD1Gh"R^_FPd-Zy }Ou PP x. E uh/":-| zf%-Ѓu-h/"R]ZYuu h/"6X넋-jEP [_bE --9-=}\SRLZYu[0SPhg#h-ah%I6-H--tjj-- -u -uΨuً-EH--8lx #xtދd-PRRe yɍe[^_]U-1----5-aN1҉--H-Yu-tjtjUWVSP- t u h/"5X 6ƅu -8u@-S5T-Ë=T-X9=P-|^SYt=-tj jsPEcUjjjRV訩;EtGSZyh1e[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PiXZUWVS u1ۉ߃=-tVI NyVXHF `=- -9^-؁}U|WQ7IZYU=-- -u-tjtj-u -C1 mCE -9-؁}ULQM5-HZYMUuXP0|PPhg#h-h%2-H-t -/t1 -- -u- u - KF @t.0OPhg#h-Uh/"=2tt- -}-8=-t=-te[^_]UWVSu VE=--E`-E1ۉ--X=-t5d-11҉UuiEZUU-5-YUt(EEtBDd-PPjAƒ u- -t C-tjtj -u -uݨuEVu9uuHtg}tIu-=-tEu~h-h/"K-Y^=-u3B=-u-d-=-tJE -uh-h/"DKXZ-t!=-t9uuu$-Cu -19uu=-=-M -=-t1ҍe[^_]UWVS];!uh"CPXZS h"P'ǃ u$0*MPSh%h-h 0"Ju WYXyh;!u7WZy40LPSh%h-Lh!0"4/Wǃ=-uVh$"h- d-+E e[^_]UWVSu] }9tU=-t VP*VP?ZYy00GLPhg#h-h90".C1e[^_]UWVSQu VJ[=-tW1ۅtW;uRWNZuZW95`-u=-t =-u BRUPu xËUF?륃=-tuX؍e[^_]UWVSPu]>!uhQs"FPY_V u P)ƒ u$0,KPVh%h-hK0"RuSRUǃ Uyl>!u7RZy40JPVh%h-Fhc0".-Rǃ=-uWh$"h- tE)؍X؍e[^_]UWVSW11 -yh-^u-P-s=- -9-؁}U|WQ BZYUu[0IPhg#h-ch%K,-H--tj j =-- -u -uΨu١-u-1ۉ߉ u\--0--u-@t?0/IPh|0"h-h0"+f%-1--f-9t{t ---މe[^_]UWVSW-C{ u)ÃE-:TRPx Y^tE--9-ށ}VRS@_ZuZ0=HPhg#h-h%*-H-t1-tj tj 5-- -u -uҨu١-5-ljD s} us*Ext-M| th/")YoE--9~P-߁}WRQ?YZ=-- -u-"%-25-NjM}t/s2PR_Zt-D } +s#- -9|R-؁}tVQ>ZYM5-- -u-ux-Me[^_]UWVSQ]utuh0")XZ} 9EueF95<0-}h8-h)%]C^XP^w<\u7\t.ˆUPh0"ZYUtF-0"0"/B000CL r1e[^_]UEH!-EPhht@j( x$Efv@0-Efv<0-U=L-uET-E P-T-P-9~ 1;`-~hb%='XUWVSSu d-}t69`-+=d-=`-=d-t1C~ Ku"=d-tn`-u=d-t[uSPEZYtI=-Mtj jqP;jjjWu聛t9d-Hh0"Y&X؍e[^_]UWVSP]U u hb%.&XU19`-~BPSYX%KMd-uSwP(x?]9tWZu̸1e[^_]UE -DBuh0"%XP<\-u-E-1UE-DBt\-Eh0"R%XUWVSd---EDJ@t t E@-޹-0U?& } $@%}^@- --8f|y@t t@-܃tQ18j h-5-TǍ v8"uh0"A^t-u18UBQ@u^t -uօuhb%$^a1ۉj h-5-vSÍ v68"unt@-`-.jd-_t|%1Ƀ/QP_ZYt-M:+@- FP-@PX.t(@-L-;u d- P-`-9Et9`-}؍e[^_]US1L-d-P-T-P-xLL-T-P-- ;tK,tF L-ʃ~L-P-IuAT-H L-˃~L-Iu J -:;vd-l9tT-t1[]UVS-11Å t]9-u 1ۉ-J@։t-[^]UVSuj82Zu+%0Q?Phg#h-h%!FV CS FC؍e[^]UME 19tx\uHPQZY1҅‰UWVS=-ujEH!-`-PjhQs"h0"/ykhh"]^tZP[=wJ@ PH1Yt:WPXZ|3/t 3/D3h0"S5`-jhQs"SjUM=-tI -QU=-ujEH!-jh-UWVSEd-1ۃ=-u-9t =-| t8f%-=-?u1-B-: u)u ?.u tԍ4-WZu# -uo-tj=t[jd-t PTCXPPj0à t9u- --u른e[^_]UWVSSuP-Z;`-|1ۡT-x-@-9t9u SEWáP-ZYUSWjq/ u -t$195`-~FPVjB/ u)ϋ-tj&jSS<[t<\t.RiZÅu!h}$ { uh12"-[1C뵉) l-=h-9-Ё}UtVWxZYUu[30_Phg#h-γh%-H-t-tj2\j 5l-h- -u -uΨu١h-5-lj-=-tj jRPe[^_]US-< u h/" XH< u=p-u$hH2"XJ -R t8u ӡp-PKXu1p-t=H-u P_X9j p-Yu(0Phg#h-耲h%hK1҉H-5-S5p-9ƒ p-t+h'h@-PR 5p-1p-R]UWVS-P-M-1ۀx%u}M8Huu-h1"[s9}n-P-- -\P--2< -=-} -U8u-ف}|WuZY=-- -O-tj7jm8uCH-B=-du f%-1-| u6/- -9-؁}tVQZYuV0Phg#h-Nh%6-H-j-U5-- -u-|---e[^_]UVSVu] 1- u 1ۉ|-U -< Uu 1w8uA --JπwE1ɉj h-5-) v8"uh0"1Zgu@-늸e[^]UWVS 5-]t-=x-}+-;|-a&M 9}y;M)9 ڋEE-}RUuZYUu]0Phg#h-Xh%@-H-t '-tjtjt-x- -U-uΨDϋ x-M9}}EMELE B19}})É>\GVrω0;UU Mr3)9 ڋEEW-}RUu ZYUt-x- -u-t x-M9u}EMELE B19uu)d9|T-ځ}tVu7 ZY45t-x- -u-_bx-Cw}9|T-ځ}tVu ZY5t-x- -u-x-؍e[^_]UWVS] Sװ^|=-tj jsPlCjPjuk1ɉ Et-}t9U3 9-ށ}V5x- _Zu[H0tPhg#h-h%-H-b-tjGJj5t-x- -u -uΨuك=-tjj   x-NjEpSP-  9~U-΁}V5x-a ZY5t-x- -u-=-tjj S6 x-Nj󤋅  ?u9Ћ)ȉË ؍xt-9<t t tjPjuho-=}tV5x-; Y_5t-x- -u-~+ uEth\2"TZDžW=-tjj S x-Nj󤋅 x-f u1e[^_]UWVSd-T-Hd-1ۉ]1P-+T-9Ud-@d-Pmuu PuƃUd-PP[Zx-3E-1SwYu' --tjtsjd-t PۭFZPPjƃ t9]u -u -uuEd-Gd-E  Euh0"XE tu RRK x1e[^_]UWVSd-E`-E=L0-t =H0-uhw2"NYm=-t -j--E=-ZZk EtTuaPR@POwGHm uu^13^@p][sHZPJJ@BE4qE@E܋]k  9]}3:}z}z}׉}8up}xK Ń=-t聺L0-d-EL0-H0-`-EH0- -u-tjt j`1e[^_]UWVS--Ht7k X< u'ʣ-B0Z9tSe;SvZY1-d-L0-`-H0-e[^_]US-9-}Pk- -EuCk- -u C-P-k -ZY]d-j Ph-& tPi Phg#h-أh%5-1--1]U舿Ph2"h-萣j| @-Q@-y ;P-| t8-J 8-Uh8-PvXZUWVSօt%ˀ9u RPh2"RPh2"莟 uqRPh2"y `{tZC<i1ҍ{t2Hs!t ,I< ϊG< ĸ>e[^_]e[^_]UPEEjEP5- U[h4"Ph4"h-^jJUWVSf@8tXu1P{1҉hW3à V8#)tSWVj 룍e[^_]UWVS} 5-fDž<^1҉hPj;à t[譾8蟾8u 蕾1ۉh#Vf8uFt"SVW yFe8#u5[1ɉjjP @u<8th4"jh<%)+jWj豓fDž=-t fDž9DžjRj_ fDž9fDž9-jSV% @u苽8tJfu ft>(@ufDž=-u#K,-@tftfDžftR@u KfDžCe[^_]UWVSQ}u VWP[ZÅuzjjXZu h55"j;s jEPWƃ ?tE8thh5"jh8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19} 9xu90tEEEE1,]9Xu]9XtiB9xt A,9|90uU9P uU9PuACk,QMukZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPDY_}ËBt1UjVL$qUWSQ---w-ڞw ]]5-5-h5"j5-5-h6"j 5-5-h6"j5-5-h06"j 5-5-hH6"j5-5-h^6"jE$ht6"jEPP$h6"jl =-t>u-1 ujeY[_]aÃ=-tUE Puj UWVS}u _Ph6"j3-B9tT-e[^_]UWVS$ ]5-t(VF$V:=0Y^ugh6" j0Pu L% yWp4$t0ZtWVPq u Wh6"Q5H%jj0։( y0h 7""jju ։ƃ C Wh VP%ƒ jjWT%‰ VX%h _Xuh17"jj[^jh h R(\%y RY߉R Zt-w1ҁbt#bt!tu hS7"1 Њ Јt u h_7"jYu V詀ƅ/ t jZV8 jZVP| djjP7& -0tS SQPR(&,7kP3Ɖ4W"8t t10hw7"j \9s1BFu h7"j 1e[^_]UWVS\]ƍ}ZE5X%(,a&V&048EPSSe[^_]UWVSĀ]p$tVP:V9Y^㋃p tV3:V9XZ㍅xP舑1RPuu聲t50-9ΉЋt}"Q_850-VPh7"/e[^_]UWVSP] AEH1RPuu舭ƉMt1׋C|1׋ujQ1RP<t2uPh7"jE01RPuu۫‹N tkvkk ыEe[^_]UWVSTE>E8Iu EuEEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉU1EUE}t EșŰU9UuU9uM] E} uWVE,# E: =-EEIu E5E@1 t1҉ËM ʋUщe ʋ}t}\SQE,c$h{#5-跓Ãt#EUSjPV{Ht h7"XS艆X--E1--E<1EEt E\]ԋu)։]uEEIu EE1 t1WVuu9E E~1҉ t1EUWVRP轩9E cEEEEuuԋE,#EЃ EtEЍDEȻ8&ELEЍDEȋEۃ0EЋHatE/haQuuPh8"3REЃP2‹EЋ^_9t"ERQuuPhQ8"jxE؉E܋EԋU؃EU1ۉ]]]ċEEEЀt)X@}99EEȋ}ȋW:X@9]9EEȋ01}WE9L9U)9E uuE,!EujP1Eă1ɉMEEËE}t;k;xd[}Nj}ljEu 9EcMQRPuEPE]tXpXju5XZ9u9]EE@]k,Pu'Y^Ek,tԉEVFF EUFVEEtP4@0FVGPtP,@(FVGltF Ek,Dԉx(F Ek,Dԉx(@P$]Ep}}EJEt#1 t1EU!X1 t1EUEU9]LEE܃8t)E"9E1EE܃8E\]ԋu)։]uE)‹E#Ju E`Ek1 t1WVuu\Puuh8"jt E܋P @E܋@1ҍMQRPuEPcE0ju31ۋE;pE܋EE9shI9uEtpp E_uuE,#ujP=.EċE1 t1u}C<҃<DEE܋}k,Pu;E_Zu E}81ۋE܋EEE9k,}}܄t3w 0x}܋t|px u}px}Ћw04/81p}܋tpp u}px}Ћw(,px}܋wp J9utGE܋@ EMk,}D$uuE,ujP,EċEk,E‰r(Er$ t1u}CЋ]E<҃<]DE܋EEEE܃8i}Eȋ];\9E}Eȋ}9x }98EЋP9Ut,EQuRuuPh8"jE]E]E Eu--EEUEԉU}E\uԋ})׋E^EXIu EEEÉ1 t1RPWV艡PuuSh8"jE}8LEiEe[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu>uFt 11E`E9sWu h 9"jXN1ۋE1)ډEUF@]t[ ][]ԋ]1ҋM])ӉM]E9Es 1)EU1U9ЋU_U܋EЋE]ÍEeM1SQRP萤FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RW=}EEPhEP%ƒyEqRPh)9"jxhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QRPhD9"1ɉM؉M܉<EPURvSE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]<E1Em}----EЋU--ẺEMEPhP%ǃ yNQWPhU9"0FPhP%ǃ yNQWPh{9"j 1eY[^_]aÍL$qUWVSQ9q--,- -?1--1--1h :"VW< ta#DtNJC 7-뷃b$%--C-C-u5 7:-e5 7-R5 7-@-/5 7--5 7ӽ-X 7-h-h9"$YX-)lj80!h-h9"XZ=-xh%:"!=-x 8u5-t hf:"jctjj)hux"h+jj[_@u h:"jj hux"Zhj00h:"@P蹡@ uh ;"t|j/SkZYÅu@s-׉hj话hj裝j$8-PW-1urh;"jju-؉8hDj=803PyP3h=;"jW5-OG9=-=-tf95-~W-4FX烽(ta1(,,9- -_=-tjt-xrP-0j-dh1҉ldPh -P%à t$8:h>"j@11ۃ=-*6, -,4@lXRjPjjT($tPh^;"XP :8zJt&Z JZ04z($J 04zh P&1--8Y_9t4VZyPhs;"jPh;"jP 3‰.Ju lxtH'‰`R840Ph;" tH891҉ t1҉Ӌ+049׋0|9؋4}Y 9؋4}s8014߭0ݝ0y11SQRP1ډ߭ d%ܝ0v7ء- 40- <0[10=-pݝt{\PtS:y ݅y+؉Ph;"jA jPh;" \`+EU5-9Ɖ 9jSZY@݅u؉NPh;"-ܝp %ܝ0 LRjP011RPl$01tZL9rKjQ4#^X0290Q_|OlaGl막 9skQ k4 JHJZH XH J HPW4 D2 D2GlFhjP8O8P PuPh<"Y[# 1҉D<5--8Hȉ9r09rÉ014#840Ph4<"k840Ph4<"jk04 4111W9m09Ћ4J8JZ8<< 89 +4i۷m۶R<8SPht<"PDPh-SW(~LFD\`HP\Ph-W\DHY, X049Ѹ4}u014"80Ph<"p1ۉ898r;D\`j\Ph-W\D𙋝09މЋ4}88SK t+4i۷m۶hQRSPh<"DPh-SW|$~FL,NY8&D8t-011҉VPh<"K=98~k,0D$Aۉ7<1߭߭------1XT0 11198 P t$k,0Ћ 9Pu9 tyt_|;TRXR801RP [1RP1F P @ 9| ,PQpQRPjW'k,0Љ1;P} PTQXQ8)Q t p|룋Tșڋቅ044؋ቅ=-t 1P-k,8 $98p 9~Љt$DPSh'="pPhP%ÃJQSPh<="j#tV":t&Pha="j,+ePhs;"j}, E$) 048<11ۅt9 k"j,5-(,{jAY((9-iPh2>"j(5-~=-th?>"h%hhI>"F؍eY[^_]aUE UMQ1]US]C Cs4SjS)1]UWVS}uj 3Zt"Å~{kP‰C X1ɅuS[1A9}XM1BBB BUWUYMukC t 40IYP@S:XZ1C Es1ɉKE CC{{j8_u.1{ YC 9}k4GZPX7p 1EZB|DBAB @Ѝe[^_]UWVS]s$tV6VXZs tVV^_{G 9w~k4QFYPGWA1XZe[^_]UE@H]UE@1҉P]UWVSEXC9Cuz@CPh>"j/kCPs ush>"j 9C kS41FFF FsZush>"jK kKK E UAQMCSEUCSEURPuupE UMA Q}} EENjEe RPu13\%yEsh?"j9 EC1e[^_]UWVSQEXCE19E~4kK qy9u U|Q 9U UQ} E )C@1Z[^_]UWVS]s4FECS,K0UM{ stQRVu t EW@EC C C[MEHEUBȉEEbMRPsW6\%9CugCC\MEHEUBȉEEbMRPsW6`%uh?"jYC$Cs4SnXZ1e[^_]t@Ë@ tËÊtBRtUWRPY_}ËBht1UWVS L 1󫍅xPE hE,ZYËEtPhEQuЋ}ԉ t֋Et+ +@|)‰1,0,9r 14DP0,us F(tȃ0tBE;Pdr,9u:s (tvRPYY09us,9uih|(_tZ t @ (jS#EY[t8(w690u9,GjSXZ (w t WV^_Ɖ׋E t1 $DH 9|($[ (E9s@(ERPWV0,h%?"(  袋9.}*WV0,hT?"j(fk,V4Z1ɉІ0PHD0,hz?"j} (&X k,4 1󫋝,0rrz E(t=@PtȉB DH9v@l9}&E}t8Ph?"4<@E0]\)Hu E1ҋ] 1ҋ] t1RPWV{kDt 18x, $$y11jDP4Pu2DH1 9؋$}W $) $119ʉ} @H9؋}{ =-h @"j4Y^wM t1WVSPE(\%=DH9}bk,4_$SѽG(Zj0P4t0$h/@"jtMH=-tRP0,hR@"j6EHa‹E1tIu$X1IuEC1 E E t14k,kD,49Et@E@8RjPjjEj8P h PR v%<DHk,49s"4jh EP% bRP_{@8tGpBuE@-0-Xe[^_]ÍL$qUQ 8-4-50-50-h%EM MuQQ$RPh B">YMɍaUS]CtS P S tSPSCr s eZS^ <-X]USEPsH) (-,- -Hu0D-Z[9u \-u' \-uhOB"jP4BPQ X4CXZ@]UWVSu EEE#0-@-0- <-M11ɅtJA9~ʳ9M}#t0-hcB"h%hhrB"r}9x4u }9x(u9p$t버t0-e[^_]UWVS]uuu SO trNj@thB"h%h1GGWX9w(~6GthB"h%hhrB"qwVw 躐G [^WY -0-;<-X=T-u =L-uBGWuX-GWtPP-WGtG4WPZWX<-j@jΏVjďG _4E UG$W(G,W0wE #0-G8@-tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hrB"pP ʉPHPPP s E]XPs2H (-,- -1ɉH H-HH-.1ۉXt X-HX- P-HP-P4JH8@-9t!tXYX tAP]UWVSUu }uWVRcËECUt8-R4-EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=0-Y,A0Éa,ڋyY I4 s RPWSQ\% RPWSQ`%e[^_]US]C%CSjS]1]UE UMQ1]Uj<UU Pl-PYtHJ l-@ l-UWVS] h-C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd,C${s  ]e[^_]UWVSuE EEEE%-1҅9su}K}9y,u^}9y(uVK0ts4q4s4 -K0ts0q4--C4d-=h-~ttpRZg{$u{uCuڋ[0n=h-~ tRkX`-l-t$;3uEE EEuCe[^_][؉؍e[^_]UW1h- .-11҉l-_]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE0-K,ϋS0c,ʋ{s K4 es RPWVQ\%9Cu CC17RPWVQ`%uh?"YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPY_}UVSӋEU tt RPY^CSt RPY^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈS^Z19tPQh/C"TN Ћ]Uuu UjDUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRPY[L(ștșe[_]UWSvhqC"h8%h hC"mgÉЊӃttRPY[LXștșe[_]UWVSvhqC"h%h"hC"gƉӉȊʃt$uҁTXe[^_]UWVS vhC"h %hhC"fƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRPYYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CC=_C_C 2h1C C$hjEhjrM쉁j`j`MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEEpduSEE싀}@u jR^_}E UG(W,}x0xdEtFVtRPYY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM uh-EE %-S0tK0J4--C4 .C(tS(P, .C, .މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhC"h%hhC"]@]9~ ]B뫋EEP{E̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh%D"}t/EEtP1uuRPhdD"辧]9]tSuuuh|D"蟧uu] SY[9t$PRuuhD"suO1҉U u=XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPXMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPWZYU9닋E芀{at WVhE"wtC M苉9t.CM苉p9t$1SQ1RPWVh#E"蠤C(S,C S$]9UrSPWVhOE"rWVhnE"^ ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVhE"辣}hE"h,%hhC"UEzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRPTUEuuWVAU9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWVT9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhE"臡EuE‰9u+|vEL։A9u9u V9s9sE]Ã}thE"8h8-,Y^tCpStCHuRPuuEU}t hF"HZZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhF"F .6EtM}`d)RPhQF" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j=pE1҉PEMAx[A[A [1ۉY Y$XZ}t.hjoËE쉃P^_ u =0-ƉE} t hF"X[1ɉM0-EPjh WVu*hjwoËEp }쉻PP P jPXZtS Su0-}URjh  t1RPuhjnEEp }}M쉏PP P jPW^_utCHSLC419|} tMhF"hWY@Et} t#hF"IWZu uuS9u u荜X S脜X]=t SoXktLǃ1҉l1AǃLcX1҉ \X`1dt}uWj mƉ_tCtPl^tCtPlFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h5|SXZ؍e[^_]UE Puj0- UWVS]FHljL1RPuu ?NEUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h(G"@ u~ 1RPuu LtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuL€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhBG" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Ph]G"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph]G"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Ph]G"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Ph]G"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuuQAƉ׀}Mt1׋C|1׋URju1RPQtPuh(G"d Ep 1RPuu?t֋F Ft:_vkk փ~t*uuhG" tFVC(S,FC vkBHMQjPjjRt Ph]G"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Ph]G"ZYEP tu}rz}zP4PR:X17 .t C0S4C(jjP0uu Se[^_]UVSUE 9| 19[^]USBPPhG"h-'h-hG"ь0-CtsPhw"h-&jUSSE] t$uh#s6ZY¸tr1EEPhvd5.( @u35.h "j ]UWVSPu }t}~^h"S5Y_DžtFh"S5_Zt)hQs"Sx5ZYthH"Sg5[_t뫿}}uh$v85ZYuUEPhud5.( @u65.h "j<e[^_]US}tQ,Shzd@5.' @u5.hH"jK" hxd 5. @'5.hoK"Y[``pp pp5.hK"`px`@`9q j RP5.Bu@uWV5.hK"OWV5.hK";hT5.q?=thw"h$;Xh8-\ ZR`e[^_]UWVS] }t5hs4P輙 v jhK"j sEP蝙 vjhK"j菌S910j PsƉ׃ 8t sh#L"98"u:9sh;L"pyhUL"e81ɉj Ps o_ 8t s hoL"=88"u!@u hL"j螋uĉ}ȉM̉UЍ$Vhyd5.c @u35.h "j茋VhL"BXZe[^_]UWVSlj֋ 1҉0-tUPQM*ZYtUBMQh$"jjhh .0-s 5.^.@u5.hX$j. .VWS5.>e[^_]U05.h "j踊USS}tE Xh#ST)ZYthFM"SC)ZYuEEPhwd5. @uE ]UQ}trEPhd@5. @uE O5.hL"XZUS d9.h9.t `9.1Ӊȉ[]UWVSӋ}7.uƍ6.u(PpPP?P*PpPP?PPJE 7 u9tN7k?9[^_]16.x@uUWVS։ˋ=5. 5.11~B? ʋE[^_]U5.?5.jh>RP3=vu5.UWVSQ54.Ctt+ t&Pσaw <v ;v ju_{Gfw$k A E1E)й 19u5{$ -1TtDQt!@ u 9u1 Z[^_]UMU 9|]UWVSƉ׉M5.5.ÉEE1RPWV2E)Ɖ1UQh|% XZ}Ut5.H9u5.H9u u9rBRWhM" e[^_]U塨1-=4.tvPhM"5$5.5 5.5,5.5(5.505.hM" 5 5.55.55.55.55.hM"Y5t9.hM"I PhM"6hM"44(5.,5.51-5$5.5 5.QRP505.hN",hN"35.5.5 5.55.QRP55.hN" 55.55.hN" UWVSQƉj21ۉjEPV腏 >u#ËE8u>28"u w܉1e[^_]US0P#$!#Ph!#Ph!#Ph!#PSh-O"h-,jUWVSEM 1-9uhQ"51- hQ"j؄ًEEUMjؙ]!É]]!Ӊ]uuWBuAtV1-1-=PuR6 3P5.R6 91-uNE!5.}e[^_]UWVSEUϋE E G"t/j"EU@uShQ"jXZff=Ut+=4.t fuuShR"ff=u%CthER"fLJ_f=Ut1=.u ShjR"Y^.tShR"_XZj(VP  x0XŃ~X R5.t\fLJᵃVe[^_]UWVS9x9.u`9.5`9.u1Xƃ7.e[^_]W|$wUWVSDEUȉM̋EGWEUċG WEUER"EEtE(["11}=1-E5.5.U1҉U܉E1ɉMԹEM]̋ERPSQV-PE؋UEUuuRP9-RPuuȋE؋UEUuuRP-RPE؋UEUuuRP,RPuhR"J ,"uuuuuuuhS"&  h-jdh8. u h&S"jhT.#h8.L+Y[8.U슀8.< <$u z Ћ -DQu<-7j EPh8.YƉ׋EEhl%P舌EЃEPh*S"u6 tuh #u t L =1-Ήʋ55.11WVSQ+Ɖuh-S"u躏 ui 5.ω%5.Ɖω uEt55.1Et 5.1Et 5.1)Et 5.1)׋E؋]؉E]hT.#S)YZÉ]; t,h8.Zƀ8.uh8.h1S"<  9uE|E9Ɖ]}.uuuuWVhOS" uȋ}u}e[^_]g_USE PuqhsS" -H- yh-$Y-P-؃ t9@t* -y h-Z-P-8 u h&S"jf~1Y]UWVSEM䡘1-E@u hyS"j0~1-EӍEƉωؙ!M!EjuuuBu @u1-1-uhuP. nR5.P/ 91-uVjuu51-Bu@t.K!Nju51-R51-J. 91-ue[^_]UWVSRá`9.u ƀA Mz΍t9. S}8PR t9. e[^_]UWVSEыEU u1+ˀ 5.1ۉƉ)߉u}};=d9.}=h9.S"EUEUE9l9.p9.}=4.t Evt9.KiE9t 5`9.tމ&ʅu+5.9UE}M1E܋E9E܋U}t0}t}utsƆjS"S"ȃ[^_]UWVS EӋEEht9.@Ph`9.E 5t9.t hT"jg{EU9E|E9u|`9.] }) VRP5`9.31fǂU }u@5.5d9.֋M)}CsKSCPKSs FSjt9.Ee[^_]UWVSE}u&7.ƒ<1IE E#֋EU EUEUE9 5.$5.M@5.19Et\tSMM1ۉ]]9ً]M}3M9MM }ST"=4.]@uER5.˃t h9. d9.t!=4.>x9.1hjg`9.[^u hxA"jxfǀUEx9.EU d9.h9.EUl9.p9.t9.ytbt]t E^t9.QHu`9.<=4./hT">YT"gV5.=h9.t9.;d9.KxZ 5`9.t1;EM |9UE}=4.t`룅d9.E 9h9.u;]t~t9.H`9.1+]9~ Fu%uF PPR t9. *5.1RPEU d9.+E`9.XZEU d9.h9.EUl9.p9.T"4T" T"nT"Ѝe[^_]UWVSË@S t+5 5.=$5.9u9t hU"Y]sǹ󥉍1󫍍@u'CU" Cu G"RhIU"|XZߋe[^_]Ã=4.u x t"1UWVS|Éס45.tP iYj/S^ZuS51-h_+%h45.L# S艨45.Y45.u hxA"jujP'XZy545.hX${[^xPSZY@tMuи 9E} 545.hdU"T 545.h{U"?h h.S"' 9t545.hX$O{f=.Ut545.hU"Y^S(XS'Z tje[^_]UWVSÃ=.u1Ҹ#.f=6.u1f=.I؁=.t#.@5..󤡼.f6.f>7.Ut6.1>7.u[^_]UWVS á6.fE5.5.5.@5.11t#f}u&6.t9r $uɡt9.E `9.19E~+f:uzti 9t@Ћ 4.t=4.uaf}u6.! 9*=4.tu7hU"Y=.t f=.u/hU"hE%XZ=.tT.!945.=4.tPhU"_XPhV"ZYt 1=. =.uL#t#%1j.tr.!9tSP545.hbV";=4.t1~f=6.u3 .545.hV"ZYu6. #%te[^_]UWVS(ÉEU EUE؉uF=4.EV"e[^_]311ɉD11ɉt<u ȉhjhh%P)q%tPQRhV"d fu1k t Ph!#h W"(WVh!#h!W" =1-RPSQKPh>W"Y[=4.u" 5.9u1ۉ)11ɉj-j)]XZttC9Eċ]|N1ӋF19Eċ]}|]9؉ӋM}EUG롾@5.19}tHt?19Eċ]ȃ|19MċE}]9؉ӋM}EUGu EċUȉEUEU+EUȉEUE Eu hZ" E Et}u9}E}}u5.5.1RPuu| u 9tۃ}u E9uuujjRh#EUEPuh Z"h)Z"h-jdh8.u h&S"jbh8.[vEHƀ8.t'8. t9EEHPh8.hEZ" uh8.EP? uċ}ȋEEă}t6juuWVUċE4.uD<=4.1EjuuWVUċEu=4.tKt$|=4.us=4.t PhX$j[P]juuWVUċEt)/juuWVUċEu}t }tPhX$ja}uf} E U u }EfukE } 1E}t Dm:}ta}tE 5.1 d9.h9.9u19tuugZY `9.UӁþ]EU]̊EĈC})}̉Guw OWPE̍HPD3}̍_S^_E}tgfǀuEPkE }P4. =4.u=4.<t t9.(hiZ"Ytfu'uEPkE }P =4.9=4.t hZ"Zu4.}ft=4.hiZ"[E̊@EċE̊XEčE@‰5.p1WVjjjZ"E1ɡ5.p1WVjjjZ"Ã(Uă?1ɋ55.1WVjjjZ"^}̊MO_U? ˆWGEĊ_EčG‰5.p1WVjjj["E(1ɡ5.p1WVjjj["ËUă?1ɋ55.1WVjjj!["}̊MO_U? ˆW(} `9.uKye[^_]UVSá4.u h/[" X1ۃ=4.u Sh\#Y^jjڸ@5.CXZu҃=4.u=|9.th@["g X1L=t9.thd["u Sh~[";Y^g `9.RP1҉8XZ=4.tC4.9t9.A=4.~h["5`9.j5h9.5d9.RP 믅<f=6.th[" ^h["[6.t=hA#o6.Y=uh[""k Ph["@XZ hm"2XhK%/ X=4.nPh[" Y[=4.6.PPh[" j=4.t>u Sh\"XZ9t9.} h-\" X; `9.RP1҉u Sh7\"Y^jjڸ@5.XZe[^]UWVS ˋDž G" t DžU" @uhF\"aZYߍ1jh_\"Sz t 1/9Cu苅9Cus Pj ;Cuă=4.t.{ t(s$s shh\"he[^_]UVSPE1-;1-u*=4.u!URhmdP' y hܟ#`X@5.11@uh\"B=.u111H.~ ف.@uh\"J`^E`9.01C;t9.}. `9.d9.h9.@@uSh\"`Y[1҉U1-;1-u*=4.u!URhmdPD y hܟ#_Xe[^]ËUPhq"h-jUWVS|E|x9.wShq"h-fjRSCEZuhq"(|ƉjRPu9u9thq"Oj Suu  9t"|thq"h r"OXj1EEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4%hr" :.fEEE9.9.19E~WtL9u.;u&}JPaR :.4%hHr"tuu u@뤃1\3 9sR@E9E~WtM9rϋU9sэPaR :.4%hvr" }9sf}wfE@f :.}E4%hr"tY[n}tGaPE4%hr"Q } t}t}u$EEfEEEfEE:.uEE]9E@ƒt<u+ExمuuEEZEEu9uuIXEe[^_] @-yUh8-j 4XZá8-P8- UEU 19s f3P]UERPZYUSBHBy;B| X RQXZ]UWVSQ]u uht"SkF fw4%h`J"Pht"SD FPjht"S0FPjht"S Sh%IXZFXt Sht"IY_FXt Sht"IXZFXt Sht"IY_Sj 5v(ht"Sv,ht"S v0ht"Sv8hu"Sv4h%u"S$vv" h!#hPv"V O8C1PhXv"VC 9GS6EXZEE FEe[^_]UVSSPPVu ujVSh%/a,@uLt1w"t"0FZBw"tXw"PShw"jNjUVS]u VSԤYZu Shw"jN;/t"Shw"XZu Ex"e[^]e[^]UPh)x"h-jUVSPh"P [^t,PjPuVVt jPZYSXe[^]UWVS EEu EE}]EEE1҉;.%1ɉ ;. ;.hbx"Vu8 NtJb$ %1= ;. ;.$;.;.;.뗡 7;.jWh%5 7u h&w"j7MPYY(;.J-4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP]+XZt1h $9}PZY uċ2jWSh)%^@uLt1w"t"0C^Bw"tXw"PShw"jKt%@u=;.p&;._;.MDžlx"= ;.tDžx";.t #P=(;.t ?%=$;.t x"=;.t 7$1ۉXP Ihlx"hԧ%jJShx"hx"VLu h55"jJj/G PZYt|=Shx"hx"Vtj/C PCZYt|W=XjdUVS]u VSYZu Shw"jI;/t"Shw"XZu Ex"e[^]e[^]UPhx"h-j@UWVS]u1 11҉t11ɉphx"u u4 athg$%5 7`CpX5 7!CtXDžp5 7XCxXDžt뀃K|wK|njVh %5 7{u h&w"jHP'X<-P;UtU tu4uVEptFuxPVFgY_@t#ECpJtuUxPV#g_Z@u8Vh{$jG4HxPVgZY@tuECpECttu E%Cxe[^_]UWVS SVpPtWu uhWpSh "Y,@uSVh y"jGGr@t@1RPh%hSShy"(jUSP]jEPSPU :9uySu h7y"jF]US]SZt@ h"SZY]US]SiZt@ h$SsZY]USP]jEPSiPU 9t :uy ShIy"jUF]UVS]u VSvYZu Shw"jVF;/t"Shw"FXZu Ex"e[^]/e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RP|Y^CSt RPy|Y^CS e[^]UWVSӋEU ΃tt RP=|Y^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]tËUWVSEUˋuE FUU tJ$1EE ~uJ1EE ~<$ffCRVڋE E CRVڋE uEE }t>}tWWVzY^ƉuuzYYEU0`}tΉȋUʿBUƉ4s {$s({,s0{41{D{@{HUM䉓CPsKC 1sss$S{l} E 5@;.=D;.}t M U JpD1HӉ5@;.=D;.}tCS}t#RPyYYCh}t1ҋM M  t1WVڋE BY^1U ~ 9~}t 1҉TpTt1|(@ԃ} }t1E 1ɉKXE HpED1Hy~FuhqC"hl%h"hC"}t1҉1҉TX1HF붍e[^_]ÍL$qUWVSQXAAA TAAAAA A$A(Q,A0A4PA8xA<@t1É1ɉWV1҃t0119s#h_y"3+ZRPPH0jjjjXSËP%F߉ȃ ߃@C C!C(1C,ǃ ǃ ǃUƃƃǃ ǃ ǃǃ1ǃ1ǃ1ǃ0xfǃƃbCC CC C8CT Cd@ChClUCqǃǃǃ ǃ ǃǃ1ǃ1ǃ1ǃ<fǃBƃY PCh)%V\ZYth)%Vhsy"( u&;s5;slDž:DžDž u;tU('DžuLDž Dž;DžsDž ~|t~(uydhy"'^_PDžDžt9t hy"&Y9~Wthy"&XZ.DžDž9|ċ9|<t h!z"(&Xh5d;.hCz"ʿDžy(hz"%^_uqhz"菿YI;rhz"%XZu) u 111(4<81L\0,$H1dH@D uj$_t⋅9t Phz"G$Y^Ht2{{ @D0{{@D#Zt⋅9t Phz"#_XG1t{${Q!#^t <8(Ch4CpHt ǃ ǃL@tA"ƸY9t Wh{""XZHd 1t1\{ChX\Clg{ OtIh6{"h-D8ljPhg{"h-t@t)1L@t31#LC LClC XkT,Pxu$xtJxHXCdTCT~*0CPPlxtxp1PF ^t1P YttuxPZt*1 t1s{ %1t t1s)Й t1҉p11Ҋp t1Ҋc t1hl t19s hl)ωptct hlCS s{C`hCpC1ɉt‰ Ju s1 t1WVtpct9Ǎ@4pp4CtǍ@pp11҃ʃʃ p t1ct"uM 1FCXS\u 1Huw?ǃH3Qw ǃt)t%@ @ v#vxǃ ǃxd‰9rw~uZ9$}Ldu2Whx{"h-  9Huh-h{"%XZdѽPh{" dt$hd|"h-蓿OPh|"7 v$tpPh|"踻^_j кY@uh|"h}"XZ+1߭ڍP l%WW$h<}"RHuƉƉ1 t1 ‹)ЉʋCtSC8S< C$1 t1OD1t 0 ‰D2耽tC|P4YBu@u0&PhЁ% tu `duCPODž1v 1񉅰 t1 t19u9t h^}"_ tG ?9|$ tj jh}"q$t*uQ1҉Ɖbu 1҉h t1C` t1)CS\)CDž+x|ƒu Q]1 t1҉Ѝ Ɖ1҉"vJt\9Ћ}x|) t19r$mh~"^t+)CS)C +V ‰Ju 1 t15Q‰扅Q‰扅扅tV׉sX{\׉sh{l׉sp{tC`Sd*\ȋΉs<ΉsDCHK@hfYu jj(@1󫋃@t<<f<%fGXD@<f<%fGdDSP1R_ZtT81RP}XZ1ɉtpxpx t WV^^_Ɖ׉ t19s=Pd/D ]juƉX PTYP9FZ@HRjPjjt Ph]G"N>^_@ Gt3~S@1҉P-HG 1ɉO$)~\@HG~F F <@4PXjjXjjS'ptK KS1P1ZY$~dt.<f%Tf-f1GfFjs ,<f%Tf-f1ɉOfFjs1)щ1 t1҉GW jhZY<f%ffAXZ1ɉ19sDA u҉=v D PjVjj{@ Dž%Dž1p._<҃D 9sh~"5`;.h " Ft Pt#u?RPXY^f*uGɉf1VfN@ tBh~"hP%hqfFu=@ A)G G p 6p<uGG9rh~"h@%hhC")9rh~"h@%hՉϋ)1󪊓t@@tf)th"h`%hh"LP4PRAH‰ljX1OtVjR1RPQytPjh(G"66 H TƸ1tvkk ʃ@u51rrrrB 1z0z4z8z<@1OBB~B1ɉJJ(MB 1BBZN9s1BBrz 1BE]9s1BAJ1B$79s1zAJ 1r@4PY=?.u jSqqXZt 1{@{D1s,1ɉ9\FH|‰1RjQ1RQVAtPh|~"3‹p JuI!F u1kF FtL<1 t1F tX1 t1 ‰ ‰1 t1ҋtC@SDC,F t 1 t1҉щ‰8ubvVt \Ɖ 1 t19Ɖs)щ‰jVXZ$t,CpSt'CH\+ƃu 1 t1WV@Ή+tC@SDC,)ȉʉщ‰_1v- 1Ҋ t19sƋ1𙉵st'{++C8S<++C$BHQjPjjR t Ph]G"/^_A |tVC@SDs8{8tGpBuVE?.1-Xe[^_]ÍL$qUQ ?.?.5?.51-h%EM MuQQ$RPh B"脙MɍaUS]CtS P S tSPSCr s ZS ?.X]USEPsH) ?.?. ?.Hu0?.Z[9u ?.u' ?.uhOB"j P4BPQ X4CXZ@]UWVSu EEE#1-?.?. ?.M11ɅtJA9~ʳ9M}#t?.hcB"h%hhrB"ϲ}9x4u }9x(u9p$t버t?.e[^_]UWVS]uuu SO trNj@thB"h%h1GGWX9w(~6GthB"h%hhrB"0wVw G [^WY?.1-;?.X=?.u =?.uBGWu?.GWtP?.WGtG4WPZWX?.j@jVj G _4E UG$W(G,W0wE #1-G8?.tz8GC GtWP { _ Ge[^_]USEM PuhB"h%h4hrB"P ʉPHPPP s E]XPs2H ?.?.?.1ɉH ?.H?..1ۉXt ?.H?. ?.H?.P4JH8?.9t!tXYX tAP]UWVSUu }uWVRcËECUt?.R?.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=1-Y,A0Éa,ڋyY I4 s RPWSQ% RPWSQ%e[^_]US]C%CSjS]1]UE UMQ1]UjUU P @.PYtHJ @.@ @.UWVS] @.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdr Cd ${sP ]e[^_]> UWVSuE EEEE% @.1҅9su}K}9y,u^}9y(uVK0ts4q4s4 @.K0ts0q4 @. @.C4@.=@.~ttpRZg{$u{uCuڋ[0n=@.~ tRkX@. @.t$;3uEE EEuCe[^_][؉؍e[^_]UW1@. P. @.11҉ @._]tʋTËË@t@Ë@ t@Ë@tË@PtË@dtË@htËtËtËttËLt ËTPUWVSS]CE1-K,ϋS0c,ʋ{s K4 es RPWVQ%9Cu CC17RPWVQ%uh?"X YC$Cs4SXZōe[^_]UWVS]{4Cu2wC t1t)F@VD)F,C @CWSjS1e[^_]UWtBRBR t RPI;Y_}UVSӋEU tt RP;Y^CSt RP;Y^CS e[^]USËt-w1Ɂbt#bt!thbRhB"91 Ȋ ЈSZ19tPQh/C"蚎 Ћ]Uuu jUSt)P8X<)P$[]UWVSƉUMXC0E)ЉEE+}}t/ujRu uVtEjE0rY[EOEmCdpx K}t)Eus 3C EUP 1׋MXZ1e[^_]tËUWSÉЊӃtTtDptRP79Y[L(ștșe[_]UWSvhqC"h,%h hC"賧ÉЊӃttRP8Y[LXștșe[_]UWVSvhqC"h%h"hC"IƉӉȊʃt$uҁTXe[^_]UWVS vhC"h%hhC"ΦƉӉȊʃtutp|tҁT(e[^_]UWVSSÉЋu} 9r4"E t19ur Y[^_]Et# #!Z[^_]UWVS(M}tE1҉EUЉÉ3]3u]u)EUtApE̋ẺEԃ}tC}u}u}11 9E}|])EU 11 9E}|0)EU11 9E}EE EEEE܋EU+EUu؋})׉u؉}܋}E؋U܉WU)ЉG1x EEHEEHE̋E}tUE؋U3E3U tE)ًEU t}!EЋUu؋}܉2zB1r EH)EU랃}tE]ЉEEԃ([^_]UWVST} uU _ ;EEr*t1MEƉ׋E.BuuuURU VuuWu:U ENEEU1MVEUE EtE9Eu%E9EuuuW ut jS[XF EPuuWFË@u7ENEU t1C,S0C CC4SPYNS EkEU+t jS\XZEu} t1 uE0x1e[^_]UEjjuuu Pp$UWVSSE E}E.ptVEX Et ËtRP3YYËCt1N9u9Eu1ۉ؍e[^_]UWVS u}j8jËEEC1CCCC '1C C$hjǿEhj踿M쉁j`j覿MAdK1AHA 19Et EXEaMQjR t1WVEPUBBRUuu uƃ(Uu7jRmEU EpdJ uB S< EE싀}@u jR^_}E UG(W,}x0xdEtFVtRP61YY Fht1҉GW EWW 111E싐E t"EHdMWV‹EZYFM u@.EE % @.S0tK0J4 @. @.C4 P.C(tS(P, P.C, P.މe[^_]UWVS4E$EE tPPED1EEEv#]]܅xL}҃}}܅x.}҃8U }}1E2hC"h%hqڋE+E 9zEE }uQ@9E}]]B E؋E[CEԋM܋EEȉEyhC"h%hhC"ٝ@]9~ ]B뫋EEPE̋E<ƋE_DE EE1 t1u}u}8uE=0E E1u؉uȉuЋEEÉËE _H9MjEEÉE tPPE ÍD19E Et"]9X}98E }]9EXEMQjRu} t1WVu8EE؋P }̋]؉TjPEȃ Et-}1 t1u}.E\]X1 t1u}Et E @E @}9} tuuuU 1ۋEԋEEÃ9I9uEtpp EZƋEEPjVEU t1RPuEE؋P }̋M؉TjP Ee t1u}CL<҃<DEEHE9E PE PEƍD19Esx9Mot }_] 19]u 9MLPuuuh%D"}t/EEtP1uuRPhdD"{]9]tSuuuh|D"\uu] SY[9t$PRuuhD"0u 1҉U u XE܍e[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEEUu}1ɉMԋE9EEIu EYEdE1ҊM t1҉EȉŰEtE؉UE苀\EE܉+EUuuRPMeEU9ui9ue 1ҊM t1҉EȉŰE9u E9uu}1ҋE E؉]9]|9}u 9uu}B uϋE‹EÍMQjR t1RPuEX E芀E؃{atjuXZ}uc{EtK 9u׋S(C,K9puċS C$M9ErU؋EPCPZYU9닋E芀{at WVhE"wtC M苉9t.CM苉p9t$1SQ1RPWVh#E"]C(S,C S$]9UrSPWVhOE"/WVhnE" ~}t5EtC(S,C S$9Uu9EtPuhE" EUjuuWVSuEE؃uju [X }t$EtC(C PWVhE"{}hE"h %hhC"EzEEAEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋ESEMIu E1ҊM t1҉EUEU+EUuuRP蚕EuuWV臕9EuQE}lj1ҊM t1҉Ɖ׋EUă+EUuuWV69Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMju#XZE9Ƌ}E Euu}eY[^_]aUWVS ] }t$Ɖ׋EWVRPhE"DEuE‰9u+|vEL։A9u9u V9s9sE]Ã}thE"xh8-#mY^tCpStCHuRPuuEU}t hF"莚ZEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPhF"$P.6EtM}`d)RPhQF" tCpStCH9Uu9Eu ]1EEe[^_]UWVS u }j8j胰E1҉PEMA2AA 1ۉY Y$XZ}t.hjBËE쉃P^_ u =1-ƉE} t hF"[1ɉM1-EPjh WVu*hj软ËEp }쉻PP P jPXZtS Su1-}URjh  t1RPuhj%EEp }}M쉏PP P jPW^_utCHSLC419|} tMhF"讗Y@Et} t#hF"菗Zu uuS9u u X S X]=t S XktLǃ1҉l1AǃLcX1҉ \X`1dt}uWjQƉ_tCtP+^tCtPFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjSu1 h;SXZ؍e[^_]UE Puj1- UWVS]FHljL1RPuu 腎EUt1EUEU싃C|1EUEU싃URjW1EURPVtPu h(G"@ u~ 1RPuu ӌtDTEU"7vkk ׋GEEjV XZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuu€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et ExEau } tu}}tE1ۉEEƉ׋E t1 9E9ƉM|BEE]Ɖ׋E t19E]WVUEZY‹E@9sq~mE}u1PWVE0ƒ E ]RPʋEEH^_}t EP4PR[ }9}TtuuUEZY|x#] ]Ett E!ËEU t19r^Eމ}t(SuuusE}@,@0E@dpx E\9||>}5EPj|uuuƒE}E}u1Puuً|Eƒ }븍EPEPEPuuuu?ƒE]x]tCu xu}|9|~|uAEE@dPx |xt!@uEڋE u ڋE|<ڋEylp]DžhE.Pssu{‰E{up H1E@,@0S@uIB4dERlp t1r,z0B BRdP_K}w Ea u$EtDE/lpG4WP^hh9|c}uuUEZYPuuuO‰EEtxB,B0(}u }ut x|t |u4EMEzEME|KE?t|URjPWVutWVhBG" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1҉Ѝe[^_]UWVS(}^:EUEU t1҉E܉U7URPuuVEԉU؉ EE1EURPKt1ҋM܋])Ӌ1ҋM܋])ӋG|1)ӉƉƉE܉É֋EƉrvaPJURjujjP>t Ph]G"XZMA tP@G(W,@G jQYXtG(W,E܉U_(w,G 1҉E܉U_ vbBHMQjPjjRt Ph]G"`XZEP tZrZP4PR:XEԋE1EUh‰1 t1҉щ‰3EEP tJUЋM9ˉE}#E1ɉHHXpE ϋEM܋]L\}UЃv8M9ˉE}E1ɉHXEkEu܉t6M9ˉE}E1ɉHXE ku E܉D2BHSMQjPjjRt Ph]G"XZMq EUtF V$FA4QP:E̋@4uP1e[^_]UWVS]vfBHMQjPjjRt Ph]G"B_XEP trzs({,RS jPHY^$EtC(S,C 1҉EU苋AM؃H/E^1RPuu藁Ɖ׀}Mt1׋C|1׋URju1RPQtPuh(G"d Ep 1RPuut֋F Ft:_vkk փ~t*uuhG" tFVC(S,FC vkBHMQjPjjRt Ph]G"XZEP t~vrzNJP4PR:Xju_XtC(S,C 1 S^Et UC(S,C IvkBHEMQjPjjRt Ph]G"ZYEP tu}rz}zP4PR:X17$P.t C0S4C(jjP0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPpY_}ÊtBRtUWRPEY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]Uh"hL%hhC"E|UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRPA e[^]UWVSEEEH@}W4}t D) D)ƅ  Ex 19}5uVSh"` E|BD1H)CNjEahE@ EDžp1-pp@tUkl1ɍ9~ډM}}x1:xURjV1RPQdtPERPh|~"E‹Mq EJu KE! E1k֋^ jQ XZE4fHEu_ƋEJƋE1 t1E虋uƋEEڋ}tG`Wd}G@e[^_]UWVSEt1Pl@hEUE1EU}+GpWtEUG$:EPDUME@`1҉Ɖ׋E@H+EU)׉u}E@1ɋ}9ȋ}7UMEFuE^$EEtphxlppxt@DƉMAHE)׋EEIu E3E>1 t1҉MRPWVj‰C0E}Mtp`1 t1s(EAHEpNjEƉ1ƋEURjW1WVQ賹tPC01RPh|~"kE‹EEp {0E,Ju I! 1kF t2EC 1 t1Ek( ju!EZYv{0t EEBƉ׋EE 1ҊM t19Ɖs)щ‹E[M t1 ))s(댋Eu})׋EEIu E>EI1 t1҉MRPWVhC0EUM t1C(1E܋Etppxtpxx|E@HƉMALE1CCC$C@CECE‹ER t1RPEPEE}8W S E1CCC E}EEDu1 t1ES Et=p`xdrz1BBaB8C1B8BPC41BHC(})8OE@@B 1zBaE>BvB0C1҉PS41p C(})҃0C(E)ЉC,E@rEx<u?.@?.?.E@@]CjSJE܍e[^_]UWVS,}E @u +FEHPE؋AHƋE X01ÉURjV1RPQʵtPE @01RPh|~"‹EEp E @0E܉F uMMЉF <u v0E@4uPu芁E܋E PEHEXYu܃}tC1ɋ9H~@ Ɖ߉UPSUȋ AAMX뷉Oơ(P.,P.Nu"h"h\%hXhC"bt5C0S4C(S,C 3C(S,PTPTC S$pCE @0膮E @BBEPuϦ CPCP赦^Zuخ ‰E1 t1҉É։1 t1Yt)G8W<)G$}u h"jE Xu9utpE MAP9q4u8P.USht"h[.[.XZthy"h[.<YXth"h[.;XZth"h[.;YXth"h[.;XZ[.]UWVSu }1ۃ=1-ÍF P.s==P.t"}u"h8-POoXZuWVh"h8-] ؍e[^_]UWVSl]u }1=1-EF P.r=P.Sh"h8-K u=P.iu =P.=1-u(WVh"jd]S}u WVS VWVv YXt%RU "PS MUufJ"uWVS"Ã}uPt^XfKEe[^_]US1ۃ=1-ËE H P.s(u ZtfPfPxtP#X؋]UWVS=P.th8-hţ"mXZjj_Xt^=P.th8-h"~mY^ދ[F@H P. s P.sV_Vl#XZu1;5P.P.WVYXt{F P.ra=P.tS Ph"h8-{uS^S"XZ"S\s s[.C$[. [uWe[^_]UWVS uE HP.EV-Y1ۉ]t7Mp p.[Zuh"aYYE9Euu XZEECt 9t@Eup9tY}uW]W!_X)=P.tWDPh"h8-W[[YE3}}1}uhEEuIEtCC;EuEt4G;Et+MMTĈ} t:EH$%fK=P.SxVøW}uW\W XZWZXuuu VBÃ}uPZ_fK=P.t%SVËE\SVPh<"h8-_}ufCufCECuSVPMTVS/!fK놀{uSPVhI"h-'EPuu VyfH=P.gP_UËEV}ubW[WEPuu V2Ã}uPYYfK=P.S UøFSVPho"}ufOfO=P.WTøfCth"SuWXZ{uG{t h"SWW_XSZS[ZYuuuu ViPY) uSXXs s [.C$[.uuu V&Ã=P.tSVPh"h8-1]uu Vhڤ"h-nEVPh"h-M VPh"IU e[^_]UWVS=P.th8-h5"g^_1;5P.P.sxWVY[uۀxtVP. s؋X tf{u0=P.tSPhO"h8-S#YSXZ[5[.t[^ tO{uDf{t hm"S|UY_=P.tSPhO"h8-&SXS!XZ[뭋v$롍e[^_]UWVS=P.th8-h"f^_[.1[.t#{ t{$C$SWSFY[مuȋ[.th"ST[$XZe[^_]UWVSPP.=P.Rut6h8-h";f#th8-h"&f^_5P.uY[jjQƉסP.EXZP.9T.T.P.WVPƉXZT.T.9ƉsIWVYXuWVh"R S?Ph"h-fcWV}PƉ׃9u9tRPWVh"h-xCRWVGXZu h?"xRYCu hU"SSXZCt SVfcXSPvCfcY[P.U9Pu(Ce[^_]UWVS=P.th8-hm"dY[fT.j_,B jjOEU衈P.P.RPOEU5T.5T.TOƉXZuuCOEUuu}OEUE9EEEZE;T.ET.sffT.j+7Bm [E;T.ET.rj9P.uA95T.T.rA- P.S9uP.9(T.T.9ƉsQWVrXYuUh"PXURUPh"h-iUfbWV2NƉ׃9uM11 WVXYuUh"5PYURUPRAUfbXZ9P.t A_WVde[^_]UWVSjjY[t<Ã=P.th8-h"bXZCtSPLfc_X[u=P.th8-h"Jb[^1;5P.P.WV!ZYuыXtCtNPP xu StjSjjPPAOfc[룍e[^_]UWVS=P.th8-h"aXZ1;5P.P.sJWVaYXt3fCƒfS{ufCf{t h"SOXZ[Ƀ릍e[^_]UVSuVZuVhϦ"h- 1Suu YXt 9t@uu h"M {u}t h"SOXZ19e[^]UWVƉjhRP @`.t9xu9pte^_]UPh"tqZY8u"h6"he"5hP.h"h-Hj1UVS@fC\.=~B\.)f$\.5(`.jhh \.Ht 6-Z1\.5\.CPS \.P)5\.C\. e[^]USjjj0+CC]UWVSƉӉ9tR)ySh"h-Z j%RP6^thF P6F e[^_]á$`.t#UPju uHt 2-iUWVS =P.uu 9uEffthB1ƒ=v.t fjEPWW:Yf E{1;] }ߋW v.=v.ut'?t"GGȉffWttG%)Wu9rG9=P.th8-h˧"]XZGt=P.th8-hߧ"j]YXGP.O9st+PQh"h8-\=P.th8-j XZ?te[^_]USjh 6-Y[th FR Zu SY11҉P]UWVSX=P.th8-h!"\^_5|P.5xP.5hP.h@"hh 6-P.߃Who"h- &؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃSh$%hV%V^NjP ѡ `.a5 `.kƃt(@hK%P/ZYu)5 `.CYu*LSh"h- 7Sh"h- FhK"PYZu5 `.Z1Sh"h-J `.Ƅ=FVvhPSh"h-:hPS6n1RPSVH `.;5 `.Bơ `.Xae[^_]UWVSuSR_X؉8/u@1Ҿ1hqF%PXZۋtm;thlu1WP ѡ `.S^5 `.Yt@9uVSBP uȋ2lЍe[^_]UVSu@Y1ۉ tÅtƋS ؍e[^]US]3PX]]DR UWVST=P.th8-h"!T[^P.$`.ZYuG 0?V Phf"h-h 2-hq"h-h-h<"gS$f` mE11E5$`.jLjEPI5$`.F @t&h 2-h">dh-h" S  ]9~;t uP XSQH E_߅ujSVS $`.@ @uV1VSju$`.@ @tjh 2-h"ch-hƪ"xRh-hت"iRph 2-h"wch-h"CRh-hت"4RDuuƠP.ZY nVUX=P.E}tPuPuS uSEZY~/9jPuSjSh:"hS"h-mEPSEPS=`P.tuuuuh\%SC uSY[fft uN Z5$`.nXe[^_]UWVS}E U#ÅuWuu hh"=hhW ƃ y@Wh"h-h-_0S Phx"h-u 1S ѡ `. `.0MNj[Yځ~RQW  @u550U.5T.5T.h"h-50aR Ph"J=P.uURQVD  @uG50U.5T.5T.h"h-0R Ph"h-$jm%WF V@ XZe[^_]UEU ]U= 2-#tjjh 2-h 2-@4= 6-#tjjh 6-h 6-4UWVSƉ׉ˉ t;5P.P.rWVhǫ"; u.RPWVu.s{ S$=P.t [$t9{ u9suh"S<XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh"Pb<XZUWVu} 1 tC;5P.P.s.u.RPWVYu.t;x u;pt@$e^_]UWVu} t;5P.P.rWVh": u.RPWVu.t H$9x u9pu 1pp P$WVh."i: e^_]UWVSujj[_ÅtJNJ/t tF@PW3gZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P,_Zu1,VeY/txtEVhH"9XZEe^_]UVSus.Fo.9s%)P6Sɤjj*9tC/vKSh_"Q9XZ؍e[^]UWVS}u hv"09[uYƉ XZu h"2YSWV y.60bG Ph"h-uh"1j(PPVm xVP.Z YV(6 ãv.Zt5 v.11 v.50U.5T.5T.h"Vh "h-؍e[^]US] =P.tSuh@v.v.P =P.uOj1RS5z.Bu8@u50B P50U.5T.5T.h@"h-j]U=z.t"f=T.u50U.ht"h"J 0U."fT.1҉T.P.P.T.T.=z.t1z.jhz.UVS]u =P.tVSh@v.v.P =P.uHVS5z. @u50A P50U.5T.5T.h"h-je[^]US%tuPA ZYt1ۉ؋]US]P.9(:-}A.tP< Y P4 .Zuh-h"p>j(:-]UVS]P.P.=P.tPj |^lP.-j:SZYt"z.pS3[jh~#SZYh"h"clP.Y^ud80d@ Ph"h""h-h"hm %(lP.u(0(@ Phm %h""h-j~ .Vh .UXZe[^]US`T.dT.EU]SouPhL"h8-> hT.lT.MU ʸ6"tS;uZPh]"h8-  A"=T.tT.hS.PhS.5S.hn"h-hS.h#h-$=`P.`T.dT.EUStPhK"5`P. hT.lT.MU6" tStYPh\"5`P.Q A"=T.tT.hS.PhS.5S.hm"5`P.hS.h"5`P.$5`P.h";XZ`P.@ @t h"jF]UWVS} u=P.tWh5"h8- EE]99ru4=P.ѱ";]u!#PhL"h8-L {CPCPhy"hR>=P.t R3C4,:-hZ"h8-t}t?SHK))PDPPCPWX"uSHK))PDPPCPuWܱ"<SHK))PDPPCPWW"@:{Nh"PvZYt h"P_ZYtJt%uCDPjW ("?CDPu襓ZY "CDPjWl "@{atNt)CDPjW蓑 ("?CDPuZY "CDPjW "@t=P.t/Rho"h8- =P.th8-h"8YX=P.th8-j XZe[^_]á8:-x=z.ti0UPIXUWVS  .}tt=h"]%[15z.5z.t=P. 11ɉ1z.5 .tjP.P.P.=v.uP.]UE Puh- UVS]u =P.u0VS*ZYy#00\ PVShH"h-ɯ=P.tVShm"h8-誯e[^]UVSuP.u8jjhVL2y"0 PVh~"h-[%=P.uVh"h8-6 ؍e[^]UWVQM1y;5P.P.s!WVZYt xt@uωeY^_]UWVQM1y9s!WVZYt xt@uωeY^_]US]ht"h@.Y@.XZCth"h@.KYXC thû"h@.4XZCth̻"h@.YXCthջ"h@.XZCthڻ"h@.YXC@th"h@.XZA.]UWVSQMS=Zt$1tH P.r11Sh"h-萭 eY[^_]USuh"h-jh-.lP.HQPy P2Y J tlP.Hy PZ J: tlP.@ t1yt nw1y]UE Puh- =P.u(h&"1ʍu1ɉMfEEE'E0VhQ`5. @u h"jJE<u 5`.h"<u5`.h6"h-d ~<tP5`.hI"h-E_Pu󥀽_y-`9%CShj"xh8-ˇ j RZ<hr"HXe[^_]UWVSE] h Zu h"j1󪍕 19}J jQh G"\8 ujQh"=8 u#Fuobu 4jVhN%7 ÅtIjVh"7 u'jVh"7 uƅ7fDžjh0uhj P5.cƅp9؍t h"SY_uu"-h G"SXZth"SY_h"SXZh"SY_u h"SXZS5p.5l.5h.5`.h" @tAtif@ffh6"S%Y_`f@ffhS"SXZ!/f@ffh"SÉY_!u h"JZEVh"4ShX$)X4S׃X9uEe[^_]g e[^_]UVS ] }t3ha#VˢZYth%V躢ZYu E'j EPV E U:uy 3h"Tsha#VvZYth%VeZYu E-j EPVV E U:uysh"jAEPhU5. t h"jEe[^]UVS ] }t3ha#VءZYth%VǡZYu E'j EPV E U:uy 3h"Tsha#V胡ZYth%VrZYu E-j EPVc E U:uysh"jNEPhU5." t h"jRe[^]USUBBPJ R Ph"֍ uE"]ƯSh1"賍XZ]UP}E 0EEPhQ5.vt h7"jU}tojhQ 5.A t hB"jqU}t:jhU 5.  t hM"j<UWVS } 11;]}#j4hZ"p2 uCPQ1󪍕JƅPƅTJjh'jJRjS5. jPj!gW ,jPjAP jRjVRt VRPW5p.5l.5h.5`.h^" rQƅRjh'hVjS5.S ȃf=v1QLhW׀ HLQhW輀 LHtpQƅRjh'hVjS5.9fv1PWhWM h"Whf#LgQƅRjh'hVjS5.Nf=v1h"蜬X1G9 5Ct9C LHD04|%h$%h"%4 {y0L%`vRh" 4`%h!%YXD4 %h"XZ1ҀHu6C9s!DLPh"蹉LBYXj ȈXCPShSS艫e[^_]UWVS,EE܋] h9 E^u h"jUU 1E1E9}t3Vh"ZYtNVh"ZYtAVh%ZYt4jEPV| U:u=v3h"j1EGEEjh0uhuj EP5.Ep=vhP5`.h"_E1E܋U9UE܋EU܋ Ћ\ˉɉʉىӉ1Ɖ׉ Ɖf1u1u M ]1}‰E M ]SQ5`.h"ŇqEEe[^_] UWVSEEu EBU܉EP[ XۋUu h&"ju1ߋMEfEfS1j EP6z U:t6hK"j.TTdDG9}ujh0uuSjEP5.r]e[^_]6 UWVSÉM}EU%qtE8uE8At=ʀ@tQVh5"Wu)%tQh"Wu WVu\ e[^_]UWVSDEU ]utlt"tWJ*P @ VBXHM}P @ j@WE4&hD?%VS肄xw!V@4&S HPw$w}txf@Ph"mutf@ʃ@t%L"tY"QPWhW"VS>L"tY"PQhv"VSÃf@Ph"VS訃1ۉ؍e[^_]UWVS]}hpVjSzPh"贄{vTh"衄Y {yj h"艄XZ,C@tPh"qYX,C t Ph"YXZCȅt Ph$"CYX{w j U_CȅtPPh7" S C h:VhQ"C t Phd"XZhpPjSuj ߂Xu'tPhy"褃j 辂 W;} } <;u GVh"lYXujh"YXZjh"D^X>9tR;U }MuRlh"ZY1ɋlhlPh=$hAlBXXh"ؤXe[^_]UWVS] }uh"讂^X1C9~D3Ph"蒂FZYj 见X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u @u h"j9EtU`.<uRh" <uRh"h-[ #<u jSRPRh"h-6jxe[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUM1EEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuZe[^_]UWVSREUMt2uBItu< }[yt ut܊ y_vCm t4\ 0H2N0H2N0HB]9uX[^_]À\um tf\\M t݈@UhPh"h-pj\vUh1" yUWVSÉ֡.P.uhh.:(Y_.hE"hS"hW%~hQs"W_Zu˞hE"PhY"j J`. u.h.Phr"hy"裂h "h.Ph!#hy"u1X9ډ}Dh.z  $h"C t.tWPjh`.j?;9}~ڃ=ș.u3{=ș.tNu%"u25;-Rh"%r. .h8-jWS^u"Rh"r.XY~7j q^.~".~uى؍e[^_]it1RE rGK=.tUPh".rYXUt2=.uUPh" rXZUB9|SWhy"q NuE"e[^_]qE e[^_]pe[^_]UVS]=.t Eh"S耄Y^uEEYF1҉jEPSEUE 9u%Suh" =.jg8u8u̸]1PSEPuVuu@D@u1t =̙.1ș. .u}u}tPjUEPj "UENY^tFș. .u}u}tjjMUEzjj "UEXZe[^]UWVS]=.t 'EEΐ18jjEPEPuu"C@uuh"kjS}W u%Suh"e =.xjejuV{|W58u|1PSEPxPuuuB@u1Ft =̙.x|t1pș. .tpjxUEY^?URVEPVh"jduVBmpPUEG$tkș. .tjj|UE~XZEURt裤EPth"jd]SljPًUE$e[^_]UWVS(;-8 .t f./. .SVYZYuVh.6e[^_]É)@E̍EӉljDPh. hqF%h.uUWVS`Eh.ZE&1]M;>r2jPRU Utj@uVRPV3h"WGjEPjh.RU0 UuE Eu1}u+E9Eu#/tj@uVRPV3h"jGQ1EEe[^_]UWVSEUE5̙.$ˋ .ș. u'. .h .h'"[^=Й.tu*jtHu!u05;-uh"%l *h8-jSuXHu"uh"kXZ=.~(j jY I~I~uڋEe[^_]1v{9}E0Ph"}kFYXt WhQ"ikXZE e[^_]uje[^_]UVS]EjjEPuVuuo>@u Be}t She"j. ș.tjIY2=Й.u Sh"jXZuuuuuh"je[^]UWVS]uEEU E$E. .=ԙ.J. ș.t}jjEPjuV=@tdMt]QM XtMMMjjEPWuVY=@tM;Mt Wf _j .PY}e[^_]E }tuh .h" = t)tu*Sh" uSh`"Sh"Sh8"SXZe[^_]UVS]E jjEPuVuu<@ul} t She"j9EUEU . ș.tj cXP Й.u EP P5;-Sh.%h&IuRPhX$h uRPh"he[^]UVS ]EjjEPuVuu;@u}t She"jd. ș.tjE=Й.u5;-Sh"%h EU=Й.h RPY\ t PXuuh"g e[^]UWVS,EE̋}uu<=.t3EjjEPEPh"E܍Pk((U܉UȉMQMC XۋMЋUuwuM1BH(jjURPVWp:@uCEԋU܋M؃t (9t$9uދẺE1uhe"j 1C(9~ˋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPh;-uh"jUReUUС. ș.t7j(EY(}t GE܃t9]e[^_] =Й.uuh"eXZv$v vvvvv vv6h"e,뗍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph"r|<Dž|tW XuJHxjjxPVph?8@ut9xt She"jl%EpujjڍE_X=.t=19|Wh;-Sh"jURc jjUE{G ŋ=. =ș.t jQ=Й.u Sh"dY[|~+t4Wh"cG9|~ hA4#cZj bXue[^_]; e[^_]ÍL$qUVSQ$A QEjjMQuVRP6@u}t She"j}. ș.tjYd=Й.u Sh"5cXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$h"beY[^]aUWVS@]=.t Dž S Xuh&hX$j1h%R蓘Y^618jPS V u.8"uSh"9t8uSh"j"9tҀ8úw܉ h%ji 1PSPVuu4@u1t =̙.1ǡș. .tW EZ)APs<$PUEV tVș. .tj EvX1PTs$PًUESJ e[^_]UWVStx|h .sl .$.rYh.h)ȉl)ȉ.u .u|uH1ۋx9t担tK%u!#RPhkY%PPC뿃} t~|P;-xw!#RPh"%PP|PK%xw!#RPhkY%PPU Dž|;-|;-Ã=ԙ.( =Й.th.h"4_XZh.h .h)"_ EHv h $h3"<4l&h3"^_X}uC|@0|psPh>"^Y^P|p4hI"^ |p@hZ"^|0.XZpt !#6hh!#h.7hhe"h.#%ppu/hWh.hhn"h.揃%ƀt2hWh.hhx"h.%s2hWh.hh"h.x% s2hWh.Thh"h.@% s2hWh.hh"h.% s2hWh.hh"h.% s2hWh.hh"h.% s2hWh.thhz"h.`%s2hWh.<hh"h.(%s2hWh.hh"h.%s2hWh.hhZ%h.%t7Vh"7#j VhZhWh.hVh.r(h.|p%Ph"p[|@H t Ph"U[_X|p(h"@[j ZZ }r=ؙ.=.u }|xXDž1DžtxTpj`SPPWt-@pu\t|@9uߋ|@(9uΉdQp ^dtNjp󤋅|@XPwPi Y|XX=.uTE tN|@XpHv9} |pUE"<=Й.uh .h"}YXZ|@XPvh"Pe{X}|ps E z-UEÃ}tP@uj- Ph .h"jqOs u|xtjh.h .|@@uojjPjxt+@uD. .=ԙ.h .h"|@@EH{$&|xt|@8d uq=ؙ.:t.s j|xtjh.h .S . .=ԙ.h .h!"Wtx\=ؙ.j|@4p\ _+jjPRpx@PtV*@pt*|p`t7|@4`&R; ^Kw8 nЉX1ɉp`9ptkp`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXpsRr X1.d1ۋ|;X4,F\s. .t%xQuujPtC`jjPSxt(@jjjjPSxt(@UjjDžjjVSxtM(@uIu8 u3ʳ XjjVSxt(@u jٺ .|c^_9S [DžjjPSxt'@tgjjٺ .|^u Yuh .h2"5;-W KjjPSxt4'@u jڸ .*S) XZhƀ.lƀ .e[^_]UWVSƉLH.j=P>_ZƅTt9sx?u @ƅTGhi#V,Y[.t;-;-8| 8Vs tG=^jh5$S P` F<=t:;-M  T=ę.u hU"s 41Dž81ɉh 1ۉtpƅY1j,T=_ZƅtF1ۉH1DžL1<1ۅkj=VN=[ZÉluh.#VdZYu09@llh.#VdZYu D1j,S<ZYDt @Dhd%VdZYHt;G"Hud%PThv", =.jGr10jlPSD-u F0j PV x;3ue[^]UVS@Ë5.=X<-tjtSvQZYuFl6j j5SHFSP$PFShI/%PӾ.5.F Ph "j@]S=Sfe[^]USQtP!{=8.uSZ]UVSÉu=8.u VS ZYe[^]UWVS׉΋]Uu E E!UuU$t!#[^_]USt<0„!1=8.uSZ]UWVSLEӋu>h"V ZY)ƒ?EljDUhbSPEUDEj URPEU:*u%jjWSRPEP,tEuj>u' E9hbSVT e[^_]9`<-t3UVSRPjuV;`<-e[^]#@.t ú.=t.u.UWVSƉӊ>uuVh.HtB14.hgp5.V=4.1҉4.hgp5.S9=4.~؍e[^_]UWVS,E90...}]6SP:Y^y#...=,.u. ,.SoZ=X=&wAKw2if>7[nRf>7D=,w$==!f>7=Xf>7=KwJ=w$==` f>7 =%f>7 ===f>7wf>7lf>7af>7Vf>7Kf>7@f>7 5f>7 *f>7 f>7f>7 f>7Eۣ.Eݣ.Eܣ.eẼEfE1E. 5._Sj5.E0.e[^_]USEPhht@j> 1ۅu E]u+h!"eaZtPu.X30%T~.h"5aYtPluZy..1ɉ \<-=. .t.0h,"`ZtP u.[ #~.h'"`YtPtZy..=. .P]UPUE.1J$& (U4"U7"lyU:"U="U@"ۍUC"эUF"ǍUI"뽍UL"!u,UO" u...1UVSPht"_P_ZYX<-hN?%_[uq%1ɉ 8.Ph.b[^Ht 8." t 8.A"."."x.Ա%t.3"l."<.!"y1......|..~1҉l.E.U%t>7UK#u!#\.U#u!#X.U"rd.U"`uR"T.U"Euc"P.=<.t8=.u/U"L.U˼%H.=L.u1H.L.!#=H.u H.!#U,G$.t8uh..!#UǶ%.=t.tt8uh..!#U #^.t8uh..$U"/.t 8u .!#1҉p.EPh!#h!#h..$"EP5.5.hx.|.%e" EP5.5.hp.t.$=#EP5.5.hh.l.$ # U#Uu!#d.#t `.%Uͅ$ `.tހ8tٍU#Åu!#.!#8t&jjPPuZ,uVAEDE".UQ%Åt =\<-u!#.!#:t+.HPjRWPu+uVDDEo"Y.U#6uo".Ur#Åu!#U&4"…u!#=x.u!#É.;u .e[^]Ë.T.n.P.^=D.tg=8.t =.uMU=.t=.u.X.=.u.H.1҉D.]1D.á@.t 1=D.ú.....USc=8.t =.ul=.u<.L.fL.8tH.8t=<.u`.=.u.\.!=.tD.=L.t9.~j CX]6]Uuj5. =T.ud.8t .Ã=X.uUjlXË..q.bUWVSu M1+uAM]-}tue[^_]USÅth$PAZYu "tEPEPS tt<`Ux&"Ux<& "Ux "Ux"]]ÅtVUVSQ覰Xue[^]t<+u;+uC؍e[^]e[^]U帢$.h.p.|x.m1@.]UE t L-@t]USuZù¡|.ڡt.ڡl.=.ttS蘯2Xڡ.@.]US=.t@.u ]SJX]US]SZ3@.t]]]UuZu Y9Ã=X<-tUh"Xú`.UWVSu}]E Et#jYu7u21ۉ] E"jYut$RPyZYtRPjZYuÉE1ɉM E" t9Et'hÃu1҉U t E "E "vOԺHu Y n1EEU҃Ut<9u t0G9Eu߃sڅu}EU e[^_],1E E:"e[^_]@.B@@@ 9uUS]t=h<-tjhN"XZh<-]Ã=@<-UWVS.@@ˁ1 }1119މM}Z .9t+9xu"9puUpP5@<-EO Uхtjhc"FXZ뛍e[^_]Ë .…t8=.u/US@t &11Ҁu 0@4@[]UWVS$.$@(@u9t9pu9Hu,@;Ps D15d.%uމuv@E9t(}9~u9NuF9,@<vԋ{9t utt=.t @td<-x; @~QMh j ZYMu 1.0 @@@xCSP{x B C{WG B POE܉G1GE@Gw x Ex.$@(@ EUF1҉E܉UEUEUEU9EM|!@uWE9@u E9@t`?@]juu@-Bu@ujh"[^&.M]艈@@h<-Ft*Th<-=.1ɉMܻ.@Mt@ &T뾹 )QDP@ià u.u}艰0@4@Et]y*jh"XZ1K@<-yZ=.u/@<-x&t"SVTRPK 1E 1E .ؙ@@^}t-=d.uAEEPhX$Od.ZYEU艁0@4@=.u2j2X=.t!=.u+lt.8=t.+.98t<WQ Gz8OW Q JMԍJO]É_ y z,@;F0De[^_]Ë .t&US$@(@ ,@1[]ÃÃ=.tCUu/ .,@w B,@$@(@1]ÃÃ=@<-xzU=.t,5@<-HL@<-5 .4 1ɉ .XZá.4@uƃ0@u.jh"nXZ;@tt.tUWVSu} .Uy 9}!@u EU@uG@E䋋@9u9t0E%@؉EPE9t8E;BuE;BtREU$@(@%,@1?E9ƉV.@9@}A@4t.t&[^_]UVSjjY[t@.9t2ʋqY9t9rr}ы扰$@(@1҉,@1҉Ѝe[^]US.u1Q@t@h0@4@[ut RPPZYs@tt.t]UWVS .t @t e[^_]pE11E9t:EP@ EUE@1EU9Ɖ}Ɖ׋EEWVZYe[^_]Ë.,@t H,@cUVS$@(@9}Q@u#%@Ћp9t.9^u9Ntv퉊$@(@,@[^][^]ÃUUx1ud<-]US.@uǃ0@ǃ4@|9t@@@g0@4@.1ɉ@@$@(@,@jjj@&Bu@ujh"XZ]Ujjju&!Ѓ@UVS.0@4@ut@@9} 0@4@[^]UVS]u 5<.q.Yh8@j.@1҉ @@1ɉ@@$@(@,@ǀ@ǀ0@ǀ4@XZtSYu .@5.5<.pXZ.@u@e[^]UVS.@ t4t&9tPQ P裆 X1ɉ @@uB u @yFZ.t ǀ@P^ 1.j5<.*p e[^]Ë.1t@UWVSt/Bt/; r"H19|0<9Osr;s B1[^_]UWVSR1ɉM1.G*u:Vt3st!dt1k1uUE 0e[^]UVS h!#j訇 h"Dhd.o hX.e hL.[ h@.Q d.8.h.<.X.0.\.4.L.(.P.,.@. .D.$.h"0D1[<=:tjh,"?j FWZPÃ$0 &%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=.tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=.u~ 9sSCM9sICKB~PR_<9r)S{Y"9sC%[tS[Z1Me[^_]U .E1uN(.Ev¸u6A-E^u =D.t<-ED]U .E#1uN0.E¸u60A-Eu =D.u<-E]UE=.tE].]USQ]uh"h. w?SSZt'؃@PCYu@Sh"(S5t.SZt. S YtS5p.j h."yE.SEPEXZ.]U8.E¸uH=-E]UU 1}Du% ]UWVSSEIuRfP$^X[RVZY1uEV Xt Sb$Y-h.jEPVPhuV)ZE8} tE 8؍e[^_]UWVSRhh"V:h:"J:ShJ"PQOucjhR"V=Oǃ u.h_":ShJ"POu0ShI"V O ShJ"PNEWx Ete[^_]UVShm"9P9ZYu3h~#V#ZY1t=hm %V#Y[1t(VsZt ؍e[^]te[^]UWVSlht`ƍxPV肣Y[{%=eh"V3Vw GShV  #jhz"V蚵  1҉p1ShW  t t u@h"W"YZh"W"YZh"Ws"YZt<"u5vptp~HpSPV t!SjEPU)U t1e[^]UE.U .t@]UWVSSuE 8=.u ^9uO tu QMZYMuGCQNn WHn _Xu s ZYt,jjEu VC EC3FC^ Fe[^_]UU Et1ɉME U]6t E]鋙]á.t);4O-t!Ujh.P.@ UWVS]=.u3.=...uP..Àu.%=ua%=tSSH.%uF .A..9~1!Ph.ZYu(1.K1=.4L.15.=.t1ۉ.UU1;LO-u PS_/EZYKHA$D &}e,+1.#1=.15..t.8 1ۉ..=.vx u-x .=.w1ɉ . .5.GZq1..8\<1.I1.E1.:41.)91=..=.v6x u0.=.x Z߀x I.=.w15.1ۉ..8 u.8 o롼.oZ.Y1ɉ .=.=hO-y.-.hO-_hO-[} t9s RUVh. Uuω_1.ItVh...XZ.8=.t }.tPai 15._.=EP9[¡.u=...u"z.tމU&U; u C9reO-EdO-E11ɉM.9t)9s"RUuV Uu ta}t%8EEF9rL< u+9sJu/8ENu9s,Eu뾉9suՉx1F\..tP h Xj.)@P,..)RSPS.0eO-8uCSm<XuSA._WA.Wg Y[..t{}t1.Ph.o-1ҋE7_Z.E%..9.s졠.u,15../]1ۉ.Ku5.DY..=.v dO-8Huh"(ZuqF%1.v.e[^_],e[^_]UVSQM1uu.EQЀ w[jjjj uuuVtjh"Y[11RjjE0RPuuVuɋE@1҉PU8.uEPjEPc EUeY[^]1.9.|.á.t @@@ Ã=.uUj11Ҹ XUWVS.t`O- 0O- .1Dž|PG@$jjWPCV-T:QDQhQs"VXZ$fSftxRPZYx,E%=ufSfthP'YXh"%Zud P-:X~PO-1Ƀx tA O-x t tlphz"hg#S|1ɉx =.u:pl)ыt)Px jjxPh"SSWVR%Vc Wc XZe[^_]ú9.t9.t 19.‰USR.t>BE.Rc XE=@u$(.t t7tut g ]UVS=\<-u=8.t =.ut/,.0.u ujjj54.RPV p.u)=\<-u^5L..L.1ɉ .-5L..L.1҉.u H5zY6Y5L..e[^]U]UWVSt e9ZƉׅu‰...=t.u0t;5..}jjjG 1.t.ld8e[^_]UWVSQE)ơ$.u$.$.ǁt#t1 2ux%$.Su5$.á$.ƒ$. . t;x- st jk1j1Ztjh"蹱ZYtV1VJ)Xe[^_]USVá(.$N   tw #5.jCP7tW6%I/f5.S5.5 .q1 .?E4.؋]`$.$.PS5<+u C< uH.tP_ Z;u 1H.SH.X5.jPCP=.SB1X];!t,.tPc_ XSQ6,.Y=.ui,.uh"h!#XZMh"P=.ut71ۉD9tt KtXEC<tiи e[^]Ujj#UP1҉.YYu. ыuUS]t CPX]UPKPEEUWVS<$..@(.e=(.t1(.1.. .=t.t= .tj轳_.t x@jB..Yu*:t!u5<.YBZujQ_=8.t*:t!vu5<.&BYujZ18.=.u1.=.tjhW"1.:͹t h#Xt?uh9j::_X Ws^Y=t.we{Ã=t.Z(.$/t.-7iCЃ . jS_Zdteh...^=(.t1ɉ (.d= .u.u_un.ƒ@+t2tA!uI1D!-tȡ .=.uLC1@ ‰.j@.]=. .  =tSZHOEa<.1EЍEPEPEP虝 . tDFEĉE=.u Pw P1_=E@Ƀ}XHNuEЅ:EPhu" 15.HY= .S贜 .YuSEЍEPh"C. ..Ht!5.h!#5.5 .. RߓZt5 .j1ɸ/eu;&7C!$ &*t0@tg!=(.7u-%$.=.$.=(.7t%$.$.=.=(.7g=(.7tWjh"j#]S^SvRPσH=(.7t(3$.P_$. tA tS u݃=\<-u yhK5hO-jYO =(.t)SZH Fu]EE1҉UURPvƋEY_tPnXi Fc $ &j1ɺ#7 .19.}.1;..|Ϗ..X=.t5.5.G^_j.19.}.1;..|m..j1;..|.1ɉ .=.u+;..}5.5.YFXZjj5.1;..|.1._jjQjj5.V=jj5.v1;..|.1.=.;..}ze1;..|.1.jj5.1;..|..=.u5.5..E_Xjj=.t5.5. EY^1I+.19.}(.=.u5.5.DXZjj5(.K7 .19.}(.jj5(.8tFm謹G5.1;..|.1..Y5.5.F5.q=.y1.....d9|d u=.t.d1..5.5.H_X..19|, G..19| G{RPEv=.y15.5.5.5.5.YG\x-1EȍEPhX$=<.uEtEPZ9%t...D..x.jYj譧8..$.1;..|.1. $.  . .$.1;..|.1..15 .Ѓt+Ѓ$5 . t $.1;..|.1. .1_5 .x1FP薶XdW[..15.D..1=D.x..1x.hs"?맃=.j 4O-" =.z5<.6h~#P u jh"5<.P7Ytjh"ԝXZj O-e$t5.jPoPt jh"<;..|.1.5._vt\,t4uj^;..!#}O"EȍEPh*"t jh9";..|.1ɉ .5.Zi;..!#}O"EȍEPhJ":1;..|.1.5.XuMjh]"@/1;..|.1.5._u jhi"V^ u 5.RP>1;..|.1ɉ .5.ZJjhy"?|15<.V`2_kPYt VVT2.1.P臇Zu egjP1..j1ɺn" =.u) O-e$t#j=. jh"[Mj1ɺ"L_  1?PSq'@0j1ɺ">^  Sq?@j1ɺ";4Y u lpSrj1ɺ"%[Ze4 t u.Sp_e.j O-e$% j1ɺ"^.19.}.#. ....;. .} .=.+.Y.19.}.#. .....1ɉ . a..=(.it Dj1ɺe*%iSXZ=4.t.̯UE=.t@]UWS]Sj"XY1ɅxЍe[_]UWVSu}t ME  u ZE EE EuEE܋EEM9EEujEP5ǃ Ethuc;us^ .EPU9@%=EtPU9rtEt>WSXt1E9EsWQMS_ZHMt QXYKEPU8EtWG Zt WYI YWEP.XZ}tE)}+} MJx҃u̓@tAu=. =.B$}mu;.}Rj#;k.XZ끍e[^]UWVSÉU΅!CEC1ɉ}M98P@uBgtB$@ur5X-(@t Att+e=. =.B!5.V9}Pj#Rj.XZ믃DuA1x8tLuxgt;AyuȍIty@8u}O@Gdufu die[^_]U塌..|.r.]gUM U.y1E E"]7]UM U.y1E E"] ]UWVS.Et Eju;[^xPƉUY9E}jV< XZu WXjjjWBu@uS@ W^_VSWEWMș}9u9tS@ 륉 Et;u{Mu {+u{Gt|3t|3uHVSY[|3Eu3|3nu,|3du%{GEtV~_u s|$W% XZtu hqF%Vh.%WS}tjSdY^y S9) ZP/X؍e[^_]Uhh"ZjuPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'<.<%t8.tRPY^CGjCŚXZutKH݀u=9us8Ft38Ft1 <.<%t 8.tQPShSRÃCFe[^_]UWVS]S^u1jjjSBu@thVS ~ˍ19=.t)RP芨ZYu FSW_XSjW]ƒ =.u9P4Yt"SWP;5Pi:vRgZd1e[^_]UWVSu'X=.!8u~#P^h":PEyZYUt"RUƉ$YPkL$QMWdO-PeO-PURh"MQVȽ$Wz& tXUVVZUtRh"P;?G Sh#P)?V/& t'YWY>u V & Z S& X؍e[^_]UWVS}1ۃ=.u\WX$S~Wh"SPVuPǃ VP3ZYu S% Y1W% V% XZ؍e[^_]UVS]h~#S^Zt(hs"SZYth"SZYƉe[^]UVS]SYuVSYZu]e[^],~V&~Ze[^]UWVS u=.h.ZjXh"Y_?|uC؉E-uEh~#V_ZECHtjh"!u[^Vu6Ɖ<$,T$RUF}WuURP^W$ V$ YtsfGftjEPV Ht-WZKtcu_E18E h"|XBEP;E8E 0h~#|Y^WBZ;u Sf# X1ۉ؍e[^_]UWVS}u =.j֐h7"nZY~1E EA"e[^_]sVWSE4$E<$UMT$RU{EWVSURP$W" V" E@u" t]e[^_]?e[^_]U|EPuNXY1xE%=@UVS|u= .u1V[t&V$P{VPhR-\|PVMZYy VjXG1ۃ= .u j4jRpucpCuC C C$C1҉SSS0S,uR-sXF@C=R-t@.SvAX؍e[^_]UEt@]UEt@ ]UE@]UWVu Ex ^_]UWVEp } ^_]UE@]UE@]UEU P]UE@]UE@]UEU P]UEU P,]UE@,]UVS]u C0t 9tP Xs0e[^]UE@0]UWVEUu} EUEUEUEU]Qu TQts16utjjWVuuՅ*Qu <u`;jjuuuu襅ƃt=u5<,>u#jjuuuulƃt*u Ee^_]+e^_]W|$wUWVS4GE̋G EȋGEċ7uu2,=l.u2=.Pk.RPWVcWV4Ɖ׃ - .uWVcY[uu}t.Eu藊t ub EUcuu3uuEUEU9uEt.$ uuP&EU ~ÉEf=.Et& t uEUĆ t t)E]Xȉslz( 艆E }  Eԃt.g} t}uS*(EƉ׃}s}t$ ._E@)1ۉu؉}Z~Nt;} t1҉U诅RPu%à }tA臅E؉Ut.襅t u`Ɖ18. .uM9)ډƉ1ۋM} t} u.Ɖ> t t u* uxuuل)ډƉSDL=.t)} t} u}t裄ƉE„EWu؉}ܹ11Ƀ}t&=.tM\RPj =$ Mj}!SQ{&uu+z^=.tMWVuuRPEU$=0.t;}t5 ut.t t@t!e[^_]g_鵃e[^_]g_UWVQM1yHL¸u 1=.jjPWVeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|'EEH=l.uk.9EE}11軁 .uEU)juuRP蹁EURPǃ[^y=0.tLۂւ t u, ut.<ͅ u@)蔂t.訅 u B@u2E؉Uuu+ZYZuu*_XE؋U܉EЉUuuY[1uuЋ}EEÃt.Ex u5#Å^IJ .MCEă=.XmRPSO!Eă J…u =.~1҉8.uȉ}E=.u  t umU4 Ut u uU Uu uE9ƉM_u}EUI}u}uEę)ԃ=.t t u}tu}EE9ƉMq1҉uȉ}uȉ}̺1EjuRc"uuvt EЋU=.t.WVuuRPE؋UEЋUԍeY[^_]aUWVu} ut\WV趀ZYu[t t u݉5H<-=L<-΂Hw t5P<-=T<-e^_]UWVSu} ucWVHb xb)ޅ~j2ajjjRPV tEjajjRPM)S=.Ee[^_]3rWVEZYt1ۉ] E"e[^_]E\j`EUj`EUEU!YY@tE9ƉEU!ЉE9]}O}t-9uE|#jjjuuE.)HPt%x=u\P-Ux=uOP+Hx=uBP=ÍP^wƅPha#jWT#5j PWO‹ 9u!##xԳ.Ze[^_]ËX.;P.~~P. ̶. T.‰X.US<.X<.ж..[]É19V-t @uUP`iYt.t.t|.t.UWVS.UjS EjS }tUuu YXtP5.} ljE5Ķ.5Ķ. 5. E.EĶ..XZ1e[^_]UWVSÉ։9.~.Ķ.< +t[^_]UWVS׉ˋ5̶.V̶.Љ[^_]M=.tt*ttt t XÃ=.u[USjm50.蓀ZY"t:t1ɺNC=p.t#t1ɺ*C]Uh%#讽0.PYZt 0.?"h6#艽,.PƽYZt ,.G#jh=U.jh,UĶ..h.h.ނh.Ԃh.ʂ h.轂1|.ZU1}]á`.d.Uȶ.1<.1̶.9ȶ.~".̶.Ķ.1ɉ ̶.@1X.T.P.h.L.H..D.@.(.t.p.l.`.d.h.(h.h.h. h.1҉|.UWV=.uu uƉXZ11. .u=.u u$ZYtl.@=.tʺ@b P<-T<-.ut79MM |-M9 H<-L<-U |l.@x@l.c B.9<.H1Ҹ WVY^1 tj uVRP;FV衤ƃ1.)9~1Ҹ G19tD=G1Ҹ <.X.e^_]á.t.=.u .DUSȶ.9̶.~$Ķ.<u.Ph.€XZCԡȶ.̶.<.X.]UWVS]u }Eu@0tjxYEe[^_]騣=.tW~Z=.tw/P'x_uSQ~[ۃ̶.~K1S|YuSWV~_ZVĶ.t2dZYu̶.Ķ.DV c_tW̶.uVb^ƒt .VĶ.tcZYt t.t.t.Ӊ؍e[^_]UWVSEUMЃtH.} u)}u#=t.M(.}tuEPjEU RPu ugu=.t[l.tR E..ut;UE }EU ..(.u=(.tr1ۉ(.1D=(.uf=(.uJ8u u1ɺZYG9{Ft|.1k À.ك}u E1O. ̶. E1~RjEPy ̶.1҅~ Ķ.TRPuu&Ã=.u}u9EEEE55X.+5h.Ee;5.'EPv_.9h.uY=d.u=`.uEU `.d.1=.~+9=.~.81ɺGh.w|Ym19}E81ɋUG.9h.|1}uEPh.|XZȶ.9̶.~Չ19ȶ.~=.   Ķ.<<@B)5̶.h.h.9.}1ɋ. JKݸe[^_]UWVSƉPq[=.t<X.+h.;.~u u1ɉZYuFu1e[^_]UWV։PsWV ~ e^_]UWVSƉ19.~  .t .)C1[^_]UWVu} =.uWV1ZY ie^_]á̶. .X..á .̶..X.UU1wR50.wZYUS]1w%SZ1uS5,.vZY]UU1uj jL1҉PPYZUSE] xt+uxxt \tf1҃‰PTx6 G&9tu!ـuJ!G&u'@S$Yu SZt놸]UVS] uVjSu 93sPuCZYHte[^]UWVS ÉUu} L.Ex.=.uuSx.Zt t.1L.x.dSPEZYtJHWVM^_x.xt p.Sh. yWVMZY5x.( 1x.Sh.xh.k|. .Pdyh.x|.@}|.2..9h.}%h.xX..=.9=h.| ̶.̶.؉ESjEP8tU$ t9r)ډh.w5x.] 1=x.[^0x.t D.u"uu} U̶. p̶.~@9ȶ.| .|t Ķ.D0tu u. u#uWV11ҸJt1Jutq.ЉERj]S*sƃ .E9s=)У̶.RjSsNjĶ.̶.?4WtVL)X.~뫣L.m}̶..=.uL.PapY̶. Ķ. M9u3_u(t M:H.t E)M Ma_uM.UK_uFM@t>SrZt H.E)̶..PoSPYtE u1L. t.t =D.uuu} U X.+<.4W- .~9|0W-)ș);.}s.)WVe*%U ZYu K=.tw.PmYtu} U؍e[^_]=.t+=.t"SqZtSarWV WVMUmZYe[^_] UWVS]u }@.t4 u ti5<.58.1ZYt 1@. p.t =D.uVuR=.@. 58.=<.1.._@.1ۉ.i뷃=.tH=. . . (=.t.un. .ÀuWV1҉ZY%=u+%=tSl.5.=._1%ul .A. .9Ph .'l[^5.=.th .lWV .. 0.1ɉ .<..P.1҉..=.uufe[^_]Ã=.~U..1҉.]1UWVSQu} EE@.tt t5<.58.1^XZh.tl=.tc.;X.P.X.T.̶.Q..D;X.~ .=.u.;X.~1N=l.tX.@.9}Թ Qۃ=.tt =.u =.u 11Ҹ *=.t&}t 1Ҹ 1Ҹ11ҡ̶.e[^_]UVS]ȶ. Ķ.ށ9̶.~tu ډ@[^]UEж.E .]USEM =D.t)=.tu ~JH1҉ ;<.9~.ж.ȶ.)ЋĶ..[]D.1h.UWVSQSMQyq uu RPG\ZYuh[ƒt1ۃ tt t.t[8.H9UUt Z.[C뮋 .t .teY[^_]UWVSQMQyq 19| RP[ZYu.X.D]E t$t.u}tjU.Et ,ZL.UL.T1;.r H.E)K.Uz11҅t .ىt .eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQjPhUt!SMQPEEPE E1jRjVE)E뜉+E)Ѝe[^_]UVS.1.SutFjjP t.@11ҡ̶.:.e[^]UWVS5..j:Y119=.~ !AtRP X.9}G؉5.19|)e[^_]UVSu E!y=V'Y@ w>uVV-SwXZ1jjVM u뾍e[^]UE1҅x V-]=.t&.tUSJZ P+JZ HX[]Ã=P.y-U=.u .1.jh`#A5ZYáP.xW@dP.UWV1ɉ P.5H.=L.,9Ɖ}jhx#5P.XZe^_]ø`. @= .u1 .`.`.T.@.....1҉.....1ɉ .UWVS EE} MEE..t"C 9Ku}9{u E9C֋s`.T.t `. 1T.ЉpHMH MHxC;4-=T.u`.PHE8}.t'Xp9ډ} EӉEEډÈ}tET.T.@B [^_]ÍL$qUWVSQQEU=.t E]!@u 111]9؋]ع5..tF U9V}}6E9F uE9Fu N^*H.L.1=P..~t-uF"Hhe$(V(h"( TEj舦C'j9jWjEjۜby uXh#Xu>h!":tu R5_UVXtˋURUdÉ<$ZL$QMt5蔻WPURh\%MQSs W2 _urVZ5YSzS j u#ujVj8}t&u'h#'X,j &u& VC.u蜬X1҉Ue[^_]UUWVS]EEEEuu OZYt jh#hQs"S苎YXujh#,XZFhe$&S&h"&A%j 8jUjj 衑}u}u)NÃtNN@u,E UM;M MM|E UƉ @tt t MÃuVWjj &j`Ujs7B.jTe[^_]UWVSu6EU_}u }tcjT/Ɖ[u u11j:/Y}.uRP*M9Ή]| RPuuBu @ujjuuWVu 0e[^_]ÍPw k.GPw'k.1.'t'.#tUEEPh#**YX1ÉUS.w$tX.'^<..1....tP X1..mNt jh"g.K <. ....jh.{/<...Y[뉉txux ujh#5)XZ1]UVS.1۰#4t'5t C'Ca1ɉNF FFFtP Z1FC6ue[^]UE]UVS E%tYu EP.UEY^u uT@2M5<.sS CKCtP Z1C.e[^]UEt*xu x u]?@ @.]U Pu]jEP-UEYYut@ <. ...E..tP Z1..UWVSPEf=.uJ=.uA=.u8<..1.....tPr _15.{u#jPs蓾CsH 1ɉKs {SC;<.u RWV UP號ZUte[^_]UQMt<.9Ptjh#&XZP@ UVS]u <.1k9.u$9.u9.uPa~#4t P'@5u1҉[^]UU19.uǀ.ǀ.=u]UWVSu薾[1.t:PPV诀 uE.. 1҉.YS Xue[^_]Ã=.UWVSu hg#up. C Suu.ue[^_]j }WRP` su sʽXh~#VZYtVWsPh#ujpUWVSEPU8mEP8 UtYÅE8 u@Ej URP!ƃ xuu=.E8 u@Ej URP Ѓ xCU: uBU1҉SK C9~CCtP Y1Cu,CZe[^_]USE] =.t1E E#tS_, .XLt1ۉ] EA#u=@<-x1ɉM EU#^S*á .ZtP XS茫P軦 .S 5 .K]s@=@<-y1ɉM Ep#]J# .EEPh|#4#XZ].c-x$Ujh@BRP.RP.USEtzE 8.MU u4@E Qh7%RYc- }t jh#}Qh7%RC }t jh#k.c-ac-y.EEPh#>Ph#j ]ShS`|~P|0uD]EPh#"XZ]ác-x$Ujh@BRP.RPh.USEtzE 8.MU u4@E Qh#R<c- }t jh#}Qh#R& }t jh#k.c-ac-y.EEPh1#>Ph#j ]SgSC{~P|0uD]EPhM# XZ]US] }u!jSŽYZt]EPhq# XZ]US] }u!jS^YZt]EPh# XZ]UWVSUE t tP(.^w=.t1ۉ] E#e[^_]/ P['PR蠗?UZYt]e[^_]3"SƉ׃utS莗5.WVe[^_]USEU tXtugR%(c-YYR&ác-Zt=c-tP XS|P諢c-YX]] c-EEPh#QXZ]US] }uC=h.tS'H.Y,.hqF%rrSlrXZE@]%r]UVSE] .E.*.~#tRGYEEPh? #XZ]UEtHw1E EW #].]U}u=.u]g.]Q.]UEu=. M.]UEu*=.~!EEPhh # .XZUEu*=.~!EEPh #.XZUEu#=.t=<.to5Bu @u]]UUE t#u?c-^u2@t+c-!c-PJFEEPh #@ US E1ɉ . .E 8,t)EPha5$E P }t jh #3.E 8,uf@E EPha5$E P{ }tjh #XZ7.05.5.hg$j]S]]܍EPh #u]UVSE] J1 RD+~vQQ r/d~Q wG$G&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPh- #1CSPh.Y.E sEEE sF@tK@sN@ sR@sW@tY @AuU9uE-EUEPhH #XZe[^]ø=.u=. 1=.á. .+.UWVS }8uMEPh[ #Y[1bÉUPn$@PƋUXZt=.t <\u {t C<$ut PWSGZYtFFC؍e[^_]U@uPhv #j*h.ZPRh{ #j*h.vZ.UuBPhw #h@.@.UU1t 1BS]UUN"t B tB]U}ou<¸A#u1]1=d.Ud..EEPh[ #KZYUWVSu ]E0`_18-u@JЀ v#tuKuEPh #&j uP yu˅tӉuEPh #Y[뾅t1҉t؍e[^_]UWVSMd.tFPtu)QjP_XDd.ZjPEP 15d.1ۉ]1U:BE<-t><$<~,Ht<+tO<9 ~1EM؉Uu7u*à U܋M~ZEE܃߃A<vG}-tA9u}t%9~-7dZ9Eىu1ۉ] 1ۉ]EFt}u Er]$I}t}t E1EEȋu} t tE Ee[^_]Uh:#zYtP轎Z~c-øU =h.u[h.-RZtL1h.EEEEjEPjv M9 .tt._kh..;EMMEEE=d.t=@.t=.uc-=.tuPjEPPw EufE=.u);>c-9u t.&P\Xʃ=.t ƒftըu1ɉ h.uu uv 1҉h.=.u&u`.@`.~Fj.Y<1҉`.y!q8mp8#_M9 .tu1 .Ujh.PUQEPEUUWVSp0ƻ ubÉ4$a|$WVuh "WP1N؍e[^_]US]S蕻 ZuShJ#hl. l.]ÍL$qUWVSQ Yq AQEU}WRPq1bgˉE؉UM܋EuƉeWuuRP'gu؋}׋EUE؉U܋E!E1҉UԋMЋ]M]E1E9M؋Er1EEEUeY[^_]aUuujjdu uUQMAQ jhi@BЙRPq1U EEUiEi@BEjEPtXZUSc-.t,c-.Sh.5c-r 9t .]UEc-]Ã=.t 1.s U=c-.r|c-Pc-M1.E]UVSPt.t .E1.EPSXZt'u> E.Xu{ VoYCe[^]US]t CPJX]ÍL$qUWVSQ8QEȉŰAEċA Euȋ}̉3E3U)E]uu}MQuuRPihK}ЊT# u؃}yC-^SuEXZeY[^_]aTUVS]1)EM}IT#uyA-NQu 3EXZe[^]ÍL$qUWVSQ 1AEI1EEEM؉E܊PЀ wPwW PwO79ʉMЉU}?jjuuuu}W/;jjEԙRPuuW9 ]F8M덃}tE0ƒ}uEUeY[^_]aUWVS1E1EEEEPЀ wPwW PwO7;UU}AjjuuMSQuVs:jjERPERPV69 E8늃} tE u0uEe[^_]UWVS1E1EEEEPЀ wPwW PwM7;UU}?jjuuM1SQuV9jjERPE1RPV8 E8댃} tE MuEe[^_]UWVS U] 1<%tJMP~XBE؊B<%.e[^_]US5à Hw ot tSRX]UWVSu} .ouWV"XZE e[^_]$=.u`~h.WVhc-n.\B1s9. .e[^_]@UEU E !#E!#e#]UVS]u .uu ]e[^]c-P-ZE #E~#؍e[^]KUS]tu uR4=YZtg=. .j ZQuj>X؋]UWVS]uE %= .t >t:SqX$PKfPjjjjSPwf$9twVQ Xnjjb1= .1҃=. PSWo ÃtW _}t-jh#[^tP6 ZY>1؍e[^_]US]tP3赬 ZY1]U1}]UWVS|}ue( u iW[E E .x9s^U xu Yw 8u 9Ut 9t'B@9Uuu>}1҉W1ɉNG랋E10E18](11}$1ۉ]]uuPEPjWu ƒ1ۅtEUE}yȍI|5xj9E E HMM9|_y1UE1ɉ e(s )؉ùE(tE}|9|u1Au߉؍e[^_]Åu1뎋M1yyuu$!#E<:N<%<.uFu RPY[ +!@ *u5<.蜋_vG9^.1u؍U؉ƋU؍C<6$H& .1Jk.RY19. .{9)ISQRP[[u  u11ERP[_19r .+ .ISQRP5[1.N5<.5<.P5<.PDwS覢 x(t u(5<.pRY EӃMЉ]1۹}9}RP薿Y_9nRPZXZH'u70EЉUsӋEЋ}!@ȉ9څSQZREЉUXE E)ӃMȉ]1۹}9}RPϾY_9RPuu@'u j ]SRPlWIx u ȁ .wt .1&t $Ek/";5<.KZtP X@= . . .e[^_]U5c-USH.=h.t¡c-u.PE1҉D.]U5c-*UWVSSË@ 1uuC1uEl@tg}tC E;P p$}p tJ;V ~$}@}tՋpt%lj;Pp|;P p$| putC C 1Z[^_]UVSË Bpt9QuAACPrt[^]UVSË Bpt9QuAACPrt[^]USË@tP Y1CS5Z]UWVSNjXt 39s|=jjj,VC 31CCGtX_CPSk,C e[^_]UWVSÉυu/1ɉH . .13CP_ 1ɉK^։UR8IZ9Us&RUjEP!Pk Utܺ1҉S .t  .SuWV>ƒx6Ct P؝ 1CZVH@$jCVP/{1e[^_]UWVSE֋xtBE3ExMAA ;NF |"Gt=NjEFOW9M}ԋE9G(u։NV ΋O W$9M|-G뿋EFOMOMW(]9]]|~E9G(uˉV;NV |9Uu=NV 9Uu9MuuwG\_ t;C$uE;C u K S$=EÉGxG tC X_ h9UuC;G$uM;O uFV G W$WtNZ9^ u;JuurBE(ÉGx GtCX _;C{u 1szp9uHtyt1ۉZY@9Zu9u E[;Zu;Pu E2[1҉PB;XEu [^_] [^_][^_]-.uU5$.Z1=(.UWVSE؉U܋uE)ȋ} )ϋ M]܉M]UUX9QDP9u9u>EU܃EU9EE} UL.9}EU܉EUC뫃[^_]UWVSEUM}EȉE΋E?UtW tP9sFu h@ RPMEUu  @P4E4MEU Cuu h@ 7PMEU9r9ut6F5,.jjWuE)PV5(.5$.$'e[^_]1$.(.,.4.UVS=.t 5p.}uufp.1ۃ=p.uDSgYuu C.H9RPSjY wyr5p.e[^]UWVSP<-ET<-E@u }H<-EܡL<-EH<-L<-P<-T<-=p.u e[^_]=.t11.H9~qWEUwZ}u}tQVkUXE9E܋E؋U|59MEU|!Au#uuoWZI `x t e[^_]Pe[^_]UWVS]3t~v 谗 V誗 ZY1CCC `.d.h.l.e[^_]UhL.XUS]$.#t-=L.ujh#XZ]1=p.p.E]Uh<.'XUVSu] t1ٸ<.t;pX[^]UWVSEUE|E x.p$l.h5.u8.tXsmS芎 Zjj1CCCj y]e[^_]J 8.C8..e[^_]U€u1=8.1]UWVS4h.l.EU`.d.E܉UtE؋M܋]MjEPjujuuu $`.d.u}u܉}Mut}9Nju|M܉]E܋URP ZYh.l.9E}|!@uc1}9}}Uuu[^tDjjuuƉ׃t$EUEUu}M܋]Eu׋EUh.l.E܋U`.d.,jjuuEU}u}tu܋}뙍e[^_]U jEPXZ}u}t j)jRPuujgUj1p.=l.u]]USj5LO-#ZYt8jٸ$.Xx =l.u=p.uS1]U=0.u . .$.,.]xUWVSU EEt :CM@tE3,. s+jh#Eu jh#=l.=.=l.1ɉ p.MMM1ƉӃu]5.+PXZe n=l.=.jh#_XE:jx^@=p.@1ۉp..1EPM$.Zxl. . j1p.#X=l.t =.TƉP.u}tp.xu }@u}uQ.HEP5.X}tW&jjRP艞ƉӃ*W ƉX}CjYj111 ƉXF=G;=.}W؃&MxuƉYjZGMEPjEPjuujjE Mt=l.t =.tZ}~TJEu2EUutjEU9u9t5.RPy =l.t =.tjFXEe[^_]UhPjJ< t.XZ=h.t.Uhyj!< t.XZ=h.tUE]Uhj; t.jjm=h.tU}tOhj;YX=.uyPj;hPj;jjx;hjl; 2jj^;jjU;jjL;jjC; jj7;XZUWVSt.1҉t.tijj ;/jNjj:jj:jPC$hyj:j. tH=.5.y9=.u95.t.@(.h耲.t=.tj"Xe[^_]UWVS E։ϋx.SRUc.$EuUR u.{tUM tuWV袠C SXZ1e[^_]UWVSSE։jj)u-$@PCuPs {E C}u1C%u-$@PCuP؍e[^_]USc-c-t%CBsy sq Sk 1x.|..]UWVS5c-'Vh"P Z1ɉ .,[ÍhV0 i!tSVϿ uNJ< t< utZ8tPt u9_8bPjP蛾 u1Px^u ȋ8t6t2\uG@x9tzP‰1Ҁx$‰uH11WQщ‹Mc-c-Pc-.ZY{X=.tc-x.|.1e[^_]UWVS u!b1ۉ.c-c--TÅ515.h#AP>AZYqK&STYua*ZO*lj4$E*$L9QZVh#P9tV Xh"W>2W f;?SQTYSBTjjщ‰c-c-Pc-. VhP th=t.t-tV/5XGP7)_t u Ƅ@t V詆[ u- u-DH@ZutfTP@tCu* fLHt@u C@tC fLHuDPttDP@yulDP@tG UDH@cBV4Zt1x.|..%c-c-tx.|.1e[^_]USc-h#S(ZYuwh"#Sg(ZY¸t_h)#SO(ZY¸tGh/#S7(ZY¸t/h~#S(ZY¸tjS;ZYxPn<X1]UZu E ‹E2ttHu jh5#jhB#jh[#XZÍL$qUWVSQ x.p x tWV虛ƉY[jj1EUXZt.uBEPEPWVNE؉U܃E EtEU}u}ujhl#=Y[=.tuuuu誗=.tEUju4P4ESj:jEPuuS"4(eEuz Sz XZEЅu u؋}eY[^_]aUWVSx. |.]11~1t2c-t AFKމt x. |.[^_]UWVSx. |.]11~1trc-t IFK݉t x. |.[^_]á.á|.Ëx.tUrIZøUjjZujh"8ZYyjP8ZYxU.]øURSjEP5.hU ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPx Z1CC]UE1҉P]USUBt XZL[]UE]ÍL$qUWVSQʋEqyIZJ ZrʉWVEZYeY[^_]aUWVS]E EC9C|WtjjWVRPCPltjs3ZYtKljE3w XECHKM e[^_]US1;]}E Pu[CXZ]UEU 1ɉHr2P UWVSS] EEMȋEeƉϋE EtuuWV*M9u"9uu uEZYe[^_]Uju-jh.UE=.t&uf=|h-tEz#]S.@]]UVS0.1=.uD.1(hj-XZhj-Y[h.^tTjj,XZjj,Y[h#0^.u 1"15|h-=.t j[P ֋54.d-t,PVo!ZYu.8@1ۉ.#Z8,t@8u݋8tH58.R.PZY.@8tSXh"5$.^Xuc5$.h"| Y[#S$S5D.I& BP5g-P+ ^ZtbShV Nhl%P#^Zu @׀8 uSY#hT.#P#ZYt @׀8 uSXG(#8t%8,t8 t@Ћ8tH58.R.PY^.t SZ@.P y#Pe[^]U$.jj)XZUhӣj).XZU! .jh.  @-Q@-y ;P-| t8-J 8-Uh8-PXZUWVSREƈEj}W5D.$ f=h-tk1.5h-jW5D.71j=.t.V]"Ph#  Ktjh.5D.# 럍e[^_]USQh#,jj(jj(| Åt4EP Z9u< h #P,jjT(jjK(]jj=(jj4(h-j/S څtPjRSeh-h~#Xsh #j ~h-h~#=sh #j~USQjh#5\.. f=\h-t#E tPE Z+u}f= i-t WVh #WVhw # jhX.5T.%h.jj_e[^_]h!#i"X UWVSEhVh #F 'jh-"5\.%jjjjh.jjߡ(jhX.5H.*&sà yh #!X11ft#jpzƉXP5Y~G9uAj5D.詇j~jjjjV Vh!#`jf=|h-tjz)RPh-!#ejhX.5T./$h.jjjj! jjXZe[^_]UWVSE[hVh # 4jh-"5\.#jjjjh.jjz(jhX.5H.$à yh #i X11st#j yƉXPY~T9uNj5D.Dj5D.7j>}jj jj$VVh!#jif=|h-tjx)RPh-!#jhX.5T."h.jj菟jj jjXZe[^_]US,]S5D.h+"u].u M e.Sj5D.h.jj ]US,]S5D.h+"uEu %ESj5D.踞 ]UShSh7!# S'Eg-[tEg-jh$5\.{! Uh-tUh-5h-t5h-5h-t5h-f=\h-t_h-t$h-f=h-th+"ht#uY%i-t%i-,i-.5i-t5i-jZEi-t$Ei-f=Li-th+"ht#X]Ujh{t 5D.wj9jhzt 5D.^US]Q1ujP "XZ]US]CStu RZYt1]UVSEh>!#PZYtPJ^yhP#Ou[PhI!#hPH*ƅulh-uq$!$!X$Z!$!1ɉ $Ph"SSju*h%"tXm!Xa!X1N!$h. à '!XP>Y9u tth-hQ!#bXZ댅yh#txuPh`!#uPhp!#h- Cƃ..8 u =.vH@.e[^]USErjPh`.h!# uxh`.hhPR<.yh`.h!#ZY?hSh # t h`.!S 9X<uY8C L{ t VWZYtAEPuWoH YVC Zu h)#Xc9s ts tC Ke[^_]UVSá.H!vd3VY..Swt^'@-H@-x&8-P8- .P."~;P-}h8-j XZf{ u<@.@-H@-y;P-|8-P8-!h8-j!^X3hX$Y[{Vhu#.C ^ZtaP;.s Vh)#>Vhu#.C Y[t'PP.$hX$W =."~1.ho"BZe[^]UWVSQu E]K:EE<\t<^up{tfKG^KCxЉwŠSzЉw>)#t18uG(NJKyЉvK KNjUBbM8t1ۉZ[^_]UWVSS]h%SS^_ug@g-; CteE0ƅUB@tY[C=.~ho",1.Ze[^_]UVS@g-t'CtP~gZtC C tC C 5h-h)#hSmh"SƃtJVhSw t0=P.t Sh*#YXj SrYZtSZVZX%g-e[^]UVSu EWøtACtV‰[1'h$u ZYu VX{Սe[^]USSjh*#5D.j]EPhf@5D.Eu9jhxt 5D.jhyt 5D.Kuh*#wX1^(~(Ph.5D.Ej0h.u(jOh.qZYtjKh._ZYn]UWVSE1ɉMh@jE[^1=t.h@.Ztuj^_1j5lg-Z$EP5D. jZ[]]1uY9sE:0u}FEtjjvXZEe[^_]Uh"+#Gt.jh@.MUQjhxt 5D.jjhyt 5D.j5D.! $jrj5D. jh?+#5D.E+#<3t<0thH+#h_+#XZj!EPhf@5D.ujh+#5D.sj j5D.| jhxt 5D.:5D.UVS,]2mf=|h-t h+#Xh8-TuV5D.M@Vj5D.zj5D.  jh+#5D.o"o"jh+#5D.؊t =u,@S$S5D.ljho"5D.Zo"5+# ؀1uj5D.F [^=t.ujjh+#YC<w3$4L&hF%h"h+# h+#h+#ZSSh+# h+#X1o돍e[^]Ujho"5D. HUVSh,# M&X$%1tlRPh"%h-CttHu)h-h,#h-h",# h-h(,#w@YXA4#u,#Fh-j XZe[^]UWVSf-fuURhht@P Pu fEfth0,#LN&[ $%tIt>UQMY9MU~ ,#QRh"%h-ÃA4#h-j XZe[^_]UPPPhH,#h-w.t@th.XjPuUhH-#hL&hqhV-#E.UWVSSt ÉֺLN&"h-#hL&hhV-#u :u!USPZZYUu=.e[^_]VSh-#z`jUEuh2#hL&hhV-#@0h2#<1UEuh2#hL&hhV-#m@0h2#1UEuh2#hL&hhV-#7@0h2#1UMuhX3#h;#r4h^;#b 8hx;#O@h;#?Dh;#/Hh;# e[_]UVSh<#[1H9~D^Ph%CZYj]Xe[^]UVSh<#Y1H9~(D3Ph"DYZ9~j:ZFh#Xe[^]UVSfxjRhV VhiSJ@u h<#j{91e[^]UWVSDu h<#j%9jjjlH @uh%0jDS襰ShiH@u h,<#j8uɋDH<1DžDž?ڋD1DžL`jDV\h9<#h8-p Vh:iH @u)Kt&j. h8-=jm1҉ 8t.e[^_]Ë @-Q@-y ;P-|< t8-J 8-Uh8-PZYUuPPhB#h-|jh`.W|$wUWSˉ1҉`.M]m h%h}fU fUm]mURp pSQhm-0hE#h-$e[_]g_UWVS]E }܍p(}p4EPS7Y^tShE#4XZe[^_]UWVSPu} FM% FVFt5RPW à tF1ۃ8t/hm-hE#I4[XRPhm-à tŁftvWZYt#/vhm-ZYu}u2}u$hm-hE#3Y[}te=h.u\VlU1҉UtRWuZY@uT8-tRhm-ZY@u"~lthm-hE#a3[XuVhm-VZYt؍e[^_]UWVSx.dt2hm-=hm-Epd hm-!jjEp` @EuphX$2_X-xP=.t . .t 5.t2} F=|.u:xPhm-|K[^@} 1ۃ=|.hm-hF#h---H- yh-Y-P-0 t+@t( -y h-̯Z-P-Ѓ߃Yt`_(,hm-h}$1`i DždWxPhm-I[^@t1E%=tEjhGPhhm-%à uA 5.uhm-hX$khm-*GPhhm-ÃtNjOGXW\X\t;X\E@hDžlm-X\ptX \TX9и\T<0XPjj`jjPjvTjwXP: X1ɉX\vRLP)TPS! L9thm-hX$/XZDžd:)։1X\=`.tX\hoPTGY^EphX$/XZ=t.Džd1X\t~hh/`ƃ ~KVh/S8 9thm-뎉X\=`.tX\htP`GXX=t.u`0XM=t.t#S`$Y^thm-hF#'.XZ`^du S[zt.dtSWLZYd=t.um} tgG t^.9GuTxPS諱Y^thm-hX$-XZDžd$E9Gud.#G%PS*Y^uS>Zthm-hX$N-[^Džd=t.tWhm-9ZYde[^_]UVS]hVs u shjj h!# SQj]ST@u hH#je ShH#XZ=5`0FډWVRPH#=<0tH#RPQݗ e[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-PMXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpP80tvv RhH#Ã=0=@0tBjj h!#v\vXjURշ@Uu hH#j RWhL$蘖à L `0AF`VdEUQRuuH#=<0tH#RPWQJÃ0 0Et*=(0tU]Ã=0u=0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPo7EZuEH#EC u= 0tECu}EUE؉U܋=x0} |0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut'C  CtNV [[^]UWVS(]jWx0|0X=0uEԃ}Eԋ@ ẼM AqP=80tvv s hH#;=0F`VdẺUЃ=@0tBjj h!# RPj}W@u hH#j&WshL$ٓ K `0AEUЉMMuuRPI{H#=<0tH#RPWQ茓EPvEԋxvs$EPhI#c=D0u7s,h I#H wsh I#5 =H0twsh?^# F%= u9N % 1RPs4%1RPs0hI#ӒdVXN\=@0t3jj h!#QRj}Wų@Ws(hL$葒 "{(H#=<0tH#QRWPm=T0tF(V,=0tF@VDF4V8[0 0Et"=(0tMUF=0u=0t@uZF%=uE@ Eԋ@z뭍e[^]UWVSu=0VLZt1w Vh=D#jP Xu hI#jWVSqShX$蛍S e[^_]UWVS ]SҟYD1 󫍕t 19)ڍPRSP ǃutAu$t?aC 1뉃u;p-sLt?0CQ Zu?t0%e[^_]UӫPh.I#h-ۏjǂ0U譫PPhTI#h-贏j蠂U EUuKI#=0tI#juuh%Ph "hI#B|hI#hX$WYXjJjURP1 @uhI#hI#-XZEthI#otRhI#| u+juh%hJ#h "hJ#{hJ#njURP貲 @u hJ#|EƒthJ#hI#IhtQhJ#hI#, JW|$wUWVSDӃ=0tSDy^_gjR2ZYu׃=0t;jD^_tDhJ#ShF#h- =0tjSאZYxtPS@^_ajD詐ZYuMP|ajufLju_Je*%V u!#SVPRNPhJ#h-> -yh-Xuq-P-0 t[ -yh-_u-P- uЃ߃Y=0tSDhI"" 18tSDh[#tVSZYu0|%=@uS_tSh4J#SsVDEZYu.|%=jjD ƃ y D|hS@ yShX$V觯 =0t18<Eܣ0P 0_uj1ۉ0VQ@띉8<=0tt1ɉ 0߭8 h%mٽJfJ fH٭H۝4٭J4Puu<8SDhE#h-$5050V苭ǃ ~ W50@0 9 q-y hJ#jbt)tSuSu* XZupuhY[etju jS "ju jS J#u"ujSVV@y hJ#ie[^_]UWVS ~1ɉ=(q-u,h~P50q-裪 ~fDžDžVhm50q- yhK#0j諧 7fDžDžVhm50q-ˉ y 蠤h9K#h~W50q-à  thcK#h~W50q-˩ tNhJ#`fDžDžVhm50q-? '(q-tithK#jXZ fDžVhm50q- y"谣ShK#0jq؍e[^_]HyUPj ^XZËJ UWVSH]0q-tPX0q-1=0=d0=`0=0=h0=4,0u- D904q-8u150q-0L#0jH50q-0q-10+PZ@u0%=@u650hPL#j50q-覧0q-10= ueEPhm8@50q- u-t%h01=0h0150=`tojjj50q-蹅Bu @u l8t)1ۉh0u-80<0EUE EtGvh0u-1ɉ 0]h0u-1҉0u\: ;uu- \20X20Tq-(q-1yud5X20~~PtH0P}vKX20 Ջ5\20H0P}vFX20 H0H}vt4 -t X20Jt X20X20Qu)5\20tRVuu u5X20}X20~~1E t7MWVuuӛ ‹Mu}t X20E}t5X20u X20(5X205Tq-ye[^_]Ã=h0u =(q-U~h~P50q-Z (q-1$q-=h0uNUjjj50q-y譝hL#0jo RP50q-Rq x11U=h0uhL#j;XZ$0t505X20hL#jUWVS] }1WSu莢 ~ )ƅuƉe[^_]UWVS] }1WSu ~ )ƅuƉe[^_]UVSUM (q-0q-=h0u;QRPà ~Gd09X20tnX20tb0VQRPơà ~ d09(q-5,q-t-VhM#0jVh2M#j ؍e[^]UVS] 5(q-Su50q-ƃ 9u$q-d0~1(q-h0tH~N;jjj50q-謀)RP50q-o ud01=$q-8u1(q-8EuE8t8EP8 uhSM#j謜1ۉ(q-^X1迚8u 1ɉ (q-s訚8t螚8u݅x QF=$q-uh}M#m5,q-h2M#j> 뗋,q-WShM#0j@$q-d00Ht u hM#jh N#jܛXZe[^]Ã=\0<=(q-/UWVu-wh=N#j薛XZ=d0h0u6~OfEEEPhm50q-~ y`0~uz1=d0]xl15d05H0~SuOjjj50q-g~xFjWVRP`)WV50q-<~x(q-"1ɉ d0=(q- hlN#hN#j蓚XZ1e^_]ÃUWVSPE1҉P1;EE (q-h0jjj50q-}Ɖ׃xtEU =h0u80] <09É}EjRP50q-Y}y%hN#0jК(q- )}W =h0t1e[^_]ÍL$qUWVQ1y(q-Ih0u9hO#9jjj50q-|y(Uh/O#0j (q-)y11҃=,q-~h\O#ZjRP50q-F|hO#~X2019}oMQRPWV U UthK#j茘XZjfEEEPhm50q-{ yu肖VhO#0jC'(q-1eY^_]aUWVS8-=u-t-P+50=0X u1=0=u-Oh 6#WV5D205@20胔RPVhO#hW~s5D205@20hO#hV\s0WVhO#hVAs}}t^=0tU5+05+0hO#hVsVh0h P#hVr(V艆$Vj. =u-ubht$4,01WVRP脓RPVhO#hVrV54,0h!P#hPbr0h 6#H20L20@20D20WVRPRPVhO#hRr5L205H20hO#htWq05D205@20hO#hVqRWV54,0,q-HP00h2P#hPq8}uV50h "S[v%V$Vj— }*e[^_]Ã=0q-y14,0d0`0UP0 ܳ0t@=h0u7=̳0t 050hcP#50u50f=0tGh050q-pZYu10%=u <0 80u5010X=u-w=0t q-~ jP臘YX50q- q-Z~jURP 0 ܳ0t.=h0u%50hz"1̳050e 0q-d0 `0u 14,01d0`0=0t,q-0 ܳ0t̃=̳0t0J1̳0=0tg50hP#؃ZYuQ@20D20 tjhRPRjh5L205H208RPhP#50tj50d14,0ZYUVS Sh0j趕 yhP#0jݓ jSj芕 yhP#0j豓 5\0=$q-B 506=`0u50hP#[X0hDq-S貂ZYjhR#9h SRxhK%SہZYu5\0(q-50haR#1̳0[^|tFu=y밉؋]Ul2040=u-u>\20t5=~~ h~Ph-W#thPh[W#jy@50Zx%X20l20h20d201@20D201 yl2040Tq-~X20~UWVS0t hW#jfX20=\20Tq-u\20 yIh20+d20EU EUTq-EEuuuusu})׋E9ƉM}u}WVMZY+u}l20 Tq-19}dd20 h20d20;h20s5X20PY_d20+l20RP_Zxhl20Ɖ5d20Tq-h20 h20d20Tq-X20EU)@20D201ɉ H20 L20zu-hW#jwXZ؍e[^_]Ã=Pq-US=u-uhW#jvXZyx1ۉ@20D2015Tq-5l20ZY~%l20d20‰h20@20D201+Pq-~C9}Ph!X#jTv yu뙋]ÃUWVuM d20)ȣd20^_]UWVS$]CDž$$ x$|$x $=0u15xPu lQ^_y狳sVh>L#0jmvPu7QZYud%lshGX#0j(vۉ15Tq-5l20u xƒ l209|Ru -WQQRu<9uUy%rVhoX#0j@u79|$u9x$t hX#jtZPu OZYyrVhX#0jtNjE49}u;0thX#뗋9}3t)1;x$|$}Ru ye[^_]Ã=`20t1US5Tq-5l20ZY~'l20d20‰h20@20D20=u.=0u`201$x1@20D200]ÍL$qUWVSQ Q1ɉMM u15d20=h20)9}Ή5d20)ډ tƋX20]؉}܍MQWSRPkƉ׋EUEЉUԉËU֍ ƉύEPWV yEU)u}@20D2019<h20+d20щ9|gx t%u؉}9}M؉]܋Ed20+u}뢸eY[^_]aUWVSU Ӆ~Hh20+d20U U  )څ$ 9~؋5d20}5d20)É}봉[^_]UWVS}x$|$hlGdDžp } xAxPu LY[u]%ndhGX#0jqۉtE1҉P`1h9Ɖl  h20+ d20 } ^ș9hl}hdSpPtPQ5d20u O]hlS} yE] Cpt1;x$|$5d20=00\t`A9\u\d20)hl} xdptZ;x$|$}L pN;x$|$L#0jl[h20+d20~b9}P5d20u o )d2019|5Tq-|^y t haY#UxPu FZYy iSh>L#0jk+0}94u;EthY#jj 1thShPY#뮋U Ze[^_]UVS]E xz$usPoZyihVhY#0j*k$tAP&Yy$7hVhY#0jj$誮 1$0Ze[^]UVS|]s|PVXYxS=0t1F $M9$$u0;|u(,$U90$u;EuVhY#jki 뻸e[^]US|]EPS.ZYy1=0uOE%=@uEhK%S^YZYu\SKYy} tgShZ#0ji/SޔZy50o:fShY#0ji̋]UVS]EUdh1ɉlE Upt1x}=u-t =u-|PS!^ZuZ=u-u#EUdhEl=u-uap#ƄWVZYp` `D$@$WV:WV7fVh[#V P`eZYVh \#j_ U]lt lt)w$V#pZYxDžl=ȳ0tVh%[#RjD`뒉l<$8$VO lxDžl0=0u =ij0tCi<$8$Vy =ij0t#($tA$u($(($$u ($.($($tbYX$50hP#NYZjV;BYZxPV$YZy+Z\thF\#0j_WV@1$H%# PVXZ=ij0u ($jij0 u- u-t[j $P3VA=u-u =u-t51$PjL$H$X$T$t1e[^_]UWVSu }SE8uEEME;E~])])؋ME8tR<9rt >8u9@}jؙRSu8@Zu h^\#E18}t}t:\0T0E\06SVu譽 9Zu h|\#iX0P0EX0ҍCtPR褝 XY Ph Yuhn\#j%\XZ>CPVЉUPdEU 0j\̍<+E e[^_]UVSu] }u1NjjjV?y YSh\#jh0V] yYSh|\#0jt\e[^]UVS]u x@P`X=0t*jjL$H$X$T$xe[^]UWVS(]} $(v(11ptWPu b^ ~ pt1@9uNjt9|$up9x$th\#jsZ xPu 16ZYyqXSh>L#OT$9X$u;t h\#jjju q=y$ XSh\#0jZp1$1e[^_]US0tP 1ۉ00X0um1 -yh-V/Yu9-P-9t-uu%1S 0 t뭅u tډӡ0A0u0 @0tϋ0zyP1ZO밣0j50h0„0 &1]U=00=0t0=س0t 0@=0u'h 谔 0Yuh\#jjXXZ1x0t9UVSut>uh*]#j T XuhE]#jXY[FVGZH~ 8/u3E ؉C1C=0u00X01e[^]á0t@=0t 0=0u4=0t+UE$u0tjP50e US=0t801t6{u+uhl]#j(WXZ3hg#h-7 [Ƌ]UWVS]=0u =0u$150yx50[0YtHHQf $Q&=0tȋ@PURURpp p0;9xjjuuuu졘0pph]#j6Vph]#h]#p jW Rph]#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=0L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RP'X y$0pRVh^#0jUƄ  ǃ$h 0pCP謲h 0rP芲50hP#jD t10@8e[^_]W|$wUWVS<ÉUMMQEPu}jë 9ƉЍM}Qh^#Qh'^#j@Sue[^_]g_UWVS\]uCE=0uPhg#V44 ue[^_]$}W($fT$X$E(j8$Ej<$Uu!#u!#PjRj4$Wh3^#V3$ w'@$  R%PhE^#|$x$hP^#Vc3uEPhX%VN3$Pw ShW^#u ShI"V3 Vj r,ZYV#Xe[^_]UWVST]}T$X$uV($eSWVh_^#aQe[^_]UWVS]u fVfuP)-Zt%t0SRjP}WiVWACۉu ]e[^_])e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVS EEU1} t EE1EED}u^9r^MHYW wY0Xu}u}} }u,HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UWVSS}]u 9yK@G?ș9GG1 Ԋ< u G9r11҃G11ҍO9OYЈ\$ w %Y\$v Y\$w\ D$G맊YЈ\$w0GD$9r h11Y[^_]UWVSUED1}uo9ro]H 9޻r0WHM] M] u uu,HM0Hu} u} } }t9sԍr19r)A9r)‰ð0E E [^_]Ã=0!u%U0hh^#jMXZ1ø1UWVSSu] E}MM1҉ 7=0u0K 009-u B0 -=0u" 0Q0u 001Ҁ=0t7tMM}E] ue[^_][E] ue[^_]ȉUWPZYtU:u W3h^#(x:u9-9} 7@-W3h^#h--?e[^_]1UE E EE]<W|$wUWVSjEPS4Ɖ׃EU E9Es 11M9ttuj,VZY…tUj=VY_DžUuh_#Uj  ZUuh^#jJS舏 jul0 h0Bh01h0Boe[^_]UWVSQÍEPSD^_u C #ƋE| t@E]S膆 Zud01 KDe[^_]Uh-h'_#Ԑju-t 9tUu-Uh-h_#螐h-h[`#菐h-h2a#耐h-h,b#q j~UWVSPuhqF%SAEZYhqF%SҦ_ZÊEhViYXuGVhb#0jOJ }t/1e[^_]UWVSlj/E 0m^_0t@E 0hf#P* Y[d0f#0`0111҉U11Ejh`q-h|10p0=p0u 0ij0u-c0T5 7=Y10o 0` u-G0<%80 7`0#0EH9~2MxPV XZMuh^#jFjpEƋ 7`0PM0>$100ܳ05 7E0ef#f0u-W0u-H0u-90u-*0u-0u- u- 7001xu-1ɉ `05 7"DZ40\0-E GEt`0>}15`0jP$Y[yRFEMhc#S2ZY;GCjP[^u}uhc#P<2[Z_uh~#S2Y^-uS(…u_h~#S1ZYtV^=d0tShc#zFtjP8ZYy*h"S"XZuSBhc#RU1ZYt8jhc#UR UujjRZYMpjP؃jSu1ɉ Pq-}J0t 88h|"莨0Zt 802" 0!"11jh`t-hd#u usz$S&1t-ă뿃 7\205 7hc#00x 70f 0 T0&c#E0@30΀0  7 7h-h d#轄5t-h!%h- 5,u-h!%h-h-h$聄0<%00 7ÉѣP20T2019| 5 7h;d#%thhRd#jV=X0 7Sh"h-ZYuPq- S$`0 - h-j Y[{%E1 u1u-08-nEE uu- Ge%1ɉÁ uu- 095 u u-܋E5 _u-.1 t\50hd#h- 1 AI!U&Pho$š-P- u-uu0,u-v/t1jj} 4 --9Em-9Ehe#j9ME M0PZy$j j} 4g^_'--;E|1ۉPq-e[^_]ál0t Pl0Ã=l0t[U00htjMYZF}uvQUtPU!uX1C<]t:m~-u Vt]t:E :U|^:EuĿ1}!9*A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puhf#j7D։9r KNKNp19r)XӋE}tE9r NKFC1e[^_]UWVS 50hf#6[_Vh+g#6h[g#|6h}g#r6h W6hK"W'ZYuhg#W]&[= u hg#&6Y덊uhg#6ZX<.uuhg#5X1t3L@LuL@L%H9s tFCC@9u&>t!tWDhCh#j3|tHL@t<uDhfh#h-N WDh|h#h-3t@th WD芑0 1e[^_]UWVS]t K΄u hh#4<\u FFu8ujo Xuhh#j2^_DžoGjQP蠚 t2hVP諁SVhh#jd2 Ww [띍V֊t\uF8t)F Wv Shi#j2YRpZu%տWv hh#j1$N1GtYuhu hk#j/Vi[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVhk#j& TE@jb Xuhl#j&Y[0t;u GM1GtAt0yVhXl#&O}thE8t`W yuhtl#j%Wj bGƒWt+G 9OG}Vuhl#j%WUj 1G=(0u=(0$0x=$01 hl#e[^_]UWVSM=@0tPÉֹ=1:t9pt@9u9U}tj:a ZUuhl#j$[^1p1ɉH xe[^_]Ã=L0u1Ujh e L0YZt1h m#j$XZ1UWVS}L0$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj.` YtGGPSZt0 $$$CSEC ECECEC1vSjh Yh4m#j#XZ\Uh 3 P߁ 1$$CHCUwC3h Sh [^e[^_]UWVSML04$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3[g X]e[^_]Kg e[^_]UWVSS=L0t51ۋ4t#1ɉ v0Eg EP g XZuC u͍e[^_]Ã=H0UWVjhGub H0_ZuhRm#j"Y^C}m#=050Nu-Z@u"50Vhm#0j"50MX1e^_]1Ã=D0u1Ujha D0YZt1hm#jp!XZ1Ã=@0u1Ujh=a @0YZt1hm#j3!XZ1UE$$ $]UWVS(}=@0$ $$$EUE 1҉EU苟,$0$E1҉!މu؉!ȉE9u9tE1!É]!ȉEܾ 1EE11ɋEUÅt#@ u9pu u90g@E]!؉E̋EU!ЉEЋEU3E3UЉ Ӊ] O $$$Å}uIE EtAj\ X11q $$$AQ C AK 1St$00400040 u+0040M!u!9u^9uZtL00540 t:Ujn[ Zt+UM܉HUPp K HC $$$3GPhn#jhNn#j$P @ $$$E؉,$Eԉ0$1e[^_]Ã=<0u1Ujh=^ <0YZt1hn#jXZ1Ã=<0tDUVS1<00tjjs sss3觵[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ <0=1Et#؋M9Hu9p u M9Hu9xt@$uj(Y X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!Rb XE n#Ee[^_];e[^_]UWVSEEE EM}<0tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3]a SWa XZ1e[^_]1UWVS]}E=0t";/tPS^ZuShn#j$rX YuSho#j. hS舠ZuSho#j ue[^_]` GFG4W8F VG(W,FVGlFF 80F580e[^_]US80tvC80=ij0u{ t s3hXZu- u-tjjssss 3輲=|u-t s3YX3_ S_ 80XZ놋]UWVSSUE @~ T@119}At41ɉMU1ɉrE1uZ[^_]UWVS u=H0FhGSPl <9tjww 5u-;Wu;G t |h6o#*SR5u-+{ 9؍tPhNo#0j SR yT$X$G9__W1jU Xjjj5u-G WxNS5u-z 9u)T$X$GWH0W8hfo# uho#0j7 W] Xho#j#ZYe[^_]UWVSQD0uho#jXZohu u Eޅt6u Y_tcvj T ^t;uƉYt#uGZt _E81QV.] XW'] _hp#ja[^0^SuZYtS\ u蟜F_Zuho#e[^_]UWVSu} D0t=h7V t&3V5ZYuusV3v [֍e[^_]UWVS EЉ1lj t׉ EE1EEL} t} t} uA HA@ AA4AA (HM0H]u]u} }t9sԍr19r)A9r)‰ð0E E؃ [^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=-ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u Vh6p#h SSyEVh>p#h SSy=VhIp#h SSyVhWp#h SSce[^_]USSˋ t%RQPsE3 Z 1U1ɉ EeveRu Ps ]URPhbp#jUjhoø1҃=d0t1UME1҉d01Ҁ<u=Bu} u,J=`0td01҃8]UVS]} ~;uqjhf#P@ u%=u-u u-hp#j0ZY1u-jjPƺ 9؍e[^]UVSiÅ3hp#VZY[uh6c#SZYt)SVhp#jh6c#hp#hp#j u-vSVh)q#jtt0o1e[^]UWVS]u hVZYy\- 1{ǃ4$K<vCVhT0\0 x RhP0X0 U jjFdPG%($jjFlP/8$jjFtP<$$jj F|PEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1$$$$ 2t|,1ǃ$ǃ4$($Qw\1ҀKƒ $x$|$ށ$1$$$ǃ$($w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%$1$$$1|/uDe[^_]UWVS]$Hwv$0V&=t0t_hOq#j hxq#hq#hq#Ń d~ Phq#뮋p3Sc~Rhq#땹1jdRP_n1ɉ$$$ u#EƄ5/jj o11_Z1u9E2jd PEPnjj o11wE1Ex$|$ƅz ynH0P t9uon19r)J9r)lj°0󪋅 thr#$%$1$0 0t50=0 T$X$($1jjWZY8$1jj_sZY<$1jjgRZYjj {5^_un1jjMZYuJhP٠^_y>jhZYx鋓$  Ѓh2r#e[^_]11UWVS}} ?jhf#V  ÅulhWr#VlY^¡`0 p0 up0h_r#j XZjjPƺ 9tPVhr#j ؍e[^_]UWVSu] hS2ZYy- 1~dž4$1E쀻Yt"h YPWjz/@E K<vM E)ShT0\0} RhP0X0 } jjCdPo%($jj C|PлEUUEщx$|$@uAjj P T$X$H$L$`$d$ƃH<$P)P yjjCtP͹<$ ƃ(8$P P׬ZYyjjClP藹8$ 1$$$$@$D$<6tL<5t_<2Pπ2 ډe[^]wUWVSu>-u~t2h"VN_Xu$&0RJ PVh`t#j[-1EPS_ZYt/G}vEVWhst#jEUt-u1 SXe[^_]á|0t UU RuPD5|0UVS]u F5x0tRPSR tD3j SZYu1e[^]US]}t 0ܳ0 0t=̳0th-j 1̳0ZY50h"h-Su h-(Dh-j  ]USjh"OY[xEhQs"P|0YZt&h"Sx0YZt135|0|ZSX= 0th"ht#j ]UVS] u}t 0ܳ0 0t=̳0th8-j 1ɉ ̳0XZ50h"h-Vuh-*C~SG Ph3$h-[h-j XZe[^]U#Pht#h-+j0UPht#h-jUWVSƋ=0tPht#h- =0u ЉˋQtjPYZt8tɍEPsbXZ=0tVht#^XjsJjsCe*%} u!#VWPREPh1u#h-(h--H-[yh-Y-P-؃t- t( -y h-Z-P-΃1Ylje[^_]UWVSAօu9VPmZYt&0hX$\T^_F%=t1jh$ @txPY[|x^9|u,;u(^9u;F u%=t /<Zjjj  ׉NX^\19ȉ}{ 9}Dž 1P 9y+{,ZCjjjB ' NX^\19ȉ}{ 9}Dž 1P 9+{F[Zrjjjq VNX^\19ȉ}{ 9}Dž 1P 9+{wZjjj NX^\19ȉ 9}Dž 1WW 9PPWi +^_jjj ~\vX19}p1҉8 u݉19} 1QP6 9u#)m[@H0hX$jOXZ9Ye[^_]UE @E E@E]UVSutYSC t } uC0@0R; s; S; 0H0 u0t+e[^]UVSu0@00؃8t VPjZY\0u 0u0t e[^]e[^]UVS01؋tJ9tFjPZY\0uԉe[^]UWVS0@0ƍPӭY11ɋ0tx?tBA'u9t hu# 0u0th jVSs19}Vphu#pw-HQP yP]w-H Z J GSŭXe[^_]UMtA'10]UWVSu^Nj7t#vuZY[Åu jWXZ ׻؍e[^_]USh "-ZtaujY1"4H0tP{ ÃH0X؋]UWVSP}U UWRW"ơ0@0$诫WC1҉S URҫC0H0u0t e[^_]\e[^_]UVSuV[t#sV@ZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY1H08u&S;u0hu#5w-XZH0PH0uj=CPY_uyjS5_ZDžuShu#5w- Shu#ww-xWP yPw-H YlJ ]@PS3XZKe[^_]UWVS5l0-DCtWjEPVd0h0] "c&:MAEI"c&uV)PRhu#"c&tK`0\0C"c&u)BUPd0NjUd0Xu,Ƹ^ À~|tH;= ÊV~-t >θ(%)%#Ƹ Ƹ^l0e[^_]U5t0PhWv#UWVSQ5$0\0$0PÉ5$0^=Fw-t wv#uKt;u%1҉jEPS Ɖ 8uE8t+8tv#`"c& tBUUue[^_]W|$wUWVSE܉UM7E܍Hw$tW&v# u v#!AuEU Ѹv#t݃} uWVuu\ WVuu&MΉEEUM EUEU)?EU t1?EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉM][EU11 EU11 ۉ]1E.E!EE!EEU11 EU EUEUe[^_]g_UWVS }Ӌ7VT_=p0%us Љ UU_EU=p0&t v#wEd0h0S1 VVڋExYtEUe[^_]UWVS(Ɖӡd0h0EЉUtSUЉt@ vSUиƉX^MƉׅuGMIt!ElM̍YWVщ‰Y[ƉWVh5"j]SNjSu e[^_]US7=p0)u _[]W|$wUWVS4ƉӉMЋ?E1Eă0HId0h0SuЉE뭃$9 "tFكPE4EȉU̸v#=p0#4EEЍpًt(SEȉŨwhfp0SEȉUYEȉŨw>/t[50>t' 0H 0FxFCXVԀ~/u# 0KhK"VZYu$v-9r :ƅuh 0K;/u>thK%VcZYt 0x/4艝X/ |XV>t 0H 0FxފFC9v-u 0x/C <X/= 0u( 00@0|0tP3' X0|05v-0j5|0hOw# j50hRw# 0H0u 0uUe[^]UWVSQu} EE𡐵0@0VrG[y 0u 0uyj4á0H0Zu0tt9=v-u =Vw-t'uVhg#Y[50hg#XZt1Ee[^_]UWVS5v-ƅohVw#zYt p50h)H0p+0pPSh‰$pp ;-u{u|0u0t<.uS{.t K%S^t>h#WZYEth"W ZYEuEE1}}FHπ\ut}tnxP0tB<wV$W&NE1>: 6 2 . * &щǍ@0w\9Eu}w-HyPw-H X JF>/w-HyPw-H X J }u-w-HyPPw-H [ J 5w-w-fBYtfBhx#j(1e[^_]UWVS]u }w-tw-9tx u hw-X00uPh"hw- 0t0Ph"hw- t&WVhw- x0h% %hw-ZYxS$ PhX$hw-w-HyP#w-H X J Ew-e[^_]e[^_]U塘0u謫U0jP聸UU 100@0tuRj u0t 0U10EEEEjEPj@ =0t=v-tjQjjj U=0u 0E Puj:UEPu u(UE0jUS]+Su 0uUuu 0uUEPu juUuu j}uUS] Su0^ ]Uu u0A UE Puj+ Uu uj UM@X&ft9uPU t@Qh'%j h00á0UWVSP>YuOƋjjP ǃ t 3o;ZC jjPǃ t sH{Xe[^_]USh!#ĨYH08tNv-w-M0thB sXZ顨0XjjSP5H0#j1]W|$wUWVS ƉӃ=Ե0uj'-ak<Ե0X Ե01ƉU1}m %M1EmPP$hsy#jS蜳;6u{0ujhC3$S5F SZÀ{0u K{.te[^_]g_1̵00ȵ0ĵ0US]tvUUt[F~#CtVj RPWjEpS:~5j Rs cWE@C us XCX C @C[놋]Ã=ص0USQjj]Sjjh$v-"@tBEPص0Zt,jjSPjh$v-@tص0PATH@=5ص0 ص0v-Xص0]áص0US ]t6;u1Ct*p~Zt0PjEPCp1(]UWVS }W1t@0B0PWDrE_XZsnEX;t.Ey"xVY0 Phxy#1Psus ua 0u0t[~5jVJXZ}xuju0 jssYX}yjs_XZxV^uutYu u|Z upX10 0u0te[^_]UWVS}u w-tu u101E܍]SÌXZ$0Y&uwYX=w-m=̵0%jw~XZ=w-K0 ̵04jwNYX=w-=̵0=0=0t>VW VW=S- =0tVW=0tjwXZ=w-=̵0u=0uSŋZU ?1=0)=0tuW =0tfuWSi =0tAuWfك=0t(www+1ɉ 0jwXZ1=00jwY_=0tr0f=0tW,S踊XZTjVW S蛊6Rhy#)hw-ES{SpY Sgf1S轊X0t}=v-t0t tPtj=e[^_]UWVSE ǃE܍uV5$0ju^1jY=w-tKt>=w-u5tUXUt E܃PuRcXZ=̵0u V苉X^VZu10tje[^_]UWVSWE} _v-v- 0 0HO;t( 0sx&迊P ωʋ7 0tx BM蓊P M҅xJ wH+ v-Q茇^0PS}ZY100e[^_]UVS]ȵ01js&XZ=w-=̵0tT̵0uе0Hе0x1̵0뼃u е0Qе0 1ɉ ̵0MwE50=0; ut-t)E Ps50XZ=̵0Ro ȵ050e[^]UWVSu=0=w-u1EPIE؉E܋^Yt$hPSO =̵0b[E؋E1҉ȵ0]؅6F$0=w-Pl0P莦PChN"9v 1w-xWPyPw-H =_ J=sw-xWPYyPw-H X J 5w-?_jsv E Pv =0=w-uJ̵0t:uе0Hе0-1ɉ ̵0Hu е0Hе01҉̵0 ȵ0=0EPPXe[^_]UWVS]uV薅E؉E܋S $0jPsiM[=̵0{tuG$0EpWRZYtV1=̵0uZ=w-uQSC ; t$0u P 0[_.[$0u P0ZYu뇋[g10VlXe[^_]UWVS]} 31EsZ=w-{5$0l0P*Phy#Stj RU5w-UR hy#Xu hy#Xw-HyPVw-H X J 5w-X0@0ujSguSPEq}trt8u4guu 0u0t3js"Wsj0H0u~0tunUu;Rf1ɉ 00H0[0e[^_]Rr00H0Zu0t tJ=w-tA{t;5$0l0PjPhy#w-Ee[^_]e[^_]USD0EE1EEpX=w-tlExtc5$0l0PZYEP$y#[EXtj S5w-X [hy#g[5w-XjEP艦ZYtlE00jXEuKt&:EP$y#X5w-XԋEt0j50g0@0Eģ0j EpXZ1ɉM 0t5u Ep-Y[0@0E0j!X 0t0t뻡0tEt"EPK$y#?X5w-Z]UWVS}] 1CCC =w-EP聀0@0E^y hy#xjWfdjWPyu31ɉ 00tuOjujWu2E؉s 0H0Zu0tEPwXe[^_]UWVSE ,1@0X 0(0$1`0EP{X10E@$0ptEXt8sl_u&C$0hpPSG [u[ċt1ۉEp :^x|EXtC$0sYu|1҉4pjxPSF [븅t4B4닅4P}_0pt0J0H 䋅010T=v-t"=ĵ0u4~0@T40)Љ0=w-u 4fEEQ 5$0l0P}ZYP0[xuvp1s%Zw-Hy`PXw-H =~=WXtNw-Hy8P_w-H {j=W.Y^ƅu뽋J=뫋J Ӌp t:w-HyP5Xw-H J s^X뽋EX w-tRSP t [HyPXw-H J 5w-h_gxsjhY&VF u Xԁ}Q ``041 Huw)4)400tX4t-X`0QRUR0af}Zf}tJXZ:-{z-uzu apu CSu>E9, `tfE=0u Ext,AEftfwE= t= tˋE@fat50@0ju^[^ZYxtTWV ([_tVhSP%E%=@u Vhu#$=`uEVhBz#WS'ZYt!SoXjVtPà u럋E%=@tЉ؍e[^_]UVS10j]ZH08tQuVoH00jP{C00ĵ0@0jWk0DVo0e[^]U0}~E p(|X 0uĵ0t.~ I19 ĵ0̵0е0ø1UWVS4h!#yEP褙UċEE}̉EÍMԉʋEƍU܋EURPMQVWSEPuhXz#5w-1e[^_]UWVS}] uSWʳ0 u;}tjoZjWB3l`00SjA耳0e[^_]UWVSEEE EEEE0}tE%<:tuЉU)Eu衤ZM\ M9tBϋU9v-} U>nv-9tߋM/t/CUuS_1ɉ 0U^_}9uB0<:ttB1::uBMu ZD+v-Ee[^_]k1e[^_]UWVS|uj/S|Y_tAuu VS\< xP6_$_Z@ j6EPǃ tjMy\=0uSuu VWu>ʱ8t48t*趱8 uxPW#ZY@t 蓱WkX뀃 h u tCƒv~ 0PSP6h "jUWVSuU F^fftfftdN0$U jS$PJPj IU yхtvhuz#XZWPXtkhz#<XtZhz#+_MtIhz#ShX$0@0v~P$Pb0H0tShX$NY[?0thz#,Phz# PShz#M~ t-w-HyP^w-H *Z J*w-HyP1w-H X J e[^_]UVSuh&t"8u%uCVPZZYt؍e[^]UVSu@h&t8uVP(ZYuCݍe[^]US,v-1ҋ0tHft fux@ |u[]UWVS}0@00t,Pfu9x fu9=,v-| P X҉΍^x0t 0u0t e[^_]Se[^_]UWVSSu0X'1E8Et$}u <:uWE}:u uW@u6u#<%uUFPhz#uZYUt>:uGFC딃=,v-y t ,v-u1҉MRM ,v-Xe[^_]UWVS0@00t!f{usS XZٍ݉wx0t 0u0t e[^_] e[^_]UWVSutA%<00tCVPܞZYtdߋ} tX0@0V$eÉ1fCC VCP0H0 u0th=0؍e[^_]US@h&tjP)f@SPXZߋ]U塐0@00 P 0H0Zu0tUWVS] j/uv^_t[EtFxPuZYy 蔫8t芫8t耫ffCf1CƋM09tMEthz#Q2mY_tM ju_Zt>HftftfuEEu E u=,v-yƀx u91ETtE,v-tuDYDžDž\DžXDž`juEP` Wd0Z?/xPWlYZ2E%==0NEWrLȉ`+v-$]cWabjuƃfx`QWTfXZF FfF CfF fCFC,v-f~tF\`9\HPhz#pZYtuYDž 50hz#epYZ`9\~88kި8]ШXKWuhz#50@0dTujuY_f~udfF`FDžX t@Et$jXPuh%5w-Tf`0@0dTujuXZf~udfF~ 0.0!1 e[^_]UWVS$EE111E11EEhz#yEZtPEbw$Y&1EE1ɉMſE뵾뮻E랃}uutjLY1҃}u/}u)}u#uEEEH0810tROft!ftfIu:}fu.} }tуtEЉUSW>XZEЋUԋ?몃|u5w-^w-@hz#[EjWZYt[@ft:,fuu>H0PH08ufHu*}"fu}}t˃=,v-x t0PuЍEPW}t f}uA-tf}tjW~Y_t jPFXZvd]uEԉERuIEe[^_]UVSu 0@0ju!Ë@ZYft&fHu sgXfCFC fFC FC 0u0t e[^]e[^]US ]0@0fEEEv-fEu ?EEPSL0H0 u0t ]~]UjuTZYtfxup)X1UWVS 1ɉM11uhM{#@vZt(ptvtVuEEлɋE 8ctu ދM Mt4PhQ{#Ht}t5hc{#4H0:t/1E H0:!#H0:*{#RPh{#m]&jjV XZu}jV)XZGfEGEEfGfj/VNmZYEEԡ0}tEjVEPGEP\My`uhg#XZH0PH00Ih{#.j wl h{#whg#H0 8w-HPw-H H0PH00YV_8uVPZYmIwh{#owhg#J H0PH000PjEPV1MfHf!#t8{#Ph{#iY^jVۆ_Zuu h~K$FYV`0 Ph" H0PH00 u%h{#uh{# uh|#fVhg#H0PH00_Xt!H0PH00E.h#|#YEE~uh{#넋Ee[^_]UWVSEPyZ0+v-PYv-XY}GE܊_tkta}t\} C<v2u+:t$ t/t6EP=Vw-t"E u 0xB [P}눃= 0u[ 0v-8uu@hh"XtVAZ^E %E1b(P YuVZZP X VZXu‹E|}u5F< v@ 00y8[P0Csu2be& <w 00yZP08t8}t!߀u8CuEԉEtCW tC̃W8uΉ֋EԀxAȋE1҉U]}t usu]uM΍HMЊ1uEΉEAx<EЍp[<:Mh0|#V_VZYEąM9EЀxupx9u"c&EEE9s2>uF9utsE"c&tdU9UvsԋUE͈@ĉƃEM9MUP YPEP! EXZt\uuЀ>-utF<]tm/uu}NtFuc=|0Uqxvtu@r t@١|0;}u5|0S[rxRPZYyZ9tt1t9s'@ZxvttE]S@ϡ|0;EtP9Uu8/t}G K%qF%P=XE9|0t@/Džp>t F1ptJxw@tu@o0tSYpu{F/uSZt߀x .u o.uǍx jWt tptWuBh5|0 덋EG@WPu@/VP_Xle[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu0skY@uP0DVƴY0u+v-,+v-EEt;t}1ɻN)ЉE=Fw-8<@.<*&}tE<VE)HPh3|#(1ۅI~@ 0H 0Cx0P0S։MAP0SM뻍G1҅~օ)xu u܋E%PV1ɀ} k0+v-ыE))00 0@} uSWvZ}EtsŠbe& <w2 0x0H 0U@H 0U 0x0H 0U@H 0UԈC뇻11EԀƒ v! 0xM0H 0CuJ 0x0H 0ĈU7@H 0U뫈U@H 0U뫻1111ɋE%Et>@u=L0uM @1 1E @€}E$0Z&U50Q80^_Uzu LuЉU E PuY[ExU^1 00yB?P050+5v-uuuuVuu%0+v-ʉ0)@ 0uZ0uuuVuiƒeuXE)$0 RhK|#誩}O#uOQVHPRhf|##u EEEPVE)HPRh|#g[Tu9u1ۅu"uԡ0+v-Pu 1Ҁ}t`]uu E]Etq|wt 0 0׃usuKt@뿃uHuEe[^_]UWVS]E %E1ɉME tEw-0u 0E졠0+v-E;~uE t u SXZE 1Es}B~< O$lZ&:=J{s{u{y{@u{=uz10E} t 00ys<P0e s 00yI<P0$0 00y#<P0 t=0t"0+v-M9~xuH0 uE uE 11 00y;P0҃}u C< w 00y;P0S 0x0H 0U^;H 0U߈ ts$0E#E PVu R0pl00VrXU 0x0H 0U:H 0U߈E {~=u}1Eu V[X u$0 0x0H 0U`:H 0U߈EE Ru>HZY0+v-jPHP wމe[^_]UWVSEu ]=&w-t1҉0P 0v-0v- 01ɉ 0 0P$0Sp_Xu&0= 0u90 0 00yg9P00+v-Pq600XtAh0W&01҉00Y_ÀtS50+50_Wj6x00Y[k01҉0tNFe[^_]Ujju5v-@E5UWVS$EPEߋ50+5v-hREС 0H 0ZYx0>8P0=v-VWW]S60+v-P+55$0WȕEԉUS6v-򡠶0)Љ0 0 0 70uuh5"j50蝜0׉Gu}"tj)PV} 0)O0)= 0EЍe[^_]UWVS]u =01}DPSXZ0= 0u70 0=0}=v-}t }tA M;tWhg#hw-褛j[&Et|#PV)KSh|#֡jWV肥+0=0) 0e[^_]UWVS]u=0CvLE%PuXZ0= 0u560 0=0 v-}M  t?9s@UVWQM MUt <CÍY9s1:UVWQM{ MUS9st{u8u@@9r9sS륍Y9rVSQM, SMt9s{u8u@@9r9sS뺉A9SVSQM u;Mt;uCCӈ)ȉ+00) 0I9tKCCG+00 0x C04P0 0 0e[^_]UVSu]Sc2F 0v-0v- 010jv 0H 0 x04P00+v-P1ju PES2Ee[^]UWVSuFPhe #蝘w-xWP[_yPw-H Y J19}E 4hZCWh #?w-xWP_YyP莖w-H [BJE 4xw-xWPYyPFw-H XC9| J1e[^_]Uh|#Uh|#םUUM 0v-t 9PuH]Ë 01-0v-B t xt 1z1 0 0UWVS}u ]0@00v-z tj.0v-J B ZB$B 0P 0P0P XtK =05 0 0u0t e[^_]re[^_]UWVSQ50v-^ 0@0{t-WRUfZtUD< t< u w-Hg C0C 0C 0F $9tSl X 0u0t e[^_]ӛe[^_]UVS0v-H  0tBu y8 0xxhw-Ǔhw-轓XZ0v-=0X0hS0v-py qu 00jt8tġ0v-xus8#ujjjz xtPjjy xh|#茔Xu00v-1p 0v-P001ۉXъt< Y0t,1ɉ 0 0h }#Ϛ)щ 0H0! H0)H 03=w-t50ד5w-[XZ0P0~e[^] 0x0P0U=~u! 0x0P0]]U0v- 0P 0P0P4v-Pj8r+0v-@1҉P P$P0v-YUVSu] 0@0hZ VwjjV5xtt0v-@~PwY0v-s{uh*CZ1 004v- 0u0t e[^]魘e[^]UWVSĀu0@0jV!wY[y Vh'}#ÍxPSO_ZuE%=upjjjSpV u]jtWSv u"jh5}#W uSwVh:}#jjjS$V tSgwVhW}#MSu^9uSKwhq}#2u Px0H0ZYu0t蟗e[^_]UVSu]0@0} t50VaZ 004v- 0u0t e[^]=e[^]US0v-0@0CxPuXCtP聶 Y{ t0v-Sf 0v-P  0P0P0@4v-0H0Zu0t ]顖]á0v-US]0v-9t =0tD0t h}#і]Á=0v-0uU=0v-0u]U}u"0v-@~Pt0v-1҉PYUE9v-uE v-]UWVSU@0)i5rO9v-t5<0u1#v-(9tC߉9} }t}tVǁ[v-t?iӀu.tiրuv-v-XZ[^_]UVSu9500=02v-tPmsYjh"gsv-[Z1@tI5v-rv-hua Ps5v-S~40y;"S!wv-Z@uCt SJYth}#!w-X4)v;40t jj[Xjj?jj6jj-u¡09t PjPZY@ul0 hd505v-*}Y[@l0 hPh}##u¡409t&Pj[Z@ul0護 hPh}#5405v-|ZY@uRl0~ h5v-qv-jjGjj>jj5500e[^]UWVS]u+@0i5rOCSh~#0@019~Qi@tǃu=uFjR!ZY@uxktP蟶 PhA~#9+@0i5rOCShZ~#輒HJ΃utBƃs 0u0t e[^_]e[^_]US]0@09t PP Z1ƃ1҉ 0u0t ]霑]UWVSTÉ։Mt&uPh<"Sv =E,EtM}~EtEtCzMB9tMtEttt t tM IuɋE0u#E@VYEEHEvE9u]=@0)i5rO v-+9t# ti1;J-R@Ph|~#jEP舊h"jEPs URZZEUt%‹E0h~#jRUDURbZǃE@T=uh~#RSAYXu*tQh~#jRfhO~%jRTu =t̉UQij j URP/E@Ut$RYǸ@)$D=Ph~#`/ U:PYlj$URXZKyS赇P Y P G~SEPHXZEu EL}tzKySgP _ P KySEP|Y@P|4M}tWh#S藈 iEM0EKySP Z P EEE}S{X>e[^_]UVSMt.t 119}9ivtC䋉11tJiD} u&ƒuu=tă[^]UWVS utF>%~W..[tW-XY~#*Ft~uH<-tB<%t<+u:v-~#v-i@0~#@0<0E1MxdtS~JH~?u(UFPQM'YZMUt UQW,YZUu뗅uV7-ZtjV,@0<0XJxRt~i90tM΅x29<0~*i@0t"~# ~#~#1ۃ} uVPL؍e[^_]UVSh!#6X=80tYh~#rw-HP5w-H Y肈SnH0Z8PH0xjH00Y^u h~#請=P+@0i5rO@Ph#8 9DiPh# FXZՋJ ;1e[^]UWVSQ111Uh!#5ZUt$jtptguܿպλǍH~h%# H0tyt hM#辊UjPYXUt 1t+@0i5rO@Phk#t$Ph<"'XZ1tiHi0i0hq'#w-BHBCY_y3R4X9H w-z99y9H y:؉؍e[^_]Ã=80u!UjuZYu11á80u!<0 @0Jxu 1øUE=v-t@=0t7uR+@0i5rO@Phq#5w-趂UWVS=80t.5<0@0NxtS{X180<0@0J0B0uh=ViP*Ë<0@0i߉_19~i9uFPT ^@0<0iƄDŽIu<0 0u$0t膇t 󡐵0@0=Nw-1ɉfǃ00)؃} ~iE PZ 0u0t؍e[^_]UWVSu]=0tSSzYXuM1000jcjjz100XZ}u*=v-}u=v-)=w-t u 0Vjp_X}u-V5v-_oZY@u^0 hPh}#\SjrSjr{}t80}u`SjzSjzu }um߃u2`u)jejhm %d thm %h'}#Ѕt$=v-tSj\rSjTrSjLr_e[^_]US]U M=w-u1t uEM E[]qdUWVS}tE1ۉEPu EPǃ u]80t0@0@0E1i<0M9i MEEM99u]Pu Uu6$уu>t6Uu@ƃP}uuPtуut 1ɉM1҉UY}t-}u tƃ<tƃ1҉[tgu tUP=0t =v-u;u uEɃ@ ;u uEuEuw-P 0u0tȂe[^_]UWVSjjjà ~ jjj=w-tQCtN5v-8lC^9t79P5v-kZY@u?[0k hjPh}#訂1@095<0|btPu=80u>SX5E t t&tt M ڋE8F떍e[^_]US1h{#,Zt$ltptZu⻀ۻԻ͡H0u t8t PhX$CcjCY[=v-u =Vw-u@t4jH00‰١w-H0PH0YZxuS5w-?XZ1]UWVS411Eh#+Xt)ntput h#&5D0Eƃ}t1E̅u480E̅trHH08uEu=80tO*jjV~ uVh#jV9Y_t Vh#蠀=80t}@0 <0=H0Ix.}t ?u1҉1E؋Eԅju4EZYtxu M؉}tDE؀u8jPqZYÅt j7V薃 =v-)ugXE؊u CM؈`H08tu E؃]ȉ1}ܡ@0<01Jx8t(t uEuEĿʼntEĉE܋E܅u%}jbjuV贂 OuA1ɉM܍EPjj @usE܅u ߉:tU܊jRU_ZNjE؋U9t}uuRY_Eԅtt h!#'X6jsjs u7{t1hy#XhP^$jsh%1[(h%#js u h֓#_h#js { t&u h֓#n^h)#cjs T u h֓#H[h0#h"h4#,XjsZYu h֓#Xh<#js u h֓#Xh %hN"s h #jsyh;#js hA#Cph #s t=jvih"djv U; uhG#hL#A_vhQ#s)hV#s#1 #%1"1#1# #S9tRhe #j}W^oWV^w-C yh~#@xPSZYy1EЉEԋ\d0\u94`0E} 0ux#e1t:t@u= 0h#S^^_19v-XaXv-50߉Sjw-xWPYyPiw-H X J EЋUԋ\`0d0\ne[^_]UWVS}uV[1ۡ0tCe=v-u\ujJY=w-j5w-jhw-hw-jI=w-uQ1~jIZ=w-u8u{=w-ur;u=v-t`=v-tWh#iXC+t'=w-u1҃=,0‰,0jPvY[1V4ܑZuVyXe[^_]UVSU:0@0jRM[^y$ 00e[^]4ojP0H0ZYu0t o=fw-u11.1=w-t w-1ۀ=w-t w-j蜑jj莑 =fw-ttw-tw-e[^]Xe[^]US]0@0jSMZYxjP0H0ZYt Sh'}#n0t3njX]UWu}~E pdPBec1Uu݄ Zu h݀#GnUu u ZYu h݀#'nUVSuV8@$VP؍e[^]UVSEX9v-}]ށ}0@0FPbv-Pv-5v-v-0H0Zu0tm0@05v-v-)v- 0u0tle[^]UEuj h#jI'v-)v-v-UEv-v-Pv-P 0P $0P$0]US]0@0v-9tv-PNj XCv-Cv-C 0 0u0t ]l]UU0@0B$0R~0H0Zu0tkUWVSW v-\ k0@0=v-5v-G9ui@0tav-CPW¡v-v-J v-+v- 0v-$0^^t5;8u1H+pp X@MSNjM󤣐v-v-X 0u0t e[^_]je[^_]UE0B0v-)v- 0u0t]j]USv-v- 0v-[]USv-+ 0v-)أ 0v-[]UUv-)v-v-v-+U У 0]UWVS,ME 11˅t MP4ZMwDGƋ܃}tE0v h#PjFPKE0u _E1t0wLG V 4YMVu!MM̋3XZ̋EЍe[^_]UWVSD011EE h#wE_t/}pt}rt}duܡD0EЋD0E뿋=H0?u h#ijOE^tt Sbe[Ejhe"pEZYuEl%EP 5v-v- 0X1EEЉEEEÉEjMQjF HMu6U߉Ӏ\uN}\}uKjQjF Hu U߃ u Eu}tjPa[X9UUtRUuf ZYUt@Rhl%R ZYt}tc }Eu[}? 0_/}] 0xFUpUԈ+v-E1ۉ]E 0u#EJ 0xFpUhe"7^2ZYUu.J 0xV }P+v-RE^)u\ 0j5v-7k 5v-v- 01ۉ]3= 0u2 0#Su ZYt*Shl% ZYtNEv-9s}~}tjuhe"j j5v-7|j t jh[&PEP+E؍e[^_]UWVS1h#/E[t硐0@0jfP^0H0ZYu0teH01rErǀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD5wFuD5xFD5EPEPEPhZ#C_Whj#0__X0 wI112NЀvShp#%ɍD=vB:u҅t Sh#eP0@0S*^u 0tWt=0蠈 PSh#dׁWPE)ËURԃ 0H0 u 0t9d0t)dӁS胠Y5w-\\Zw-@thɁ#]XEEe[^_]UWVS,f11}Uhہ#E^Ut*}St}at}HuMЃMʺË]E@[&Eԃ8t@9tE Sh#cH08}Ѕuxt h""c}uEh"u/.ZYEЉE1E؉EEȋE@HЃ w7̋}9 ErXk] eډΉ׉u؉}뷅t uh#IEX 1RShj5}9Us uh#}e؉[}uE@[&11114Eh"E\j h!%9\ Et‹u}eh"\X}j h!%[ YX;EPC PsCP3h #[EE|u}eC 1RPWV4ƉRPh##[ *C 1RPWVm4ƉRPh##][ Oj h!%I[XZ M؉]܍}WE@ PTZY@M؋]u90 Ph)#HE}tXEtM]tM]WE@ P赝[^y90跄 PhB#`EԀx udjĻ0/tM] EtM]uu h[#qZY$E@ 1RPSQY3RPhX$MZ 5w-eXZw-@thf#YXEE̍e[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS"M t#9t9uƉׁvSh#Shς#_e[^_]UE0 w @8u1]UVS]1tSo)Z1tpVhW%SΚ ¸tVVh#S贚 ¸t<uh+"S} Y^¸t0 vSSZe[^]Åt2USv-t1:v-uv-Auv-[]Èv-Uv-PSw-PXZ=0tM=6w-uDP՚P>0ޙXY%u#jPh#b UWVS}] Fh#UW_% %1ۃH0t H0u7;0PH0`0jPƿ`00XZ=<0t6u h#XH H0<0PtH0`0H0T0Q0L01ۉB9tt 5L0 H0e[^]U}ujjjjuXE0@0jcH0Z8tPX 0u 0u1~WUU0 wj jRu Hu1X0Q0UWVSu}Et8uLu+E@1ۉ1۾E?C:-uލBztՃz-uztĊ] :MtKu5>:u$EEEjEPh#}[à uVh#cJz:u벉뮍Hz:xuWمuU6<:u!EEEjEPh#[à tuVh#hw->Pjh#`1H9ujQh#Zà 1Mjh!#h#Zà M+E@1?1ɉE11ɋU Phe #j MQOhMQh؃#_Z ÊEEEjMQu EZ( t1E1҉URjUe[^_]UME  h߃#UP uT0=Q0uX01ɉ \0Q0h\0hX0RppUVSM@0t:u>H0u1:-uztXH0z-uztBu H0ͅtɍr8tuPh#9Yy:u܀y:u.zu H0J H02u Ph#T5D015@0e[^]UWVSj,H0^_zth+#:8->E H01@0jH0Ytzth<#(TL0uD8-u @P5L0P)XgL09ZyhN#9|EPá0@0T0 L0)<}_߉ƋM9sω9s x19r )ЍpkME9s 15X0 0u0tRS[PYL09} he#0B0)أL0T0ljNx=P0tE7q ZEy1ۍ T01u1X0 0u0tR1e[^_]Ëw-z8U 0x@ 6@w-J8w-z8]ÃxuUSt P4q XK]HÃ8uU1҉P8u]UVSƋXCF~hy1A1ZAf@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉Pw-JHR P UPUSUJtXxv-u~u C $t h9#w-B0+B8PCXe[^_]UWVS4v-E=u6E8t hh]&3=v-v- 0} E=v-v- 0\C 0\GNà " 0 G4v-(=k 0H}t 0G u͡4v-@4v-=-} uE( u ƴEu 9E@E菴t9u& u4v-w-HH FՁt| tf,jE)VP+ &kx\[x 0@x 4v-w-HH 0xO Hv-)Qw-X4v-U)Ѝe[^_]UWVS@} w-B ]urVY wVhG#Vh_# 4]&hz#j"S|GSZ؅tWh#}xM4]&h#jPGGSUWVS]S;5v-MM E,ZY9v-ulP&_H=09s<wDu 9rMW50h ZYt%0=0M܋=050 ##S>e[^_]ø!#w-ztGUS0ttt*υ##0054v-P0ZY]UE0jZEEU\uHر u"4v-w-@8xtjjX聮jjh0"耮 镱UVSw-Xt 1ۉXX=x tjbw-1҉P Yw-1p84v-P0 0x0P00Fƃ)c t,~tŁF $\& 4v-w-PP @\ |td;Z=t 蘰 uc?&uw-@19w-@_|uw-@w-@$&t;u,w-@ w-@ 訬w-@w-@rw-@_蒯=t0 u74v-@4v-w-B0ztjj[Yw-1҉Pjhg&Và ؍e[^]UWVSSáw-@tuxt =w-,uyGEt7]&t,O8uQPZYu]&^_8Et2jw0/Y_t XS4$PSd Rt w-1҉P؍e[^_]UVSw-p$ t jjw-ubX(x,u{ upV Zuh#P: uBPVLw-BC1ɉ ^t‹(wjpVe P0+P8RuF Xe[^]Umw-B]US]V9tjS]UWVS 3t u%j 8XpZʡw-@؍e[^_]UWVSw-@}t11[WT^&t1MHwRFuvw-@@},jEu-뤃uj p1AXumtCMuj 18XMHXj 1҉WPMHGYljރ}t' }uZߨjE#BW}uGw-}u:w-@@ T^&}t jjw-@e[^_]UWVShEӉMw-@E1E0E豮E+v-]jEP0ZYt0@01ۉ]]}~uEYE5v-NjME0 0t}u0tD54v-=v-v- 0w-x tj[w-1҉P xÃ`u8 0G+v-~P4$jP蔬 ] \t=w-p0h# à u4v-w-PP \ta`t\$tW 0HMIMMDt"t/ 0x\G%x\4v-w-PP " 0xGx@tjZ1ɉw-up54v-}u'jǡ4v-)E$yXxPPU1xjX4v-)E:Ut jj,w-Pxmw-1ɉHv-u9v- 0}tRߋuME) 00@0ua 1E0H0Zu 0uE%Bw-upE0E@EMȋ5 0Vfxu@tC 0xC@ 0x @My.@ 0xC @e[^_]UWVSE 1҉lptw- 4v-J0fDžz=f&Hf~1ɉhfDž|fDžx1ۉZ8EfEv-v- 0l1\G|Bd&u Ã= 03ËGHu1$(\&g&fxg&u fx 0E4v-w-xtjjZXsbf@fLd;xcTd*"t~L tgF=.H#"$d\&Džd't+pЃ辥PЃv;4v-w-ht蔥PЃw tSdCd\ƍ@;w`u h\#\u9\uhs#ރ?bDžd Džd11`PЃ `w t0)Pw t0Pw t0臡 Ad9ud(=w h#0= 0 á 0HCw6 0?ʀJ R 0CC@wj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0qwj 0 ?ʀJ w 0CC 0?ʀJ vH 0H@ 0;wj 0?ʀJ w 0CC 0 ?ɀQ vP 0P@ 0 ? 0?ʀJ w 0CC 0?ʀJ vH 0H@ 0 ?ȀP vQ 0QA 0?ȀH vJ 0JB 0?ʀB< vA 0AA 0ph#} ~€ u 0st] t%舡't:\uy=uh9# 4v-w-xtjjFX  Šbe& <w 0C 0sfxt @ 0C=u 0s\ u'4v-w-@8xtjj^WHtujXY>tt-uVƉCY;Ļ0} ;Ȼ0~Ȼ0}>uQy>u |u &u !Utv&uya1ɉKw-dj`dB(w-@(X4v-PZ-w-@(u @  1҉P 蜘y1sw-X$w-@ Ww-\H,hP SVw-pw-@ X P(Xu1 0GD 0r5H"0ǗjhډMX 0HXq{t "c& 0X+5v-T 0`X@Džd{1d#kDžd}tm"c&uW-DruJt?:}u5ľ0ž0jjhľ0ٖ 1ɉd躖Džd "c& 0t> 0x`@`H`"c&uKЃ wC 0x`@`H`iÃdt@@Ѓ v6t'H 0X`XX, Džd 0x`"p=d%:t #u)Ph`]&[Z…t!Džd[Sh`]&ZY…uH% 0x:F p:Džd 0xF p_]&{`@9Ë`uBW``Dd u(}t# 0x#F p#Džd詔d1ɉdGfxufxt dTv-Jwd@ ӈd ӈ{dNj@f@f@dK@g&1҉P:'uAW|g&u1 0X\Nj@@be&f@ 0X$諓H 0JNj@@Bd&@f@e[^_]UWVSSw-1ۅtXC1w-0x tjRw-1҉P YF8Pv v^S‹FP U8tSjw-pZjhf&P`w-HUJ@ B 萘]e[^_]UHu+]UWhPT0lژdw-`0\}1󫡨w-X1pjEP(ZYE00Ew-Tjh` jhf&Pc w-B t$Pt=^w- hppDžt1ɉxR|T}Ew-jjtP袉 v-pnXw-`w-d蜗Zl0\00u jlNDžp!#u^j-Džp#Xw-`w-d.Xl0\0pu hpp}UWVS w-@1ۉ]}U w-u@$x @40$\&j袿jCjj Cu;jiF EjUBjbjUB뻡w-xu jF Y1҉V @j]j áw-x 14$pCjj_Cjw-@A. uw-x,u pr[u h#j腾 w-PS @0CBw-Yx u`x,uZhnN%p^ZuGu w-up0pY1҉US@PvjjfHu?8j@w-1҉P Pw-J0HCBHYvBw-@-ttjjjCVw-@^Xjk w-B0+B8C j fw-p0C5w- ~ uhnN%vZYt hnN%CEFuw-xjƋE0FEYw-xu;w-x  jj p0‰EEU表w-@Zu UBE밡w-xt jj@0FjF w-@Yt-Pv jj u w-@FEM1҉@{j jeC1҉SY^tNjjLX=Vw-tt3jw-@X&}tw-@uWd^_Tjj w-u@$x@1ɉutt;tj ;XZÉs؍e[^_]UWVSV} uE E1ۉ]1]w-xn w-u*p0QƉXYtաw-pZu1뿋H up$E0FE뢋}9u}} uwjw- 4v-H4^S ZYuh$#SZqj/v) t hC#t w-4v-+A8F%Fw-1x4R@@u} u jj1E1҉j1ɉHEFE F w-@0F[e[^_]UWVSSw-@1uG u=Vw-thU#w-@puWj Y1BUjBËUBpXYUj)&C^Ut1ɉ ֡w-@tj)pZƉe[^_]UUw-1ɉHHPtjjYXw-1҉P t/Ht3w-@jw-Ytrrhh#n&w-1U11ҋE]FUU Et 9Pt]UMԾ0tPt9JuB]US]j袷SCU PUPUP X]UWVSEPe[y hy#%u;5w-~5w-ExWZ=w PWV% `jjj uNujj#jjjjjj$jj SEpuj]u5Ee[^_]1=о0UWVS}u }t~h@VWdà VWdZY}t9u9t:WX19t-y50aH PVWh<#SSVWhV#$9w-}w-؍e[^_]UWVS]{tN7Gu о0} t} t&Wxjw PR+GxP6YW0C Z1Ce[^_]USԾ00@0uSwԾ0SB 0H0 u0t ]T#]UVSuԾ0t1u(jS#ZYFxPX6utse[^]UWVSu] 95w-}5w-9w-}w-9t7SMjjSV%9t8V.WF PShr# #؍e[^_]USw- @w- w- ~.CPjj x9w-}w-PX͹ؙ } ̾0]UVSu̾0 ~;Ļ0|l5̾0j Và x9w-}w-9t PSh#;w-~.w-&=w-}0w-$9w-}w-xjjRU UuRSW0H00x}t w-w-}t w-w-e[^_]UWVS ]1}}7-1EEh#u S0 tu~tvhe #S S4|^&ZYt vVuQShJ"MSh5#EF y)KySP-Y P-Phe #Sq SvXZۍe[^]UVS]$0u&=0u h0u0t]=\0uTY=0uZ`0tO`08tCt>`00@0=v-tu0u 00[^]US]SVYt ]]ߴhF%S:8 YZtSZu]US]q#t%SZuShe #j hD0D0]UVS]} t"KyS P ^ P VPhX$S  t?uSh" ZY?t.!KvyS9 P X뭋P 롍e[^]US0@0`0t8t P2 1҉Y`0u10 0u0t ]-]Ë0u`0t9u=`0u 1UWVSu} =0t=0t?u;`0tۃftGtt;0Wt2<=v-0uQ=<0uH=nw-t?$=v-=w-0u> uU0tY<I<tG<0<#t5<<0uw EPjV @}ttKtR1N=w-t tFv =v-u <t9uy@ PVvZY@t\u0u jVZY1E܉EEEN>v  DjEPjo e[^_]UWVSu] uh%sZYtsh7$VY_uhq#B j5w-h h~#V_ZǾ`0tl0@0`0P/ 1ۉ`0^u 0t0tjW0H0ZYu0tG@u1501ۉ].{h#WZYth&+"WZYu/p[vtEuEu11j1}h%3pZYDžt}N}u N_}1`0t@taGwuu%hv#WPh!% WvPh!%C ~h"__1똅t h"L^11`0t\`08uPu%h#"VPh!%'VPh!%tC ~ h"[1F@ut h"Y1ۋ`0t7`08t+h#`0P SPh1#C@u}u3=0t63{Zu;?-uu1t 11EFh#EXE=}}uU`0t`0Phg#tY^PƃX?vsh #5w-- h#`0Zu h~# `0P XVPh1# 넍Fuuz0@00@0u1 WX`0t`0P+ Y<`0t jVxXZ 00L EEe[^_]UVSuu 0d0tJ8tC0@01P-`0P0H0ZYu0t `0uu e[^]#e[^]UVS]u 0u VSYX0<vjSXZuƃ0e[^]á0=0u t8u1UWVS\01ɉ 0`0u@@u \0e[^_]1҉`0=0u‹`0tX0}W-50SjP9S<* ,t }wW,50Xe@Ht `0tUS]9@0t$jjrjjijj`@0]US\1ɉM=T0u'=\0tX0t EE0P0P000tjEP[Zu Eģ0jEPZYt0@0jEPY[uO8Eģ0=0uы`0tǀ;t 1`0jSXZ몍Eģ0ZjKtX]~ ~Cvv1ɉMMMMEPj/FXZjS>YX1EEEEK>v  DjEPjS hSP XZ5P0WUT0EP0]UWVSh_&PZYj'VΫ_Zu <)ș19e[^_]á0@0w-t,UP' 1w-w-Z 0u 0t 0u0tUWVS]߅~91Wu u ~ )Dž~E u F ~) 8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu`0CfKS u>0@0s6C CC0H0^uV0tMFfu9s0@06CPRC S)S0H0ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9w-u]e[^]e[^]U5w-uXZU5w-u~XZUPuu EPE u h:#ouPJun% UEPu u UE Pu5w- UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V莨_Ztt~tnhe#V7=ZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h_&V$ZY<tBEt7KyS'P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KySbP'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9w-u]e[^_]we[^_]U5w-uXZUhw-Mhw-CXZU8ruPhj#Ph#@UWVSSEPE X85v-v- 0j=RUZYj=SץZYU))9~߉Ӊ 0I 0t$<=t xFU蔗p UCɅxUvU] Ue[^_]:UE1@u,$0+ 0Rpp h#jh0袸0UWVS]} Mt t9u t113"c&ƍCt9t"c&u1@t)؉[^_]UWVSS110tZuA=u܍P襓EY10t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#S8ZYS Z9u;ShX$j'S֣Y^ƅu+Sh*%XZ/<'uhϋ#sXuS)Phҋ#t e[^]UWVS]} sSt"CtS҉XuEs1Et Wh$!Y_}t5uh$ XZ$w-Jy R` w-z9 _F>=u y:Cu}th #FPZYw-HyPw-H X J e[^_]UWVS= 0u0 h8 0Y11ۋ0tJG} tE t8tEt.09P5 0 0%0XZ 01҉Ѝe[^]UWVS00su"v-s v-s r 論YVCƒJujvXZ=StuPF K DPY_F u v' ZCFC FCFS X`e[^_]UWVS111Eh[#{Xt2vt&etfuEՃxuп뽋E uH0t0}tUP( YUtW2U XZUʉ؍e[^_]UUE  E U?t h`# jpp 1UWVSUUu 0@0j臅XU:-u0zu*5v-kv- v-C 1ɉK^1jEPRUǃ UuSj=Ri_ZUtRVVP?VjR E81ɉK C1s@C O t0KOKGt u tGG <=uRUVP tjRULXZU w(0u1 40< =u0H 0{00 0u0t e[^_]e[^_]US]tu s?XZ]US1ۅuh#'NtxtIuh#貜Yu H0PH0t SPXZ]UEU )]USME )u AR)[]W|$wUWVS1҉j EPSΡƉ 8t98"u/EUE9EsSh #-9]u Sh#EMDJ@t@E}u9tՉe[^_]g_UWVSQƉŠukIe9Fu[~N9uJjjOY_UP(PURN Hx N9 uWv XF!؍e[^_]UŠH8-u>1tfzuh jjh`a&1zuHh0 jj h b&BRY.uh jjhpb&h-#P荺ZY1uhb&UVS|ƉӀ8!uxu :\|fxqpftft!f u&PQZ?;*;"|f uPS:[^1PS9ZYuNf$`&|&E%=E%=@E%= E%=`qE%=bE%=SE%=DE E E 6M;MU؉!]B]xL9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$`&SV`Y[SVP_ZYSVC[^SV2ZYƉ׉11 Ɖ׉11 ylj։91lj։9rlj։g9(Tlj։I9PV7^_xPSy7ZY04]E9uc9u_E98PV77^_uWxPS$7ZYuD04MU9u9uE98f9]PV6^_t1PxPS6ZYu鋅|9u;xu͋ 3E3U >~u5!uډx!(u;)u{u ?e[^_]UWVSu] h*$3_Zu!Nu xtP!zUWYu UR-DPtÅt SaZ@tM}th%6ZYu }tM1EE8%u!Pz^X6hc# _Xz1ɉj EPu跪ljыE 9Et:8u5 t/u u!# 9uMB8Mt#y޸"uPhr# EGSW YZ@u'##|x"RPhX%$ Etu jW XZMurUVS@l00005!8t j=SYZt hSLXZd Phe #j@]S)jSh#|j hw-he"k(j hb#h؃#W茀ƒ %u#j Ph#2j,h#hy#!j hb#h#$e[^]UN=0t 1 00cOw-01000=Ծ0t jYw-w-w-w-w-tP 1w-ZUj=1ɉ 0Nv-100v-Zxt@ۆj0@0jXZ10uƀ0@@u 0u0tUEt]UVS]u tVs XZe[^]UVS]u j&$i&Vs [u CEe[^]s 譮VDF4$VsJVs Vs[Vs GsmVDF[ ]VsVs C[XZD[*uFE$Eh'#VY[EEE8.u(px*u Eh'#Vǯ_ZEEu uhܐ#}f?f}‹}G}#QMFZYt*}HE @,1e[^_]UVS]ss 3sh#:l&tVTRPh# SȾ S VPh#e[^]UWVS uj:u uZYE u h0#j@E } hm&E PyY_8j=Pt_ZqxEPh`#W84E ( j jhm&EP{tHPu~(tSh#t!JRV4uSh#O} VPX1e[^_]UWVSSƉ׋]t&MPVӖZYMuA# A? Ԋ-uFt.UPV蚖ZYUu3O Ȁ-uщ!e[^_]UVS] E0C@P q&q&YYtC,NC8P`p&p&1Zu؍CDP@o&o&YuC}w t2o#&o# un#w#rv#r"v#~#@u}#@t"~#y#Àu!#y-#Àu#PI# r# r##' # r# s### r# r### r# r"##u#t"#~#u#u"#^W#u#t"#70#u#t# u^ǔ#?'f#tg#^ǔ#}wu1Δ#%ϔ#uΔ#֔#uՔ#u"Ք#ݔ#uܔ#t1ݔ#`%Yt@#J#@o#>uM#*tO#n#M# #n#^#3@#o#^#^#}w s w# rv#%=t)wt=u&5#=u=# 1#9#Q~# r}#<}vw s3##'# r# #r#r## #r#s# ## r# s###r#s##oh"#r!#s#"#F?#s#sj#^}uS)#Pl&;t3CaP3h0#jd,Ww 1 11ɻl&;}t SC8t{$(Wh9#j ,(PGwCPh9#j }(P w$A u,P[WUY_1Ƀ bt,P9EP0XZe[^_]U荗Ph>#h-{jnU塘0#=0u"PRPh͕#h-a{jMnUWVSQÉ蘘10;#uCj EPSjk{ 8t ShX$jE8tWSh;#je[^_]USÊt%<#u"S#Zt@0]UE E EE]UWVSÉU}utj VSj @t 9E s 辗8"u"3O;t)t:Et-fDB@fO1e[^_]UWSPh#Zu0.j URP7jà u@8"u h#j1ҍe[_]UWSPh#Zu0.j URPià u8"u h̖#j>1ҍe[_]USÃ=0t =0t?09t6t2##t{"{"=u##QRh#n 0100]UVSƻ`u&t[PVdZYuICƒ00C0C0C 1f‰0te[^]% Vh#je[^]UVSÉ֋t8uVh #jURM1YZtVh8#mXZ01EEe[^]UWVS11Dž=0~ VhN#mXZ1 RPhS =t=0Vhd#&f}Uu1.=0Vh#:m[^v49tVh8-h#Ea6Wh#h8-rvWh#h8-rF (tl# {,ujhM#g_X{0u jh^#1{4ujhq#dgY^f{Hujh#JgXZ{8u C,C0C8{<u C8C4C<ujh#gF_X1s(t h#fYujh#fFXZ1s(t h#fX0z9s9RPh$#f 1EuuO9}ЍWRPGaPh\#afGf뭊EaEG?tPG9C$u ~#EPV8EZY9 uu VG Ph#S t4Ph%SN HtSh2#nRXZ붋fv(hU#SW Dt0Ph%S HtShp#RY_뻋F(v,h#S t0Ph%S HtSh#QXZ뻋F,v0hͧ#S t0Ph%S` HtSh#QY_뻋F0v8h#Sm Zt0Ph%S HtSh3#2QXZ뻋F8v4h[#S  t0Ph%S HtShp#PY_뻋F4vv" h!#hPv"VJ O8C1PhXv"VJC 9GPS讱XZ`8u>u `8t/j^} tu Sh#蟹 Shԧ%菹_X뿃} tu /Ph#q 벍/Phԧ%[[^띋$t $PYPZ}tEGjPSf y hI#XAЃu ƀt/tu1Pr$u h "t7 e[^_]UE0E 0]á0á0UE Puh-1h-j :j_4UWVS]^8ށu=0t50h"=YX=0t"=0u50h٭#=10XZuu 萤 ZYyWvPh3$[= t7=0t.j e<X=0t\P50h#$=j3e[^_]UE Puj' UE Puj UE Puh UE Pujj:3UWVSx1ۉ0PhqF%^_yh#hVub ]t Ƅ1PSbZYySh&#LY[u%=`uz 9u;u0Shh0ۇ ƃ uSh6#뜍xPV_ZyV끋%= VhP#e= u:u*ShV# t ÿ"Shn#0S臙[+S{Y0hVk u|h0hX$5XZ|듉e[^_]UEPZtPRPh# u uh#hh090U0tjXj :ZUS[j0h ~&j_ 0jjXZ[]USG[jwjjmXjjdX'[]UWVSÉ֋x CPww wwփt=0~j wX0e[^_]UWVS1=00010001 Dž襘u/h#h#2[^Dž SUYuFÅu~3hV#i ǃ uVhX$ӳXZAP~XEtVhɮ#9 Euu듋CuOHujsVsUYE >9 C 8H1u"Whۮ#h-&< Dž CC jhPjVx Ãt'$Phzd@S;> @uS_ [WJYD -9rDYt)PH0t4KRWQz u <tPȉjvp Wo C1ɉK C C1{;0C00XZ{ t%VwaJYZuVh#0XZ?jp Vio G[o G Mo GG1CG8{DžaETuDž0Eu0} u:E 5j 5Ytsh #6s _Xtvh!%}66M 9~=0 1ۋ9U tE 9}?Cԉ a^ EtPs ssh#5…g=\Qs ssh+#h-!9ҋC'BDž 10C0 1F0H0~ + 0(P6^t509F6냽tr0t`!#:t#hO#Phi#h-V80t/";tA4#Ps ssh#h-!8͋  Ph#-Y[0F1҉StPVS s葛s艛S胛 uU89;00?uǃ tuU E t$9{p1҉ e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssIY^} GWss3Y^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHsNjCSMEAE@ufFZ[tA 1(0Ee[^_]UWVSu^8C@PvBBp+BtPR|[^t00 hl#qY=80t-5(y-jjjj00 h#Zu5,y-RPjjPt0=80toh#3b50=0 t(jj[[XA!HfAWV#100XZ=80tj p_00 tjjRPe0 0u h#+5050[^f%f=@h°#h# ZY50=05(y-jjjj00 xRP5,y-jjy\jj5050ƅDž WV@@PP WVf@50505050蹷^_8th#1ɉ (0[00 tCjj RP* {C9s#Qjj RP' N019r)#u 5050u"h #Ah"11(0XZ謶fH^_f@t 5050hK"u6!@t%hK"50505050)Z[@@fA\5050f@5050Ch4#<$u thK#  =80j XeY[^_]aUWVS}u w wTXZCfEE9uc0t=80t =<0tj jjjw w'u0jh^#W  w wNYXG 09O u,y-;0tf%L#f=@u"Rhd#w wgE)Puhr# =80us=<0tRyNj h#XZ=80t2h#p._=80tfE)fCe[^_]Z h#eZHt1ɉ (0x밍e[^_]UWSá0p8hSY t& 0q0RP¡0H01z 1҉Ѝe[_]Ƀ=0tf‰Ã=0tÃ=0tUWRPtY_}UWVS(}M] U 00;E] w+EU 90p8}E9|+F]!É]E !ЉEEUEU9}"=\0tWN#uVu uh# 50}̉Euuu u>* EmEԉU؉E܉U\TtFЋ]!FEU؉E܉UFEUӋEUEU EU9ME FEU}9Ћ}=\0tlSQu uh#  0\Tumq֋]!qISQuuh# ZE̋UEU؋}9Ћ}};=\0tSQu uh#` 0uuh6#E $럍e[^_]ÍL$qUWVSQ0QEU}9Es9=00Esuuh[#"{0 00sx1uЉ}ԉ t9E}rEU9E}\1ҍMQRPuu ŰEUEUċEƉE؉Uu܁Tt-s։!U!CЉEUuuuu# K` t1Ɖ׋Cu}ܡ0t`s0WVխ00@x1҃ RPuu! M])Ӊ 0 00@x1RPuum! 0R=00tЍeY[^_]aÍL$qUWVSQ8QEU00Ӄ 00}9u}9u9=00Esuuh{#y00E؉U܋E9EEE0@Ẹ00\1ҍMQRPuu UEUEUEƉEЉUuԁTt-s։!U!CЉEUԋCx1RPuu! K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=0u 00 00EUܣ00Suu5050腧=00})E50=0019}VVdf%ZYf=u Gvdv`YYF`VdvlvhٰYYFhVl1tttpM述YYM؉DpTtA u1M蔰YYM؉Auv<=0u 0(1E؉Ẻ}EċM9MSuu5050躧rVVif%ZYf=u+=L0u"}uFV c9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡000=000ЍeY[^_]aUWVS u} 0M]1EuuWV\  ‹Mt WVh#u10010 050=050=010=08#AH0=00态1ǣ01ã0050t C0 =0 0QhWp0ZYu hò#te[^_]á0tUPiZ1ɉ 010UWVS u=00tFVFV zEU존0H0AEUSQRP!  w 1҉UtE4P`X30RPuu  01{{E U 1҉CS1CC E UC SEC$EC( 001E v 9st DpTtD(D,T0Gу} w0090ub11tDXGu뺍PRdZY=0u h#r00d0P00e[^_]UWVu} 0RPWVh 0t9xu9p tWVh #re^_]Ã=0tQUS00\;0r 3gX50rg50gg100ZY]á0@ UWVS$Ɖx@t@VЉ_uDž& v vv 0p0vvxNjH0P0@t 1ɋ9}=؋ÉA빋EU RP É19r=0th00tF1ۋ9}&G q1DYYQCG W50ɣ[X9}W ʉ@~ 09Ht09Xt~zG=00t T <tYv vh #hRrRV莤t"G=00t 1ɉ ؉L1҉G 1(0C|W50[X"~@)EU 9GG=00t ȋT tdtJ1҉FVuVЉYu uXZ]gE E H1ۉ(0FV RPRPhS¤ShA#o he#蟛Xv v!ZY=00t@V+EU FV@V z+EU oFV hs#0gX g؍e[^_]UWVS uE 8t18E 1ۉX0X400tFVFV щ} G$W(ff%f= 0fua(9=0t;9ظu!t F Fu~hu)}t@󥋅 󥋅 w0NӉWVSQ 100 t 0#8tU@DNL!Ή!؉HT t0@8] C t`d E x@1҉(0P @RPRPhS聡ShA#hl he#^YHE p p^X=000tp0PCSp0 ЃW0  B=00=L0tzGf@t`r@GpufGGhtGtSfGyXZ G=f@u10000FV =00tGFDG FHGXGpFDGtFHGd F@VW[X=00=,0t =D0G\uG`Wd uGhWl tlh̺#Ch#ou 1ɉ (021G\G`GdGhGl f!0XZ=,0ub0X4 ؙN0ʋF4f0F0V4=00LGWF 0W\tF@I0D11 0 G\<#8ts@DYL!É!ÉIT tA8F D`Td uDžFVVV[tbGhd19u 9RPh#mA=80t hF#Yh#7mZ_XF0=00tV4CSCh~@jjv4v0vHvD whS#@h̳#lH ZY=00t @0@ @0 4e[^_]UWVS0E1ۋ 0;Y,EUu\TtA!A1EUAEUEU11tAu}׋E9ƉU}=E1EEU0CBHLY4DEUE9ƉU}:E1EEU0븍U1E 1ɉ 0 0 0 0M0];X,}|1Eu| 0EXZ\Tu]e.Qҋ}!Q1E]]UuI SQh0p500}=0t =0t =0t50u50P =00tE@x 01҉EU=0t60p,kEd1<SVuPhl#h-10=80=<0ExU t1U u E#uh#=_XExU uۋ}G\M]ȋ} }tyt<҉UEyEEt0ËEsM]1EUH뫋u!Ƌ}! uEU9]u9MuډM]EEt0ËE} u 1s<}%?}u}9t uuu'xYuuhû#;jN1xM󪋅xC|UEUpt|}9r WV/XZ Mt9uɋp9u|]50=0|U000M]11 19E}eu5t09|]s1-h1l|]+hlȉ uv/t0]1t_}}9u}9to<%?u9tSQh#:jӽM]WxS+Y[M]u Wuh#9MEsE)lj1VEi10e[^_]UWVSEP@EUE@ E}juu# t0t`}9xuPu9puHEuuh8#Ep p{ 0qyEpxu}qy 090u 0u덋=098tEUMK؍e[^_]UWVSTU1EE 00111E0x,9}=0t2kEd1E7uWuPh#h-1=01ɉM0M;9ظVSXZts]u0=00tGuEG.GptEGtEGEGtEVSlZY8tEPWZYuEHEe[^_]UEU @,+B,]Ƀ=0tf‰Ã=0tÃ=0tUWRPHpY_}UWVS EX8=00t 1Q=L0tt1;00slj}1RPk@C^_DžE@4} G0.3ChK%PZY'Mqy u9tXY_8u6950|_ssدFXZC SCS u950|)js s]Ah<#,#hb#%O 3ss訦1ƅs{Dž( ^_=00tBBBpBtVR`ZYu hc#["_PsstQDž ss輥VPtVf@Y[5050~VfHXZ:e[^_]UWVS(EP@EU졬0E0RVuu EEmƉׁ\TtCЋU!CQC RPh0S500}=0t =0t =0t50u50 ExU t U tuh# XZ1ɉME@ Eܾ}juu |EE1E؋UԋMUM0EMB0Åt4}9{u}9{tPHSK0PhX#E}tlExU t}G`ǡ0RPuu ӉE1EЋE̋Uǃ00Ex@t+jj0@4 ؙRPEpHpDp pa 0Ez89x t0}t*E@$ EL@ EUMM}ttto0E{89x u^E@EL@jRPEpp K` tPuSYdh 5050Nm5050W=0t0PP-zXZ50"0h0zR 0e[^_]Ã=0tUWVS\U1E 1u0X,9] =0t/kEd1VSuPh#h-1ۉ00u1EE1ɉMt0MU;9WVWVQEu} 00tCECECXCpECtECd EEP$$&EXftbWVYZt=\0WVhֿ#!WV^YZt!=\0WVh#] SEP襛XZ0Ѕ9xu39pu.JZHX0R~jh^#EPLjh^#$tC CC Cu jh(#jh4#EP躴`WVPh<#E?Ee[^_]UWVS00|jj'P1󪋅h_X=T0xX$=80uh`#*G^uhw#)[=80t؋1ɉ$P0h 5050i5050+T=0t0PPvXZ50t0XHXI$~6B#9)Z#~$tl<hNjH`ltW,Ћ9G0sVh#$^_n=80tVh#Y[h#EZC=80uՋB,t|Fl$1~H`F|@ltË#XLS50 |^_u h#|0P0h 5050Pg5050Q=0t0PP/tY[500Z00tt DžPLDžHLPP1󪋅lPP TCHX$~@=0u\t`H`CXDžU X)Xtu{xlLtuQ+HhVHXDžU 1DžPDžhDž\TPh#1hDž\L1 L0׍G@tutL9t G@L9uՍ1󫋅<8tx@8txؙ!lj!׻9tx}^x`1d`dtx0ttx1tX,9t=0t4ktd1=VStPh#h-胥10tl1p𙋝ttƉߋ\Tt#@`Ћt!؋C1Q@ RPh0F50|=0t =0t #=0t50|50r =P0u-|xU tU tth7#[^=0th0(H 0Y=T0t =0u0 H0 D0 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5050kC 0𙋽l׋pЉ`Ɖ׋`ǁ\TtAЋt!A1qhARPh@0E=T0tthW#XZX0ph5\050?a =0t505\0*n_X0\8 uǀ\T5050KY^=T0th#PE_Zu)5050CY^u9,0u 0Ah`𙋝lڋpÉlƉ߁\TtAЋt!A1`AId t1RP5050Aj50HXZΉlߋpËlቅlpplp8T<DT9ƉD} TD00Tl)Ƌ|@`ui@,L`tLH9t||`t||`tLH9tușD1ff1h$~lj1w8d1 |@(9r1|@,9r1 |@09r1$1t|@x9sЉl(1󫍕HU u H1׋h󪍕U u P1׋Xu"xLu DžU t11ۋ;WVBZY< <<tt<<tM U u P`ك⋍`9s WVPh# CVtuPU u PU u P1ɉ`T9lpD08lp1ۉL1[8L9˃<1҉@<@8 rRځU uT ڋ`Lى4ً4 @LC99hHd`1HU u HU t PLP1~\Hd`11ы1Ƌ1f$H```ktgU u Tjj(R``)ٺ!PMH8șlp`3$\`x`11;dsV`!։lt @lt$9~؃҃u`GCl뢅t$9~ș`l tLjS P) =\0`t'W3VslsQs th#葕(h#PX<ZYtej PSdWh 5050NW5050A =0t0PP-d_X50 0^1ۉ(0=P0tP|x\|P( uT|PTxU u |PTHU u HhRPM( h!#\P@;ZYtw\S|CV HU uHڋ|xU tT |GThRPUh0c; 01(0=<0u)|xU |P\1ۋ9PU u P|U u |W\ !8uC<1ɉt[|xU t |B\u0tȉlPh9#,YXlAu1ۋ|@H9=U t | |G`U u T !8uC<1ɉt[|xU t |B\u0tȉlPhY#OXZlAu농U u PXRP% txhx#P8Y[taU u P|xU t |G\XRPbSh08 0t j SV$  =\0ts h#讐Dh#Pu7_Zts󥋅ƀƀh 5050]R5050<=0t0PP<_Y[50&0Z1(0e[^_]UVS1;] s8Shk%^X1E0Ph#FZYuj XÍe[^]á0!UVS1ۍsrT =80t40y-h#wYX"#t#P.Zty=80uɡ0t4象01ɉ Lh P50Q5050;=0t0PP]XZ500X15(0Kt00=80t h*#袰[hH#-Yti=80uۡ0 h P50[P5050:=0t0PP:]XZ50$0X1(0jWjWYXuj]Zuj]Xe[^]UE0E 0]á0á0UE Puh-h-j 虊jUWVS]k8ށu=0t50h"iYX= 0t"=0u50h٭#E1 0XZuu O ZYyW5Ph3$ t7=0t.j $X=0tkP50h#j^e[^_]UE Puj' UE Puj UE Puh UE PujjUWVSx1ۉ0PhqF%n^_yh#hVuU ]t Ƅ1PS!ZYySh&#LY[u%=`uz 9u;u0Shh0ƃ uSh6#뜍xPV_ZyV끋%= VhP#e= u:u*ShV t ÿ"Shn#0SF [+S: Y0hVź u|h0hX$5XZ|듉e[^_]UEPm,ZtPRPh# u uh#hh@0A@0U$0tjXj USAj0h@&j` (0jjV]USjjj,jj#]Åt3USӃ=80tPh"܉YXSho#XZ]USu=T=Tu =Tt=Tt=8 uI 0t=u 111100 001<=T=Tu = 8u1ہ= 0묃[]UE,0 H0t,\Tu ǀ\8 Tu ǀ\ 8=D0t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC"Zu"h#'[=0t h##)Y=0t0PPQXZh 5050D =0t5050QY[0\8 u,0ǃ\T1\T00uSChEZ:#= V p0΋p0ѡp0ƉϋKdC4p0RPWV藡 000 =`0TC,HEƉ׋Eǁ\TtC!C1uCRPh@0'=T0=0t\0PP^PY[0ph5\050;C =0t505\0&PXZ 0\8 u ǁ\T5\0Q50u tc=\0uT#EKh#̢=00shX9s΋9tRP+0Ph#莀h050*0 H0[^ D0t[h 5050DB5050,=0t0PP#OZY50 0`0X%0e[^_]UWVS]u %00$0xPSY_y膠0PSh#f=40t(jS 0_ZyTU0PSh#5%= tSh=^"whk#p u1.=i0t 0=80t"h#/_jS脥 0ZYySh'#~1ɉ 080  0u Sh9#~XZ1 00000010`0H0L01X0h h"0h hǣ0h h\0h h0  ʅ ʅˆt h@#VSÐY_¡40t"ujV: _ZyVh'}#-^0=40u%RRjPVM8@tl0p0t:`0 80 40PDPj50S7@u She#Y^Tu She#h%tV_Zt%h#V谏ZYtVSh# `LuSh#C\uSh#+50V4uSh#uSh<#f^_uShc#܍X1‰11p~u 1ۉp0}Tu%HSQRP+ DžTӃ~ ƅtBtѥPD1D1É1P1RPWV蔚 OډSWRPq h#Z1ۅ~;srPƉρ}Tt!1׋ t1`01t ;r5Ch#h#h#h#h*#hC#hd#z5`0hw#@^_=KÅt0\Tu [t1ۡ0! 0=80tth#[u h#YY0 h P50N;5050%=0t0PP-HXZ500_1ۃ=\0t0Ph#xY^0=0uNtJt2= 0#=80t7$Ph#XZ=80u h"#X08<00C,01=0C0k NKt鉅 ׉ ЉNj׉   =00=T00=T0x=80t hC#^hh#[01҉XǀP1ɉh P5095050#=0t0PPE^_500[=005=80t h#Yh#ZX0PP #0ǂL1XǂP1\h0RC h 505085050"$=0t0PPD[^500Y0 tyPh#h̳# Hu^0  h P5075050 "=0t0PPlDXZ50V0_0vuh#gh#`[^Hu\01ɉh P50 75050!=0t0PPCXZ500X0@_X50?0`0^0(=00tx<Ph3#JY[=00ăx0(=80uh#ZHuqht#А_=80th 505005050$=0t0PP=[^50m0`0Y 08<qH։9u9RPh\#q0BHЉ8< =80uh#. ZHuqht#X=80th 5050/5050K=0t0PP<_X500`0^ 0@DqL։9u9RPh#0BLЉ@D =80uh#U [Huqht#Y=80th 5050.5050r=0t0PP;XZ500`0_@0=000PH҉8<PL҉@D15@00=T00=T0?,=80t h#i[h#I YL00ǀ, 04ǀ(<PH҉8<PL҉@Dh P50-5050=0t0PP|:XZ50f0`0X=00OL9=80t h#lXh #L _P00ǃLǃPǃT\ǃX`B,F$1҅~K`F@#CLh S50G,5050=0t0PP&9[^500`0Y =`0tv0=`0uhh P50+5050X=0t0PP8XZ0ph505\0+h@050 50Sh8‰L^_u Sh0#1׉1ɉ509)~09~NjLWF8HLNd t1RPS50 t>t Dž)hX#hk#^Zu1ۉ(0j_=0tHWSS6 0WA8HLId t1RPS50 =0t WSS6 0@0 0011Shr£0XYu Shp#1׉^,jSt0_ZuSh#}=0 00 ȉڃ9 sA0001ɉ 0 0jPã0j500…ˆt0Ph#"Shg0_Zu!Sh#[^1(0jZ7&0 <0=40u*t!h#P0yZYu 0 p0>hSP5050ƃ 0000=LBALt[=0h #h#Y_jjjjjS6:=0fGW69fG0CJtejPh(#k =80uh#BZu9hF# X=80tC=0fGW8fG0_fCff=v]h]#Y=80uh{#Zu8h#螆X=80tfC=0fGWZ8fG0_fCffuih#Y=80uh#lZuDht#4_=80tjjjjjS8=0fGW7fG0f{f9}zD3<:uƃu}EEUEURP5l0u uވ l09ul0E ;}|vp0EUtJ9tFRPؙUEЉEe]EUSQRPb| RPh-#\RPh#\ Fyj [Xe[^_]UWVS}u EUEUEEp0ؙMʋEeEUMuuuVW蓇 9Eu 0UMr"wh;#[X19]~KؙEURP5p0VWB p09tؙEURPh#[ p0E e[^_]Ze[^_]UWVSQƉӋJt,B=p0g#9u!#s sRhr#C 1҉Sss ssV01E1ۋ09)؋r09~ƋL߃=0t VWWj) 0VEA8HLId t1RPW50=0t VWW) 0X0Ede[^_]UEU z t]]UWVS]0Hdu } t109{ u9st7S500uWVs50Cs{ ECe[^_]UVS0500t+NdEU  t19S u9CtCt[0uh#uu uS$SPC00X0K؍e[^]UWVLU1u} uĉ}ȋEER艪Xe^_]US]U tuwtttoPh#9{@uRs s8 RhX$XZ=80th#zYh#Zu 1]UWVE500x=0t50p50 * e^_]0ÍL$qUWVSQQ90 0s RPh#H5t0 01ۍ}WSQRP

#N/50'v X0Ee[^_]v e[^_]ÍL$qUWVSQ(E11҃}50~8]9 00)ӉMЉ]ԡ0E1҉])؉EȉE9‰؋]1EEЉEEM]KE9t*EȉEËE]̃rAMEEE؉U܁\TtFЋ}!FEU܋0QF EURPh0500=0t =0t =0t50S50 {U tU tuh#XZ=0EUؿEЋEU 0{U tEC`؋Uu؍  0EU9Uuu50=00MLU9P8u+KIjH`URSPU)S$) )Q h 5050 050So=0t SS^_500h0  0EY[E]9]yV11ҍeY[^_]aUWVSu x0!Ut 9rt8R}t-j+Xu h^#s1rBЍe[^_]USM x0#AUY9u ЋR9uX[]USEU 01!t4^Fu(9u 9t331 É[]UWVSu} ]9WV+ZYWVqZY00t9ZtjSP0 0M]XM ]$HX 0t}9xtju5|0e0 0UMHU M$PH e[^_]ÅtUWVS E uV8&<}EEH89~kًEuC&E4@&ߋE9x8|EU!9u(EU|EUqU߉eMMG빃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh&hz#UU ME@`t+tDuTɃu:< %ЃPh&hz#oUSE MUR`t't6u?Ƀu)3  Rh&hz#]USE MUR`t't2uAɃ)u+5 Rh&hz#舺]UWVSu E$ %EFlU(EFhUEEM}}~ ExE$E8NpU9r UùupE9} Etуu EFB܉)EX؋})EyEؙ}ǍW?ك9M}tu :JI)ˍD}9~} UEU~E U+EU~E U+EUE$E~CUuI[^_]UWVSu]tVO _uVhr"j `1ɉPhd@u [ tGRhedAu J @u!je8tuh" XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h $  ƹ ߋSh"V9 CPh"V+ C Ph"V CPhĆ"V CPh؆"V CC,$C,Ph"V C0Ph"VԬ tPG X}!uhzd@u JI @RhedAu ,I @uuh"jT 41}󫍅Pu^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*P j PEPL1e[^_]UWVS4}jhPjW)tGjPjVWVSi u$U ʋMQ؍e[^_]UWVSu] 1PV'ZY1ɉ%= j/VW_ZxrPRV)Ph#h0W?jP. ‹ 19}e WPSZY u$PVZYyA =@uusauÉ1ɉ PSt[Xuk%=@u/h#h0V>VÉD= jf XZy.hh \f à 1҉PS5>ZYt-Sf Y 1ۉ 9u 9t0Pg6_Zq8T8PRPS3 s>PhFSD yL_8SBf Y h#j$Wh=jjW8e Ãy}tWMZt8PhF|@SrD y&hF S`D^_P軥tP覥Y}}Wt9Pr趌XZtPSXiut背ߋu0P _t PYtRZxSd 룅t6X؍e[^_]Ƀ=0tf‰Ã=0tÍL$qUWVSQ0EЋAEqy AEĠz0Eס0X0]؉E܍EPuuWVHU UMUȉM̉E9މEsMp1Mȋ])jj`SQW ǡ0U4ڃr h#迯_W!ʈEċxlEHXx0!9tPRPh#u0u< =80t ht#^^h#2[u 1ɉ (01!EPT@P}ЉWE1҉PPPTeY[^_]aÃ=0tUWRPY_}UWVS EԉUMQƉ׋] 0H0ș9Ή}EE5EPWVuP0;B0u Exth#tX0@0RPWVFY UBEuWVPuU tUB EPE܉UM9E9u9t/MC E܋UM9Mt}u ƉaE9t }tcM܋EPEEPT@PƉ׋]E9u1 ce[^_]UWVS,E @XEȍ]ܹ1juȋEp ޅtPEp[_E P@#EԉU؋VẺUЋE P<@8N^ }9}u}9}u9u9tQSQuuRPuuuȋE0h#ˬ,=80t ht#{[Yh#Zu 1(01)V] CSFV sC8S<e[^_]UWVSPhjjFƉRP/ÃfC9EPjjSN0;B0u UztWV2K_X50u  z0QrRP3 E@ `0M ȐȔh P50h$5050[^=0t0PPEZY50/0Xe[^_]UWVSE XChSlEEUE EE=00tP@P @ƉuOEXuhC#1҉(0YX500@0RPWVqS E@ `ChSlEUE Eu hd#蛩0H0ș9M}sE E>EPuuunL0;B0u Exth#PX0@0RPuuP UBEPT@PChSls}EgUBXEU}GWEU G8W<5x0#uTGPWTEUTE@ U B 9t`1e[^_]UWVS8]tEШ"i# E$d#z00}}{rT 9RPYXJ0ws$&1҉Ut4Vh#=80h#WXt4Vh#賨=80Fh#_WYRt4h#kj+t4+XZf%f=tC0ڔڐVPh!#5=80h#VXEPjjQJ=0;G0u Ext+Crt4ljE G0E1ɉ ‰L_XP=0%JXF^9t(ߔߐVhG#蒧E`QB9uРz08BufJEf9uwh̳#@_uS h̳#/Yu(h̳#Zu1(0}t0ؔؐ,F_X01ɉؐؔ0{rT uDVhe#ʦXZ=80t h#{U^h#YsS50,XZ0t4*EEPjjujH0Z09u Extuhw#1j)@E܋E=00tP@P @u4puSQRPM EP蓑ƣ0X1}9}~h0X01uE)ù`1j@@Pv_X1U9} MȉыU @ۍzEE܍HhhGr EPUEk[^1E9E~+u܍LphGr EPUEVhX$htQDhdv$v tQh-#W>,jVjhdv$v W 6lQPl/SlX1e[^_]UWVS ƉUMjQRPtuh#V_XfUt+tuuhY#VSl^111 tuB t@uمtr} }uWuRJtjjhu#V~jjh#VjSjjjjjV pfuuh#V~uuh#VjSjjjuuV,E E܋E E EWOM1ۉ]G uuuh#V ~#1ۉESPuuRRh#V EԊWуt=t8juj1RPEUEURPVi u[]PB2EUE UM ]}uSQuщ‰ @tE9 SjX렍e[^_]UWVSu} hjeY[u)Vh#|XZÉEEU(,E$E U$0418%jhSPVJuhVSh#Sb<RPOZY@uh#B$D%=u?$Phd@| @uh)#S&^_$uh@#M, ((Phd@+ @uhW#뭋, (hm#S딋Eu ǃ$$, (uO1҉MRQWV  ‹MtQh#SVw! (,u(,EU싋$1҉MRQuu Ɖ׸9ЋM|RVh#StRVQuuh#SWVS @tEjjEP11ɉ @t_jjjSEtHt*jSZYt`@ P$@ t^9sVu jRPS@u7tP& Xh#SSf 1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@ @u%h#SXZuSh##S E](& ]US]jSYZuhi#jS YZuh#SXZ11;FN|#~$u~,u;FF |F1҅8tZu"[tuY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu+_ZNjF,uVЉ||t2@|jmURj$O8QJUR|P tijWR轍 uYjuWUu!@uuZYjuPUu@v0shd#us[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0ht#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh~#S{ZY8$E܉E1EuuWV  tuWVh#SBHEPuuuu Ɖ׋EU tuuuh#뷋]9ً]}eY[^_]aUWVSu 1ۉ^h%5 7K. _X1td1SщU &M YZMtUBuSh#u} $&(&  Vh%j- XZ똉e[^_]US1,& &uh#`u܋]UWVS ]} Wh!#Slx 1$&(&E؋E!ЋM#M t:!#;tA4#UWPSxW &SxUҋE!U!E`uE Et;uuh)#juV!#;tA4#WPSxWVSx؍e[^_]UWVS]} tEU E U uh0#S_X S^u E@P;E sPu h?#S؋E pVSZYEtu h^#S 먋EЉE܋EЉE؋E#G0EE#G4EEU E UG0W4S(_@fVSZYM#H0MM#H4Mu} u }p0x4S^@+u hz#Sn Ee[^_]USP] ;u:j EP5 7( U:u1҅u5 7h"u Ћ]UEUitstau+u PJ uPZYUg@Rh#P UE ft*u 5 74ZYt5 7h#uA US] ;u#5 7蝛Y1҅uh#u%XZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h#PY[E1eRP6 $RPn[ZR@8Zfu%S5 73ZYQh#P\ ֋]UWVSu }jj h!#WVj]S yEWVuh#\}t Sh3$HZYj `Xe[^_]UWVSQ]M tu EU"E G"Qh##S'M $jUXZM uWh>#S 9jVQjjuuS U 1ɅuWh]#SKVY‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjSA_Zthx#2jS,Y^ujjjjSbEUE Eu h#SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSZxt h#PP @9E}}EU u h#'EUjjjS@ $u TY_u h#jPjuujjS9 uV4Xh #SZ p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PS1_Z@)QFHVL}$E$9EsE܉FPFTy 1;VPsUWS1ZY@UB߃}uujSu@jp juuuuS u h@#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9-tE &1҉Ue[^],(hg#)$hr#$1RP,(4 RPh# h#jSm uh#lXrX CRPh#Fs,s(h#s4s0h#$C8Phe #hxVi-Vh#sPh# 1e[^]UU E$E8E U]UWVSVEUFV E܉UEUEUEUE9E EM|vuah#WE UEUEԉU؋E9EEM}6u&uuuu uuuuh#W(1FM]3M 3] t?uuuE Uà hz#WEXZ맋M܋]3M3] ut.u}t#uuuuu hB#WEFE F E$F$ku}tR#}w+M&#}w M&#w &RQh^#Wx1ɉNE C E$C$E;Eu6E;E u.FCstX^EUEUV#E9Eu2E9Eu*FCstX^E܋U+EUFV vE U+EURPEU }PH SK UMUMUMNU܋M+UMVN VPC^sXPtB؍e[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP щΉE؉UMWVuuS  t/EUWVRP щΉEUMEEċE܋] ؉EE] ؉E}EăxfPEЉUԸ]9ظ]A}tE9E؋E8E؋U^9uEE؋U܉EU}TWVuu} EUE Et6EЋUEȉUWVRPS Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}tE9EȋE̋]9uȋE|E] u?9}EEPWVuu ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@Eu1EċEčeY[^_]aÍL$qUWVSQ ȋ]yIX P@EUw Uyh# %uh#urXZ~th#O_ ȉFV E؉U܋E Eu.E؋U܉GW FGFtxM؋]\MЉ]uuuu M؋])ӉM]MЋ]9]u 9M9ME}uuSQh#uEUGW )ډVFV )ډFV uFGFtxM]SQM؉]uu  ‹M؋]t&M]uuSQM] M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U M]uhz#u+GxpF)^N^ 9MEu h#~t h)#FV E؉U܉ȉ+EUEUE9E؋E܋U} hT#E؋U+EUEUFV ȉ+GW VE Eu FGtxM]dM]O_ ˉȉڍeY[^_]aUU Et 9Pt@]UE]UEt ‹@u]UWVSEtf1yAQ $T$D$T$ D$9E E\$ |I11҃yuEԍe[^_]UWVS@]u }(,EUEh#WVH3 t(qtsu&jsEPjjS@uvE95-th&j[^uujjjSlEЉUԃ}u}t.EЋUԃEUE Euuuh#SE$1RP,( Ɖ׃u؉}܋}9ЋU}uuuuh#SjSEZYtE̋EЋ@E Et h#fEЋ@ EjS^_u hi#?jSzZYu h#!x G EG$EjSG jS9 tu h&#S^XPH UMċM9Mu"M9Mu}u h=#SY[1p GPGT<9s/jh&Ve tV(F,9ŰM}ỦEȃ͋u}+u}9űE|uuhb#4E؋U+EU9E̋M| h#U9UEUиM}9|E 9ȋU|&}tE؋U܉EUh#SXZE9E؋E܋M u}uU4}u h#SYX UMH0xh#S{XZ1}9}[uujSD@1jp juuEU+EURPS uh#S @ r $󤋃p PF V$1FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@.Eu}U؋Eh#S_X}ffuS7Y^@,h=#À}|h#SXZje[^_]UWVS]1uuuuu11h[#uu ". btENtoat%itClh$%Y1EPS &EPSEPSZY@kq`1;EE}=S0UU܋UUZt&xuPtM9Hu M9uU@օtE 9-uEU t th&jZYWVRPuSe[^_]UWVS EЋu} jj h!#RPj]S} yEWVuh#G}t Sh3$3ZYj KXe[^_]UWVStƉPZt 9St[Rh#V *{ Rh#$1s3щ¸#$1s sщ¸m#WhX$hV (Whe #htS SVXuhhq%VQM SVh#6GPhe #hS Sh3#$jmSj$G8P7Sh#h#G0W4 uh#X1RPhP?Pލe[^_]Ë @-Q@-y ;P-| t8-J 8-Uh8-P#XZUWVS֋U} $ &E#` u>h#X ׋󫋃V6h #XE#e[^_]h#X8She #htS Sh#sh(#E7#EE#뚋A t h #WXhS#LC SX1ۉ019u 9tCuE]#!#t!#PPh5% ht#_tjmWj$8Sɽ1tttShe #Sh~#hWWh#QZY?h#CXu+u"E#VE E#e[^_]e[^_]UWVSxh% h#hh#x h#h#xà Džp#Džp#s3x pjs sx pM Ct Ph#K Cs31 W{ WhX$hPD Whe #htV*VPuhhq%PH Ph#XZ{ h0he #hVVh#`Vh#U h=#Hjj h!#x$K x$cRPjV* x$K x$cRPhE" "jmVj$G8PVhe#h#G0W4 uWh#X[tVh#eGPhe #hVVhX$AZYgRPhPP)h"K Cs31 OC tYC 8P)s t󫋆Rhe #hVVh#1e[^_]UWVS}] u1EEEEh#VS$ t^l`~\a wT$0&ut:xuCMÃM뽃M뷍EPW EPW6ZY@uM딃M9-th`&j^_xjWZYu h#X]t UI;]E}1WUM^t xupt9Hu 9uu@܋Ut4h% h#9hh# h#$h#"W+ƃ E#EE#v6 uv v u  FtMPh#XZ N Fv6U vXZp h"VY볉؍e[^_]UWVSD] 1}&}E#uh#uu q" tditHTt*PLt7olt Pwb&h$%Y1tukVS_Z@ut6PEPSB @u#tjh&VWV t E 9-tht&jZYVhF EPS&e[^_]UWVu }^_]UWVS]u 1ɉMMMMMh#uVs! tfitLat%bt0lh$%/Y1txEPS~thEPStXEPS"_Z@uG1;EE}1SM}Zt xuPt9xu 9uU@܅t95-th&jeZYuujjuSe[^_]USЋQfPfQfPQPQ P 1Ҋ\ \ Bu[]USÉIQHQH QH QH QH QH QHQHQHQ0h#RSW]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&WT uu wu#'% _@@ǃu‹p 2 vh#P}( F8Phe #htWfWh#S+ `FPch#h@&hh#b轑 X hShp%, þ11{f ƅxh#P# u V輽 [TPhנ"V' tCPhJ#Vm' tCPhU#VV' tCPhb#V?' tCPhF%V(' tCPhq#V' gCPhz#V& LCPh#V& 1CPh#V& C Ph#V& C Ph#V& CPh#Vo& u DžVWG ZYuh#{Y[Buh#7Wh#, uSPh1#S;$ tSh#8 B p Dž@$A 9I ÅWuh!#h4&hh#P;! Vhe #htWWhF%S[( FPhe #hWWh#S0( v$v h%SV' v,v(h $S:' v4v0h"S' trjmWj$F8P2u S _Zt@Whp$S' uh.#* u ^ [h8#* q Y讹 h~#% t9hQs" XZu&h#諬S[.8-VSH_X8-tVɫ^S3Z1ɉ % Xe[^_]UWVS]} U~#1,hX#R$W  @$t&Ftiu5 7Dž,9=-tE h&1ۉ]e[^_]1(,$($jSZYt,uh\## C Y^uh#륋$1QRPa uh#S辪 芷  h# XZth#Vލ ZYtjhP?a u$h#ScV4 )  4Ph1#V F41$1$8Ph#V# TP8hY^(1RW($ $(,101ҋ$()׉ h8# 菌 _ZHh.#Pz ZY-PE _ujh&R#E umV迺 Y8PhF%W" dR8BZYdt8h#S葨 1ۉ,DPh%W }LPh $W `,9DH0|;L Ph#S1V $@PT, uh #SXZ:jjj5Bu @u h6#1$9sP,Q ;$usV軴ZYu+C xu"mt s sFYXj 谠Zu?Xe[^_]UWVSE @80ƅ77Ph"u t 7uCu X0u: ^t h#0p jVh.(4 Ttg81ƅ9.(@󥍅8Ph#jPS{0Ph#jPuV{ VSh#j SG[t h$j T˅t_S zuR(,Ws,ZY,u1(zu%B sVqZYu+C xu"t s s>YXj fZuXe[^_]UWVS@J9sr[^_]UWVS]u)ZuPe8E_@u h &h#u0^uh &h#j sP3s Wsh$ut t.P! EheD$uit E tZu EYLEPhَ#u }Chs@Pu @qh#us XZt V蒂 Yh#us XZt Qt XMEPhَ#uK E Mu {hE EEEM؍CU`EPu u @Muh &h #fEftft5fu6t2C t Wh#jG }tC(Uh<#C0ut3hX#j t C0sHtS4KL9sщ}t:s@shuÝ us@s`u讝 @u;4肸81t/sl`}t$CU[s@s`ux @uEsd6CptSuZY@u s\hn#s8sXu@ @u s\hX$te[^_]UWVSPuo Zu1iu q _tQVo Yt=Wxu EWu Br MuSF VW [^PQSbr uV< ZSo X؍e[^_]UPEPhC$u ƒ 1tEUWVSu\Ph#V t\Mfnj4Zu\VXtd$1jRVUVhiS@tt}f1RPh#u  1e[^_]US]uu S? @t ]]1]UWVSu up [^u `P~ Y9EsC?V~ Ƌ}M)1Ze[^_]UWVSu up [^u P~ Y;Erܵ?V~ Ƌ}M)1Ze[^_]UEPh"u ƒ Eu膵UWVS8uEPhu#V uh%h0&hh~#h#VLo _ZtP} ƹ}[E]ShiV5}ĉjS| Ph#u o ƃ St Yt=EUu؅yكۉM]! EjEP{ XZuVh#u Ko V He[^_]UWVS1Rhiu4 @t|j7RPh#hSހ>tVh#"Vxt j7RPh#hSi;tSh)#S;\ e[^_]UWVS]h#Sm Y^tVP| Zth9#h &jVh~#$V#| ƍUܹRhiS3@u h[#j e[^_]UWh%1󫍅hPhiR3 t|}UWVS\Ph#u2 uh%h&h0h#jdShiu13 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVvZtÍEPhG$Vj uh%h &hh#被uS1^Xu h#j- CPSx ZYu h &h#Ph#u cl uh &h#j S1e[^]UVSSu] EPSV @uhЗ&h #j h.#VTk ZYuhѲ%hЗ&hh#ت#EueD$PRSk He[^]UVSSu] EPSV @uh&h #j/ Eu h"#j h#Vj ZYuhѲ%h&hh#KPh#SKk He[^]UWVS}h:$Wwj [^uUPx pY@vh8#V2Zu hM#jz VPh:$W@u hf#j0 xtdPhiWp0 th}#뮉`SQX`e[^_]UWVS}h$Wi ZYu萯rPx pV}YXuh#DVSh$WE@u h#j 1҉Uu]EPhiW/ @u h#j~ SX1e[^_]UVSÉЉʉƃ ιa#u!#QuRPSh#e[^]UWVSu1jS,Vhxi Pœ@uh# UЉUPXۋUu h#j U]Vhxi W @uh#ڋE9E~E1}~ WhX$VFXZ;u} j eYj [Sj诃UVSPuVZt"ÍEPu V @u Sh)#j6 @PbUWVS$ƉUЉh#Pg [ZtPUv ƹY1@]Shvi V.j Svt Ph#uh à V HZe[^_]UWVS0]EPh9#S uh%hė&hfh#迦MԋU ;@uE̋UЋM]Mĉ]ȅy+كۉM̉]Ѓ]!ىΉЋU!Љ E UȉƉ׉u}j EPs XZtVh#u Ag V He[^_]UVSuV[th$VUf ZYuhѲ%h&hh#٥Pt ^fx PS+ZYu h#jY PX1e[^]US]EPh?#S0 u «&juS,ƒ 1Buh&hX$IXZ]UhH#説1US]dPhWX%S uh%h<&hh#d|lPhiS+ @u h#X1]US]dPhY[%SI uh%h0&hh#聤d|lPhiS>+ @u h#LX1]U1EEpPhiu+ t h}#j 1Uh.#u\d ZYuhѲ%h&hh#Ph#u d HɃ0 v+BwBÍBwBU]UWU1ERhiuG* @u h#j 1}W|$wUWSÉЄtGjj h!#QPj]S觩 S z!#ta#PSh#_ h"¸A4#Xe[_]g_UWVS詧"` uh&h#jU jLh-Ds_Z!#t#jmh-(sZY¸#u!#WPSh#h-W=h-t VW?Xjmh-rZY¸#u!#SSSSSPShs#h- $V j}UEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-qYZt k=CЃ v؃߃Av Ih-趘Z>u, -1]UE1҃t0]UUp-t H9t@]UWVS81ۉ]܉]E䀖511EЉ]ԍEPjCLZY@MЋ]u h#EU׉uȉ}̋}51ɚ;EEtJ*EUʚ;EEt$ӃMЉ]ԉ11EȉẺEЉEԍEP[@tEЋU ЉEh$j; uGEċ@C t@PYEąt݋@EtCt}tMEU9u2U9u+9u}SEZtjEP. Y[=1u4]늋U9ыUjSZjujzEPjJZY@UE]9u]9u9}~ 9UȋU}h,"j UWVSÉHPZtP_D 1D1V9"LY@u h&h#&RPHSƃ uh&h#j R1RPh#hW%WVh#M jVW舺WhiL&@u Wh#t Ph#XZjVW>Wh~iL܈@tt Ph#łY_j ݁pHZ@uh&h# u =`-j:RPh#hW?tWhX$LW袔| j:h#hW?tWhj$W\| tHSW?YXjVW!Dž@WhiL詇uhw$薁XZjS#jVTWʸDžd1hlWhiLP @t|h'Xu h$l@1dWhiL  @@u h$@lh$@RB =?0t%oA"wh&Rh$覀Y_HS XZ=?0u0=>0u'DjHSDP jV`V蛷V>0-{k?PL1@us$=>0t#PjS h$%$1%X th$A4#X thA"A4#oX th$A4#MX tRPh$\ h$%$1j_ th$A4#^ thA"A4#Y th$A4#Zj }5X-X%SV65p-tjHSVv e[^_]UWVS]S^t EPu S @u Wh)#j u 0V SW YV Etuh&h$j EPީEZt h$j- u1EVtRUWɐZYU}tRUu誐ZYURhC$S[ tFE=1tFtj=1tFu[=1tFtL=1uE=A0u+Hu)}tj L|Xh8-vZY U6"=A0tj |XSf u^ u螯j\sUWVS,ÉUP(^uh#@h($SW ZYucU̹ Rh8i(S @ua8t h2$j jh($uF uh &h?$j Eܣ11u Vh\$jB e[^_]UVS։P3VSPhn$j UWVS]U h$SV ^_uhuZ%h &h2h$_‹1ށ؃E u %ERU e NjUR)e WP!tDPEV菥ZYUu #9ERE ËE É1X1e[^_]UVSP]U Ch$SV ZYu WPkd Sd VPD!Ãt7EPS51跥ƣ1S/1Fu>#U1e[^]UVSP]U h$StU ZYuhuZ%h&hh$Pc Sc VP Ãt7EPS51ƣ1S1Fu>#U1e[^]UWVSS]U h$ST ^_uhuZ%h&hh$YƋ1%EVc V>c WPƃt1Pu ZYu$EM É11e[^_]US]U hEPh$Sr uh%h&hh$誓 1%˃ uˁEU ى 11]Uh-h$)XZUWVS]h$SS ^_u3h$SS ZYu"h$SrS ^_uh$SaS ZYtP1 11!‰1d$1󫉕tVh7iS @u hL$jV e[^_]US] udPhX$wE tPYt PhY$wXZEPYtPSh"%w %܋Et Phb$wXZ]UWVSuV[u h#/VYu1P4Z@u hԡ&h#p 81jS8Pq8Ph8i(4 }@`%1󫍅`PhiVT @uhԡ&ho$j tWph$vX&Ht#t8uP9u Q萘XVh$rvXuSh$o_XjPWY^u h55"jw \8Ph8i(4| @uh2$HPh$uhe*%HH9Tt$hO^$uhe*%Tj)tj tP4Z,H%(h$uu&_1ҋ0t`&xtO(9u 09t4#HɋL A4#u!#QPh"%u ,딅u hq%t^j tYjmZti 119X~M%9u>uWӜPh$t h$th$4j sF뫃 u]e[^_]e[^_]UWVSӉϋuu?L 0IL Zt2tVWPO u3x 1ɉ [u1V~x ZVux ؔ Xe[^_]UVSu]}t 谔jb NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjP6u(BpW[ Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URP}Ɖ׉‰ 9иr E8t肓8"uos;sC| C 9s} R"WV Y^u 8 볋K(PUE Z@tE}G _C G1e[^_]UWSËtPv X1e[_]UWVSÉUMU1}E;E t[ztMUj8^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(PXC$ue[^_]UWVS1@}u -E@} uE@ } u"PRK [^uPRK ZYu덅LPh"E 0 tu 112L 17 uu_tHh%HPf`H,ZYu Dž,%E@0tj/S'&Y_0t @0`1DžTXDž\@PTP,S^ǃu.@xuP0 ~kTtHu@xPSDYZHu.fDžtt0u_SXDž,uTtt,1҃0u$SZDž,T(j DP0,D (t8t,v ,v腏"S X%Dž,(SX(jDž,10dr<wWr<w7 0 u0 Ј0E޹Eވ0 A$(P_,fCNj ֋$B$@tPX^(SLT S LEHVUE [@2Ex0$,S ZYu,Sh&h;$j& @PVS V> uh&h#j SEpE0KG uSp h&h#j So XE}G }xG }G1e[^_]UWVSu]}t W}Zv W9 Yu #NPڋE Z@tEC sF C1e[^_]UWVSU1EX1u܉u؅Cu3}Ej1ɋUE ?E1҉Pupup Y\uu}Wu Pu4EAu~n }uE$EXExtHu E؋Exu[}t1}t.E؊}ue[^_]UWVSQu}u覊EX$Cu S{0u3PE 0D YZun?-uGPRUu|YZUu{(WR`|YZuA{ Cu CuHPE 04D YZtPE 0D YZu^CwH$&PW -w7D w7 XZ1u(7 _uCPhZ$j ȋK 11PE 2Z@tEF EFC4FCF1H Ue[^_]Ujj$WZYt$Ф&U PUPUP UPUPUjjZYtȤ&U PUPUP UPUWVSu] FtVuVVP3X1;}t$jXt0TQ1҉FNG1 VuVVPXFue[^_]UVSuj(jfY[t2&EC1҉SCCuu SB @u SX1C؍e[^]UVSj,jY[tDÉ&E CEC1҉S$C$C(uuuMU @u S'X1e[^]UWVSPu]1҉U1+Ei̋M ;}|1_t79rNGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EVj EtG븍e[^_]UExu@RtE]1]UEP 1tRZ@US]C$u 1ɉK$[Ps S: @uCuu PzZ@u1]US]C u 1ɉK [$(KSs Ps @u܃C4uu P!Z@u1]UVS]u jtZt$pSuCCC]e[^]e[^]UWVShr$u8? hy$u)? tÅu'j`h&h$V] VM SM Y[@8Fth$^F1󫍅Nv󤍝tJvr󤀽uCU9 t h$j |t uh$jP jS PhJiu @t1 h$Xe[^_]Uh-h$uXZUWVS, =@0 ƅƅF1RhKiu3 @PXujP Y_VjWhQRPm!qpujPv XZpVjRhVpQP'!h%Wu$,h%RtZY, $tRVRSPh.$ae[^_]UjhIiup @u hH$j 1US]D-9t@tu1@51Lj X ujjS 1 u D-D-]UWVS ]UUEt ;0uK-f|JxuEuE} tˆUPu KZYUtC}t:=-‰EHffUtSUBf<fuhd$E9r^h$ E9rh{$YX1_EtE -WtU0 -fW ƒF-C+UE9~)1E؍e[^_]UWVS]u ~;0uS-f|PxtN=-119} fLOu0t ,@t@ޅtt SVh$SPhy"s_ %h8$d_Y19};Ph"N_GXZe[^_]UWVS ] uع1}t}u*U UܸM؊MMمx9s1LuÍKكt :M؍AMP茽ZtfP׋Me[^_]UWVSQUU} uj[Uuh#RZu h#j jPV菕 u} ]e[^_]&dUWl$1E|Ru ul}UWVS,E u:[u h&h#j6Y@uh&h#j PoZ@u h&h$ݍF1jRp sAp^_C xyDž@Rhib @uh&h$eZYq:u]S @0PjjhVPRu+t"%t$VPhw"c\  Xe[^_]UWVSu FPZu|8+u1h%jH \`%1juS4t \vSh iRa @u|81t|8/th$'Xpe[^_]UEU =A0uRP*ZYE E$\[UVS] t4sVu>nZYtC P;UuPVZYft1e[^]Uh-h$jXZUWVSSÉ։M1S>_u}uJh!$j jhK$PO uW-DPtVh:iSf @؍e[^_]UVS]u1ɉh@uh̥&hD$j EPhP$S u{)EfEVh9iSƒ 1Bu hX$j? e[^]UVS ]u1ɉ@uh&h#j EPh$S' t,juV E؀8t-EPhP$S ubz)EfEVh9iS=ƒ 1Bu hX$j e[^]UUE9@t-EMfuu d$tURPhk$Y ËPt<$Pt2$P$Pt$Pt N"ø$ËtI'$t?$t2$$t$t N"ø$UWVSljӉʋuFEE9s]19tc  ^w@v|USh8$W K 1UvAE9s:2UFPh")ȉMP7M UuRW u9utD7...}e[^_]j1e[^_]UVS ]uVhiS @u h$j EPh$S uh%h&hh$qE߉EVhiS uEh. $XE1e[^]UWVS$]uӹ!1j EPhK%S?uht&h> $j EVhiS @u hP $j 1e[^_]UVS ]EPh_ $S追 uh%h`&hh$puVhiS @uh$E؉EVhiS @u h. $j_ 1e[^]UWVSxhShs$u@uhT&hn $j DžDžDžDžDžSh $%_Zu?Dž1ɉDžDžDžDžjSh $ u ؉8 -DytRx:uL҃0jWVh%Pt;9u8tMh $j jRVjPdƒuOu;t 1҉Ŕ@|Phi8uƒ 1Bu h $jk e[^_]UVS0]juVha$Sо@u hH&h $V] Zu Vh $j Uf@fEލEPhiS4 @u h $j 1e[^]Uh-h $XZUWVS] 1}EPh8i(S @t&E1r r%1ʹ|󫍕[!RhiS @[< v Ph $j h $R[P\P <fDžLVhiS @t%fNth $=?0t h $hRXfDžLVhiS @t%fNth $=?0t h $(RXfDžL VhiS @t0Nf=) Ph $Q_X=?0t h $QYfDžLIVhiS9 @t0Nf=) Ph $QXZ=?0t h $QX1|󫍅|Phi8S @t}u(j ~P$PhiS@)_h $2QEEEEĉEEEԉEEEEE|Phi8S^@uh#PXr}uMu u uuBEH~HE-DJtx:t~&jPh $X uWh' $vP^_Eyh $^PY111Pt՘hXZGj,QODYyh $PXh+ $PY4t8h7 $OXZ ht#OXj N_PhiS= @PhiS! @jh@&P^ u ftePhG $sO[^Vf"fP PhQ $>O ft Ph[ $#OZYj ;NXe[^_]U81EE1҉UUUUUUUUEPhi8uF @u h $j 1UWU1Rhiu @u h $j 1}UVS]EPhh$So uh%h&hNh$huVhiS @u hd $jf 1e[^]UWVSÉUPhX$NSY`Ǹ) 6 9|j<M)X$jLXe[^_]UWVSƍt1fDžfDžRhiV y h; $j. h' 1p)֍H(@!P }_9p}p' Džp hV $h7?%h[ $h_ $h $h $h $pphd ${L(G(\G!PO(!W Y1t 1E1tI@tc@tC@tP@ tS@@tB@yA@_GlGdw19~L9}B`fWGu uw%k pfx p@tp d#z= tt= w-g [=wOf?v'k 11?1p%1=$v-- 1p-1ƍG P h1Sld`VPPpph $JG"`G!\ƃ0`*w/wNtA2FltU0W=?0FQSPh $h $IQl=?0=} $v $=?0$YdPhX$IXZ"d9 ʃl!#y$lRPh"hIC%빀=?0FPFPFPh $h $2IF1d^1ɉll9d&j>H[S=?0FFPh $WKStRTRPh $HRPh $H l대=?0FPh $~HXZlF=Ptlbh $hX$?HY[=?0FPh $!HFPh $H^ fdV\ $t5X\PQh"%G\K n"XdˉX\lT\l $XtWl $Pt $Pt$PtN"PQh"%2GlX n"렊dزT<\t=PuEFu:h $hX$FXZ=?0%FPFPh% $F t#=?0lv $h $hX$sFY[=?0FPh> $UFXZ1D dD ҃L ll\!#lt $dRP\Q4&hL $ECuh{ $hX$E[X=?0FPh $EFPh $E^V l\l $Xt5dlPQh"%TElK n"dNjXfld\ Td\ $tR\ $t $t$tN"PQh"%D\K n"lXkT؃dPh $rDZYkl=?0.N=?0'$& $}' $ts, $ti[ $` $Y $R $K $D $= $6 $/ $( $! $ $ $ $2 $F)`j B)hXh'e[^_]UWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh $覽XE1e[^_]UPEPh $u{ uh%h&hh$h]ME\UPEPh $u3 uh%h&hh$ ]MEUVSjjj"* y h $ݼ\1ɺxBhPSqh y h $褼ZuufiuS[i Xe[^]UpPhiu< ulh $BXl$Eu h $j諵 EE1UPEPh $u; uh%h&hAh$[MIE@u h $jm 1UPEPhT%u uh%hЧ&h4h$[M E@u h$j 11 -USE UUXt=EEEE1҃UjURPU` 뺋]UE Puj讬袬 US]SrPh$j} S_H1PH1~ UuUE PujOCj} UE Puj-! Ã=L1tMUEE EjjEPEPjEPƒEBuh$XÃUSPh jh& f jSe uSh$6jPfZ@uSh$j^]UWVSd@u~Q1}=L1tC&;Et7EE jEPjjjV@uuSh$O 1ۉ]]]]]E}W]Sjn^VSje^Ãjh1$EZYu1$>$1uuuujEPjc E!"1}jhK$hw# EPhq$t hq$h$j{ jz]u6h$r[jjjRe jWj]jVj]_1ɉ -jEPje un^8tih$Z+U9uU,RhB$jWj=]jVj3] up Ѓu,t$h($BjSc = -k = -tjWj\jVj\ -SӃ  LEEEEEPa Xe[^_]UVS]E pt&I>v P]![^]USQjj]Sjjh -th"uT1Zu h55"jL jjSPjh -Gu‹EP1]USR[Ph$h-X?h-h#$%Sh$h-9? j"2UE E ]NUWVSE u}8@D$ 1%$1D$D$ 1 %1ۋ$T$ L$ 1 ډ9td&(  9\$ tL& 0&11ҍe[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9td&/ $ 9L$tL& 0&11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]d& $09tuL& E0&11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9td& $9L$tL& 0&11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]d& $9tuL& E0&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]d& $9tuL& E0&11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]d& $9tuL& E0&11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$td&9T$L&uwy|$y|$L$ ˋL$ ˉ$4$19td&9L$t$$9T$t$ 0&11 [^_]Uhs jjh@-u.1҅tPUWVS jEP Eu_X1E9}2uSPIZYt!SPIZY tG1EEe[^_]UVSQË0tRVhY$EPqV۝ERnZe[^]UWVSQ1:nuzouPanX1҉Uh%PFl ZYt98nuxouSP蹡ZYu}SP觡ZYuE1VEEe[^_]U}uh $1_17=81u卅$P Y@uNh#XA=81u}t2ҋ4h!%C1GXZ9j V0X=81t=t t6h%"蓫X t [XPN=81tj}t0$'X j X j(ø @u h&$'_-,W3h_+%h,R$/P,RŢ 7Q8tV,Rh#Ъ ;u Q8uWVWhF$讪jO t m[P`Y}u, Ex]()W jj M WS$U ~)t}u2h8-,PޘXZj P$U ~j,PV @uhI#辩X,Ѓu ƀt&qttP+PVh "1(H}41 010SV% Y_@uVhY$EXZ e[^_]UWVSj Phd$N.;11to&tZ&t =41t>&FO^$tA4#QPh"%- !ǃ 끍Wa#O^$tA4#WPRhw$-udtjO^$tA4#Ph$e-u t 0hX$ he #:-XZ=41KtSp+F=41u=41KtSpO^$tA4#QRPh$,=41hA4#hX$,sds`sTsPh$,slshs\sXh$,0=41~chSjjhw"ju.t%j S^_tSh$/, h%*NY'"t#PhX$,XZ !#He[^_]US] 1t-tPu>ZYu<11=<1]UWVSEt48nuxou <1PX1uhx"X1Y,u@B uP6_uh55"ѥS訒[^ljxj,SfZYt X1e[^_]UxJPh$h-.jl!UWVS]!11tE1҉7-111ɉplhI$u u 0r=dS6EXZEE FEe[^_]UVSSPPVu ujVSh%蕫 ,@uL+Ft1w"t"F0AZBw"tXw"PShw"j jUVS]u VS: YZu Shw"j ;/t"Shw" XZu Ex"e[^]e[^]UDPh$h-$(jUWVS]E1ɉ#11d111lhh$u u謃 HuLf$M,9tQG.C|g$ &UC| C|C|C|5 7 CpZDžlL5 7CtXDžh.5 7CxX5 7Xjuh&5 7Qu h&w"jc PPX5 7_XDždC|-P;Ut0ttSxt SxߋM |u4^uWUEhtFlt#uuxPW芵Y^@uRWh{$j蛖 xPWkYZ@tECp'xPWQYZ@tǃluECpECtuE%CxdupV諜V@$XZK|ǃe[^_]UWVS SVdPhWu u hWdSh%輧 ,@uSVh y"j諕 f@tKRPh\&hSgSh$!0jUSP]jEPSU :9uySu h7y"j ]US]ScZt@ h"SZY]US]SqhZt@ h$SsZY]USP]jEPSqU 9t :uy ShIy"j] ]UVS]u VS~ YZu Shw"j^ ;/t"Shw"NXZu Ex"e[^]7e[^]UhM$j UQ?hi$hz$h$h$h$Ph4$h-@# j)UVSQÉj EPS虝 U:uVShN$j舓 e[^]UWVSuEE@t"@1 1VFe[^_]PL_u hx"j_ VP ZYuj]e[^_]jUWVSQ]E10u1-h$u u)~ 2F$ &=1t1뷃=1u1c뛁K뒺a 7C8K t 1hK\cPD 7jC@K@2K&g 7@P~ s4K I 7C(KK@KEPuh &5 7lKƃu h&w"j賑 Et 1tctKtK@tK t=11 s=1t1c@tKt1҉,-sc sKsC  sC sh"VLI1Y_Eth$<%V4IC$KXZEthp$VIC KY_Ethv$VIC$KXZEth$VHC ƒ Jujuu s# ]UVSu v81҉uuuVu~C91u7VJu/^˅t)v 180*80Sh̹&h$;e[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/70轂Ph&h "u7HxUWVS]u uu uQ fMA1CCS1CC1@1ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh E$&1t<16 1Ƀ 1Ƀ 1ɅtuRh"jZu 1ɋuЋ} t1M"8"t$M tM9uM9t Suh"맋E9ƉU}7= 1tuuWVSuh"uuWVSuh"?9u؋E}<= 1tuuWVSuh"uuWVSuh"j}t e[^_]g_UVS= 1tPh$h- h$Ph $h-h-hh"uiXZ= 1&ttshf#h-j jN= 1u UP<UWV=L-uHH׉=1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃= 1t/= 1t 1}mQ 11Pu Pס 1RPSu5( 1* 9t 0jPWVhc'$j"Oe[^_]ÅtUWRP蕪Y_}Ã= 1UWVSSƉˋ  1= 1tSu 1Qp S׉ș։ЉEMRPSu5$ 1) 9t 0@jPWVh'$#j$e[^_]Ã= 12W|$wUWVS#Å=T 1uP 1BB40 1T 1  1 ; 1 1ؙ=P 1;|*9T 1_1)։ؙ54 1pؙQ Y&JtRz!9t !9t ҋ1҉ؙ= 1Q 3Xe[^_]g_W|$wUWVS,EU؉M܋ P 1A Id t158 1)X=1t8 15P 1PPV 8 1xU th'$Y{X8 1H xU t@\M؋]ȋM؃=1t8 15P 1PP P 1A Id t158 1P 1L 1JH,1X9M؋}ruuh'$~ P 1\E1ҍMQRPuu lj֋EUEȉŰϋEЉUMԁ}Tt.CЉ‰!!SʉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK054 1P 1_\T4 1@xRPuu; Ã=1tKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu:]%ClRPuu Ã=1t]Su,XZ1EtttpoY_DpTtF u1EGY_Fu @ߋu\%CPP 1H054 1EЋUpXe[^_]g_UWVSQEӃ=11}=L-tBBfCUC)f UZ[^_]USÉЃt't7uFɃu0 ='Sh'$h- ]W|$wUWVSLEUȋ P 1A Id t158 1yY=1t8 15P 1PP 8 1xU th'$1҉U؉U܃xh($_1E؉EP 1X`u؋}܉ tu}}zU tStX~KM< ɅP 1@8EU܋8 1J9M؋E܃|R`뮅tGt%b 4!Ή8뗍 ?!8u{!8hvSh5($h- Nt% tSt1\uWEahR($Í Í ? # Sh|($h-} P 1$~?8 1EE1uԋEЋUEUClM 8 1EHP 1L 1EHesE@E=L-nKdu؋} t1RPWV }WTU u}WT }U P}t}}}GXE1}EEċKdu؋} t1RPWV MQuuRP EыEȉEEeƉϋMUeuuRPF Eȋ}EЉEeЉƉϋRPWV }f E9C0u'=18 15P 1PP K4EDS8)‹}W S8)‰ }W$D4Ɖu}܋8 1 P 19A8~zU tR`˃]1ɉMM]ʋ]؍ @뛋 P 1A Id t158 1$XE؋U܍e[^_]g_W|$wUWVS։ˋ@1 1=L-t@fxfDžAx͘ ‰|fDž -=L-t-P 1@40u 1ۉ,P 1@DJL!ȉ!؉ pZ4JdQyt@f fDžA 迗 ‰P(,iKL04H8P 1%ƃC4D8<KC,ș)׋C)ȋ1)׉C8HK` tƉ׋Й)׉!lj!׉11ҋ!~ ) 1҃1)׉@D04=L->C s(H11t ǃ^F= 1s0Kd t1RP߭ڍl%VV$h*$ P 1 ؙy8PۅI4%WW$q,h7+$ P 1A0= @ 0 1, 1= 1u\Tu kУ, 1jjjhj5, 1j虙£4 1u0 19, 1uhq+$ j& , 11= 1L 1 19|RPh+$  1 154 1  1(&[t?t  Lș)FOu뺸2=1t?jj51S$= 1STb  1uPؙVpjV uؙ= 1VY4 1P 1Xlj=1t PRXZP 1x4 1\= 1~ h+$D XDž= 1~ P 1A,XÉƉ׋ǁ\TtA!A1׋AId t1RPh#jjdfF-ftRhht@P DžPu ft 1= 1tu1'1=P 11w,1P 1;x, h8-G P 11҉牅8[9<}Ƌ\TuAЋ!AAA)uky4D1ҁTtYӃY19Ћ|h+$ (_P 11=8 18 1CU C )C5P 1$~N`Cp=L-u*{tFx9sCxNfKxF,H9u fSCf{CTCXȉC\OK`ȃ~:=1uCh|{lN`Cd9sh,$. %P[8 1P 1P t+)lj1ɉ1xU u@\€ 8 1H xU u@\€ 8 1H ?xU u@`¡P 1@`P 1$~%8 1Bl58 1FP 1=L-~!{88 19rKd1VT~U uVT~U t PFXƋP1~FKd1111f3P 1@8P!tx 8 1)D4)Љ8 19s?zU tR`ك 28 1B$C1ҋ9r)P 1H`艅 P 18 1BY89&zU tR`A`P 1$~%8 1Bl58 1FP 1=L-Kd1VT~U uVT~U t PFXƋP1~FKd1111f{89rNP 158 1$.Nh񉍸Flx1Dž1҉)D48 1;xsxU t@` 8 1@$벋!ʉt:@t@;Npr1tɋ$9~‹GDž붅t$9~‹H 1BH 1;D 1u^=1t@ 1s4PP < 1@< 1P 1Z4Jd15@ 1@ 1H 1P 1H41[P 1Z0 } 4 1؋58 1=1t5P 14 1P58 14 P 1X054 1ދvxx P 1\t4TuT/%FlB/%CPO붡4 10 1𙋝ڋÉƉ߁TtAЋ!A1׋AId t1P 1Y\Tt= 1]s8, 1){0ƉK`Cx1񉅰69s)9s4 1.%Cl뀡4 1, 19rߋ P 1A01q8𙋝ڋÉƉ߁\TtAЋ!A1׋A׋1Id t1(Z~== 1j.X܋ P 1𙋝ڋËƉ߁\TtAЋ!A1׋A׋Id t1e*%u!#WVRh=,$9]= 1DP 1P,t,= 1t hI"X1j X1b~j {X= 1tjtx|m_u= 1thF,$v5P 104=L-0FF4+=_w h^,$j; 4 1X󥋅`1=1tR5P 1蘾[^4 1= 1t ǃ\8 5P 1x\ 1RP SMY=1tL 1P 1r4PP蔽 P 1X4HdLH t15L 1@ 1Z;H 1sE=1tP 1r4PP8 < 1@< 1P 1Z4Jd15@ 1X5, 154 1YP 1@4P5L 1iYeY[^_]aÃUWVSu]tV8; _uVhr"j9 `1ɉPhd@u D) tGRhedAu  @u!S8tuh"?XZ6B<1CB(CB,C B0CB4CJ8KCB@C BBC$BDC(h $ ƹ ߋSh"V", CPh"V. C Ph"V. CPhĆ"V- CPh؆"V- CC,$C,Ph"V- C0Ph"V- tP X}!uhzd@u 3 @RhedAu  @uuh"j=8 41}󫍅PuV^_@4ȋ99t(Ћ}1ۉ1E1ɉ [Eƀ*Pj PEP5D 1e[^_]UWVS4}jhPjW tGjPjVWV< u$U ʋMQ؍e[^_]UVS]u VSՌ YZu Shw"j6 ;/t"Shw"襻XZu Ex"e[^]鎻e[^]ÅtUWRPnY_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVS]MpM1}tfF^1 :^F: 1 MKMKfCCCCC s({,C8C1ɉ P2\-h8-h-X22^XZe[^_]W|$wUWSøth`3hG4$CXZ52hd4$152h}4$!3t Ph4$ _X2t?29} h4$[()h%MMEuQQ$h4$Ù j ژ2Z133EE2ۃH~-2]PP$p1 %RR$S2QQ$SEWW$S h-PP$Sh4$ <3d2p2!]|22Ezu%ٞzu%=2\$=2$h5$}e[_]g_1UjjqXZ1=2P辎U=`-u =2ujh,u(2ZY92~23ueUSáT2P2xFأT2X22%w%r\-y1]Y]W|$wUWVS22ff222=29=2u ;22f2f2]f21Ej]Sjj53L yhG5$[jh3jjh253` y3t hh5$J_EjSjj53\L y h5$j h2j ] [^22f23 s$ 2ɡ2ȉ 22s223}f2Bf2H24fpjh3jVP53a Ã9t:y h5$DYSVh`3h5$ߎh-Z1`-2% 2 32@222󥸈22 2u|22󥾬2󥺬22Av.}fE fEm]mE22%52=2 2222U u}fU fUm]mU}ЉEΉ߃ɚ;~ʚ;Eހ}2 2222H%؉ 22 22E22=ɚ;~ 22-ʚ;22rW 22 22 22222=ɚ;~ 22-ʚ;23t ;3te[^_]g_UWVS<ÉUM3tUUEčs}uyMăA}9}fE؍t E;2uJ122u5}t43u+JEPuh5$l Ѝe[^_]W|$wUWVSEU܉M7C]3MQURuh5$t h5$XWh5$3Y_t,%E %RR$Ph6$谑3t"uC-e[^_]g_xe[^_]g_USq%= 3u!#ѰSPh>$h-ؔjćUWVSƉP ¡D#3_tEtPh!@$E X#39U|} VhG@$j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ X#31҅w =w"=w'=w?=w W=w F=v=w=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPsO PVhU@$ SB PVhc@$5BhPSjEPVhq@$ S^PCPVh@$h8-AXe[^]Ãt"¸@$7t@$tURZø@$USљRPQhSYh8-S ] @-yUh8-j XZá8-P8- UWVSDuh8-莂e[^_]ÉÉh@$@&aXE1ɿ!t0\Љt }uCEtHP1DA u1tЅ}t2}uKU1ˉj.h`#3EPj:U1ˉuM VPhX$j.h`#3ًh`#3h!%XZT58#3VPh!%G 0=$#3UWVS @<tPh@$赌Y[C&tRh"Ph@$茌^_Ph@$|XZCH<$@&h!#C PhA$PC & ScsshA$"C! &<t&<t&COS C #CPh9A$CZYPfwk$&hKA$hHA$蹋X1ZhUA$hbA$hpA$hv"蕋_3huA$胋^!h}A$qY Ph_G$^XZ뢍A9shA$N EԍsfCfhw:ffEPEPEPEPEPEPhA$jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPhA$薊t 1ۅtVhG@$t/Exuxt VhxC$jd p}Pq ju }CtCU/1}#Exux uxuxu xE@E< u2UĹ1jEPEPx ¸%EE耉E 1}EP1E1FXЀ w.XwWEXw7u\M}wRE$&FXЀ vRXwWȉ<E9sjFXЀ w/ˉBE9rLB1}13B7뷍Xv E`W븉EE9E)ˆu}1ۉj/VnZYÅ}=L#3V7 Z/EEPV Y[V7 YV@YV褮ZqP}Wp @0uD V̠ Y{ȋMUPCUe[^_]SEEPVN [Zt?EXSUC YuWEEPV# [Zt#}uσ=L#3t$V6 Z@u6'V6 XuX }u MU1% X#3U1EDe[^_]US-tuP躔ZYtC]UPu*fxu#@Ph[G$hh%32%3 Htu DP+7 P5 ZU}uE ҃' hcG$hE$RRh|%PPhiG$ UEt#t#G$G$tPhG$G$G$Rh2H#輀XZUVS$@&E׉Íu 9stMtJ@ShG${XZe[^]UVSUr %tYE uLjjEP觫à uU1j.0skY^ƅth$3@PYZuUuR@ ZhPh%3 %3e[^]UUE Pjjhh%3PR> thhI%h%3jk %3UVSE UMYt @ȅu˅t6t1R )˅t8u3jSZYt%ur %hPh%37 VShG$hh%3}mVPRhG$hh%3}DσVQPRhG$hh%3d}VSQPRhG$hh%3C} %3e[^]UWVS$u} KE 0~y111119Bt} |t 1M LtMw tLxw tHuGC@u?6ttxtu#2 @"@Ƅ9t(Bh1u "ω9)51u- uhr %h%3v[^vthG$SvYEPjjhVPP; t hI%V8vXZSVhT%hh%3f{%3e[^_]UVSMQ#3Q#3يۊ &BZ &XÃ@.)օ~=$3uC#3[^]UWVS uE Eԃ=4-tL1ɉ 4-hh$3$[_u(j.h$3;g_Zth@Ph$3 $3uhhr %h%3 F<t^<t<udEԉE FEe[^_]!Uڹ1ˍ}fEu jEP [^uԍEPmZY6e[^_]VPFPhG$hh%3y%3e[^_]US]U MC<t,<t<u/MU ]]OMU ]]U؋]!S"PCPhG$hh%3^y%3]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV }yE EX$e[^_]ztEEԉE E?^#e[^_]yEEԉEE E,"e[^_]yUWVSXEEE EEEEEEE"1EEEE1҉UjjuVjj]SLyhgB$)EuhG$f Xe[^_]P3Xu jj~ jjVWjS}LyhH$݋EEhG$ XE9^CU!‹M9A}tSyM9,sxEt  Cy;8-t8-PuCyPP C E1ɋEtttHP1DA uЋU؋uЅ~uE'uPsRV~uEuPjjucE#CP>h~#h~#hH$w@-H@-$yh8-j ~XZ8-P8- }e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ#H$~kMUD8-u^@PZMt$Ut:u?DX,t*DX\}uCNv t4}tEEEe[^_]UjjEPEPu u-h?uuum(US讕Ph*H$h-yShgH$h-yShH$h-y$ShH$h-yShH$h-qyShH$h-ay$ShH$h-NyShI$h->ySh+I$h-.y$jlUVSƃ=&3uKj舭^_jh@,3Y ZYu= 3E E ;u"1ۉd3jju à u=<3tՃ=d3tԉڋat5353 3ڍYZY9u 1Ƀ=83#P$=3t(P$QPSR謆E =d3b=3U83831ҋtd383'=<3t=(3=d3u"C9]j3[^1=d3E ot͋E 53531ɍgZYU 9u1҃=83‰ֺ#P$=3t(P$VPQR貅=d3c=3V583831ҋE td3583% 14RjhE 4蝜 u uE 40hUP$P^_=<3=d3E 553531ɋ-ZY9u1҃=83‰׺#P$=3t(P$WPQR|=d3u5=3t,=83831ҋE td3=83/P Xe[^_]UWVS1}uEE PPEu^^Ht}6h=P$E PEPT uh2P$E PEP9 t}E xptYu31Tt&1҃=31=31Ƀ=3111RPtXZ}=X3u53hqP$ [^닍xPSZY}uIy,4v8tSh&#[^1ɉ 3 3P337U Ru-jRZZutL9¸}9U 9zu19ZVPuWShP$|1҉331ptXpe[^_]U3 3P$u "Pju uU3 3P$uQs"Pju uUVSEu35HuhP$E PEP td3133xhP$E 0fZYu*=X3u53hqP$ [^Džxh>Kjt^Xjh@,3ZS XYE t ;u&1ۉd3j5 3u 躹à uH=<3tу=d3th@3S[ZYuShP$53V 멉ڋE t5353 3ڍYXxt9|PVYZu33 Vh&#XZ9u 1҃=83¸Qs" 3 3tP$jRPSVhP$1ۉ33E =d3=383831ҋtd383tjqXZ1ɉ d3e[^]UWVS u }t 蹗h"vUZYuvhP$53U uj hP$Wv > Qs"3 3t!P$tVWjVjjhRSxySHX 3e[^_]U帥+"}ut#]U}u ݖhP$hQ$hQ$53CT13UWVSE]uu1҅‰uTpuCE xh+"W$ZYu u0Hht#WZYu1t/t#@ u븥+"PVh!Q$53Se[^_]Uh)Q$h,3u uI3U}u3=3t3E E3Q$] ]UhgQ$hL3u u3UVSE] u1=H3H3u{+"yt ash+"VZYtBht#VZYu 1H34V^shvQ$53R 맣D3H3노t#PhQ$53fR =H3t5D3hQ$53DR 53hX$ H3Y[t1҉33e[^]UhQ$h3u u3UhQ$h@3u u3UhQ$h3u u3=3t1H3UhQ$h83u uM3UVSE] t~ ܓ1=33u=sh+"VMZYu3ht#V-ZYu139s? 3^hsh+3S 3+33 A 33t#8u-#QPRh;R$53P33e[^]á3t8u53hR$: 13ZYƋ 3+"Uh^R$h(3u u3UhgR$h3u u3UVSE] u duosh+"VZYu03d3_ht#VηZYu1ɉ 03d3HVϻZy$shR$53rO 1=0303d3t +" 1t#d3PQhR$53&O1=033e[^]UEur3HuhR$E PEPc tЋE phR$aYZu9=3uJ=3t53hR$l XZE phR$xaZYu3@31 3USUE 3u DS3Pt ]馐pYteP Z@u ShR$@=@3t"h@3h S$53M1ɉ 3 53h$S$衳 XZ]]镱]UEt~3=Huh=P$E PEP tӋE phIS$``ZYu 3USSEu轏3HuhP$E PEP访 td3h>Kj E[Xjh@,3MI XYE tE ;u1ɉ d3jju 讯à uu=d3tڋtShIS$_[Zu 3E =d3u=3t83831ҋtd383tuj>XZ1ɉ d3]UEu蓎3}Ht}6hQS$E PEP uh[S$E PEPd t}E phcS$^ZYu!E phkS$^ZYu 3UWVSUU] 3EKj轘EXZjh@,3E Y[uhE \EH9=<3Qs"t "E 4M}xS$t#jjRVQPoz=d3t C=d3u>=3t583831ҋE _¡d3t@d3583ujZY1ۉd3EM9t EP蝫Xe[^_]UWVS}u <jj薗ÉXZSKk CYujjfh#Q à uq$j/S _ZڅtPhRW =03t653S 3HQPY^y Pj JY^ J }~j53h"WS3  jWS3 ShS$誽3j9~PD Z9uWj腖[^WjyZYt1 hS$]X3e[^_]UWVSPEEu豈3%Hh T$E PEP袸 EwɋE phT$X^_t 53hT$谫 Y[}h*T$谔 Zu ]E XSh5T$XSeT1 t뙃}h=T$f Xu ]E X ShGT$PXST1 t-U}u"E X ShGT$XSS1 <3Ce[^_]U3}t\= 3t =@3u#׭=@3u3E EOT$鈪 h@3huT$53D13 U3}t=@3u#P=@3u3E E$S$" h@3hT$531D13 UEu茆3{HuhT$E PEP耶 tӋE phT$VYZu9=3u<=3t53hT$艩 XZE phT$VZYu 3UEu3{HuhT$E PEP tӋE ph U$6VYZu9=3u<=3t53hT$ XZE ph U$UZYu 3UWVSu huSE 9}1hE4S F 9~hhe*%S GShX$zUY[Hu jNZ3e[^_]UEu˄3/HuhU$E PEP迴 tu uh!#- UEu3/Huh(U$E PEPs tu uhBU$ UEu33[Ht}6h#E PEP uh=P$E PEP t}E pphHU$NT USE3u贃323Hu hYU$TYE phdU$SXZ3]USE3PvW323Hu hrU$SYE ph|U$SXZ3]USE3u323Hu hU$ZSYE phU$GSXZ3]UE} tu覂3=<3thU$SX#U} t}uj3Ã=<3t jjXZj`Y=<3t jjuXZj2Ujjj2UWSREEu3=uE XhU$N Xu]ShGT$@RS N1 e[_]UVSEu蕁0HuhX$WzZYt.hqS%WiZYthX$WXY[t뷻v[Zt3u6hX$R0 td3td35d35d3hY$R013e[^_]UWVSPU} uRUyZUuUE -Y$3Ee[^_]x0Ë@t PG1ɉKXW讧CZ=3ttP3hCY$5390e[^_]USEU 3t tt<]~r-t8Cu!#PRj hZY$53/jrr 13]UVSu 3}t e[^] rvxXuvh-Y$53o/,Ct P>1҉SY3hcY$53H/13 e[^]US3}uq3<=L3u3E EtY$]є 3hY$A3X]USEU 3Hv3q3P=T3u3E EY$]g 3Hu hY$nAYrhY$^AXZ3]USMU 3Avp3Y=L3u3E EY$] 3BuPh Z$@XZrPhZ$@ 3]UWVS @Eu} t-p3AHhW$E PEP tЋ5d3} 19~j k`c3Pwr t*Cu%whP[$53F-3 h@h3P蛪 1ؿk`c3X 9Xr-DP@tC3<$t<\CFC -K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mP3)PE 4V詩 E 43߿iu6CDžؿ9}~)3)PE 4Vn E 4:ƃF;rd30oXu 53hU$u!53hU$n 3^X~ t=<3u 53hU$΃=3t:53h3( 3HQPYYy Pj ].YX J j 6R菨 d3P5d3V =,3t3~t-3HQPy;P| J Pj-XZh@Ph3! qd3Ed3E 9XCؿt G9}ce[^_]USËt P&1XCt P1ɉKXCt P1CZ]USd0K3jyX=3t>EPhg[$jd]S%~!3fJftPSR8K jh-3Y& USdjkyX=3t>wEPh[$jd]S$~!3fJftPSRJ jh-3% UWVSƉӋ:j:WYZuWh[$V蛦 :WjP|YZtj%WYZtWh[$VeWƌC uf{P Huf{tCPhR`$V3 h~#V%XZe[^_]UWVS ERU\7ZEE0U;OwuCuRS蚨 uCEÊ u w)tu C;OvE1e[^_]UWVSË@t P̋1s_stV6Y1Ct P裋1CZe[^_]UWVSljӋu3u<MP]wEPMQSW航jEw>yFE8 u@Euh[$XZ,HEHwuE1e[^_]Å8UWVSH%Pt=-ufTwfUtePt^ftwftO0Euf]fۃW})߉0ufWӉ)Ӄ@YA]AXZ[^_]UWVSUu u h[$j诖 ljjh[$PZ uW1ɉK fCPjh[$W3 uWC fCjh[$W u WC _t36vCvCF C FfC (Wuh\$$ Ef: j/RU ^ZEUu R腜8)ЉUHQM ƋMQURP茢 { uEuLCYj@V ZYt_{ u1҉3Mq@Pj:Epi  t@PMAYE@E@tu[uvVj]RU" YZEtH:UttWuVh\$)PERVMV蟕u WuVh6\$tEx:u-u%p/Uj:V YZUt>t3 3ׄtK3Gpj EPV >tU:u PvWuVh[\$X/fC*C tt53u53t!#V軚CZ{urF%{ tqF%P蛚CX1e[^_]USZKJy ;J| t Y RP<&XZ]UWVSP1ۉDžfDž1jh[$P jP_$CZY@tt8tt8uVhx\$uDž8tj;P [_Åth\$PHZYtCh\$S7Y_t>h\$S&_Zuh\$[gVSh\$Dž DžsDžVÉj@PI  t1҉3@PΘYj: ^_@P覘[H8?u1;u11ۃ/j/SY ZY9u$uHsjhqF%SD cu)uR(31ۅ%pu'j(3u911ۃ=(3Džt*1;t%h\$S ZY11u @11ɉ>t+h\$V_Z1ɉ=3=<3t jj_XZ=3z;hPW 1 t1ɉ$31҉$3QPZ$3<3YZu u*N"#Hu9d uWh\$z u Pj衾PjrY_t ;1$j/S_Zu Jx;hhǶ%R跛 1ɉ 3Pj=3u/; =3h-h]$贃 XZt>ut>uGt>t݃t3hSS hhqF%S hVS赛 $hhP$Sʚ 1 tL5831ɉ 83=3t hhP$ hhZ$Sl Wj$583F3uj/V1 [ZtP1ɉ=3t WjWjXZ3-1ۃcÍc؍e[^_]UWVSl<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh-3 ZYu P_$Y[@SG^5<$!Zffu0t#;thR^$S踂ZYt h\^$3t$?t?u+u =3uh^$W苑Y,,3t <,j/Pv _Zt@,PEZ P2Y3 t 8uth^$c1=3=333DžtDžx=3t0 tRPZYu33D3^$,h"P+^_44u ,4Pt$PY[u/tx3353=3 t14P_1҉$WVPy,Ph^$=3u=d3<d3 -,Ph _$53. 33 3 u53j n[^RPh_$QhSh,3^ H3,3p8-/@dj VP 9pd8/Pdx*u,j pPRO pd83 3Ghta$a$d+tXH ׉dR%s^_Džh8HRYtxa$dtd襁2a$dt]O$dtha$ Xra$d`ujhb$ ^_p@9'b$d't;b$dƅu Ab$dutPamYV̀Zt<oZu&J3 3hSb$ _t 8uhxb$ڡ-3P-3~ hb$ ^}31uQu2P7ZYu=YF3%hXF3j5$K3[_Zy hg$(\^YF3=@3<<YF3<[F3PZF3P_F3P^F3P]F3P\F3Phg$Ã=<3^=@3Q1҉@3XF3F3=@3t fZF3$K3tP2 _jjYF3P耈$K3 y"he$.[^ @3=@3u#jXRjhP# @uh=g$$XF3PhXF35$K3~ y%hgg$ZY5$K3 $K3xd3tjXPjh5$K3讕 DžhXF31󫍅hPR5$K3 @hg$x=t3,p3=l3 h3t$=l3=h3\tXF3<u1ɉj j WhStPtP 53=03u 3WS\hg$aÉ53~5t=<3tp37h@K3hg#53& =<3u Iu<t=<3[F3PZF3PjoF3PnF3PmF3PlF3PkF3PjF3PiF3PhF3PgF3PfF3PeF3PdF3PcF3PbF3PaF3P`F3Pjjhg$HÃX1st @3<uBDžXjXPjj5$K33 5$K3 $K3X1=&53h'f$e[^_]UWVSD}$K3=3tWPHjjP ƃ HPj5$K3 @-$K3EfEjEPOoM]ġ3ZZ<ډEUjEP#oM+M̋EZ[+Ey@Biy1QjEPV +8t!8#thh$F3EEPEP5$K3 à ty5$K3o $K3VjS @t?}uEjEPjjS荑 W5$K3Y[Quh?h$ X5$K3 $K3Z1(m8\_8#Nhbh$U뽍e[^_]UWVSu1ɉ K3hj.E[_t= 3u13;3= 3W;3135 3<3<3H3thPBUP[ UBCH3 tF3tF3 󥍺F3󥿐F3,K3<<,K3(K3@@(K33DD33HH3d3LLd33PP3 3TT 33XX33\\3jh3`UPZ j`Ph3Z jh3U썂qPZ $jqPh3mZ 3U쉂3hh3P>Z hPh3(Z $hh3UˆR Z hÈSh3Y ujw,K3 t1K3EEe[^_]e[^_]UWVSQ}j/W蜎 [^t#9u jhqF%jWXZ/jhK%Y^y Whh$RnhWh-3RY -3ƀ-3. d1.F9t@BUUjh-3XZx9U0t8u-Ou53hh$SA XZ10jh-3rYXy-3F<.u1F@F0볍e[^_]UWVSu(K3u/hh$ X=J3t 31Ee[^_]<fDžƅfPftjjWPt hh$QXhhi$5(K35(K3\ ,K3Ã(t hh$iQX=J3t 3j3<Xt(t#fVfthWP j]Yu=3(ujDZj1ɉ 3Dždh"u _Z\\uu h#J[^aDžd\fzt \@xRPZYxE%=tu hi$53 EЋUԣ33Jjh F3 ^_B53=3 h#P$uZYth-P$uZY3twC\fxu \jWVP\@jWVP\yu h^$I_X+5353hsi$  DžTP$}tEuuhX%l H3T^``u"uhX$*ZY뽡d3hi$h&h+hi$9E3s&E3tP5Xd3E3PH_E3j"^l@ujj !ZYl=H3t=3t =3y D31ۡ3`fxt `P\fyt \@S535E3 E3- uu h!5#H_XS8 33\PXY@X t0`Xz33\J뭅t[pt9533|@3#,53$^ptD3pt륋`@ @tu@o` 33<\H Xpt 3933|3 {\@ @tʸ#au h!5#FXZ`@ @tjhj$kFXhjXdtd\R^1\`P1ɉ` $b[nhPjXZDžh=d3te$K3xP X$K3`t`P5^1`j[31;33}j;Y 3h@u l@u"hPjoXZ㋅lPj ]^_$K3xP! [$K3du `u)\tꋅd\RY؋`PhXP31҉3333e[^_]UWVS104D3PT3Xv$1=3=3L333(3$hP$uZYDDu = 3uVu=3t}t}u&E 8-u}tuhi$53 뺋E Phi$53 ɋDtE uPu 1ۉ8Dž<Dž@1=3uDHjh F3 ZYt=d3tzjXhjNY[hj@^_<}tWE jP,[^E j/Pw~ ZYO8tNE8 tDE Phh$B[^3M E h~#P2_ZE 8|uuU qF%t,K%%E 9u jhqF%E jP^_/ jPwY[n= 3t 8 uW@8 u"E hP _ZyE Ph%j$6= 3t 뽃= 3tE PYE D3uJutYjjjXZ塄39u&ju0^_333ujPiY[=ujh F3 ,_ZDu}u-k33 tRPhsi$0 ͋E8t8PuhX% Hh"?^44uuhX$Y[ȃ}E h~#P,_ZuDž08-15353E 8|uXjj _Z@E hQs"@P Y[00u E @PhS$A15353Dž8=E uPY[00uE Ph#@XZ#Dž80fzt 0@xRP^_@tE%=t1ۉ33d3hwc$h&h3hi$9 E3s&E3tP[,Yd3 E3PX?ZE3jX=H3t=3t =3yD3,1,3Dt@33 t/0f{t 0IjRPQb53 E3 E30fxt 0P4ft 4@,VSu u08 u33h6j$C>^ڃD43 3#0jjjP 11y=E Ph^$=Y[Z0Jy/0P趻Zt΃ t*;533|0H уԋ0jjjP x N33,334J4P _ td0@ @ul0 u4J4P^t, VL@L Hu ,PT9ȉ*3#153)XPTD3ډPT33띋4H 0334H PT 39533|3 {4@ @t=ʸ#a8 u33 h6j$k;Y݋0@ @tE PhG5#N;XZjX8t80R^104P肷1ɉ4 $I[Lu33y3`LPhKj$53 53hj$) XZ뾋D$ u=3uj6 _苅8=ju)[^X\Bu@j`SJR^_X\lp1tE SPC ZY@XP譭$J+‹E $Phj$53`jh F37 ZYt$31;33}4jX Y*hbj^_=d34PP[벋<@u @@u"hJ[$WZYEt ue[^_]Z2øc#= 3tm$Phm$53$ -t$= 3t~ tPR2PS$2 SO%YE ]e[^_]鱣 QMZƒMuQWhn$53誺KSu QWh9n$ދ}u#Uj PMQ7 MMEPjUR rPj hZY$53R릍e[^_]UVS3 d34$t!uItJuB4314P3-8!- u @ u4tJt 41&43 tGtBB@"u\uXu@!@B؀"@tՈButBd33:d334tHt 41413[^]US33d3d31ɉ 4d31ۉX1d3{P5d3/XZtd3@ڋ]UVS 3=3t,SPX $^Z8tPh$53_ 53jh@h3h-*y}uB53hSn$t.=3t 3Hy Pj (Y[ J 44󥡰334 4XZjPR>3333+44_X49}39=4 4sB4󥋵54= 41w~s9؋}gVWPh+q$hSy3fJftPSR jjj-jh`3ƪ =3uh jjujjj =3l%_ho"P脣 3Y[tPhX$hP裨x3319߭y|%ݝ݅ h%߭ٽf f٭۝٭y1d~dVhaq$)P=PNj3~-3t PqZ)Å~:ùdh!#)Sh &Phhq$)P=P苧ǃ119ʉst @u4&SQhrq$)P=P-+4 4+ $4y @Bx%ڽ߭ 3319ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4&%11d PVShq$)PP臥á339lj33)ލ 9lj݅99Ћ}hq$VQ轤à +33߭߭ٽf f٭۝٭?~~hq$rtPh"VQÃhc*%VQà <ЙRPhq$)PPˣÃuh")PP衣à 3fPftSVP eY[^_]aUSjX]á4@ `t1US4HyPYu1ZJ ƒ,uɍPv"u|@44HyP谜ZuJ"\u%4HyP}ZuJCC4uhq$ Y@4A44HyP/Zu ZJ, „t@Pv8\u"4HyPYu JCC4uq-=@4th@4P'ZYuC ߸ ]UWVSQƉUh@4P[_tHj.V#[_1ۅt6uPZYÅu#)Wh@4V& u1ۀ@41ۉ؍e[^_]À=@O3tUWVSh"h@O3m4^_u"B8th@O3hq$Y[1$hSJ_ZyƅEj.SZ[^pu Džp!#1btH uuzG uҋpH3uSpEƅt1;4 3*%u_3uGE uh@4"} h@4P+ZYtE thp$P [_tB4fPfttRPtZYx|?thq$ h&r$w$xAE85h@4|}X 4fPfttRP[_x"|?thq$蕙 hXr$苙 E8h@4}z= 3t54PuYt u 4Hy t u53hr$Jɋd3u53hW$Xkac3`c3ic34HyPZu@J-DB@uGG9u ud3u3lc3`S3=4HyP街YuJkPkpc3Blc3klc3`c34HyPOZuJ< u6d3k`c39lc3u@d3 {u@d3KZCh@4hr$诗 _X4@tRV[53hr$ XZ543Y 53hr$ۍe[^_]1US]-uhs$S ZYuP3DB@tCjhY$S! u T3Uhs$Sj ZYu X38h%SM ZYu \3h+s$S0 ZYu `3]USZKJy ;J| t Y RPXZ]UWVS3=03u 3hW$萳^tIh0s$hDK3 ZYƺ9¸} CK3.uhDK3Vh5s$53BjhRs$hDK3o 5 3tjh/$hDK3Q uSt @3 D313j hO$h3T t\h3hnO$53軟 Bt 1@31D3t*j hWs$h@K3A u53hbs$R ^_L3P3T3X3\3`34K3{hY$Y1u(K3t-fPftjP? 5(K3Đ1(K3 1ɉ <313jCPZt Shs$j i0e[^]UWVS](3=d3t =<3u$u 1ۉ44Pu7=4uE44P4@1ɉ 4=4h5x3V /thhqF%V hhs$V VyVhs$"XZ1pP =3Xأ35H331H33} t1= 3P̼XQs"EEt!jjRPPhxS$ "ҡ3-cvt@K3} t1= 3PbX=35H33h"V薛4VO =4uuhs$踐 ^s$54hh4/ u54=1ۉ4j h4gZYu4e[^_]UVSQQMq3=03u 3=\3ut953ht$7 PhFt$EYZuBj h@K3^Zuj UR@PG M te5-DN@tVu=3u=\3u1ɉ \3t=03u53h@K3 3 XZz3eY[^]UWVSQ4MY=3}=3}=03u 3=P3u}53hNt$" fPhwt$0^_j hDK3̀ZYtj.hDK3跀^_thDK3ħYDK3uKjht$V: u7Vht$53ǘfEK320hEK3ht$53詘EK3 1}V\ZtVht$53x EPht$V3 tEEP萆_uu 03u\]3gu=3u=P3u1ɉ P3t+=03u"53h@K3 3 XZE3E3eY[^_]Uuht$j2h4K<u hu$j 4UWVSP}u jjfhc#jXWh?u$V2 ƒu&WhYu$V2 ƒ uWhsu$V2 ƒ USjEe[^_]Uhh@3b ZYu@3UWVS 3533=03u 3hRw#贩_uSj h@K3U~ZYtA8thUWS$]؍U1EEEEPSh%uy ƒ1uuv Xe[_]UWVSu] }VuSi u1N tuSv$tav$fN lS諜ZHˀ; uLUJ9uD -y h-蟂Y-H - t@u҅tsv$ff t1҉e[^_]UVSQuh3*[á3?vPhv$ juhv$P-Cƃ3 1҉UUR@)R3Ph-yhv$uhv$53jrd319d3 U e[^]UWVSD]} S\j j VhRuWG t&hhN"R j hN"V 3tzW9Vt vuvvS4 @uTh8jjjhSvvuG thhN"Sa *8Shv$Y[4jjS> ƃ u(PPh$hv$PjS @uPPhw$fDž=3~"jP<3XZuWSޮ @`8$}uL8A^PPh"`$ >jP+‹Y_+y@Biy1fDžRjPP uY货8u=3~{虧8#tLVjS赭 ƒ 1BPPh "nuW< tQDžPPhhS< @u e[^_]UVS]u S?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋC1ɃL Muj RP"X F 5454h~$jK ؍e[^]UWVS ÉUE9C y I$&DB@tCuGу ȈG:Ou5454h$48C Dr@u; }P5454h$j C tDr@[u\t#P5454hQ$DJ@t C uP5454h$hY1DžjhR 3 1҉t7P\uPt u DžAQ@뽉ȋ)ƃu4)=SSXZ23FVSG[^DB@t Cu,$IG=4t*GCu95454h$-hh SB G @SDB@u$ CtDB@uނ$ 1GLDB@tCu*%ƉG;u5454h$1tk!@ڃ 4tJ;YuAApVpZYuV5454h$P 벉jZ 4Xx1ɉH 4[rsCt<\u5454h $j$j`G1ɍ%XZu5454hi$w1t 1ҍFwDžhCr1F4Fh}X11Dž؉h<\t uuBhh<9 8uqBhzu0t'Phh@4M t Džh@4)ȋDPS4F hY[< u5454h$Ph1hn))=w(SXZDžh@4Phh@4S 5454h$1_1ss C1C1҃u\#u~nu 44@ f4454H_1+4=4u8#uxnu 4M 1M I t44t]Ut @uKf 4-t41ɉ 4=4;G 44t1BJM pЍe[^_]U塠4@ t=4t/=4t@HyPxIYuԋJ54P j XZ1UWVS|u=4uQ48u==4t h$j 4-4y$48-4("44tQHyPHZt@ J54Phi 54h4h4耹 ÃYB4=-u 1~1PF[=4tdh4膞h454y t Ћ]UWVSE0 4, 4z %&\u.rE-Dpt zu0y_<&t<\uG@ 450 4V9r0M@ 4P5< 4Tã< 4, 40 4XZM 0 4C14xutyPx utk@ 4)ʋ 0 4L 9r2U@ 4P5< 4ã< 4, 40 4YXURU4M 0QS U0 4 @ 4=0 4W9r*@ 4P5< 4nã< 4, 40 4XZe[^_]UVS]uCP9SsCPs&CZY}u1CVu CP? ss0 e[^]UWVS1548jhD 4@ZYW1ۉL 4 41ɉ 4CSt@K u#uCyK uC54)9rVuB5H 4j1ɋD 4_Zu49B |S:u 49Jrq1ɉK u@5H 4j1ɋD 4T_Z uS 49Htu CCSu @94s uxu  44C u@5H 4j1ɋD 4Y^u 49H!Ct C=<> $&49 4r4kP5 4 4XZ= 4k 5 41L 415H 4{u54s# Y[ = 4uuu =L 4z H 4t5D 4CPj V: uL 4H @))ӉH 4SPVB Ij5` 45\ 4hD 4;jjh"hD 4j5` 45\ 4hD 4Fj5H 45D 4h\ 4\ jjh"h\ 4Aj5H 45D 4h\ 4) 54s H 4;d-r54h)% XZ1@HЉ0,Ph$54E,B 90uH@)< F;5d-r54h)%J Y^54j$> 54j > 4@ @b¸:txbP裭P54h "j蔵 4 L 4u4545H 4j5D 4~-=P 4t54j 7> XZjhD 4g^_1ɉ L 4jjh"hD 4rjhD 4,@=L 4545H 4j5D 4,=P 454j = XZ=L 4rH 4=D 4BHPj W5 ƅt*P 44)H 4P 4H8545H 4jWK,=P 4t54j = Y_8H 44P 44 L 4u4545H 4j5D 4+=P 4t54j < XZj649 4r4kP5 49 4^_= 4k 5 4CFPQYFG= 4%=D 4CH@u.  4t$P9Qs@4R54Ph$j 5H 4j1ɉ@9^Z"1ɉ 0 4H 41҉HLC0tZ4uH 9Hu;Ptj0Wh, 4CP Q4pP @9u9t)HL1LH9L}jjQh, 44PHσ)HLL'Hj@$YZ"L HjHWh, 49Q tUAQ )HLLHj@YZ 4QNu9AuAQ 똋 D 4j)ȋ54PQh, 4~CP 4P @@DjH+@P@Ph, 48 tD 4D 4P 4, 4P 4, 4t< 4, 4Cxt4545H 4j5D 4w(=P 4t54j 09 XZsF uq=L 4u~uhh Pb F @t"5H 45D 4Cp` ;H 4t Cp jh"Cp` Ht1  4= 41 4[=L 4h{uhh sa C @t5H 45D 4sY` ;H 4tshX$jr jh"s0` Hփ=\ 4ujjh!#h\ 4o\D 4D 4P 4\ 4P 4\ 4\=L 4H 4Hw{5D 4=p-t 1 4H 4D 49IFTu@1*jjTPkH<9Hs B@9u[0QPV 0uՋ@9s3<jp$(Ph 4.<jjVh 4 )H*tD 4D 4P 4 4P 4 4t$ 4 454h$"54< $4 L 4u4545H 4j5D 4%=P 4t54j 5 [^?Cv1s  4ue[^_]U 4txt1҉P x{u@jjh!#h\ 4US];] ttC.UVSQƉX1҉jEPVp S >tE8t`XPX1:"u#C@؍e[^]USP$zYt@Uv‹EBu Sh"$j1 ]UWVS Ek< -Ex19~BURE@u9 2u19)VD PRkEx4 ~1]U1҃=\{4i@v4 P1]U<d4 51]U<s4 1]U<@t4 1]U<q4 1]Uq4 1]U4q1]U~4e1]U~4ex1]U~4e]1]Up4 B1]U4 '1]Ur4 1]U4;41]Ud4 1]Us4 1]U@t4 1]U4 ~1]UE 1҃8i 4 Q1]UVSQ] h%uV@& jVVjjjjh2(Vi Zx9~ʉe[^]UE]2/UEN]"/UE.]/UEg]/UEb].UWVSÉQ-W-VPh?$sze[^_]UEU t2t Ju6@t4 'u%d4 q4  s4 ]]UEU wS$&~4:4.q4 "@t4 s4  d4 ]]UEU t2t Ju9@t4 'u(d4 ~4 s4 ]]UEU t;t)JuB o4/u0 @4Ƀ~4 r4]q]UEU wG$&4 .p4 "@t4 s4  d4 ]]UVSuU E$&1i f`4ZKh$P<ZYt u h{+X e[^]je[^]US]E U $&1Ƀ:i 4 4 @t4 s4 xd4 l4`h$h4!<ZY;4t=;4t h*X):4r4@4Ƀ؋]{]USE h$P;ZYudhRh!#h /1]U4ƀxjjP#US] 4ƀxj3P4 )t PWXjj3P ]UE 054US] 4)thjjXZ9ƀxj3Pyjj354j354V(]US] 4ƀx3j354#]Uju NUju :Uju UVSu jVZYtV"jSPe[^]UVSu jVZYtVSP e[^]USRu ÍEPjSu ugX jjS5 ]Uu 4US]E $&1Ƀ=܋4i4 |4O4uh$h48YZۉ4t=ۉ4t hc'Z>ڊ42r4&@4Ƀ5܋4aX؋]#]US]E U$(&1Ƀ=\{4i@v4 >x4 w@u43k=y4_h$h=y47YZ[y4t=[y4t h{&Z(Zz4 +$5\{46`X؋]Q]Uh耷@41U1 4jvO1U1 4jaOc1UhhK$h 4J E Uhh`$h 4# E Uhhu$h 4 E Uhh}$h 4դ E UE.tgzEEPjjp貺 UE.tgzEEPjjo菺 UE.tgzEEPjjfl UE 0^Ph$jjcKUE.tgzEEPjjhB UE jUE jɨUE j诨UE j蕨bUJU ]U藬U ]U|U ]U`U ]Uj`U Uj_U U詾U ]U4,P1RP(U4,P@1RP(U4,jh(U4,jh@i(Ujjǰ1Ujj跰1Ujj觰1Ujj藰1%,Uh$\ Uh$[ 1Uh$[ U@1]U~4jM1U許1]Uj.1UJ21]Uq01]U+1]UVSu] h6#C Zwt @t2E0f~ufFsHPh #%h"e[^]Ee[^]#UEU ttu(~44 `4]]UEU ttu(4 p4  `4]n]UVSE 0ڸuh)Z$X h3Z$X XZjSh)Z$ jSh3Z$ 1e[^]Uڊ4=ڊ4uh)Z$dX h3Z$ZX XZ%jhڊ4h)Z$ jhڊ4h3Z$ 1UZz4<=Zz4uh)Z$X h3Z$W XZ%jhZz4h)Z$4 jhZz4h3Z$# 1U:4=:4uh)Z$W h3Z$W XZ%jh:4h)Z$ jh:4h3Z$ 1Uh$h41ZYuۉ4dehhۉ4h!#hy$1Uh$h=y40ZYu[y4dhh[y4h!#h+$1Uh$h4}0ZYu;4dhh;4h!#h#1U54tZujj54 US] 4)thjjQXZ0ƀxj3Pjj354S ]UE ]UE ]UE 1҉]UE ]UWVS É։M}}} }PfуP19~Pfz fSC9uh$QuRMs-he*%QuR1CuDSu0Kx9tF( Fat~UCuBEsL5})CuS փ9~Of{ufKf9|A)fKsfuu)K9M|9~fs)y1fssf9u|MS9~09},CPuAERuFYXMCu9}ys(unXZ1C9uf{th$uQsCujjs"{ uC}S)Psssne[^_]UE ]UE 1҉P]UE @]UE @]UE ]UE 1҉]UE ]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE ]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @] "U1 4jB1U1 4jB1U@t4 G1]Us4 ,1]Ud4 1]Ur41]Uhv@41Ur41]UhE@41Us4 1]Ud4 y1]U@t4 ^1]Ud4 C1]U@t4 (1]Us4  1]U4q1]U`41]U4 1]Up4 1]U~4e1]UE uU]US] 4)thjj@XZ*ƀxj3Pjj354]UWVS ]u t/{u)P/vP< t6vWJC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P%uC ZtsP Fs 1C sUs 1CZY]UWVSP -1AƉE1U9}HQG t5fu.O)ljPD PRMk5=7V ƃ11Et9}} < uEF5=7mh$jj5=7 Vjj5=7 $jj5=7茘5=7r5=7Y=5-DBxsqh>tadt\<-u(=tK=tB-wH=Rt/=Su8t4+= 4E9s$ X>t 4|h-j XZCiPCf.S K)y1fK)y1fCYCfEECЍP9UK fM)y1s9~fSUʋMM9EL8fKszkXxufufCVt%z `~x~Ha (aS9USB CfC> =S=VYv1-DB'h-jd VYp sjC Zt sP;_XsFKYt+F t!u S_Zt Cx~fF ft\uMs/jC ^tsP;s 1ɉK sJs1C 4XZu W_XF u|siC Yt sP:XZstJXCt2Po1s_$uCD0tPoC1҉T0YEC9E|ӋC4tu S_Xs 1ɉKC ^t9P1C Z+uuIu5=7ie[^_]UU 4U fP]UU1x9 4~ 4]UWVSP.5 4 49=  MRPskY_Mu11 46 4 44uj@-t-t)9 4r!DP#; Zt; 4s @-`-؋]U5 4A_1 4 4ZU5 4XU5 4XUS]uTu PgkSPjQ]US]u+u P>kSPj(]UE Puj UGuPhX$ UuPhX$ US ]uuPjSuuu jPQ$]Uh!#uuu uUWVS}5 4q5 4NXZun},u4u(PGjWPjj ǃE}t'E8tE$9}uY|EE$|9}AE6}Et)~%E8tPoZU$D9EeE} u)@E }y$uw[Ej PZYtE@M}})ȻEE9~)Ήuu uWQM5 4c*ÃMu$u uWQh4$5 4J11M@S,XMtV5=7]-ZYMM5 4SPS*~5 4PSjjSk\$SaE @PE@PWMQ5 4)P,S~ P5 4}S.P5 4Vu#u(P6hU,Ru$u uuP$t6S[XtSV,V@ SF<WP+S%e[^_]Uh!#u$u uuuuu u/$US]uuPgSuuu jP+$]Uh!#uuu uUS]u1uPDgSuuu jP$]Uh!#uuu uUS]uu PfSPj]Uh!#uXZUS5 4S5 4r؋]Uji US]Ss hh"Y P sl =o4t7S螈Ph%5o4 5o45o4v1o4=~4t8S^Ph %5~4 5~45~461ɉ ~4= 4uh-h!%a XZ]UWVS h"P _Zuoh~RjP觌Phg#h-M S%_ j0 hT.#S _Z؉Ph}#Y[&tCVhSJ uW $W t ;u뵋Ct{ tዅhT.#R^ ZY€:=uZhT.#SA ZYh8%Sv ZYWSw ;VXe[^_]UEPE 4UWVS 1ɉJ P] ^r Zp j h=%V  uՃ{ uC W hqF%W+ VW+ WujƋ;7P yC9C u=CPWY_ZuP YaCPsY_ZtۉC{ CP蔜GC VxY^e[^_]Ã=~4u UD4t uPv XZj Uhh" YtPA} Zt hqF%2} YhjhQ~YZ hZjXUWVS 1ɉM܍}1~4j1j蜇[_ ]߉jjPN =~4u:SZxEPj b_X}cjhy[^1=~4U[j4PgZY~>jh6j4PgyjhY^=`|4;SZujh_XS^u41ɉ$HugT![4PhX$jXj_4)t]SVZ4}EEjPV^XEE119EtMԋ 1҅t9t; tB F@܋Ekl9tH41҅t9t; tB Fl19t!4EPbZYu SYYG19tPZtG}WfX1;Us=klE@0 t.Hdt'yt!U؋ Ph q1p8p4kUB19t4UW=ZYmUBSXY_S}Z^u`S[Ohj]jYju8j]SZYu'@֌SVS jj^֍EPXe[^_]UWVShPVTr hhp%Vs hVW2r $hh+%Wr VQu1EW@Zt/SSSSSSSSSSShb"h4jj*Y[ WVVXZ뷍e[^_]UVShPVq hhp%Vdr hVSq $hh+%S?r St VSXZe[^]UWVS}11u܉5~4jj._ZyjVP7J e]4$*u u^)uYjha Y[,u>tPZt4$PX4$S^_EScSGZYS<^_w%%S ^5=7Ujj5=7{5=7,P5=7UEPj }tChj_jZju,jSZYuw%%̉SXe[^_]UWVS}11Eܣ~4fjj]ZYxjSPhH xpu4*u$tPV _XEV\[u4EPj ZY}t!hj`jju VXe[^_]UWVS1HH;E E8u EH1LEL0t < tLEL8PY$}1ۉ889E SiZ9$PuS蒒 O]1<%rA <%t)-< u"DB@CC8uj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< u-DP@tC8u$C<97O5=7@jPSR)R5=7C$uh-h%P j jP4]dZYt'5=7]kPS4j5=7PSjjSsSM؍e[^]UWVSӉVjhVj(P$P@  ~4h~4hpt$f =-h-hbt(A ud=-u[jh%j3 h-hf@$=-t"1҉-h-hbt( -o4tP(X~4tPXOt %1~4PMC%Q%uj j jjhm % jjrm N$ 󥁍 Pj( ( o4t#u hb%P| 5o41o4~4t#u hg#PP 5~41~4hǶ%3^_uhq%sZYu s Xe s hr4XEt28t(P _tSPht%^ S3` 3h%^ jD41ۉ~481󫋍$88Dž1 EDž1ɉ zi8/h% ^ _=o4t G0sOPh%5o4 jj P` 9 X8󥋅 ,014,PjjXPh , 8uE 1ۉ#XhVS h#\ ^Ƅu PV$D u1t@ ?uzo4tPWBK 5o4) 8uE h~#Pw ZYt f W00aH C 1x% o4xt SP XZSj/U ƒt=$[ (P o4^_tP0[1ɉ D47 ƒuhMu $t"=th'M Z1e[^_]UShhjh!jjjjj jjh-h4y.h-h%I o4Y[t Ph%zI XZj jP!Sa ]UWVSEPuhV> }uCxPVrY[tE 1҉Sth"V _XuA h"V XZ1ɉtu6o4tVh &h%P 둿tt txW>E X1lSN pY@ltJG9r7tuvQCFE 1ɉ^dWQBE XZtNp1F1}uSS Xu5o4t,Rh &h%P }tS ZSJe[^_]  UWVS0u 1EEEPVEP ] 1EԉE܅unVh %E܍t0SE)Phy"V hB %S ƒE9E؀8'uE؋E؀x*he*%u ^_]EԊp<'uMCj'S^_E؃}u SY؉E؋Eԍ4VupAE_ZOSh- %jQ j 벍Jg<%u<@T)IB*E6j/V ZYDžuVC EXuVC E̍GE/X}u$_HEu@Y M܋}ԍYtqUĀx .tx uuW1 uˋU;2tEԋEԍRUu@EZYUWVE)PhE %E܍DP y;2tVCXu6 XoE܋M1ۉ-]Shht@j f}ufEf}ufEPEt|e s+=7EjP5=7h5=7B6Et55=7<j5=7 5=7~AXZ륿랅whPA-H-ZYy h-U-AjW 0_(!G;=7tS[}ter+5=7:5=7tj5=7%Au@Y]܃Ct P@Zu@XtEtV Ne[^_]UVShV螁[ZuYtPEj.VZYÅuhVh(4Y 'hVh(4Y hCSh)4Y e[^]UWVS֍y9sjʅta}t7E t/t,-DHuUQMuZYMUtC)؃~QhL %PS F1E ؍e[^_]UWVSƉUMjjjà @t5$1UVjh*4VX VuSS"؍e[^_]USPh*4hS %EPjh"u [Xh"j ZYttjhw %S| u؃h %S ZYuh %S ZYujh %S| t؊t t@hSh"4W uP>X]UVSh(4*$)4$h(4h 4W =)4tR)~(4.u(4Ph)42BZYt+hhK%h 4=X hh)4h 4)X  4e[^]UWVS1ɺ!idu$xtx菖 jPh`(4W 1ɺ%idu$xtxU jPh (4V jjj}à < 1jh*4VV Vh8i(SwSugL8PhPh &4VV $8PXt*hVh &4V hSh &4V %Íe[^_]ÍL$qUWVSQ-P 4T[h %(Pj y,o4t Ph %> ^_h-h %= j h_3Ƌ([1ۋ(?RXYX9h$W5T ZYPWVRy h$WT |-LDžX-XtMQDI$HDQVsy uHLDAEXhViPT C (uV:W:XZ0iƄV:W:^_ujrjoY[ PDž$Hjj$V(Wh %7 @u"Dž$ jjVWh' %6 @u/ ;Psh; %jP|YZt,뱸 ;x|s:hZ %jPP_Zu(hre^t 4DžT jSd5XZYt5L4gXDžT 9tf@ @ )htjjjjjjjjjSXjuRL411PDžhjt`hPLϿh uLX8_X  4hiPh*4_R jh %h*4vt(jh %h*4v  % %1DžPhz %j@$W jjPpPW4 $@t puh48&h*4h"%h,jct8DžpjpPjj$V4 @tVh %e^[^1=*4s(u=*4lu *4-DJuPhqF%O ZYt;rPhqF%< ^X1hI$PY[hI$P_ZÅu 1DžPkjv<$1󫍽p!󪍍pi\^@u 1ۉ$Nhh %tVZYthh %4h %4jf= %4thh $4h $4hh "h} % Ãt~Ph %jh\h %S]\h %SR\h %SG\$h %S9\h %4h %S)\= $4th $4h %S \ h %S[^_h# %S[h1 %S[SNh4 %j[h*4h9 %h(h*4hN %h$S S.hr %h &4ZYh %h &4^_h %h &4Y[hd$h &4_Zh"h &4[^he*%h &4nZY= &4h &4h*4h %jtnh*4h %$Pj8~ $X$u4_hh &4h &4j~-h %h &4 &41ɉ #4hh$ %S[^h!_Zh*4h$ %h1 %hDÃ3P #4h= %\Pj_ ~h\h '4=M \3j h '4S th %\Pj ~h\h 4L \=3j h 4 t= 4t #4h8 %\Vj ~h\h)4L \2_=)4u8h %Vjh ~h\h)4FL \2Yj h)4[_Zt=)4t #4hh(4sY^u =(4u #4111hP$VK hh(4h(4jxhh)4h)4jw,PVu^Zt%#4Pu*jh`(4h`(4jytjh@(4h@(4jzetih`(4 Y= (4u=w jh<%"P?w jhG%-wjhR%h (4J jh (4h (4j{hh '4h '4j}#4u:1llPj豷XZluhh 4h 4j|VDžH '4= '4u DžHd$DžD (4= (4u DžDd$@(4=@(4ud$`(4=`(4ud$ &4= &4u % 4= 4ud$HDVQRh*4Ph(4h)4hf"hV,= '4u DžHd$ (4= (4ud$`(4=`(4ud$ &4= &4u % 4= 4ud$HVQRh*4Ph(4h)4hh"h(jjjo %x PdX"4RhX$h hZ^L,X#/h]%jktj 4Y= 4hQs"hz%h XZu>=o4th5o4P0 hh-P0 j謽 h%jTpWA W WPh%h%VT =)4th)4h%VlT = 4th 4h%VPT h4 %jATj V製=`(4sh@(4h`(4h*4h%j5h%h #4ѿ hh #4h #4jjFj jh$<uch4%$S蓿 h #4Sdhe*%dP Y_t 8tV XZjj`RPPuf= (4t h (4h`(4h*4hD%jPh`(4h*4hi%j5=(4toh(4$h(4T [^T=(4th(4$h(40 ZY~=(4th(4m$h(4 _XPu΀= '4t&h%hh '4h%hhh%hr  4j 4TXTeY[^_]aUU!#w(&]UWVS] }Vh$<ZYuu ƅ?jh%yp:jj\f@jh%M7ZY9t x/t/@?/uGjh%MXY1iR 4$SRPh%hu e[^_]UWVSƉˍPh$2ZY!#uu%VQPSSd4tt4PVSWh%he[^_]U4E]ZUS]S+VZй 4؋]9USPEEPj褰EZYt=`4r4=r4/ur4SPh_+%hh}4 1]US]= 4ujXE]EPj (EZYtt`4<4r4=r4/ur4gSPh_+%hh`4m r4=r4/ur46SPh_+%hh`{4< 1]U _ZExN1jSEp3 SuVSuVt~tg`PRT^[^tEPPRZYtU68t,8u"E@t$RP]^_uh%EPY[tEXt p$l(h,`d04t:$VSd]_Zt'EPV4PhS%hS \EpFjh^%ZY@+$hj%hy%S<#Vh%W0#Wh%S覌$WoPh}DSSO; ?Ph%A t0?u'h%聋[_th%PpZYuXRhF%P! tjj h!#,4,0RPj$W4 Sh- tHLDJ@tSPWVh%hFP} 5 +41󫍝DžƅDž+4DžDžShQVmZ +4Džf=t#fyf+4f=NE1f=FX!щ11Ҋ+4+4t'w8X$'wX$$(uJ1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`V!Y^ ?j!jAj.jj h!#,4,0RPj#R (PW#RVh%hS Ijj h!#,4,0RPj$W3 WVh73$hS跫 0E@8@}~P# $uJ< uuƄ$jj h!#,4,0RPjW SWVh%hFP 4be[^_]UVSPjjuVjjh&@tbu XtSjjVSjh&e@u SzY2he*%S(ZYt PuU ^Zu SS[ he*%j1e[^]U EEE EEh;EPOZYtEU 1ɉMEUhEP%ZYtE1UWVS`NjEA w1h%w ^ZuhqF%w ZYth&3[^G,Vuh&3ZYt\tBJ@u xt@wH44$t)tVP҉[Xt4$1ҍ1ɉ94PS2YZtXP,40S|ƒt/t#VRЉXZu\RY8pu`$uVP҉XZtً$9jjjjhSQRPx jjjjhSQRPx h0%P舢 h4PP* hu"V] h4PV* W(R'[XT`a9lhGPP`* h_SVQ* Ah0%Sˡ hwS-* hu"S謡 hwS* (uYh%V聡 hV) hwS( Ph%Sg^ à ƅG1ɋÅthH"S蠺ZYu!Ph%j^ à uhS#SnZYthv#S]ZYthI$SLZYth%S;ZYthDi"S*ZYtt hh% hh%V( hSV( ƅGw PVà {whX$jj9Z؍e[^_]UE1҉UMU ]UEEMU ]UWVSQ]} E10$hlj6S*u E%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVS E 1ɉ1D󫍕D1҃=~45=7N h-a 5=7~4 Iuujj_AXZ1Ҁt,DžfDžDž)Dž=v Dž1ۉ11119tD5fDŽ5DŽ5)H5=fDŽ=DŽ=)BC8[ty1t1DŽYfDŽDŽ)DŽBt1DŽWfDŽDŽ)DŽBhjjjjjjjjjRPj谛Ã4uDžhuhX$jJDžPS!tuiu5hjjjjjjjjjPj$ƃ4t@DžPV趐ZY^Hy V֛XS͛_u?t6hhPh-E# 4-Džc=~4yu~4Dž<1ۉ~49i8511ɉ9=~4t9i85H4t(~SW{YZoڋ t44ƀy1҉LPTXjSP6" hCP4"P" jSh~4" 54,, 0$4(804$ u1҉DHPWHDFP$4()l,, 0$4(804 uȉ1DH$=~4 pH DH9jj h!#RPjVl jj h!#4$P@ RPjP9 o48t$4VHDPh\%R~ 4$pvơ4$0`RRVP4Pjj:5Dž1ɉ$Pj行^_u654h^u1Z%$P1$Xu@P~4P54 P.^4$JZDH-1ۉ,048DHƂ(448<=~45 t4T_H4Y t4tu H4h £ t4a1X@KyuƆy$tP,40W1$͋e[^_]UMw1vB ]UWVSDž14*)Ph%hSٚ %t+he/^Sh%h訽 juehqF%4Ph54%hSc hqF%Sh% ǃ((hqF%Sh)jlE0p~11ۉR#YZtsE;klEX{41ɉ Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CL_cLuӟXZ=~4CLS<SRV菍ǃSRjj\ 1jjB6u$`&v=IC`,tPh(%hVE Vh.%PO C`,tPh=%hV CXtPhD%jW WVC\tPhK%jWǗ WVST{"tv$tb#VPhR%P譺 CH@%%GCX,tS\tPhk%hVJ Vhq%PT )%%h%P1 XZ%%h%P _X%%h%P Y^%%%{Tu%PP迹 XZ%%d1]%%NKPQhX%hcǃ-1ɍPY1e[^_]á4*;UWVS ƅh%QhQs"h#脊資Ph %j$=o4t"4X荇SPh"%5o4t u6hxo4Zt Ph=%* ^_jj 3Y[hY%W*$4[^1҉D)kSPJBZY;PdV P,P譏 Vh%W#TP,PA$T\L1PL9Phm"HPΨZYHuuRS V,TXhg1TRjPZ*Pn(P V^P1Sh%W" PAVYkDlEXC uDED;rC,u{Pu C0u tCLtċC4jjjjhVs8PRx 1҉LtL{tCH!#DžH%#CP w$&=11DžP $#"DžP)%u# DžP%hqF%HZY҃!#uhLP %PLh%Sy؃RPh%W8!RPh%hC%讄X11DžP%11DžP%<@hqF%HQZY@v{ ExtSx u^^~1;s}O19t }?;tBx(u PYFËEx uZ&1ۋ;sx(u PXC1ۉ؍e[^_]UWVSu1ۀ~ tB~9s*ًx(u1;tB9uPXC͉Me[^_]e[^_]UWVSQ8ME111ۋE;Xs-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVSh9%he[^_]UE8b]UE;4Ƃ;4:4fP:4fP1]UEPE ]UE E EE]驘US];4)PCC0;4R C:4C:41C1]UWVSÉM1u1sNуtX D4tJ};0u%1Ƀs1t0uAqt*J EE띃}tB V2BBF2EEZY[^_]UWVS1󫍵HEPE jhjjh,jh5TD4jj jPSj|Ã8VPlrS}1e[^_]UWVS<Ɖ׉1E1;S sMQRUSPL <]UBjluZY1҅E1EEE;C M9MMQuSPL k}lE̋UЉQE܅t8tjPQ HL >_4EG8EċUȉGh}jhs%*h~Vh$V5}4还hx JjW5}4@ h&h&hSjW5}4(S|Zt PSV" }JVlV)jh5}4 5}45}4jjhI%SÃ(xj VPSe[^_]UWVS։ϋ1׋B˃1t.0uKB1t" D4 D4ȍYu1[^_]U1ҋE ]U1ɺE ]UWVS ]ju ^_jdu h%PM u h54%W9 19tNi sQWVC" uΊa<w ~[BjjPǃ :1ɉPhd@W@ u u W蚣Z`RhedAWWz`9< RFaPu h%W jjWǃF s9"hh24Wզ@u W艢Xjh%h24 u܁=24usjOh24Pfƅ_ OusƄWu h$(%s CRPh73$P $1u2jau h$(%s CPPs CtC @C wF-1e[^_]UWVSEEuu&4& &:41&ƃ D4@&u1 D4@9uPD4j@{hD4j4{dD4j({`D4j{\D4j{ƣXD4=dD4W躋ËhD4$U觋9s}Ë`D4RU茋Z9s}Ë\D4RUsY9s}VcZ9rVh!#hj%jjw TD4EEe[^_]tU|EPu XY1uE%;E Uh@uÀ=~4tuUh~4h%j5 t1T4h@t4h%h_+%hh`4v hs4h%h_+%hh`{4v (h`4sZ1Uhu.UQ :4 :4u0EEE jjEPh:4jEP K:4:4USh$TzhJzjjF h$hh$hh%j S SXZ]UVSP]u EPVEP蛘 E u Vh%jS SSPh%jƘuje[^]UPEEPjeEZYtM`4hCZghr4Ph_+%hh`4\u ;ghr4Ph_+%hh`{4=u (1US 8PhqF%m [X1u?9t3h0!"S>ZY¸th$S&ZY]U ZE\URuhr4PVSuh%j"¸$KEtVSic VS|à E)ËE9th %h&h h %_Ee[^_]UWVS EUˋujQEY_tG UR#kuSPQÃtPESXZEEe[^_]e[^_]USj$utTZYtD1ۉ]XEPjhjjj EPS+U Vt;M rj$S뱋]UEPM U8XUEPM UXXUWVS 1҉<P&jƅ.Phf%V t#hjhu%h%j %!hjh%h%j %Ph`4pa Wj&V  Hvw= 4uj輒_1|-Dž`-Džjhh$jPj(Uu1 h`4h`-Wݢ !#=|-u.h]-h$zZY!#u={-u%WVRh%h谈VSR` = 4uj̑XDžjhh$0iWj'T-=4+=p4=`4h%W_ W1 h`4Wh_+%S Whp4h4h%jڇ$VSh!%jWh"%j讇W VSI_ Y^DžWj)SXZX=~4tZ=4tQ=`4tHh%W^ Wh h`4Wh_+%S Wh~4h4h%2;e[^_]USڸstjSk ZYuSh0%jʆ ]US13tjSxk ZYuSh=%j芆 ]USS1$tsf1EEPj%REZYtt`Huȃul"hK%fX t&jء hK%fYXKuhU%jTXZ1]Ã=14uiU14 "I 4p%:d4z%+$4k#`47% @4r "h4]USE] tP7fYSjQxeXZ}4E]cUWVS18Z^1Dž@DžDDž<jjZuWU2ЉXt0t04haujPjP_SmVg t,4uQX} tExuh%j老Y_}tuSh%heǃSh%hNǃ V VXZt-t44ShX$hajj@=`4t=@4tSh %j E@ D4t 84e[^_]UVS]u Stt uh%OX%qF%2u%jjPVSe[^]UWVShh%~4_Zt Ph% [^(411۸ -P/t 8t D4u uA؄t (4Dž -{544/z;i D4\,4u1uSZYH0,4544j5=75=7=5=7=3<484P5(4h3%ja_1`4Pj wKtu D4<4uf<4ƅ1N1tσ0u@/u(Ht!ȿ1 D4uƇ D4Bƅ뼀t/<4'tju ^_ D4t84(4u9uh_j 0VR5,45<4504Ph:%h^ jjY[}u%,D4hG%j}XZ/D4tkh`%h}^_Hu%h+^jY[th%j}XZh%j}h%jw},D4,D4hqF%LRP urh%hLxRPl uT|9u;xt8h%h<%1Q^_thF%j|h<%h%M迴\[OthU%jT|Y[ju XZ1e[^_]UWVS-{t0u1#W3+PYZtWhX$h\ ك1ujhXZe[^_]UWVS1h%'KPhX$P{ ytQP`[Hh%JPhX$P{ xh%JPhX$P{ y6륋tPYuhX$h2[jjEZxPʀhP$F] à tXyS)PhQs"WALYX1u|SPWpuhX$h2)[jjBUhT.#W/w YZuk$uF t*WhX$V$ ShW^R u<=uDžSQOVKOXZtz^_uY[uNh/Zj_Zu@賀[^t jh1jh2%ZY1wXi؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStitcklЉE1}9z4u@lM9ut@FjlP‰FXYt*1}9{4ukl4 @lM9uܰ1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF;s rEtEȋỦEUEЋUԉEU؍e[^]UWVS]u 1V,ZtƍCڍe[^_]US]s s$XZCE]UWVS]1;3s8klCxdF@0 ttW X9sklS9zduBd@1;3s>klCx4uFtWXF 9sklS9z4uB4@skXCEe[^_]XUVSjhPjut)uu PZ @uu0S |wu0Z1 S{Xe[^]UWS] 1Sh|duw t#S;S t%iSR3VZYt3螻X1e[_]Uu hzd@u)UVSujhPjV t(ju jPVo+S:{y t01e[^]Uu hedAuUU EHJ Ju BP kqoEMt0t(t h!#5d4h%vFtstZ~ tS4C8u%uh u hH_hPRߒY[P5d45d|4~41RPsswfRP5d4%5d|4~41RPs$s PfRP5d45d4h %v^=5d|4C S$CS ~41SQRPeRP5d4몋P A\uC( PGP5d40\u CH@L؃PGP5d4O\uCH@LPGP5d4a&zuCHpX5d4JzuCHp\5d45d4h %mCHP`u&h GP5d45d4h %v.OEERh%jPD hFURjPà P5d45d4h %vS胬kfx5d45d4h! %v豓CH@Hth( %v蘓XZCH@Hth/ %v耓Y_CH@Hth8 %vhXZCH@Hth? %vPY_CH@HthK %v8XZCH@H thS %v Y_CH@H@th[ %vXZCH@HE ` %FEe[^_]lu%CHP5d45d4h %v踒I+{jPMQKQWsPRdk B(0]EMQP5d4h %vm0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S jSSjjjjj HH-E܃,11t]DS@uu@tA^Ht҈Uth~#WUZYUu CcL'/t C/jWjWS FHHL1e[^_]UVS u vDh%j ]Sh@ j SSjjjjhG0S薣FDVHB`1e[^]UWVS jj%~[^9hBC Q]hBCCQ]hBC C,Q] E1҅tuB &tME4}GF Q]u/UDEjh誌MEZYU}B}$w"uuh=BF Q]X}$thi %h&hht % [jjjjh\hjj jjj%SjM8ƃ4xu Pd.V9S蠧e[^_]UWVSQE @4uE x8u-u uxXZttt =t ujj ݢ^_x 1҉j4&U艋G ^UBXYu؍{shAh ACh@C h@ǃnjjjjh4^hjjjjj SjM7ƃDxu P0-Vp8Sl1e[^_]UWVS] ;G(S119tuklKI0΃@jj h!#GOOgRPj!W_ jj h!# A1҉SQыcRPj'Pg_ 8uth?jPPV8 E@ tP?jPPV !#u h?Xp~?0m?'QWMQVRPpjjAd|4,jB:?SPh73$j -P8< d|4jC?SPh73$j :P< d|40j->SPh73$j GP; jD>h> pOYÃse4ROZ£e4~ް-T1~CVƄ5T -߉TPh %jPh`e4M; j.3>h`e4P5e45e4GP:P-Ph %hhd4: Dh$CXe[^_]UWVS] 4$DV%Y_TV$ C8@@8 QPVRL !B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjheh[`jj7jjjjF)ƃ4PVV)E)PB89B4<蔓ZPufLW WPF8PP8 WRPQLP $AMJ}u29Mu-*}tMJ}u 9Mu }ˀuGE }$vE0EDr%=uu r% = uuS% = t;}yhjˏYZ|tTi4t&@t 9t9i4t@u%}*h4j蟏YZ-OOBOu5(O~% E tSE (#%~ v$ t#%~ v t #%#% E uW#%E fUu)8t$EU 4;\`|ˀ}t4U uWNE (}uƒ ҅u uuth hhXjbZuWhX$h#%V膎e[^_]UWS0]}ȹ 1E1EEE =i4ujjS@ jP4E܍EPjSm@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuh#%j]UWVS4}=i4PklUVE 0^ZYE UlVSClPӻ11CC,C0CLCPCT 4$F( t1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC ƃ un0Ach%0SPh"%j[Njjg hT.#WW YZSG $Sr tVhW um<=uWZƄSWhv$%hS' Vk o4taSh$%P 5o4EV= Sh$%ԃo4t5Sh$%P 5o4dShX$h%~ 1e[^_]UWVSu] FpZFt@9$% @8$%o4tWh$%P 5o4Wh$%h$%,~SV1e[^_]UWVS}u EH$E2E %%1E2ÅujEP'YX9uG@;5hQZuG@;KtG@:1e[^_]U1 4jZt41UWVS]u 1ɉ1j{_t3DžPjoXZuC@;=\{4uh+%%jYXh@u4h@v4h4/h4hS%%hth4hd%%hs%%|h%%htWh%%hd jhLC@:XZ1e[^_]UEI]U-7EPE D4P1]UVSU E0pVSPh%%EpAe[^]UVSu] hjޅZYt,h%%hZYFu @7@U1e[^]UVSu] FPjFph%%h;tF@U1e[^]Uhh%%h UWVSH]@1u -1[eu1ɉ ~4h4jP3L YS`ZtItC"F;ue~D4$-(j4tPXXth &%h(j4j Ph&%h(j4jk(j48-(thK&%Wj? VPhl&%Wj5o4tWP$Wh&%Vt V2_[wV4XL-<V"XL-7YPQZt C8C9h@u4h@v4h4, 1-Ct@t!1C F |uʃ5=7Vjj5=7|5=7"Q5=7VhJjjhQhj&jFjjjPjÃLPSS e[^_]UWVSQƉh&%whQs"PY uA=o4th&%RPh&%5o4 h&%4Ph&%i /OuPh&%Ph/'%lX _XVhX'%S S K]th&%h'%SjXh&%Ph'%Sjh&%PX=o4ZYtuVh'%P 5o4ujh4"V VUX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝ}1ɉM] u]u]܉uu9uu~ u >}}w1] 1ۉMԉ]M]x(Ã}t*3M 3] uM ]M]U9uU9u y;u U| 9u܋U}U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á4"UWVSLEԉUȉM]E EUE}ԋwu}9UM}։lj]19؋]| E1ɉM;EE}HuuWV  t4EUuuWV_ );uE}u}]ԋEUCSEU1҉ŰEUEU]9]E9ƉMEEEU)EUEE1EЋM9M#} E؀x @11ӉM܉]3M 3]$M]] ]9u܋]9ƉE9ƉUE9EEM܋]Ή߸;EE#EUuuWV);uE}u}E9Ɖ]w)]9؉ы]}EUEЃEE9EE]|Eȉ0xEUAQ EE̋EU׸;EE3u}uuWV<);uE u}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]USQMAQRPRPjjjjU} IuEU11ҍeY[]UE]US]sh'%j ]]dPUWVS]} j/Wߞ ZYƃti)PCDPWe ƒuNV`~EJ9s4t'19ty u9t@e[^_]Uju EDPUEvPEDPu ;i UVS]=4u d4K$9C |`549s sUjjjjRPRPU t39r,1tu{(u t @9|1e[^]UWVSU}119y u 9;] u}t uz(tt}h}[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t'%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS@j41ۃ<@&t9jS2FFXZSF w&ӉӉƃ"ue[^]Ã=Hj4uUj4]øj4UWVSUu}E EE9E sX11ۀy u9t 9] tC9] r8@9E}tMa}w}uWrV}f 0}t.1HR}t PRh(%PRh$(%WV R}t PRh%PRh%ԍe[^_]US]uhXJ%h0&hh)(%sSLX]]FLUWVSÃ=Hj4uj@j4u1<@j41@"t 9u& 4419tp4x(9uB1[^_]UWVSu =4u 4E1҉U19~\UE]FPwu"u ~tu Ex(u}t!C;4GUfˉ}FFN(1tF$1Ft 8tjPkMPmd kMƄF uF }thzUXEEe[^_]UE0U U]UWVS]u=Hj4uw1E1M9bz u :D;E +}ߋE싃E苃E}t }u{(u1+FV C S$FF^N(1tF$1F,MPFtk9t jPRb F tV"}uM9MuǃǃFt$9tht(%h&hdh)(%F t'u@K 9M sM 9rE1e[^_]US]=Hj4u!w k @j4"1;4s k44C([]US]=Hj4uS1w&E[]UWVSSÉU=Hj4ud!v=4 41k @j4B9tp4;u(}u1BRQDZYt룄44k44B4V 1Sh%jRU F hr~ SPhu%jW F'F(UV,~0F((e[^_]UWVSu]=Hj4uw1E1M91z u :;E  1}1CC1C CkEt CЉSMS K(щS$MPS,U{}ut 9u 9UuKT9u9UutK }u~(uۃ}uՃ~(tτu˃K @N 9M sM 9r E1ZY[^_]U1ҋE ]USR] j EPu U:tt hsX1 R]UWVS0]C{Tuh(%h&h{Xuh(%h&hh)(%m{\uh(%h&h߃{`uh )%h&hȃ{duh$)%h&hjCDPV^ u h>)%V XZ{4uD1ttʋ5-DNuT4@׀{4ujhk"C4P ؊LD tB:u JN虄 PhG)%W#] hQs"W ƃiWhY)%j3jPhh)%V!jsXs\s`h)%V j,Psdh)%VisTh)%Vi19aW 4@&PwP7Ph)%ViG P u"OQPW RPh)%VaiH9~h)%h"V:iZYZh4 %jiV PPVh)%h)%j Ã(V*Xe[^_]UWVSÃ=4u x4{s1ɸ9|,@89@|1ҁ{v@1҉[^_]UWVSE Eu}hj=[ZtAǀǀjhPju|"@uSAY1RC,PhedA/ x0u<;|1ҋ9Ћ}ScAWXZ뙅~1E u CCCs {$s{ECTCd_19G t C <u:?C <yG1ɉPPPG1RP1tA8t)%CDP} tƃEC ƃ1EC fǃ؍e[^_]US]{Tuh(%h&jg{Xuh(%h&jhh)(%{\uh(%h&ji{`uh )%h&jj΃{duh$)%h&jk뺉EE E=@8 CP1RP sjhs]UWVS@E PEԉU؋E @E̋E @ EE @EċE @EȋE p@ EjjuujjjjUE u}h}EUE܉UEP@EUӃE9؋}|StNtIEƉ׃RPWV)׉u}+u}EU)EUM]M܉]9M̋E} ẺE܋EEEUẺUЋ}9׋u} uԋ}؉ủ}ڋMԋ]M]9ȉ} +EUЉE܉U=4u } 4E119~lMUԋUċJ}uw u9f4Gw.t*u #utu Uz(u}t0@;4}thz&]XÉuẺE܉E|E H(1t E @$1}t#EȀ8tjPkMPT kUƄEM@ P$@ ]9؉Ӌu| +EUӋEH X$FUf*e[^_]1UWVSPEE4u111t_}u@&u1A:u 7:uNj;&uRuuu jjuЃu)뛉uh@&uuu jju&e[^_]UWVS] ߋuE;Utf1Myt]J8{ sStWVPщC u5EuV2P4CZuEPDCuEjP4CXe[^_]UWVS-mk4@&9k4jl4j/_11&tЄtF;GutT54P/4^t7;t `&{t `&{t k41҉S 8Ye[^_]US1ۡ4;4stCP7X]UWVS119t u9}֍W8t1B@ۉ[^_]UE p 1]UE @<1]UWVSu] K4t+@Xt QRZYuFfH f~t1EFf` EfF{4FE~19M~)x ufP }ufP AҋKfWJt Ѓ9tЃfGJ1;x$s0Ws4RP` VC8u fL  fd GǍe[^_]UE @1]UE 1҉P1]UE @1]UE @1]UE @1]UEPE ]US]E UuhHPR0Yu hZ@EE X$CE]!UWVSu} ]=l4@1l4jl4P{ZY9l4}l4jl4PZZY9l4}l4h~l4P6ZY9l4}l4h`l4PZY9l4}l4hhtjjhjjjAjjjRVh踼E4URP[u虽V+}51Dž<Dž@;us<`RVSPL t$hl`d<@FjH&4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DP:Xe[^_]UWVSEMt]X$[ EXUjS$EZYtI-Ut#E@$19tD BMNju1ۋE Ee[^_]UWVS] Ep+s8k H(L9tWIw\hWKQVs4RPdhWWjjjj@(48WVs4PRp Vs4RPh 1e[^_]UWVS0] K4Uus 0RQPVL Utss ssuu3ҥC S1e[^_]UWVS0] K4Uus 0RQPVL Utss3CSuuPR|EU+CS;C {}C S1e[^_]UWVSDÉUEE1uu11;{ sGMQWSPL t2EԨt+M؃9u#F}y tEċUȉEUE̋UЉEUG봅u*}pƋ0VPjhKNtY}yS}ttURURSЃ u1pƋ0VPjhVS1RYt }WSЉXZe[^_]UWVSPu\hP1҉UU:ÍU.WVh"%jjjMQR9|ڃRjjh*%1e[^_]UWVSl}1E EEURj`-1[_|ËEPRHEU4PLEUYE9ƋE|EEE 1}EjP4E̋MEjjuuuu~41ҋ}9=~4׋u}EURPjEPQEƒ01EUEUEUEUhjjh:hhj6jjjuSj莵ƃ4u Sy$ZkEPV$VdS`$}u#EMQ]SP @u uXUEEP tB]fCe[^_]UVSR] 1ɉMS4t&uVRP u uXfC<1e[^]UWVS] E@fHPR0_usCthpW= ƅhWWjjjjp t%RWP@ZYuX붉Ɖse[^_]UWVSLu}1E EVUEURj-CY[tUÍ}UE;P s WRPQL hjjh:hhj6jjjuSj}4uSj"ZwURPE EPJSF"}u*UE;P s]SWRPu uX1}t UnEx fFe[^_]UWVST]SSPHEU4PLEUZY1}9M|EE1E}u{3jjuuuukMeRPjEPS,HEUEĉUȃ}uuujP8E؃ jURS @tQEM;M qku0}u jjuuuuuujURSЃ,Hu1~Uع1EUEĉUȋEUẺUЋz!EjR4E؋juVStVPSRLƃ txtjuuSe[^_]UWVS|]4tf(ttuh*%h(&hh*%xF5~4t\Un4hjjhhhRjFjjjuPh m4蕰ƃ45n4wY20蜹Ep菹|7肹xwtjj h!#jh0jUR,jj h!#jhjMQMQURW|xu4PjhN@h$$4$0E4$pӸEEEEEU׉ u11MQMQSЃ UtEfEEEĹf@ @ @f@@=4w@ f@*@,htjjjjjjjjjQRḫǃ4t P螮@,EPW^W螯Et11!UMQWSPL UuG;{ r"E EtEuEȅtօt1h\jHY_uo4zPh+% SIZujhQ_XO:jS[^Jsjhse4@u ǀ@>U1]1EEPVXZ}y1Q1҉u1Hùxt%| q1@ 4S .|GEE;xrB;Us E11ۃ}t E;]sP,C_PYV躭5n4XZ}e[^_]UWVS0EDž}uEk4jSZYt jS^_u"Y15jS_Zu[^ƅ1;44} tE 9[uE(u)tMQRYu';s{Љ E, UHD9Ɖ}djj h!# WVjWhoƃ 3WVPh8+%V2 VWY ƅ3³P6Y XZ00@ _w%tDž111=u%hmjj h!#E,}H,DRPjVVE$hn躲RjPES`YNƉ<$DT2 ‰$SP1 S[Xf S $f <$S WV9r$hC+%h&hh*%uZ1hjjjjjjjjjP菨Ã4tPS+_X19s <19t43@YڅttVZ  tSXe[^_]UWVSljfDžv/ƅujhK%Y^yhhK%S80 y賟t&誟8t蠟WPh_+%hS読 hWS/ =Džp!j/Sd _Zt-xv9tH9s8/t@Q6 YyߍxPW!BYZ%=pu5>hQWg iƄ/u%語QPh"%hS讬 %hQS. =@uW6 ZuhWP. =hS| Y_1Ҁ;/u 1Ҁ{‰hS¿p<$访ZlhЃpDl=w4uhhqF%S. =whWS. =v ?V _y V8YVv ZVX1e[^_]USÍEPS?YZx7Et.jSXZxj `PS t SY1$S`Z=vf u]UWVSEUP ^ƃ}t11ɉMVq( Zt{fx vX jh,%SlQ uSuh_+%EP @u hn\#7& 3Et}tESWuhV+%j>u[zV9 XEEe[^_]Ujh)Gj轡 UWVS he+%011tY+ڸn+%xuڸy+%wu#WS=XZuWS=Y^1yahy+%轛hPS+ WS;>1u h+%藛PSh+%j?Sh+%j7hS=ht+%ShPPJ+ WP=u'h+%SϚPPh+%jh+%hPS* Sh!%jtPh+%h+%j}uhf+%SZhPW* h+%S=PWh+%j@,h+%S!hPWq* h+%S PWh+%j ,hf+%SPh+%jMh%S˙Ph+%j*h+%hPW) h+%S蒙PWh+%j(he+%ʙhPW) hf+%SXyth+%S9 Ph+%j: h+%ohPWd) h+%Sp14 -Ph_+%hWЦ vtpWh+%jC utjh*=DXZte[^_]UEn4fP]USE@k @&t!@&ShWE 0莭Cn4 ]UWVShƍPhW@jN@1jh,%_ZRhW@P 11!tVk @&@&u Dž"BVP諹ZYu=n4DŽGjjjjhjjjjjj!ShޞÃ4tjPSsS賟Xe[^_]U迖n4tPPRRRh,%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ~41RPSQRPh#j]S ]Сd|4EԃЃ7PURjP:jPPh n4>& S  e[^_]UWVSĀE@kl} GNjE @u FuG u G08uw0WEU1EEPj גXZ}E MQw8P uEP^G81ۉ]E ];Xwk]lE X{8tIC] su19Mtklu ^c0AO0u uu ]u]u tu9]}UEG0uW+EUu FV}t ]U]EUWE <1e[^_]UWVSd} E@9E Ek] lEpF0tjPPV h"j*!URjP3h$d|4j-SPh73$jF^S j.ߝ h &PShd/%hhn4Ԛ e[^_]UWVS8Ë@H1{$C$EsCM19tklD>0 tfA A s B}lj &fG G5G$G G,G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{`S(xE+C$PREpxP@EU~4~419| EU)AQ1&Wv @u1]{]4VNUMEP$@ EU]9]s#kElx8uyP@P b]9]r,1]9؋]|ZEM]+HX M]11~8u(V] ]9E]|V1]9؋]}yV9E]}jM9MsWM]+EUuuSQ述UUMNk]lUMʋUeʉT EUVEM]+HX M]11ҋ]9]sV]9]s kul7T7]9]s kulD7T7 M])ӉM]19Mt1E9t$E9t8uW t G0u)EUAlʋ}9}}y{9к 9ʺsbkEl}GËSEUu}+u}uuWV)9uE}u}u}EU)SE};xM] uuSQ$ы}ϋUʉӉ]u9ދ}|}9׋u}ȋU}MOQ)EUE@EE}EpxPEU19]EUC<S@9Ɖ|]C0EU9ƉE@9Erk9EkElU‰UM]) Z19ʉ|EXH 9|1ɋEHE0xP0tqP0EH0bEUӋEU)uuSQíыU2zk]lu΋Uʋ}TE0xEPuFV e[^_]UWVS@PEU 8lSPh 0%vWe[^_]UWVSuE ]ƅo$&h khPWI hh% %W S0pz t7z(u1hhe*%W hRW ,9u|h!pkhPW hh% %W S0pz t7z(t1hhe*%W] hRWK ,9uWhX$v [[$h":[ h#0[h$&[h%[h&[h'[ h(jSPhD0%v軷e[^_]Ã=`4UWVS11ɉ4P;ZG418t=suB89J4ƅƅs@14k8ƒ|<tcPhK0%jP4Phf0%hhh0%R h4PR G8u4D(~&Ph0%hWof hWV 4D,~&Ph0%hWVI$$?c)((@6,,A 1ɉ Phe #jS!T jSSjjjjW=[0SE ZS6 Xe[^_]UWVS(]}h~#uVN o4XYu81ɉU&MVPLgZYU9‹M}ƒ$uӃo4} E $&h3RV Wtjj5V_h4ku2~41RP tRPh#jEPS h5&tjjUYh6u)tjjUZPhX$jEPR h7t"u he #jEPqR h8t"u$he #jEP j; 4tPh2%h+i uq 4tVPh42%hiuK 4thI2%hh u, 4th\2%hh u 4DpC1e[^_]1US]1{u4{ t; |1C4v"{x[]Ã=d48UWVS`1Dž11П4P~Y5H471ɉ$;H QPRL t tt߀8tPR3? RX /thqF%R{XZП4 QRY( ZY9st6t-QWZWY99}tt$;H s41VWD П4$Vh_+%hPGC 5П4!#t"PP= XZtП4PtYVPh+%heП488  RPVhu2%he$tt;,($ PRPh2%hue$!PRPh2%hReu&П4@40|81e[^_]1US]1{u&{@u1Cԟ4Tt" {x[]UWVSo4H4xtt$u ƃxaPYt0$xtEjjjRt1PZu#o4tSh2%PF pÅto4tSh3%1=$4'04P_04p41:uJ Jt @ =u_k 4]ȋủ44BMȋu1k 94u94u94t Bu1҉444e[^]UVSMU194u4r94u;t = u1[^]UWVSGDžH41|?1$%$;p WVPRL } t} t!} tWVS jVSSx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ)| Fhtjjjjjj |}@Pjj|Ph0Ã4u1}?PS%S0 |9ṣo4k<}Ee[^_]US<] EjPo4ZxD1k8|<u$MȉHH4t5xt$h_Z0jY^tjjXZǃ=o4؍e[^_]UU=h4tuh4%jPO UVSuu1r$ugjjjVyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#hx&hm h4%;G@UWVSQ} E@E19u~aEX=ru8u?G8.=qu8u/Gx=luWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$ӌ荓$zuubPrYtWWZtNjE@ u WV_XWPVD tjVSE@ t VPZYVXjjSƃxo4 e[^_]UWVS] uUYP}Ĺ 1󫃽PuPZt苅P$V_xt2jjjVǃtVYt P$VPHHLd 1Zw jt&RjP8x u0h#h&h h4%DR@);uEu}Ee[^_]USQMAQRPRPjjjjU IuEU11ҍeY[]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]EUM E@,1҅t9t Bx@t@]UWVS}u EW,1ۅt 9t C1L?1;G$sCk G(1ہ8u3A<Ãt#A<J<ȃ9uȃB1t4Q,1t9E t @11tt:[]UVSQMp@19|h5%h&hh5% 19ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]Ã=o4uUhPfXUS]=o4u1;o4s k<o4[]Ã=o4uUo4]áo4UWVSSÃ=o4ut=;t6o45o419t$USF P9(ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h5%R'ZYuj juWC,S0h5%V'Y_uj juwWC4S8h5%V'_Zu0j(u Y^ƅj)P _ZFh5%Vb'ZYuEh5%VB'Y_u j(uh5%V''_Zuj`u@S# Oh5%V'Y^u>hA4#EP XZt(&>ttVP&YZuG C<e[^_]USPQRh5%EPj3~-h"uIEjh&P t2uz[1EhT.#EPb XY:tjME+[h"jaIEZYuuzX]UWVS1jhPjEp [ÍPhd@S @S-:EP,[1Dž Džƅ ƅ tfÃuCt=ut2Ѓ  uuЃ A떋Ex@uS@4tPh5%Pb ƅEpPh6%j3t1EE@@Ep0Et(pv0v,h6%jo3Vy1ɉH0X,t(Eps8s4s0s,h.6%j3vE@61C,S0Vщ‹VZ*H{09L;C, P{89T;C4 PCP( ^_;t' Ps0s,hP6%jU2s@\PVu#ZYt$Vs0s,hj6%j2q{tރuJtjaYj jV*G t*t t/j jVFKj jVF u7thhe*%P hVP諅   h7#VZYuDG8PW<G4&hE#V3ZYu)+h(#VZYu)j h&VP t򉕨hje^Xۋu0iY19ȋWi[j`RC@PU C,S0C4S8 u+t)CQ RPYZuƅu_, G 1E u賨 G1ɉOOO_O _$UWG@jhRjPfIƋ_,tjP4tKRPPs0s,VFt'8t"P PXZ@8u ǃC4S8)G W$q1ɉSh|dV iRW_ZugYSh|dV5 u܋1;s̋G,tpH,9H0u0;u"H49H8u;t밉jSP BuV'Z1e[^_]Uc@4t 1=h4]USÉIQHQH QH QH QH QH QHQHQHQ0h#RS ]UWVSEUPUfPfUP Uf@fEExstExl]uq>1ۍujVk&W臒 uu wu uRCu1jSk&VL u%u vuw uًU EGue[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh#V趨4 u}w1M9Mt ]K1ߋH X$9} 1҉P P$ )H X$EE}Uz=tVwAtLw"Q w=RX<Á@1HøUWVS։M11ۉ9uuRjSP07Gуt `d1ɉMMu]썜SjuRVPEЃc}t09tGE}t"MM슌 MtMuʋ0tt9tGEC01e[^_]UU 1tEMh]UEUUU ]UMEPЃ< u1tE0]UE1҉UU ]U EEEEEEEPU EXUWVS]xu,P4x1p3?J} @0P4x1p3?J} P PH1ҋuVi13k?] 319[^_]UWVS u]}1u܉]EPU sZu tX#8%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EEPEPEPMȋUEaE )EЙ]u)։]u]uEEEPEPEPMԋUE Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋuԉMʋEeƉωؙMʋEE)׉ t/E Et'EPWVuuEE Eu}tE}}5E؋EؙRPuuEU4DH~1ERPWVuuRPEE]ÉUӉыUe9E1EPEPEPMȉEp xKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9ZXeY[^_]aUE]UWVSQME܋A1҉UE؋E܃0EE1Ɋ t.}uÃt&<t" ,1ۅu9ut@u0Eu1ƒ< PWEpWMUE{11҅xE1ҍeY[^_]UWVS,U$}(E,u01ۉ]]]]]]1ɋ]9ً]| E1ɉM܋]]19U}U19E}E1EEU ẺUЋEHXE;E9ME0juQuMU]M MȉE@E1;EE }H1u}u uWV)׉;u} M}EE)9s U)‰U1҉UM1ۋE1ҋ};}}܃}uu VN^ Eډƹ19 Ee[^_]UVSEP$9p |$1jjjjSQSQjURP>,1҉Ѝe[^]UWVSuMU ];k _(u/ȄtaB 19t Bu,1u.R E@M,9du 1dd[^_]UEUUUUUUEUUURU UEUUE1҉UP0UURU UEUUEUUP0UURU ZUE1]US]MEE k B(u#1tAƒ<!Ѓ;ukE U1uQЃ<![]UEUUE1҉UUUR*U UWVSÉ΃8t2$41jVRp $Rh{dЀ3t jhPjRx7@ue[^_]UEP0RPdUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@u}WuSp yуtu G{0Ea;hh ZYohSLZYa }U׍e[^_]UWVSEX01҉U1Eߊt]}tttR<tNwtw A,<vy o4CFU,U9u o4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU Ph 1]UWVSUE}u NtGtRutG_tvpS GPh%vS FD64t(vtvPSg e[^_]USR] =o4uj EPu ƒ =w uE8tt hJX1kD`4d4u]U U1vEEUEPDU E7ZÅt*UVS14LFZuSLXe[^]UWVSQu>xp19|h8%h&hxh}8% ]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`Uډ@8;FF| FP1RPz~ tjURjVPL tWEċUȉḾ1 u@dž9|Ӄ!lj! t9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E E th7%h&hh}8% hjF^_`&u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP@ǃEPuO^_t!ẺEЉEԉEȉC1҉ ؍e[^_]US]=o4uF1Ҹ;o4s)=w9t kD4B1=w kD`4[]Ã=\4u ^X4UWVSƉ $41󫋅 EU RPVhk5%h4P E jhPjV>)xShydP @u VnX1VcjSua e[^_]UWVSlu] E EE$EEPSV EP^ډzXE8t%E8h8%h\&h h}8% 1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}t }t#1A}tPh54%%uPu` "}tPhx0%Ph %uu, ؍e[^_]UWVS8Ɖ˹1jhPjVK'1ɉDž11؉1u51 RPhSK =|e=ZbƋ!!Љ u9twEXH!ƹLEXfUtƒ<<„t <uh[0101ff=Ut f=u(Ћ,D1ɉNu1󫋽~wRXu[tO ttGEt%,MPP,1RW6P Px rt6t%F,dDž $t tW9,sAu1hjG>^Zt1ɉF1*1҉fX1u1fǃUe[^_]UVS0E E th7%h&hh}8%7 hj=^Xu1E u葁 CEUY~11ɉKKCSǃ?ǃjh>RP@ECǃ1҉K0SUE^@uSfAhރ{ u_C$9S }NURjSPL t;M܅t4`4t,`41@=tD9u=uSXe[^]UWVSSMӅtY0uƀ1҉8,0)߅uU,)ƀX[^_]UWVSP}U] J3ȃ<tu&`t$[choXQ1EEJE,K1CB C 1CtqE1ƀEDtP?1҉TY}`t01`1ɉEǃ<t}tAu1ɉM1EE9`uƀ1҉vN09MuCt:8%29Mt΋0ukE00,09u/1O0t0uu 10M`0 e[^_]UWVS,É11@jhRPSyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< 󥋅EE 1h1󫋅,t20t"uh#h&hh}8%  u/ƁƁƁƁƁƁ} }t~1É1uvB? ڈD>1É1uvB? ڈ49 fDžU1 uAWVhPx30J12XuWV)׋1҉!!S39uE9u=H!؍SS:ș[9-9!bX؍e[^_]UWVS]EuhF9%h&h .1uEE}lj1Ʌuh.%h&hh}8% s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{1Ҿ`4`4tBt D9u3{u}s{ u}u}u}v}t L4M1;})ωxMH PC u hdl"kE UP XZ܍e[^_]UWVSE }Ĺ }Put&`4u{}1ɉt`4t_`41 hZ9%h&hh}8% D9t Gu]u1ۉ]]]]E1u)Eq9%}vuuE}t8tރtu݋M\Z]1ɉMZ1]u뼋u^0]M Mt3] ]tu$}rEdu uXM]M9M]uUMUMUMM9M]uP @x|EUx|EUE9}}}EE`ut.1EUEUE9EE}}ދ0Ή1}9}}U|s1EUEU,Mp1t1ptM9ȉЋM|/9t+E9EE|}E1hj1EZYEfǀUƀEEE1҉RPtpu9uu|H1+EUẺUЋE,ujPE}܃ t"49ttPR5Wt 4Y_E0Z}w1u}RPWV)׉E9Ɖ}ME,}ȋ})1ҋu}׉u}uĉ}ȋx|9E}}EU+EUẺUЋEujPE}܃ t"4t9tPs4Wt 4XZ0}9ugucE,9EE}Ohj/Y_uEcL4}},fǀUƀ0Ë0}00UMыE`E]}v& }v}b}X]puu;u}ʉUHX M]EEjREpRMUEEE1ҋ]9]ЋuEEM1ۉMĉ]ȉ$tuNEEE1҉UH1ډƉuuRP)׉}9ǃ}U1UĉEȋEċUȉEUEU1ҋM]M]9ȉ} +EUẺUЋEp0\EX}T>uuuE}܃ t3UŒED4Ut9tP2Wq }UD4_XE\FhjjPԭ 1}?t;_uE@EuՋE1EE1ҊG9Bt<utE0E}tbExt99BEXEtكt&t!9B1ɉME}tX̋E돃E9\=,ujSE6}܃ 49P0WKp 4XZЍe[^_]UWVSL]E EEEuC,t)uC0EMċUw-:PX{,BC0EMċUHu1uĹ 1jjjj1RP1ҋ};}}EURPjEPS,tEUEĉUȋEUẺUED4jVSUE uaduVh@&suuuus&C,u*E̋U19}'SjRPuus&C, X({,tˋC,tPC,e[^_]UWVSdE}Ĺ u^0]H`4`41@=D9u€t 1ۉ]1}t ߃tu‹};} uE@uǃt"9t}hR]QEEM1H1EUȉƉSQRP)׉u9}1UĉE11҉uts;E @˃tuZ}`tMt;E ti@EMt˃tt9E tA@E}uы0Bp}t E9%E}U1ɉMEċUȉEU1u9E8ƒt<E`EUEUЉEUMEu49MEEE}tIMtƒt6<t2,AE1҉UI1M]‹E9‹EU}0n]уtt@uh#h&hT:u09EE}}h}[UUűEЉEuEEE,EE] E9sEjQEpuMUy}$E%:%]]1ɉM1҉]ĉUȋE19u֋M}ẺUЋEuuWME]E EE t];u ǀ]܅t'EDt9tP*SFj DXZEt uDEt ]TE9u/Eu;hjjP2 E̋UЉEU1҉}ttBuh#hp&hl8EM]M]։u1}9΋}})щ h}8% E}uEgEe[^_]UWVS]uh4%h&hk h}8% Es0h9tSME M9u㋶0u͋EtP^C,t PY`11d(FZus(X]e[^_](UWVS}G,t PXjhPjw= Ãt7WjR$YXtRVSVX(SNZWXe[^_]UWVS\E0hq_E0he #jP]SI jPSSj St Ǎ@^>w̋E0he #jP]S jPSSj S@ ƍ@[=wʡ4EHDEU}~ E1ɉMRWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu=~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480h@%h}WuVEPS$xuuuh@%hWVEPS>tuuuSЃS,e[^_]Ujj je j PUS- P $!#PSh,;%h-% j U=-u J-4fPftPZ9-UWVEE왉U1E}ujEPjB e^_]U0E E1EԉE؉E܉EEEPEPu ƒ xEÍL$qUWVSQ@@u5jh44O 44h4l444XZjPN h4l4x4|4+44_X49}944s74󥋅441=4uhjjE(t!j$jjV =4u`ho"P贴 `4Y[tPhX$hPӹ xp4t419߭y|%ݝ݅ h%߭ٽf f٭۝٭y1d~dVhaq$)P=P! Nj4~-`4t P Z)Å~:ùdh!#)Sh@&Phhq$)P=P軸 ǃ119ʉst @u4(&SQhrq$)P=P] +44+ 4y @Bx%ڽ߭ x4|419ظw ȉ߭%s9ٽf f٭߽٭=ٽf f٭߽٭É 9ǿs tA؉ݝ4(&%11d PVShq$)PP跶 p4t49ljx4|4)ލ 9lj݅99Ћ}hq$VQ à +h4l4߭߭ٽf f٭۝٭?~~hq$rtPh"VQF Ãhc*%VQ3 à <ЙRPhq$)PP Ãuh")PPд à 4fPftSVP eY[^_]aUS j X]UWVSPu ]Ett v9s 71;uuߋuE9s$;ut:GFFPh2K%jW! ؍e[^_]UWVSuE E1tpH-td:t_ tZUx}HM=-DWtDOt uxu 1!tjjEP2  FCE덉뉉؍e[^_]UWVSuju=ZYt&Vu PW9ug 7؍e[^_]UVSu huà @tuuSZS؍e[^]U|EPuBG ZYtM EUQ1UWVSEE 0Vj S8 DžuVjS& ƅtu)@))։NjE 0E8 uC t  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U <v }D&7Ep V趹 YƒwCljt)1E@EȉC,ub Ex txj(Zu h&M3XYǃ,f@S(P1.1;,s$k(рyus1(D@4u e[^_]UWVSSƉM׋ttU9t7{ t1 ufujuP9 t[뼃 S Vh=%~2 e[^_]UVSÃHt1HL~t9 HXP* 1LXPt1PT~t PYP 1TZ`t1`d~t `XP 1dXt/tV1I,X} 1҉Yt/tVH,XD 1Xt/tVH,X 1Xht/ltVH,lYh 1hZe[^]UVSTjjjVmD@PjVj48@t@сt t t48SVQkXZe[^]US]E ftPh&h<%/ jP t(@t / h&/YE u1҉U E].(Sh jPe#@uE &E=%]I/]US]E ftPh&h<%7/ j|P t@k v|y U 7`x |>xYZt>1҉Sh7j"@u;E &E=%]x.h&n.XE E]']UVSĀptQPhhxVS@u h&.XV ShA=%- e[^]USË4%uXhm=%S蔔XZ{PtS0Ytp%tSLtc=%Ju+#PSIXZ]UWVSÉ׉΃t t%u=%t1PS迮S]jS`Au}=%t#PSXZe[^_]UWVSÉ֋8 Ph=%,1ɺhXZu=%VS蘓Sjj$1ɉK 4%ujL%XZe[^_]UWVSUM8tt^@@tR{ tGu}  t1҉CXZ[^_]USÃlt1u?hvPplPh=%+RPXZlu]Ãx tkUSË%u6SC% Y u=uSmZ S.YuS؜X]US]S8Yuj#XZIpQpcvPh=% +j#Shjdj"]UVS]E ftPh&h<%* |)RxPa uh&k*X;|t xD8t|xth8- H 1tf @-yh8-j A Y^8-P8- Sh j@uDE &E=%e[^])jXZu Ee[^])"e[^]UVSjhm %ZYuhm %h-}#)[^"VP$ZY@u Vh=%(ZYS$Xe[^]UWVSPu~ % tVXtpE&%Et%`u VYE%@u$t+`u#V+Zu}V+Xt%e[^_]UWVSE48ځ` u %t8tf% tWYt ߉%@ tWP+Zt 翉%` t떁1u ځ u@\e[^_]US];(%P6(jj#jj#4]UVSS]4@tp%@uft0t0VY%t1҃w@&R Vh=%&SvSZ%tw4@&Vh=%W&[^8%th=%e&jN Shj4u^%@tTS,-1ɉMjEP,־@u h&"&Z,ǃ,Xe[^]UVS]h,"&48с^t:t0t~ u h=%VwYXvj\XZe[^] @48]e[^]6UWVSD]u Ctt,PCQPhj@EP耖@uh&E%EYE{ VEPW3buVWh=%$ {EtSj@VCxP VWh>%$3'`U D@RWP_Cx3_UXZe[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3^UM   t*;xMu;0tQh(>%#11҉[Y^{ tHEU  Ѓ t3 Z@uh&#Xe[^_]UWV։ϋD@WVXZe^_]UWVS]%t S &_u ShQ>%"Y[ % ڋFEj EPju{ }PWhi>%"M1҉1;,sYk(jQMu) Mt5j EPjQEPMAPuhu>%#" MQ~G럋 Sr3Z@uC Ph>%*"Y_ t{ uS@2%ZtSudX{ tS5_t>{ u8u %҃RS}ZY@uC Ph>%!Y_t { uSjZt]e[^_]e[^_]UWVS(]} uS$ESẺ{Ls$S$ ({ }u }s uJS蛣Yt?Vh>% S{SdS諤j3XoE >%]e[^_]nVh>%f hc=%SX11҉ 9C$u/S#Z@%ش 8E&e[^_]G jjSn"SH#@u衴 8t h& _1EE A]e[^_]2"}{ tC uPh>%Ph ?%Y^{PtRStCQEЍ}ԉƉщUStCtZU9uPEPu' t{ t911҉{ t411ɉh+#SS+ES6]e[^_]e[^_]US]C Pt$ZYts$sLP ]]n UWVS];1{Ly)tC$tjjS 14%tutEC$u?tS!Y@u hx&xZjjAS @u hx&]X]e[^_]US]C][]3UWVS ׉΋U K 9}!E4UQM薤 YZMUtB;u t9{ ;u u{ t|EUh?%S_jjM%tuuS %tS薞ZSKSX+9t'C jjM$S [e[^_]UWVSS] 84%@tjE1҃ t6HjEP,J @h$&h<%_tm>hUr%he?%h;?%@t+XRDAtxUh+?%h4?%h;?% Uh+?%hK?%h;?% 1UhS?%h]?%h;?%p 11hl?%hu?%h;?%Kt [h}?%h?%h;?%<J@ulh?%?Y_jjjH KPh?%3<4u544%u dW4XZe[^_]USS]E uPh&h<% jEP,胴 uh&j4YuZ8t$h&h?%vj,,3ǃ, _w$jPh&h?%j6U8tu h@%mYuSRXZ]US]E U{ u)C щ‰ { t][]~[]UWVS ]]} utSEtXZu w{ tC Ph%@%<@%^_CStP }tQSSh[1pEPjEPu Euh`&YASuxXZu$ ~ WEtKYXt3{ tC PhE@%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh[@%11ɉtY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu ؍e[^_]UWVS]DžPPhh@ @uhL&ho@%)1XZh~@%%Y^1hPذF1׃ u Vh@%XZu3 87t) 8 tt Vh@%^_\XPS+ǃuhL&r[ttlHp VW ZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ3VhWtPtStPS| e[^_]US]E ftPh&h<%a S躡Z@uD让 87u ]]蘩 8 t莩 8Vt脩 8tE&]]UWVSD}U uMtNˉUMPV ZYUtOMv_) 7 }E 8&E "e[^_]G(1f9u2W>G(1f9uW>uxG(f9t& tʉUQPG Ph@%UfW(W>8uHUPVG*Pn  Utn uG>j u G>T tGjt G*ˉe[^_]UWVS,}E EЋEE܋EE؋h?A%Sޙ ^ZuEE IA%+hPA%S轙 ZYu,EЋ@0S ^@E] EЉEe[^_]h`A%S耙 ZYEhpA%Sh [^u EЃHo1E9}E4蝘 Y\FSEZE1ҋE9}?E؋ UQMe Ɖ$MQu )KEƍ@E UB 뺋E@uhyA%u-1-E 1E111EEM̍EPh&hA%uumMtvkt@(NtT4tW6uE븃UuM@몃ptxtnu딃M뎁M녁MyoEc-E%@4@E܉E1E11ut0tX~ tMڍN U9U~!E4UQM蛗 ZYtUBM9]uuVju EvjEPEp g uot0tR~ uvڍN U9U~!E4UQM ZYtUBM9]uuVu:u @u414E@t褤 UE%  9]u%}uUMhjQt8EE̅x ލW u9u~E4RU9 ZYt FUEЉUԋEU E Uԃ}t}t}u}tM 1҉EЋUԉ/tP9]u>t9[E4tY[tEX]9][tSu؋M܉^XZ9e[^_]UWVS] U1{>tNf}fC(ffGfJuj ȋuFZK>s*S>+Ee[^_]UWVSu} lhu?G PhjI%( tXZ{>u[C PhI% XZ1hDPWhohnRPhnR辒 =nwHƄn ƄoPRhhv 軚  DFu EPj! @u11EEEE1;s4sjEPC04` @tF1e[^_]USjPjo[ZtÍ@Pj? ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tg>U t9FuV9u@uEFtB.NtH C1҉KNt RKXVXs@1s@sDCMYC t6HtJKHPڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]KUWVS]uChI%hp&hhJ%L 4t,4H44C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t0zLu%1t]UWVS\u~>u K Vv9 7EEEE1]Mu EMQUE UJHOuԊEEjPS&PF PhJ%F>PSVk}(u V*N>׉e[^_]USEtSjS[ ]UE t E]= ]USEtSS[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV wmj:V Z ZYDžt?EPjhjjj jGP p C8 }tv UC8jVCP- A DJu <:tFu}Wjhjjj EPVo C0E t/it.u#Wjhjjj j@PZo C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP虀 ZYt[u{` 1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPkjURWPVsu juD(C*WtE4%@u1t(SrZ@uh7K%AS SwC@SzvfCDCCHSu @t CPCHC pSHuCL1s@CX_XnƅRe[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[L ؃4[^_]& US]S_qZ@u:jhj @tjhj @؋]UVS t=΁u$B Ƅ Ӄt ӁtӃuӃ uӁu [^]UWVSljQ Zuh8&LÉEhA4#EPS ZYtfP Xuh8&S[_LUj@PV  Uuh8&SUR q7SXe[^_]UWVSSƉϋ]jhCK%RU UuA}H} L @ð`jhGK%Ru u>MP} Tð0M@} DKS0CPp}7uMU E$e[^_]UWVS EӅt΀9uE1҉1j/QFM Y_DžuuV} _ZumVhNK%2@EEPjj jjj ju+c }tuheK%2Y[:t SPs[ZuuV\} ZYt/1tE0Xe[^_]UWVSÉUQMs YM<9"u"OAIQMjիXZMt3t 9us 7QS螫Y[1҉U}u9tEtCE9KEp9ush5#S l ZYudžEPjjjjjjS }ShK%ZJEPjhjjjjSZ F }ShL%8%EPEPEPEPQEPEPEPMԉډ 8%CEPEPEPEPQEPEPEPMԉډ jSuuuuuQt Sh1L%fjSuuuuuQujSuuuuuaQ볁111otq;tlj/SB Y_M̅tU@j/P_B _ZDžUuًE#ًE/*O1t1ۉEEEUEPjjjjjjS蒠 }}ShDL% )‰U썄jYu haL%R9  T uhkL%oj,SA _ZDžtxu ShL%V9u:K j@Yu h6" t%Ɔ EPjhjjjjSV E, }t hL%_ )‰UčEPSp _ZHUu-u 7L U䉔) jWY ]̈ T <4t{4u  ;6t{6u @C빅EPjjjjjjS6 }!ShL% ~LHL+j,S> _Zt Se P U$U[YUShL%RPR 1ɉW贺Y}Eu Ƈh5hQ%S f ^Zu ƇhhM%Se ZYu Ƈhh/$Se Y^u ƇhSjbE^ZPl跶EZYuhL&^lSP#pY[{u Ɔ 1kh"SBe _Zu Ɔ Nh%S%e ZYu Ɔ  1h M%Se Y_thM%Sd _Zu Ɔ ShM%pt$ jٺ@[u h.M%1 EEEU | m^O@8%'EPEPEPEPQEPEPEPMԉډ jSuuuuuJjSuuuuujJjSu8%EPEPEPEPQEPEPEPMԉډ jSuuuuuILjSuuuuuI*jSuuuuuIjSu,^j=S; ZYu h7M%@Ej hRM%SB up}u11҃uM#EEEUIj h^M%S u}u:1ۉjhkM%S u0}u 1ɉM1jhM%SM t@jhM%S9 t,jhM%S% tjh~M%S }u'jP%XZWEEąuhM%OE@MEM̍UE@u E "M1ҍE@tE WB#XEPRU2EPU̍BP2EPU̍B8P1WURP%$1ɉjhM%S }u'jP$Y[BM1ҍE@EW{"Z61ɉMURPEK1URE̍PR;1EPE̍P8R+1WEPPH$$1ɉjhM%S2 tjhM%S uB}EPjjjjDjjuu }`uhM%j hM%S }uߋEj/u67 _ZDžtSujz Hu_Sujz HuOƆEPjhjjjjGP迕 }t uhM%uh N%11Ƀ}^ٍUE`j/Sc6 Y[uEjP JM JM ٍUEsj/S5 _ZuEj P  J M J M \ETPT'E߉EEUEEEU  %EEEU Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ Ɓ DžtG1ҍEj@P   JM ^Åu  8%t EPEPEPEPQEPEPEPMԉډ jSƐVuuuuA" h 8ShN% q $IS $Y[ hL&> 4%tu hyN%fF@u ShGN%  s d X @I : + uhWN%V EEẺUЋ4%t%E̋UЉ1tt hqN%E̋UЀPt @_t1j/S1 _ZDžtGڍEY@uShN% 1,E̊EE19M k(Pu*t,Uf9Pu#U8uU8PuU8Pu U8P A밁  K  @ED1HEL PETXE\EċE18E1҉uZ }tEHM Eą hN% EH$MH(MąuhN%}tdƅu ShN%r EPjjjjjjS }t ShO%C FÅtMhO%k1uLƅtFj:S/ ZYt8URjhjjjj@PoE 1}̃}t'h'O%j=Sl/ _ZE1ɉMt@EhMa$SǯZYu)u h@O%p0h Y%S药Y_1utčphXO%S]YZu( sPu haO%Uph#S$YZu(:u hzO%ph"SYZu(u hO%phX%S貮YZu πEhX%S薮YZu @)h#SzYZu  hX%S^YZu h"SBYZt-hX%S1YZu hX%SYZuhX%SYZuhX%SYZuyhX%SʭYZu`hX%S豭YZu GhX%S蘭YZu@.hנ"SYZu hX%ScYZu hX%SGYZu hѭ$S+YZu @hX%SYZu @hX%SYZu hX%S׬YZumhN%S辬YZuThX%S襬YZu;hY%S茬YZu"h>#SsYZ t ShO%7}tuShO%XZ1E s!t@uhO%Xs }u hO%XuSh P%urBth#SëZYtS Xu 1E}u.j,EċE@PR uBhL&#V"G1EMċ 9sM9 t>{t8@,9tt(MMċJ]ĉ k,1CC C$C(S_YE{ECs Cǃ}t uQ ZEủ)1 E}t5E- }t }EEHh+P%`" S<^ud}ShEP%@dMA2Džt @hph%SP ZYUĉMȅt"hjh%SP ZYthD%SP ZYuEċU ẺUE%E̋EȉEЋE̋UЉhP%SlP ZYu\u haP%30uQWjMl HRhP%PQWj!l Hu؉߅ h%WO Y[thP%WO _Z@   jٺ[u hP% nbV@JEPjjjjjjS. }ShP%tzEPjjjjjjS }ShP%QtEEPjjjjjjS }ShP%PYuhP%XZjE@P(N i(,P,k4EfFFE̅tHEEFEFEFF}u!1}F1uFj/W% Y[Åt/uWji HtJWh N%1}_X/uWji HtWh N%}̉XZuf~jCEPjjxjjjjSUF }CShM%FY[-e[^_]UWVSEu} EEEE1ۉE싀&tM܉UVPL ZYUMtCnuFE샸&uu u E#DEEEE} &EEe[^_]E8%uu E1L%e[^_]e[^_]UWVS]}1-} t]%E苃%`E?EPh&RuuЎtAjj5 7PًU E=ƒu$E8E%A%tA%뢺} t*%Ƌ䟉 u }쉳UaUЍe[^_]UWVSQEE] 1 t 8t R舟ZPX1t 8t R]XPTXEtu7jVu| *$@%8tjjV txTuxTjP僻DtVr,DX@辞HXLtVE,LH蒞P_TtV,TPfXY\tV,\X:(/XZ]e[^_]e[^_]UWVS0uhdj虙ZYuh\&X9Áǀǀǀǀǀ@ `h&P48Y_tt %t 4 4up4@4jjj? tP\ 4 4Xjjj tP\ 4 4!D_ 4 4ЃhF+P P =v1 1ɉ} !8%j,jڗ@_Zu hl&!Y ǃDj,j讗H_Zu hl&Y ǃLj,j肗P_Zu hl&Y ǃThh&WJ =vhl&hQ%XZPPZYhT.#P# Y_t u-PP1҉xWE ZD9t t ux\tH@ߋ@D1@DHLPT1HLPTXh\l1X\hP0V*9u0hl&h " ut=w@ƄS0V 91 1} 11PP}YZhT.#P! ZYt u t:RD YD9t֊ t uʀx\tH@߅tC%䟉1hG9$D YZ} uj`@Pd u>ju P d` Zuhl&_G`hK%wC ZYu;}uPPC Y_$hр#&C YZuA}uPB _ZutDž}tuh3Q%B ZYtOPPًU mDžY1ɉLu}tSV$P XZ1+u؍e[^_]UE E9r9]UU19U t]UWVSǃEE1fUfQMKZUu8؋Msۍ;ƸE9EsOƋE)Ɖr=89s "@G19r)SEЉ‹E9s )։1e[^_]UWVSSU uJTuhS%h&h~TuhT%h&hhS%oH YLGL9t)cCu)U QM<W<ZY8ËMU t u7F|B|u t  tAH+GHu9r9e[^_]UVSjjVà tSV1S襔 ۍe[^]UWVS8}1}عEX}ى‰+E pE؉U EPW_ZuUBtt U Btu VStZYe[^_]UE UU E]rUS]h(&Ph&ØS]US]S Y1t S Z]UWVSuh U%h&h hS%F Ɖ׉j<|QS CPZtS8j'@ /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh%hX&h{uhU%hX&h|hU%O9 Fu#<u;FuFPh[G$WSA @u612WSPFDPhÃVWSPFPR Ã؍e[^_]UWVS}] uhV%hP&huhV%hP&hhU%8 GS8t)R78s<t<t1&vvRS Qx e[^_]UWVS(uuhU%ht&h$FE<t<FVU1TF1 G!)JO9t= B@t8t}19sF8}Єɹy$At}!u}@]9s 8t1s= /^1ۀ=4uV}ع1E׈E4S}W=WV&thV%ht&h'hU%6 4؍e[^_]UVS]C<t<t< /g S؉U Y=4t154S6Z;E th5V%hd&hnhU%O6 4Ǎe[^]UEU uhU%hD&huh)%hD&hhU%6 fPUWVEu uhU%h8&huh)%h8&hhU%5 fe^_]US`&tPhOV% XZ]UWVSD1}]Sk1Z@j0S_21uuuu}WS21;5 &s/$&H>v c;  DF1;5&s/&H>v *;  DFWS 2; 1҉u uSjE0EPםƃ S1YEt : 0e[^_]UVSuEPu V uVj ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWhWV%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh]V%h&hC؀xthV%h&hhqV%3 u1X9s%UjKQP t؋UGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`Pf~XZ- `S X4%@t _t^Fhw#袢YuV%PhV%S @譿 PhV%S @uWhV%S @dlhhV%W* YZu@htDžphxDjVYZuGDžphW%W@* YZW) Z|6h W%W* ZYuDžphm=%W) ZYh+#W) ZYhc=%W) ZYh>%W) ZYh#"W) ZYh<@%W) ZYuh=%W{) ZYpDžp Džp_t@F PhW%SY @p,&tPh'W%S2 @84t pNdX#tW%Rh3W%S @VLq%t І$Ju?%PhDW%S @ZvHhQW%S @BFPPh]W%Sq @(v$hkW%SY @VPhvW%S=@~Pt?vtFQPhhtR@ttRhW%S @~xu=4%@J1h&tP8tXY#FxPhW%S @uRz u RuARTX,QXtP ZYX9TthW%S ZY@jjtP蒫ƒ ttqXjjPs X9u-BTX PhX$SN @XjR뛉Xhe*%hX$S# @Xu^jPSji @Dh=%WZ& ZYu-dXW%#hV%W& ZYhm=%W& ZYh+#W% ZYh#"W% ZYhc=%W% ZYth>%W% Y_twpulelxOpu VZ;puh/hxDpjVkY_#W%#PhW%S9 @WhW%S# @VIuZ%u6u_%u*PhW%S @ut:u%uߞ@t>(WtY%uPhW%S @ubhW%S_Z@Npubll@lq PVh+%ST@d+%h@pt!pNVh.b%S 1huvh@Lt㋍hqPPVh+%SI"@urpt)ptptVS'ZYpujlt l@u1d lqPVh.b%SS@d.b%QNppuA 8tV _yhpHpDVh.b%SW!@WpCPhX$S @tXd 0uS S轾Y^u h&賛Z#_tFP`P u,h&胛X_Džp؍e[^_]UVSË2;tPSe e[^]UWVSQ} utu=GLc=%t +#Ht#"}tE1@ۅt"a1ۃuZ xut@xt:HHu 1HH}tE-@uCt WcZt!CE}tW%EE@t]jW[^t WYuu"Ep}t W%Eƃuًt 8u1W Zt^}t8EgÃuˉ؍e[^_]UVS]u tPހ~t9. :jhW%S譲 uS / SW \ZY9rh8-D X1e[^]UWVSEE} u |Uƃuh&Y[jhW%W uu Ee[^_]E1҉UWPE PhW%5EPFƃuuh&h "x jEPVs3 @u , 8th&hI#=1ɉM^_EuƒutSP ZY} -];уM I+ѻ}hA4#EP ZY;tjhGK%S ujhCK%S uu1;}1u1;} uJul& [EPjjjjjjS,O }tG,9uSv  ZYEPjjjjjjSN }u9G,nFul{% d!ukX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9!1E؉EErE,@x i$ VuQ9uuR$ "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms # 7뎉ߋM_.MIE)M܋E9,}v# M}}9]ttC }Ut;]tC } t}E[^_]UWVS u }EEE]1EE9EEEPs2&&Csy7Ku-y)‹ -DAt/rumr^s ‹ -DA@t" t\tFx+B -DAt/t U2" Uu=k" t#w " 7f\\Ev\0C0C0SEttNCEqt(tsExu EE [^_]UWVSÉ׉U.ƍPSNoYZ@WhX$S @}uSj= _Z@u$p h:"S @u@ s=Vu hV}^P~n sVu S?> _ s Vu SD=  uC V* t.Vu PhV@VhX$S?shb#S,ZYsE1D0t<0u FuM )tSP Y_@u|u } 9K;} u@tPh%Sj w ^Z@u3tPhe #S @G루tffPh%t&ffPhe #S @c t Ph%@tPhe #S t%7jPhX$Sf @sWj.VWj1 tcVhX$S* @tQ?tGuUWVC*PF U[҃VSTm_Zu VSm[^tRXZRYtPt蕉rVS舌_Zu VSZYtX /1  ؍e[^_]UWVS(E̋A tӉ΀ytu xVx}WY@$1FCt}ЉF tCUfCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPEtq_ZF tU tUԋECTt14~t  h%Et܆CTZYuՃe[^_]UWVS8t, F1Dž@jB UPPsfDž ˉhPhiUp UJ>r*hPhip ,؍e[^_]UVS1ƅ@ CtDžC8P^CPƋƒYu9)Zu)CT@fCXP5_u tЃtЀC| t Cxt(1ɉ,uCT1fDž @fp׉މ;tHH tut󥃅 T upVXZtHHt'CstHHt󥃅  t'CXsXtHH)fSP @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP_ @OHuWfSY1CPWOXZ$jjVSjLP @u 8 넋H؉@D@9DDx9@sS DD9@r׉F u]dETuGuSXu hh'wX?$RuSU ^_u1s 7CXZ]])CUE@u(1ҋEu@th~B Ep ZY@UWVSM}]utDw 7 .E C[UU +29s "1.1U 1ۉ19t9u} A,[^_]UWVSS1҅tƍ<}})v ~kKu)f…t‰Z[^_]UWVSEӅcSct- V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu& Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRQ=ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t r*Ys\1C\ ]USS`t RXs` C` ]US]$S`>XZ]]o@UVSË%tJC><vBD&FTttT9t0t&NT9JTuu Z: 뻋@À{>v P Sh7[%Wc e[^]UWVSÉ։h,j9ZYt:PǀcScufǀ,1e[^_]UWVS0ÉRi^@u PhO[%qbY[.Gw*hH Ph][%Bb %th, Pj8XZt@dtVWv<u?(9x u1Wt cScuGhu @F @(GH>A<wO*󤋅% t&x utmtdf@ tStJSjjPS*V9Ѻrf‹fP@TȋG,CD7LJcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$tQ~DcScuHu ~<u|t2<t&)ڃ*f@6Vt4L7Pu"uJƃv9C,m@1;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃f9 ffC tHGY u<)9dCM A 󤋵 \ tC)9C= A󤋵 \tIt @W uD@Wt"@W uv tD)9UC< A 󤋽 \ttRC4%u+@t@Zu)؃fPhP ƃ tt)߅tPjVPYY9qQS  C{fCWVY^g0Q COt/t+VG Z@)9 CKt tRG%t4@^u()؃ftC uO t>P)9rNC A 󤋵 \C))=+w/D@ Ph[%^XB3 e[^_]UVS~\jhPF\ uFo 8u!5 -h[%WY[ Sh'h "W 1ShjpK@uh'h=%WXZ1e[^]UWVSE}uh[%hd'hh[% Ӊ΋S IuN EEE싐%tZt Cts mjSu@ u3@C CXJP S@p@P& Z J(H J>r*󤋅uK%t9 t/hQQ@PoPB Ph\%8B>u1DhQPB*P5P Rh,\%Rh'GSXe[^_]UWVS$Ɖ1iu1h@\%Rf-Xfth$SPà 1GiPV RhW\%ZRh$SP6Ãu 8t8iW Vh "R!w h' Vhm\%R 1`64%@u"j5S,Y^@uƅS$Zu h' RX뢍lj󤋅e[^_]UWVSS]Sj8^_t]u1ƀ8tCP9$Ztlje[^_]UWVS$ϋEE Eh\%R ZYu}]ƅP1 $#Xۋuh'QYuQVhRSV+<@t-PPuk XZuE'e[^_]P1j6j4a@uƅw x,"j@,Ph@hW;uWPh"WPh"SVh\%N$v"t$u)貃PWVh\%yN(艃PWSVh\%ON ]e[^_]C*UWVS] 'tPh1# XZE1E;s31;Et k, 9t@v 6h\%w PV膹G,1;uts 3h\%Q PS`F,܍e[^_]UWVSEvpE E] P1}tEu苂SPhT%u @tBE^PhPh!%ub @t E9sT;] us< v! Juj 蔾 ZY@u؍CT9UbW "uj^ ZY@te[^_]UWVS]u }~EHt t4PWhV+@uxVhX$S Ut" QSj ͽ ZY@tǃ7OPhX$SK @tE)uSj蘽 [^@us 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hpuԋ@E܋E E@_tE@o^'EPjyMԋU܋E 5^XtE!#,EPhMԋU܋E Y[E\%EU1҉Uw|MUu X1E}UċM1uGEEPSuEPCPhEPC8P[Suɖ tEE99w< v YЍBEȉD9EM "1E )уȉEU@t~TCtE@Tt 1ɉMEPj!MԋU܋E XZt؋Euэ<1E9ECEtu :Xu EEU9t M;At;A u1EEIʸy,%=tс1utȉE@uFtEPV֡EPFPɡEPF8P輡Vu* ]E@PEPjMԋU܋E Y^u1҉UU9u XEEPW/EPGP"EPG8PWu胔 ]뤋E؋E%u3E @hu$uЋE Ph\%iHE؁ Ee[^_]UWVS(}ƅj4uM{Y[@uƅEXuX uExlSo|Pu h\%u@ujuMH^Z@t'^1Pu h\%u誡@u-S1P{Pu h ]%u@ujuMZY@t,E#pV{Pu h]%u:@@ ؉P{Pu h4]%u@ut Ex,u@GhElPhhS@Su hL]%u趠$@ut 1;j@E,Ph@hSSu h[]%uf$@up;s VgC,X鋇@1ۋ;Ds V>C,Xh1ۋ;ls VC,X鋀1@D;Ή⋍T1P1ҋ9tk,;BፕRPMU[XtxG SVhPu u7裼 8}u@v;WP诱ZYt*SVRhPu u7X ,1;Dsp⋍TPuARPMUZYt&PhG Pu u7л F,낸e[^_]USEtE.1CL[]UWVSujh0juR t)Ej}WjhPlm@u SX\jWjjSMm@tjWh@hS4m@tȍU1EfEDtEjRSc @t؍e[^_]UWVSQÉU0!4%u|GtOI9Hu Et` GdPG`_uhX'CY؍e[^_]ShC jP6@uhX'h=%BXZe[^_]W|$wUWVS?E苷EF$E1FH~ t)vFFFF F FFF1ۉ^ ^XNvUE䋀_ ƒYt=Ep+Ev$YvURPShm]%AF0FH]%%t$v$ vPSh]%AF0FH]%7~@tFH]%F0u*F8F4v$uPSh]%lAdwjSh]%~AF0 V8F0u0E1Em %}fE fEm}mE؉F8A9r=E1Em %}fE fEm}mE؉F8PSh]%@ V4F0u0E1Em d%}fE fEm}mE؉F4B9V8s=E1Em d%}fE fEm}mE؉F4PSh9^%@ F0E؃>u,Vdt%F$;BuFhuPtuPShz^%?v$stuPShz^%@E苀4E%t*FHV%hV%WզjE8~HuJFt.Fhu(VJ9Hu~<t>t FHd%FH^%>u FH^%FH^%~0uF8F4bWhOv4jES7Whv8jE:7(Whv0jE7v8v4Sh^%>$E䋀~@uH%u>ViRUSh^%>vvhUR7 @Uu Rh^%>Y[^hE䋀t=W[2Zu[E苀8E%t]h=%b>jEH7 >vHWA75juWt(tFdFhӉe[^_]g_e[^_]g_UWVSPuE EtuVjj<6(tl%ub  CiP66V@ t;{t5{<t/s$qPF Ph_%_=1ɺVjj51s p1C Cs`CCCC 1CCECHt V0Y1ɉKdChuVѣXZs1CC C$Zue[^_]ae[^_]W|$wUWVStEUM]EEu\Pg?_EPT%_%u'Ht :tRQE Ph"_%;1ۉ]EPLt @v@}GLih Eu>ZYEE1}m5%EPT%_%u'Ht :tSS$RQE Ph?_%.;MUEE@iEEE@ht 1ɉMExdtj$PuP% t؋E@$EtˋE@EPWS u{4%t Sh`%5[^jWS t jP&ZYF MpFuWS uh`%h<'h h[%  FdH PF ,Ft'N V$vX]e[^_]e[^_]ËJh1ɺBUWVSËN t9At E9F$E;2UhPC Ph`%4FiP3EUu~@u kUjRS EtjPn%XZESjj,E%tBFH}=%h}=%S48%Y^ u-j,XZSh+jj+Ee[^_]UWVS(Ë4%Sjj+V BuB EjEPS u2N }vuu܍EPEPWS%BPt3t P)#uUgP Sh`%2SAXe[^_]UVSËu%-ZYƒ%t/s$bPE Ph`a%-EEe[^_].C  cScs$aPE Ph|a%<-E1C<wPh*PBP2 uhx  X\`\u TT1ҋTX#DT9 tj`9r7'_Ph PhNc% \X`#D`9  `T9`rj5dohYZ@u ƅo4\`%th Pha%)XZn o`< uBHvWdVha%WdVhb%c  uWdVh2b%uWdVhBb%1CLDžXXX\Dpt;jXdhZYtWdVhTb%.XXuDžX`m\@6@t:j6dth0ZY@uWdVh`b%WdVh\%$dhƃ tPh Phkb%(V; h4%u$hgb%hCiPh0豢hh+sPjhCPu CP+WdVhb%;C@FC$CD1C<wPC*PEPl' u%C PF Phc%uMU[뚍e[^_]UWVS8EE] }uPYt99s&}E EE 0'Ec%e[^_])WPS U nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉjfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMк EUfҋEftuZRPE Phc%?(fEfu)T3EPE Xe[^_]UWVS$}E ^\ftPhp'h<% cCubh$RS u#>t=G Php'h "{WsPRWt^\ue[^_]UWVSE 0xjPu* uE'e[^_]ËOwv QPw Shd%<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhH'h<%" t @`jVPi u hH'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuVXt,swsos g \SVtttt:uj@苃t$P ǃ tPǃY1Ze[^]W|$wUWVS tu}P.YUK>vuu{(Ofu  tu%ue[^_]g_hE ƉE1Em5%RR$C Ph'd%Sh Vjj(e[^_]g_UVS]Sh jrt~ht j3gXZe[^]UWVS E} wLBuB9{d4G PuF PhKd%VU1Cdh}=%V|V GunC t{@;GusPLPF Phld%%t VXCX{F$E}uEUҊMM섄tLGECЀ8t HD)у@v q M@MH@E}{CH]%j6PesHVv}e[^_]UE1҅tB]UWUBv 0E 1ɉJI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u ~qZt unueAhBhu&FAhRhu tBu 6,cScu=cSc =cSc[^]UWVS\EtE}?Ex 'Eu1E@$ h&EPjju Ã{E8uǀxhtxduhd%hP'h*hd%蹡 h&uVE@dZYx tWu(]Xu1EK|EPdB#B E}WS+kE@d@ EWCPkC9SV^jjEEP# jjEPE }E8Pf_uqE0[^D$NjuuP\C| SEP]juEPEuEPZY@E@$tvtgu[X1uuVSiVCPiE@dEPC8PiE@dEPCXPi SEP1]_Xu[jj}Wà SW&sxC|ZY uC|E@dEPCXPciSu 9tSd[SXX떀{tjSu hà uhSud_tߍC8EPdd^ujju 5ƃ t9tEuVGfZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E@$tLu>E@hu5jZt9^duFh1Fd뮉e[^_]UVPuu,jy^uEh0' YE1҉@uUWVS]} SE^uh ' %t Et09Pt jPoXZjWSk ƅu&j4Xt^FFF`EF EFE0pE73AN }WPhT%jQME E0A #C$Mt1"PWQ She%\ Vj贕@u,, 8th 'he% Y[FtVZ1Ft1E@F0Epe[^_]UWVSQ]tdue%u=t-htGdt jPXZj3ZY^wHSr j3{ZXZ1GdEw$jVS t'W(9P uW,9Pu PC Phe%= 5w8w0G,PG(PVSu 8t둋AhAdjVSh ƅu She%g ]}tEW$9Pt jP(YXwdGhj3YXZ?uwHSq3 e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mutu |RPFEZYhPaXu KUjWuR Ã}Ut} tuMUj4XۋUuE'e[^_] ECCC 1ɉK BCZ;C t/C 67=VPhT%jC P{ }t EC1CECcHwnEE] Ee[^_]CtNt;C uCECKtHJSHwuSjà ]e[^_]e[^_]UWVSut=t7;Ct+;$ PjCPC PSF PtjR$ōe[^_]USEt6t,ttHJHPX]]y]UWU@Euu' Y_}UWVSQƉ uXӸ('ljU '9r 9EsҸ8'ljU0'~9M9 uZ[^_]UWVShPLufJ}xv #htAEH@‹EEhЍHdfhdZhf%hPh蜁Ëh  8th'hf%XZh?w8j@Zh_uh'^Lhǀ@h @uhSh8S\ =wPƄ ƄPPhhf%hY@u$h'h2f%h1҉Y[hCjydwZXETE`\fu `\\@)ЉD 7RP*RuM UuU]UWSU v– 11}}u1'M[_]UWVSUt΀yv e u1y tËAdr@t$tt @$u@hhf%X؋U-ÅtF PSYFP}WWCPYFd@t Kthx.( u} WC8PY_XC9@VCXPmYZY؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PV>LXZ?1e[^_]UWVSQEp1҃t<t 19sDB]۹yAt}u1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}EEEHfw EHfv藔 Ef9EEEM) u k@w ¸ w w w ?w xK9~% "}u1EEf}tdf}@~9f}? t1҉EUE) t1$t@E) t1u}11ErEUEa ׋UM U MEREC1[^_]UWVS}E uuGd((*1ۃ t%jPG@P ut #wdۉ؍e[^_]UWVSu }WVuw)WVu(pttSHIH9JHs؍e[^_]UVS]CtPV SjjV]e[^]UWVSuFhPF Phf%HVj@u3 81t) 8tؑ 8tΑ 8t h'JXF@t>jVC@P ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjSu'ƒ ujjS0n ]UWVS} uEtMtGu{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVSu 1ۉ]]]EdߋGdEuu;tGu}묋WtSWuJMQ1ɉ uHJt6GuCu;W_IuWYUOuUJOUjW@R06 t)G9Au!%uFEPQXZ8MWG E1҉UE܃YtMuW Xe[^_]UWVS} Et0t[uvtCPEP_ZY@t/C@3#Eu%CD3G#EuCH3G#EuCL3G #Eu붉e[^_]UVSEt0t.ttju CPP t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j|Zuh'YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZfECCdUSǃt_{ u Pu uƍS@ C t@sdKQPuR@u{ s{ u @t{ u j.EPC G{@u RURY^@s@t~{ 1UĊ  L @uj.EPC@Pj tJSRPhT%j.ChPke jC@Pu t @`C`KdK`C`uKd hx'SXZ1ۉ؍e[^_]UWVS EEE EEU}uM M܋M$MM(M؅uE苀t2RPe[^_]UUjPR 1t!hRu hmg%uItUE1҅t%tHd((uH`ۉ]UVS]u!uu1҃jPS, t8Hu@`tFP^jRPStk1ɉJHB1Hd@ @$ǀ7jPj3|=uhW%SUXZЍe[^]UWVS]C$t1jjSP u苃%uuS9^u묉%u^f{(uGC>Pu<{*Vh'W tVh'W u 节 z VEuU1Ejj@VSHƃ@$@ 1ɉMH P@%t<u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV_ V8FHtVE FHE88V% 1ZMjG@PRU U܋Mt?uRG`t%tEGhPG Phg%.VC讀 sj.FhPRj 1E@F0EpjV@e[^_]UWVS]} FtHtJN HPZڅt0jjjVtEE Ee[^_]9jjjVVd1Sjjt$e[^_]US]-XE]UWVSQEvs E 81ۅEjG@PE@P) tGd(1E@`G`}u!GdtGhPuG Phg%eG` ttGd uCtWZOd }u/GdOdt OtHU JOWX}3u1ۉ؍e[^_]UWVSQu E@EhE@PE Pu[ǀS@4uUr4{(s41ҋECEH$Q+B9sȉC$}O : v: K vu9F s} SEZ11BCZ؍e[^_]UVSÉփhPC Phg%VSt VPZY h'Xe[^]US ]Sj"ڋEXZ]UWVS Et_uVj"XZ؅tt8;Cdt,Q PjCPPCP@SF PtjR $če[^_]UWVSEttBu[0tFd%=u1҉vt Pu 0Y_6ϋEu@EtE #1B*Et E @ tt^tTCƅtDGPEPm9WRV=EPFP=C PF8PSji@ut 81tt 8t hx'TXES@EPVCPC PRU@Uuhah%YECd׃Cdj.EPRj踇 tSRPhT%j.W$R Chh[ ShZPja}u[8tMGE9u?Gx1ɅtPd8t+9utU Rhxh%XZ?믍e[^_]UWVS׉ΉÅt${ t8CujWC P~ t؉؍e[^_]UWVS] E1E;s31;Et k,9 t@v 6h\%[R PVjIG,1;uts 3h\%5R PSDIF,܍e[^_]UWVS(EEj:h0j ÍuԹ1Ej}Wj j)S@u S-yXu}uj Vjj:Sg@u_EjWj$j)SK@tEjWj%j)S1@tM@EjWh@hS @u낃؍e[^_]UWVS|]|}1EfEESU|MNM}Թ1ɉMЍMMEMMEMԉME }UxjjS uC Phh%ShX^SE} Eȅ@)@. us Vhh%(Y_xu_jxZuhT'bXxh}jPx<@uhT'h=%(_XjEPWu @u hT'Y|@P|WShX^jj Vhh%XZe[^_]UWVSUB UPh i%XU^_u-jj%ËUXYuEh'e[^_]^U6SFUJ>_t @ FUMvj±ZYUt0Mt&@}wFH r*NjM;jC 1CUe[^_]W|$wUWVS %ue[^_]g_h ƉE1Em5%RR$C Ph+i%ShE`Vj4(e[^_]g_UU t,t9PuƀRhfjjUUу1t3wt-tRh'hci% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`PEF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS<1ۉ]]]E1u1EEE9CEׄCdKTMЅtYURQP蹘 t t0u5CPE Ph}i%1ɉKd EEt9sEsxF URV4RPG t tlVdtRNhHV%t$QPF Phi%}Vj a@uk 81tk 8t h'gZ1F$F fdEt9sE6NEtXMPF$Pv藗 t t1F0PC Phi% NtHVujuP ECPEЋCL }ffMM9Msk KMɉMM̃щu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u%}uƃEă}v1ɺ1]/tuhLcWjEd}t?E Phi%dEESjE0#h W%u <e[^_]UUt&t9PutƀU]\]UWVS}u1-0t9~t6^xtuu S0 u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EEP 1ZYtU9pu 1ɺPGEttu4@t$Pnǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`u @tײy1҉[]UWVS@EPj E _X1EE 9CEuhi%j uVD CPVhi%u+ @ursXsTVhi%u+@tuuVhj%u+@tCtPVhj%u+@tC`PC`^E'+"uE!#C"t !#Au7$J" u!#9#@u!#!#y1^#uRWVQuVh#j%u!+ @&sdVh7j%u+@ C1C;s WJF,Z拀H1C;Ls WJF,XCPECLE}EfE9Es4e SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhjXPB PEPu2]G UU)U-sx1t8Fd%u'~ t!GFhPWEPhFj%u)@6ċ<e[^_]UVSu Ft%tF9CuuVCxPusݍe[^]UVS]Sjj1҅t#09XuƀلtKj3%Y^u=t h W%S5XZe[^]UWVS] 31<t0hk%xNj 󥊅zp 0hl%A11Ҁ+u8B,CdtG{$tA1ɉڋ8u.ڋ8ChP0hl%v1s$ )t1ɉEP8Q )xdu+81҉EP8V2H4818EP8V2p*v>xdu"t0hm% *?)t49$8xdt⋅4t4^u0hAm%聿Y[+(뗋4t=4O8xPc4j40 8Y4jj498jj4 Z8@`y *t[j@t/*tJj4>^_@u80hkm%蜾Y[$*0h{m% XZ4e[^_]UWVSp]U Dž 11DžDžDž0ftRh@'h<%ҽ jWV.W u h@'蘽YWSXZe[^_]US]jjS u"C Phm%Sh ShX^j&]ú 'Jt f9tUWVSEU MftEv0f9sP 1&f9u}tMf9)O [^_]UWVSEu} tRU w O 'fɋ] ] +39sO "1?fҋu1҉]19tu692uA,t[^_]UWVS8EċEȸ&uѸFURj uQЉƃuEfǀ<N GfEfwEă Phn%sY[f>ff}fuEfǀ<N 1҉1ЉЃEu.Ef}w  'Ph*n%j ]SB, 1:BUP_XۋUuhD 'ϹXߋMDڸuf}f9<t >Mčq RVh>n%P聸S联Ef]f<M 18f}uVhSn%}ȃl.(Y[Eċ4%tjαXZE΍e[^_]UWVSSƋ1;,k(f{u{u4{u.{ t&{u&{ u {u{ue{u{tYCUhPCPVUt1ǀ; Kf1ɉHGEe[^_]UWVShEwL EdEEEE@|tXdÀuXdBEAE1ɉMM}qEf9UrZ9]s#L E Phpn%蝷XZ0u<}])Ӎ{}ff}ftftfu f9s#K E Phn%4_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP6 UtGF΅uE4%@u+j EPjEPetPE Phn%f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPtuSVPE Phn%$(g1ủuEEPM1ҋEJE[tE2Eƀ>#f}uEȅWeEEEPjuWƃUЍ M))Ufw#J E Phn%萵ZYEܹEȉEUʉU9s'I uuE Pho%1qEX|ۍEjPSs uCduCdcd{4u EC$U9S tKdS C E}}uuE Ph&o%胴 f}t2}O`MQ9rG`E̅tMqduV9rAdE}E؉E};aV}9GhUGhMjhPu~ǀ;EfEĉ{(u 1ECEEe[^_]UWVSljUMu w@ PhNo%G 1҉u1ɋUYtG E1ɉKhKdK`ǃu uVjEXZƃ>VuMUZYuC;u}tG Phio%[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[]F 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύK G=DQwWF(1RPQho%豱~(WQho%! EPjSuuAtBf}u;8σ G=DQwWF,1RPSho%W~,WSho%DZ e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@o%}tQuЋE؃ Pho%u18ujjE؋'EPj$'8u ǃ8p%EPj s@s<Qtf}uʁXsXS`1CdChǃJ8u ǃ8p%8u ǃ8"p%8u ǃ8)p%8u ǃ81p%{`tts|C`t}t8sLCDCLCHCPCFd rFV t#tFhPF Phl%褬 1F$upFhPF Php%譬 Vd s"1F$F VjjF-NtHN rVXV蓮YHE؍p C`;u PVhp%MuVhp%,KdSh tRQPVhp%uK)uVh q%u4 RVhH`%u jE0XZ}uA}t;WVh^%脫sHsDhWE0 & @u Wh^%˫_XE؋_|tACdƒ t ujC@Ps? tKd Cd uVhq% h8u%E0 E؋4u$}؋t%ujȣY[XZ믍e[^_]g_W|$wUWVS,(h1Džh#fDžBDž<"#K8Qff@98tB9rIpr@uHtHu f$8,nt104tj l0\ZYHu" t\10fDž$H8% t#j@wP[(| @p|1(Hx@1NjDC buy(u4tƅ,18$|Dp<@D&v P Ph7[%, DP4BnFDFLVHVP1ɉNDNHt hu=%SXZP3h SjjMw0%t11҉SY2~Dt ho%SUXZu Shr%i1ZYe[^]US]?S Rhr%PF ؋]US]C Phs%5XZ؋]US]?S RhEs%P ؋][US]ShjC Phjs%軑؋]US]?S Rhs%PfShsj聉1҉؋]UWVSƋu5h@\%觐f-XfthWP* 8PV RhW\%ahWP6 Z4%@"PPR @ {TWjpj~ u +)CTSXWjKZY@KhtD1+9}F PhCa%-Y_DsDjbCD_Zu h 'qY#Nj󤋅CH_1҉tjhj|P蠗P6 sDj1CDCH e[^_]UWVS] E1E;s31;Et k,9 t@v 6hs%< PVKG,1;uts 3hs% PS%F,܍e[^_]UE@|tPd(t1]USEu1X|tuu Sp u؋]UVSEt0t-uvX|tuu S( u1ۉ؍e[^]1UWVS} 7G@4j.DSFPjA5 4wShs%|)}tE@<"jWu蟚< u hh 'iG8@Pj48PNj<% tj<01ɉ,0,;(⋍(tx}HlaDP< Ph!u%/<;8BPj48ƅ0tfBu0S@tWC<8uOBQjRPDt8fBu.08r$PDP< Ph>u%R48sunu StHuZ%uGjSƬY^u9ϋt# w~tn0ueeu1t1%thDjVYZ@(@,1҉P|P|10fǀ<fǀ?SjhPxjjS襂u"C Phyv%y~ShS詉FSX:Ѝe[^]UEtQw]UM E]UWVS É։M苐t 48UMtSjjPiv u EU S跀Zt~8 1pp@1x xx$3@u Shl 'h "}:SY(hv%SXZP3YXt jjV|P蛅t j3XZwLXGDGLWHWP1҉WDWHYt=t8E%Uu=t}uEv%uSwZYwLWw4WwPhZw% YX؃t w t u F17tA9MuuUM7Ph%* XZUM΃`Ѝe[^_]Uh-h^w%bTjr t4h4t9W|$wUWVS41Bh41-% 6f 7 s f4.s f4P s1f4f 4f 446 1s44 ut/4x4 |44 4f41=0-Of44ff4f4=@4tjV.| Eȣ4Eȣ4ZY0-X464U1E4]544jh456ƃ x9u hq%c XVS54h3x%  7Hujh,-j  P4\4D4H4 D4u\4\4D45-= -u؉}mrq$-E؉ D4H4 D4H4EL4L4=ɚ;~ D4H4-ʚ;L4\4D4%we[^_]g_UWVS4ƉU)'hUx% Y>^ hYx% FfVRVRPWSPhsx% j.]SFPj uj.hN"S~h Shx%d j.SFPj uj.hN"SNh SA F^(ZU)ڃ<,wJ<w1tR<CSPSPhx%<+hx%"<:tI<{%  7݅8tS؍1fDžF 󥍅PhG{% [^݅8=@4tQQ$hO{% ؃t h]{%~ ZT\1NjH9s:4@8t!t\SQRhd{%3  B뺉 \ <jhz4T Pl 8iT@f0fp4Cp46sl4p4 ڈ6 7 P9PWh5$a T@‰ffP ft2ftGfTffRPh{%TfPh{% TfPh{%o h{% ^ 7^ TXGTWhj.VSj VT@4 'h~%O T@f0fftf_feh{%Txh{% X 7tET@th|%h|% X%818ߋ0fPH9?H)T@uC=wtvh $i f9ff0P=v 101P 9 7ȋ8 8ԋTp_ 7t3t uh!|%ht% XT@t h^o%{ X 3 h/|%jY1H1ۃHu ˃j.RVjN uj.hN"RV Ph!% XZHuu h<|% Y ShH|% XZ eTp\G뉅PT@O9u~TX\H9s&$ -DQt!%RPR CYXDž8\P9H0sZPh!#h"% H9\saTHSH\Zuh $ [.8utS YƄ0\x 71hO^$ T@Z<t"<t%T@02ht%h!|%G X~^T@0j,H XT@uFShQ|% [_8uD\9Huj, h|% _X)syShd|%Shs|%j, hz|% T@ZY9Ptj, PT@Ph|%y  7P(PWh5$P T <x2<w><tG<T@8Ph/}%P $ '<uT@<w*$ 'h|%Bh|%;h|%4h:$-h=;$&Ph}%,T@t <uh=$hH}%^ Ph^}%r Y[THLh{}%M T@Z<t%w uh}%<uh}%h}% _h}%Ph}% [^T@8Ph}% THmh~%h~%h'~%h6~%hF~%hh%hT~%hi~%vh~%lh~%tj.STPj~ uj.hN"SJQ Sh~%0 j.STPjH uj.hN"SQ Sh~%h~% hA4# T@f8fZYfw2$ 'h~%h~%h~%h~%h!|%h%}9Huh%nh&%h0%i S1ɋHU t Sh3$h=%&uj.VSjF hG% [hQ% hA4# T@fHfZYfw-$ 'h{%!h~%h~%h~% h~%h!|% X 7t-T@<m4 'hj"PhL>$c ^_ 7  7uh8- [g v狝t݃{)!C2t!#t1 hh%3thx% C Yh% C HC SRRPC Ph% HHǃxPh% XZ h%r XCPh%b Y^19~gVHHYZuVh%= XZCj.RPjT uj.hN"RN PVh% F땋L 9؋t4p4t9~ 7 4t49p4 =p4P UWVS]u# 7tP3^1ۉ 7 7S  7@$ + 7Yu U1҉ 75-t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSUtWB<:u1<2E 028uFut<@t*}:u<:t"u}:t;EuݍG1ɀ@t1ɉ[^_]UE@-]USE] u:À|u%u@C8t9EsHt:t @|u1[]UWVS4}!}u[= 7tQu Wn[^u<5 7Pi)YtHWPD3XZh5)^1u? Dž)Etw}xjjju !jh@PME xDž1ɉ1ދ9rqhQuƒ ?tuZ 0S0 0HЀ u%V1It 1:u4:ut75Dž\t&Dž t t11҉V9r)ډ)ށVSj,ZYu"S/^u[Ɖ‰,1i<#au SZYNFS;/XDž@-K1j=h%S Ɗt F:uFHX)ىMQRPu[Ë tK}t uzXWt.^tCu F:^DžBDžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QWU*ZYu:W-Xt uXx- _<ljljƉlj )PVQ裇 SR萇 ,Ymt u^)؍P9s&PS:)ZYuS, XË Dže[^_]UPjujM UEU 7tP贻 1҉ 7Y1 7 7 71UWVS1= 7uE 7= 7uYh% 70S  7^_u=`P5 7xY[t?Duz1= 7 7t= 7u 7 7u@ @uPѺ 1 7 7P 7@Zu 1Uh%PAڋ -f\Yf:u#t = 7t|0\L 7E|0\u  7N1ɍt:uf:Y\tAߍP5 7=Y^u' 7tB @Rع 1 7ZD돁NJ|Äu :t@PFjWjM EÍ@ wCe[^_]UVS]u uu ][^]UWVSj=u uj Pjd ^Edu! l4uEdUz}<:<^uFC<:{Mu])CdPV%ZYuV([{<\ůCt}<:tyHЀw1GOD9t0v뛍{1e[^_]UPEPhh`7h7uƒ1uEUWVS} uHu7uuW1ɋUà =d7u u1Ɖ>1e[^_]UPEPhh`7h7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ'#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rס<7EС7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSPU} u]RU $URjW $WjV $Vj$S ZE] Ee[^_]fUVS@ÉjjjQjRPv tN9tLtHVPZH ZY@u: j@]S07y h"ShS%PD-=7t5 1e[^]UWVSSÃ=7tO1t 7<!j臫ơ 7!7)Y9sRUf7Z9Uu)@uÅu,87!1ɉ1ƅtÉ5771e[^_]USX?797r7É7 4t1[]À=7UVSh!#h!#h!#hx%D-h!#h"hm"h%D-D- C"=7tJ"7%=7t.% "=7t"QRPh%Ӌ5D-u$=7tr%#=7tu%"=7ts"u%=7t%SQRP֋D-U@7h!#h"Ph%ӋD- Uh!#h"PhŅ%ӋD-U7ih!#h"Phԅ%ӋD- U7Ah!#h"Ph%ӋD-U7h!#h!#Ph%ӋD- UH-h!#h#Ph%h!#h!#h!#h%D- e[^]UWVSQË@xtt*BEB$؉‹E¸1DD@J 9s:tt/Ήz}z$߉}1|C@1҉Z[^_]UWVSS(7,7$7k(0hP'@PE1ۉ^,<7~0XY1;,7s6U1h@'GPEKGU C(XYk(|0(7,79subC[^]á7uÀ=D7>UWVS 0DžDžDžjjPh@7jS豂 @u @7i <7P871 @H47hShJ%K tƄ181ƅGh[%i9Xt} uʊt͍B<9;$@ '7R7F7:7.7"7H-47B9HH-@H-77P-HP-47J9@P-L-HL-47J9~}@L-u7l7c7Z7Q7H7?767-ƅ hk"Rhj%PD-C7n3 0=7t h YP-9L-}L-=L-‰7 <7 07s5,7(747)I $77H 7tH 7 H-7X 7 7Ɖ5757#87tA 757)7=7t*1҉j Ph55" h`'h7@jˢ777h`'h7j@117@7}ã7u&@7 1tD71e[^_]1À=D7u1á7u 7UWVS@É;7;7j¡7_9u739u0P١Y;7u;7)77jVS/ 19Z;P 7PPh7@=7XZVS= Y_@u:\ j@}W0O- h"WhS%PD-=7t蠝 957u"tX 7PPh7!@XZe[^_]UWVSEЉʋ 7!Ë 47)){ MA L>D=7tMjRPy. M957sxu@)lj|| >;7Fs"J| u| | DT>| T 9Ss$EExSWAAED CSW 47)su܋tu 9t)D @!u܋D UEPh7<@ZYe[^_]UWVSQӋ 7!‹ 47)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS$E܋ 7!9_C E؋ 47E)puЋ|7Uׅu9u)Ӌs V}t Z}܉E)+F$Iu*w 'w)'w4'1;SsS |C@C;Fu ;u1ɉHt SFP>XZN]H9t9sxt PFP<Y_SVo<XZ{EЋT }t Z}܉ыU܋E؍e[^_](E܉EEPh7:Ph7>=7t KZ{ SC 77e[^_]UWVS97t79kjjh7F=ǃ t؋_ jWh7-=EWh7=7=7;7r;7rw1ɉ Åuj}먋 71ÅuP=7@u1jNj 7!‰)[9tP7Y9uō37t]EPh79XZt>G 9r7 39s0jWh7P<EWh7<7=7}뾉؍e[^_]UWVSÉU 47EC1t}9xts@Ƌuzơ7EF}}1U9sK)K)21ɺCPY^y)VxK)]K)1ɺACPV*MKZ{uoEA)VHXK)P؍e[^_]}O}M&؍e[^_]5e[^_]UWVSSlj1=p-H9s?MjB,@Pr(1 Mu e[^_]C(S,z{,f P{<t[F-01=p-H9s -29se[^_]UWVSfU0P9s'H9r f8f;}ux]u)E-HuVQMo. t uMQ ZU9ufG}uf 1e[^_]UVSË@9r{uCH7CH7KP9s+9s'8[u"x.u. K9r !f3r9s:.u z]u{uCH7CH7[^]èu'B -fAf'f` ЃðUS1u4@'袚 ZYuCC u1]UUE ft҉U<']1]UWVS É1=p-H9s33C8C,E-E-E1E9t*C(p{<t@}f;t5}f;t,Ff9{419ts04f;|f;V~ @1 1{8C pPWZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh%V, u 1ɺjh%V+ u1ɺmS j@B@Pr . u ؍e[^_](K A QrqЉE1}C @t E@<S9s8^u @E@89]u @]-@-9H:9<]<-3K-9)BC9S9{uCH7CH7S9]p9rD-tN[@3K9ȉu,M؋U먀=Vʀ-ux]Z {uCH7CH7{uCH7CH78Dz@U׉DRO^fE11=p-H9}"uQMBZYMt UGjE@$E@PEp + u j}G W$JO$f4PY{uCH7CH7EH9G8:>x]49r{uCH7CH7<]t<-u{uCH7CH7=ȋUC9r{uCH7CH7S9sH9s8=ux]u {C~8-P9x]x-t  -f9=p-f9~0{uC H7CH7f9UG1=p-H9|f9jE@4E@PEp0) u MA0Q4f8fpBQ4EV~{uC H7CH71E, U%Gu48-u@-U;Cr{uC P8]u H7CH7{ Ex8tC @tEHp-E11}tf~)f=t#M9tFfE@fNt/Ex,x4uzx$utx<un@(ffEf=t^U܉zC P U܋pEp(Ep0Ep t1}U܍D2 9Eu'C HC M+H 0؍e[^_]Fe[^_]UWVS$@ @tbF -f tNt - t< -ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]UWVS]CE q39\t[p;sr{uCH7CH7Bׁ)>t~+90y<1ɺE {*.MC @+1ɺ(1ɺ4~t6BЉE8NdBM@a C @Dz({PUCxMu*@uC H7CH7{ G7щ3S9ryn3S9Y>*ubF3CHE)PHAKE)PCHE)PXKE)``[^F9>\~{3ƋK9sI:,uDz;9s6J-DJt%9~{uC H7CH7PU:SY9s"H9s8\ux}uDH9r 9r 8\ux}u{uC H7CH7 1($S B@pr@ wML(h/S9s#H9s 8\ux)t)\ wCDLpS9s(H9s!8\ux)up39Zx*{uCH7CH72SUEECE^ ]k3US9֋My*CU z5{NGe[^_]UWVS]x;s?SB< $'^[m\p{|;{r{uCH7CH7S B@xz@ wt(hw;Cs8)t~)p wCDLp@;Cr{uC P8)uH7CH7 1E1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ]};US|1ɺ(N`g;{r{uCH7CH7Pu1ɺ1ɺ!Cxu{'{9Jր?u#@}{C {P9sx -Dyu@<,t<{uC CH7I7}{uC H7}~{u9C 0@}t{tEH7CH7+uN+ueH7CH7-H7CH7C H7CH7+tv *t?{CH)VH$K)PrCH)VXK)`L_X5CH)VHK)P^CH)VxK)K)o1ɺCPO^MNj;SsE:,u@BJ-DJt%9~{uC H7CH7PSY9s8}u @48}t#@9r{uC H7CH7 {9s9r։v!?t{u#P9sP-DPt o1e[^_]UWVS} U0E tEp9) WY [jLYt3SUUw$@@EjP|1҉UYZuS'X ]lp1tEEU1}Eue0 DžhW 1411h1xEEMU싅hE1C CE$C1C C$C(C,C01҉S4S8S qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC0Y(9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV uE @MC9uEƉ]]uuu uMrE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMQƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB ;E!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS4ljUMȋEEЊEЈE׋G(E؋G0EܸMjPh{PM UE}tEfEE9G t9GuGt E@fEM E1uE9GtfEE fE1ۉ]̋M9Mu }tEEf} u@uIf}t6f} up`@(E}Qf}tP-1Gu@$E~1ɉM1f} u @uDf}t*f}tr1w@(E}{Gt f}tByf~u"| f}G1҉U}@(E1f}u1GuEf}t}u?f~gGuE1}uf~@}u f~u7tÉEVuuuM UEMuf~u;11ۡ-f}UfMQPf_tIf}tAf}uf})E@-Buf}_uڻzf}-EDBu#f}_uff}thf}u4fzXf}tLf}ufztBf}E@Buf}_ufztf}u;rfzu"yVuSuM UEf}tAf}tY -E@Af}_ fE@Af}_ 8uY8E-DBuf}_f}u7E-DBu&f}_tVuhwuM UEUąUt }udU܋E9UtxM9MtpEU9UtNM9MtFЀ}tEVPEPuM UEuuEfEEGE@}t)EG1EEf} -1Ee[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUEju uM‰9EtMIFEEjSVMU tUU9tESVMUjuVULEju uM‰59EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV> uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0He=XSw =H=PM=@=`=h=wF=w=xU=o==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEfflEffEff}yPTfEff<@-/f}$(f}UEMA k MM)ʍ M ыEEHM)ȉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1uԀ}t!puRU^ UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U‹}}f}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVUwEju uM‰`9EtMIFEEjSVMU: tUU9tESVMUjuVUEju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1uԀ}t!puRU~ UuEEf u@EuLft:f} upucp(fE}Rf}tT-1ɉMCu p$fE~1fEf} u @uFf}t-ftt1ECEp(fE}{Ct ftAyf}~u fE|f}C1fE}p(1Efu1ECuFEf}tu@f}~kCuMF1Euf}~t}EEHQMuRU tYU9UtQ}̋U֋M}HtuuuREPűM U?‹uuf}}t4EC1E>t$E@Ef} -fEEe[^_]UWVSljMuU;u HE%=Xt+=xtM=Ht3VU=Xvd=p*CEMCEӁt @EM=0t8wUBU==(t=Htw =h}EE@EjuVUEju uM‰9EtMIFjSVMU YSVMjuVU|Eju uM‰e9EtMIFEEjSVMU? tUU9tESVMUjuVU Eju uM‰9EtMIˍ^@U%tjVSMU 9Et(V^@4֋%=uNVSMUXZ?_E+G Cd_E+G CC DEEuTEe[^_]UWVSljM];] AEE%= wF=(w"== =tf2=0t=`T=w"=k=tr===9uFf;EZ9uF9uFEA 9wG9wt39wu G9w ;w~ G9u G9z> qAG9r 9Y-EUEfTPffUu}_uc9wu G 9w sFˆEEDPu }_} uAu&}_f}G9G9wNȋ-DJ<_-9wuDJu _lFfDBfE9wu_t fGDB‰Ѐ>_ €_f} 8;w,-DJu _9wu G9w NDJ_9< u AЋ -DQ<_KED%EukKM2KM=Xw=H=P =8tK!=p =x2=h%NC5Y-9u710E%EGPx utڋ)Mu MA}dʼnM)ыU9ruG PV) uE @MC9uEƉ]]uuu uMwE%EEG]4뺋G]90t10uuu UE)PM7MtE%\uuSuM@ SUT\%=uK똋]G؋HUM+W Puuu uMVƃusGUMLa]G؋PH UM+W PP uuu uMƃuGUMTL Ɖe[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=p-lt1ۉ]tMEAEW=N YE}M9M) N,F4EF8EtwFE /19ĸ [^_]ÉUD$ED$$cEDžDžDžDžjDžUDžDžDž >}׉ƍWOt%%"F9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$U6DžDžDžDžDžUE@fE@fMIL$D$ D$D$$ t$ qD$D$ 4$ EDžDžDžUE@MIMI Ɖ ȉ } Dž UE$(D$D$Ɖ$lD$:4$ Ut p9EDžDžDžDžZ DžE@fEEDžDžkzR%Kwҋl>V9s%u9sF?V?4 r9i_oJZNN9sVu鋽D$ oD$D$$d V9sNu鋽E@D$ qD$D$$ ^V9sNu鋽*N9sVu鋽ZNN9sVuZNN9sVu=Exy @?ዕt9ZNN9sVuZNN9sVu yZNV9sFu鋽Dž6pSZNV9sFu1fTA D$(A D$$AD$ AD$AD$AD$AD$D$ D$D$ $ ȄLN9sVu鋽AD$AD$AD$D$ D$D$ $W lBD$D$hBD$D$ 멋AD$\AD$XAD$TAD$PAD$LAD$HAD$DAD$@AD$<AD$8AD$4A D$0A D$,A D$(A D$$A D$ AD$AD$AD$AD$D$ $D$D$ $O dAD$TAD$PAD$LAD$HAD$DAD$@A D$<A D$8A D$4A D$0A D$,AD$(AD$$AD$ AD$AD$AD$AD$D$ D$D$ $ N9sVu鋽N9sVu鋽}nȉN9sVu(@D$ qD$D$ $ N9sVuA D$A D$AD$ [D$D$$ {V9sNu7@D$ qD$D$ $ N9sVuD$ qD$D$ $6 N9sVuZD$D$D$D$ D$T$U$ "N9sVuEDžDžDžD$D$ D$D$ D$L$U$]tN9sVu*})mUE@D$ ZD$D$$ EDžDžDžDž DžUyzUWVSt>x ӕU11 rEEEEEEEEEH>U DEED$ED$$P:U}ĉ|$T$E$4 ƃtdE$3 ƃt'D$ED$$91҃ډZ5 MD$|$E$=4 95 M/5 8D$ED$$9 5 8t[^_]4 UWVSP v aDž/devDž/XtyDžyXXD$[$S:t-ƍD$D$FtH4$ 4$;D$D$ D$D$*${V@Dž [pt0ƅpD$D$<$s9ƅt訖L$D$<$=uD$<$=tg$9nC>3 P [^_]#3 8u)΃wΉ<$:uD$D$<$8`S9EE ut|$E$ Ut#ED$D$ $qEtED$D$gt $] 1P [^_];DžUVSs ÍED$ED$ E D$ED$E$tK ƃt?uE$L8E$c8[^]ËEUE$%8[^]þ[^]UVS `s 9 ; D$D$$ t@ $^ ǃ $7ǃƃ 1 [^]0 0ǃ $[7ǃƃ t0 0ǃ $ 7ǃƃ t0 UWVS<Dr ُuD$/4$ D$@4$5ƃ%D$T$$a5/ 4$j6Ƅ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uM- Ɖt$HD$ &[D$D$4$ = / ? . UVSp Yu 3D$/4$ "t$ $ S D$D$$ BD$ D$D$$` !Ѓ D$ D$$}1[^]YRD$D$%@4$b3D$t$ $蹍 , Ɖt$HD$ &[D$D$4$% =@- ?)p$! tƃ Y- 8#t- 0z, 04$ƃt, UE$]fffUWVS n &E@ E։υEE y ]]U ] }ED$D$ $D$s&ЉM;MM }$UM T$L$ U$D$=&ЉM9ureMϋE eƉϋ]ڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEE9EE }E2MϋE evUWVSPm éD$T$|$$|$D$$D$,H*)R)L$L$|$}<$teEU +D$T$D$T$ \$,K)v)D$T$)iD$T$ e[^_]øUWVS8/l }܉E؉Uȋ-8}tGC@%-Z+]E[t_E@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }KtO0)Ӊʸ9иbv-t9+E]܃}thEȉE̅um 8[^_]E@ta(uk1f)uAÃPt((uރEPXEȉ 8[^_]18[^_]Éc}ȉk}ȉ^}}Љ}9s]tSÃPuހ.tEȉEt,}-UЋuԍLDFt uf}am}a.m.f}pmR}p.m.1EЉ$] 1E܍,/['D$D$EЉ$]ͫ t#tWuՉD$EЉ$]  u݋FV }؉WF2}S1}؉}+E܍L}̉7[D$EЉ$] tu}܍qD$EЉ$| KL;[D$EЉ$]V Hu݋E܍l}ȉD[D$EЉ$] u݋}Љ<$]` |?sE܍lD$EЉ$] uE}u8}DGt.E܍D$EЉ$] u1ۋEЉ t.u}.E}Q} auD$EЉ$] usu̅u#D$EЉ$] uݸUWVStf Ƌ'<'wwEVN)щȉMEED$$hgt_FMȉFD$F$Cgt:F]؉F>FDF 1[^_]ÿ'E {UWVSe 6D$\D$`D$dD$hL$tL$D11rD$DD$xD$|$$1D$TD$P MD$LD$T>LN\$XD$Xtt$T=qw 9 AD$Lt$Xtt$T=qw 9 AtD|$P\$XL$HD$TD$dU ID$Tb\$XL$HrF QT$X)Ћ$‹RD$\T$`F3W @D$|t$xt$X$1 A\$H\$PD$Ptqwt$H<g9D$XrD$TD$X$Fh$$7hD$Te[^_]D$\D$`CE@$@@(L$XD$|)ЉD$|$)щ$Q0lPT$|@A$D$\T$`AQ T$TeD$T!LN\$XL$XD$|)ЉD$|$)ى$QiLtсqw 9 AO;$rD$DD$|PT$|X$A$D$\T$`AQ OD$T\$XL$HƉL$HD$|;$rD$DaD$|FPT$|X$P$T$dL$hPH OD$PtD$PD$T$L$HYЋAԉD$81\$(9ډËT$8QˋIL$0;T$@9щ‹L$0ً[I<9qUD$(B$L$HAQD$ D$<Y $\$щ‹EL$XD$|)ЉD$|L$H)ى$QE@ $T$HJZ@U@pHhXl둋$L$HAQD$ D$KF^D$xD$XD$T݉D$xD$XD$TD$dU DD$TD$xD$XD$Tt$P\$Xt $D$|;$rL$PD$DL$PYD$XFD$|PT$|t$Xp$B$\$dt$hZr D$XOD$PaLND$H&E@ $D$H$D$HD$\ E@$D$HE@$D$HvE@($D$H_E@$@($D$HDE@$$D$H-E@ D$8_$D$HX4""""9ȸ"""3ȉ)L$8 I] ApAhQl5$D$H@MQ m$($,$u@yރ1D9$($,DŽ$\$P $D$$0$$L$$\$($ \$$D$,$$L$D$DŽ$DŽ$DŽ$DŽ$DŽ$$\$,$à $  .D$ t$$|$(5 D$ t DŽ$L$$$$\$PD$TT$XL$$D$L;$o ;$b D$D;$Q D$<9$@ D$,;$/ D$;$ t$T|$X! $D$DD$D a$4D$P@D$L%w\$Tt$XD$\D$\ t$D9%Gtԋt$Pf WL$T\$XL$l\$pӉD$DŽ$DŽ$DŽ$D$T@D$<t ] 1uUT$$]AtFuɿ [^_]UWVS8 8Vt:>t M1uU T$$SAtFu̿[^_]UWVS<8 Ut: >t M1uU T$$@tFu̿[^_]UWVS 7 jUE $| ƋE%EEZUuUT$$ … U>t M1uUT$$0@t1FűuUEEu54$;E [^_]ËUt }1]uЋu9t!$Uo D$UT$4$ E0E렃}tE1҉UWVS6 2Tu Ex}u 4t+D$4$Z?uE)E@ [^_]Ë t 1[^_]Ét$RD$$jGUWVS6 èSE D$E$P D$ED$4$ QNjE8tB 8"tn¨# uOt$ E D$eD$$҉[^_] 8"u썇v#뱋 t[^_]ÍvҋE D$eD$$lFUVS5 ëRuF$9F $94$9[^]UWVS4 oRE 1t 8u$0E]M $x NjExlD$4$4MA XEU PMZEED$<$Dž?nED$=<$莼 HE u M D$<$d~kD$E D$ ED$D$4$tWD$D$zd@ $9  $D$$ |$$ƅOD$E D$ ED$D$$$D$E$vPtD$$}$4$4= 8[^_]À>/uEt$D$<$ t'D$<$^ 8E D$t$E$M}8[^_]ËE D$SD$E$ME D$D$D$ ED$D$R$ş BE D$t$E$3Ng* E D$fD$E$5MDž1D$ 6fD$E D$E$Dž1` E D$fD$E$L10$z t$ D$E D$E$'<$11fD$E$-D$/4$8 E D$D$E$LDžDžk E D$I E D$IUS(m- KEEED$D$ED$ ED$D$E$袝 x E([]øUS(- ÖJEE>ED$D$ED$ ED$D$E$6 x E([]øUS(, *JD$ D$$?D$D$D$D$D$ D$D$D$D$ $Ĝ x D$([]øUS, ñIED$D$ ED$ED$Hf$)-x E[]øUS+ XIE$iU+ ?IUt ]Í]UWVSp+ I}|$E D$E$I9s [^_]N ?|$ t$D$$[^_]UWVS* ÔH}|$E D$E$I9s [^_] ?|$ t$D$$[^_]US * %HE$n t []ÉEZfT$$EUS J* GE D$E$m t []ÉEZfT$$EUVS) ÑGu4$&t[^]ÅtEt$mfT$$EUWVS) @Gu} |$4$)t[^_]ÅttE|$ t$@T$$EUVSK) Fu t$E$|*t[^]ÅtEt$fT$$EUWVS( ÈF}|$E D$E$K u[^_]É 0|$ E D$hD$$[^_]UVS( FuE D$4$t[^]ÉEt$fT$$E[^]US1( EED$E D$E$uEfT$$E[]US' sEED$E D$E$duEfT$$E[]UWVS$' ED$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]: L$ EUD$T$EUD$T$E D$ ED$D$$$[^_]UWVS$& \DD$ D$EUD$T$EUD$ T$E D$D$E$ Ɖ׋D$ u $[^_]x L$ EUD$T$EUD$T$E D$ ED$D$$$[^_]U& CU!Rፀ(=]Í]Í+]Í]Í]Í]Í]Í`D]Í]Í]Í]Í]Í%]Í]Í]ÍBD]Íӡ]ÍvD]Í]Í]Í ]Í]ÍA7]Í<]Í]Í]Í5]Í]Í]Í]Í]Í]Ír]Í]Í]ffffUWVSP X$Hp)9s L H 9r,P 9s P P P$@(@,[^_]Ë #p VpUWVS\$ AƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$ۋP Hx,tP(9s ,P P 9s 

S S KC S$T$ʉs[^]UWVSTH# @E}>11L܃r׋EEċE EȋEUEЉUԋEE؍WỦ< <<] E;EriEE؅eEU9s UEUȃE9sv ED#UȅtEDgET[^_]ËU#EE%ju}ču܋EU$T$?uẼƉE wt ~ 1ҋM!E! tE̍PUP v)E;Es MĈEEU̍JMR wډuuUtE;Es U>EE1ۋE؅EyUE9U9v UD#Eȃv UDEȅUDwMaEEEE}ωu΀FE:j=*}_]̋MEU$T$ڋ}i]EE߉]̃{u]bO?_]̋EЋU t1҃EE̍PUt'E;Es MĈEEU̍JMu܉E}ESfO?~w<@p]fEЋU t1҉EU<@t$ t1!E!UGE̋EFE̍PUE]Ȅt&9s MĈE]ȃEU̍JMu9s U=EEEU$T$U]}EEf@E%#jxE%#joEUE_]̀}FGG9U}1 CEt'E;Es MĈEEU̍JMu܉E }EEEv_]̀}fGU}1 HE;Es U=E]̃EQpEЋU t1҉EU<@GE̋E"0]̉EUD$EUD$ T$ED$E D$E$p]fffUVS G:uED$ ED$E D$4$5D$ED$4$U[^]UWVS4b 9UEzlj(aED$/<$莤 t<|$(D$ED$ ED$ED$4$/4[^_]ËE E|$ED$SED$:zD$ED$ ED$ED$4$u 8upED$ |$ED$ED$fD$ED$ ED$ED$4$|M? 8u EL" 8t ED$|$0D$ED$ ED$ED$4$  US <8EU M ]]] ]][] USEU M]]]] ]][]fffUWVSt> 7D$L$<$S8t$}D$<$m1 Dt$D$$imũED$ fD$D$$Yrt UWVS f5D$ED$$t{NjE88/tbD$/4$j…tL)JBU=wsG|wdD$}|$M$v Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS [4}UtlƍxD$4$F tD%=`u'$U tĄ[^_]f O1Ą[^_]L 1UWVS ô3}U)tlƍxD$4$AF tD%= u'$U tĄ[^_] O1Ą[^_] 1US(} 3EEED$D$ED$ ED$D$E$貅 x E([]øUEM tP8u ߉P81]à ]UWVS  z2}tc$fUT$U T$$ ƅt/tV$ uDt$D$<$MƉ [^_]ÍD$$u [^_]U ' 1U T$UT$=7$]U EtUT$U T$$]ø]US  ]1E D$E$`=u$ED$ED$=7$ []øUVS t 1uED$E D$4$x=uED$ED$4$H [^]øUWVSL ô0E uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~E}ủuĉMEU1NjEĉD$ t$EȉD$E$qE9}u֋UȋED$T$E$J<E$e1L[^_] 7Eԋ U2bL[^_]UVS4 i/uЉt$E $^ED$t$E$y4[^]U  )/U T$UT$=7$D]UWVS_ .uEE}ED$E D$4$Z;t}EE u[^_][^_]UWVS4 Ô.=78ủt$E$聣E D$t$<$4[^_]UWVS K.EE}=70E D$ED$4$:t}EE u[^_]?[^_]UWVS4Q -uED$E D$4$U:t%}̉|$E$轢ED$|$4$4[^_]UWVS4 Ç-=70E D$ED$4$9t%}̉|$E$YED$|$4$w4[^_]UWVSH #-MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$!nE9u܋EUȉT$D$ $M8M $1H[^_] 7}ԋ Uy'H[^_]UVS4t ,uЉt$E $ED$t$E$4[^]U 0 +U T$UT$=7$u]UWVS Ô+uEE}ED$E D$4$7t}EE u[^_][^_]UWVS4 4+=78ủt$E$!E D$t$<$4[^_]UWVSV *EE}=70E D$ED$4$L7t}EE u[^_]p[^_]UWVS4 Æ*uED$E D$4$6t%}̉|$E$]ED$|$4$ 4[^_]UWVS4 '*=70E D$ED$4$6t%}̉|$E$ED$|$4$4[^_]UVS / )EM thP8t P8Ɛ=7@:t1 [^]ÁP8:D$D$@C7@<$GH8붸 [^]UEt @:]ø]UVS )d=7t^--T$XT$$3Ƅ=7tE$\1=7$S$=7 [^]ÍZ$2u뎍f$]$蝞fffUWVS0 f(uzE$z~}UU}} M߉ME؉4$#aƒ  UFD$ D$FD$4$蟉U9UX9UF?M- DQEmML$D$4$34$W`ƒ4S;} E8E}E;} tu}MMD$ FD$FD$4$fD$ FD$FD$4$fMAE9N~D$FD$4$!3mFM9ED$FD$4$2EE9;} tɀ}TUD$ ED$FD$4$fEHU9ЋUE9F M10[^_];} D$ uTED$FD$4$eED$FD$4$12xD$ D$FD$4$eeFD$FD$4$GeD$ FD$FD$4$&eFD$FD$4$1}tE9} uD$ FD$FD$4$dFD$FD$4$j1D$ ML$D$4$dFE[^_]UWVS0 !E}GDEE=798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$] fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]虁MEE9G~0W,10[^_]Ã]1^E:<$]?}1U |=7$]UVS V=7p t4$u N8@[^]ø[^]UVS| ut4$nu N8@[^]ø[^]US$@ E UD$ D$D$D$T$T$ D$D$E$$[]US$ |E UD$ D$D$D$T$T$ D$D$E$$[]fffffUWVS~ } uUE%tUG$3Ul 7tUF$U/ 7tBU$U 7,048<@DHLPEtE@$_ 7  $(EtE@$ 7TX\`dhlptxE tE @$)w 7|UUUUUUUUE}$tE$@$X 7U UUUUU U$U(Uċ,Eȋu(tE(@$,9 7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt%  TŰE@|E@hDž$&' E@,8@1fN9 4>ff~~ tωv$uE@,8@4F uf~n$O HG 9u͋940f|0yW}$G,@fD00f|0y.GDfJT$G|$uĴ[^_]Ë$#E@,8R|)4xLlx9kf+fdG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YUR, rfVAtωp$HN HF 9u͋tp9dl9h0\d$xy DžxEP$ty DžtEL$y DžEԉH$y Dž4$Wy Džx|Ƌ)΋)ȉlp9`l9E@,H1҉tvf~94>ff~~ t‰ljv$Fu}O, I4F uf~0r$H4O HG 9u͋9 Ƌ9p9pDžAlxE@,8@xM8MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bff~~ t‰׉v$u}O, 9I4F uf~k$b O HG 9uϋ9 p|9|)ȉ9xE@,@u0F,@‹NHJfB91ЉNDfHD$F|$YuXx=7}9Gx E@,@1fF9x4dff`FF tƉv$uE@,@4F vxfFXl)\N HF 9<$u,9|?EH,|f+f49@)fT094‰PЋLf`\Pp tv$UuEH,@D gE@,pfFE^*LN HF 9-$3utE@,8@1fF9t4PffXFF tƉv$)uE@,@4F otfFMh&LN HF 9;$u9|EH,|f+fD9@f+f|094xH8f`Txx tljv$uEH,@D8 KE@,pfFEЉM,LԉN HF 9Nj$u3|=7}9GG800D$E$/f1UWVS| óUu}}  7M  M 7  7  $( Q 7,048<@DHLP ,,} 7TX\`dhlptxE% TT} V 7|UUUUUUUUEE % ||}$ 7M MMMMM M$M(Mċ,UȋU$ UU}( 7]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $tUD$$t1D$4$t,t$<$ct}-T|$E$Dt} |D$E $t}$UT$E$$s}(EM̉L$E($syU$ U$T$ U T$UT$UT$UT$UT$ U T$UT$=7$w]U$ ,U$T$ U T$UT$UT$UT$UT$ U T$UT$=7$]USI EŒ=7t0ÁtZD>7tu=7 %BH[]US UE t0ÁtZD>7tu=7 %BH[]UWVS 0Eu] %tFDU>7^HFE~TFU1~_V,@M}@t~D8x ߉xf@9uڋ}9}uD$4$]]1[^_]Ã9}uf=7 Y[^_]U <UT$=7$]UVS Et=PHӁ>76u @D [^]Éց=7;1uڸ[^]UWVS< ñU Etzu<[^_]ËB$E@DE̋E@HEfEE@LfEEẺED$E@|$dEx|U B$yU BMADBEȃvgDE9tKuU M$^8@MąɋU  AxDE9uU <$U %>71t MAHALQDUEfEfEE}}ȉ|$A|$[|$E$1ҋEH~]E@,<1E@~=U E9p~*W DtL$Eȉ$E9p֋UăE9PD$E$ [<[^_]ËMA|tBf=7 U $@EH|U U :UT$=7$_]UWVSw }=70t=Gt6G$1&|$4$D$4$(Z1[^_]ø[^_]UWVS ßu} t=Gt6G$&|$4$D$4$Y1[^_]ø[^_]UVS ;EM tlPHց1>76u7PDQAP|tA\Rtu1[^]Éց=7;3u뭸[^]U UT$=7$J] ǀ UWVS8 hu=7E8-…2=7E̋2=7E؋2=7EЋ2|=7EG x=7EG$t=7E܋GTp=7EȋGXl=7EԋG\h=7EG`b=7Gla=7EGm`=7EGnE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FlNmEĈVnE4$"F=71ҋ2‰T$$V =7V=74$4$ 8[^_]=7E=7E=7E|=7Ex=7Et=7Ep=7El=7Eh=7Eb=7a=7E`=7EUWVS ;}D$4$ƅEdž3E Fdž2dž2dž2dž2dž2 3ǃ džh2džl2F`fFddž2dž3F FFFdž3dž3dž3 $3dž34$6t$<$}o2PJpdž2D$D$D$D$ D$D$4$TFD$D$D$D$ D$D$4$F4$a4$譏D$D$D$D$ D$D$4$謡F tjD$$4$$4$t4$4$6HH=7t 3t4$#4$A[^_]Ë2t$fd2$g29tDžu拆3$R4$J1[^_]ËRhD맍Z$BDžUWVSg }2t$c2$ig29tƅu拇2$g"<$a3$3$=798t<$[^_]<$r[^_]UWVS Ou, +9uǃ >ǃ <ǃ ^ǃ vǃ #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ  |ǃ$ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ  f2E@tgt.Ex tAu[^_]ËE싀t(VT$6;T$ D$D$E$ 1, Tp=u[^_]US îM1Tp, =u[]UWVS, }, EƍME$+)FF(9u݋uD$$F8CuxuD$$%$39yT$$<ǃ !ǃ +ǃ !ǃ ,ǃ< !ǃ -ǃd !ǃ .ǃ %ǃ 0ǃ4 %ǃ `ǃ\ %ǃ aǃ$ ǃ fǃL ǃ gǃt %ǃ hǃ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ< %ǃ mǃd <%ǃ nǃ %ǃ qǃ #ǃ oǃ, #ǃ sǃT %ǃ tǃ| $%ǃ uǃ 4%ǃ vǃ ,%ǃ wǃ %ǃ  xǃ ǃ$ ~ǃ #ǃ pǃ #ǃ rǃ d"ǃ yǃD e"ǃ zǃl ǃ {ǃ `"ǃ |ǃ ǃ  }E2xU, U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$6;L$ D$T$$Ep, }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^< $vd $# $:\ $'$ $#L $#~t $#l $-Z $-H $_6, $|$ $o $p $r $y $zD ${l $| $} UUS , ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0 6EU܉MDŽ=772EE4E, fEE$ƒ=4M4%y 4 44fǃ, EDPf~M䋑f8>@E, fWfcftf.MlU܅t=7Q)ʉ$1E$ƒE@ @M M4 /UfB 49}} 4% 44;4yf, @27f1҉Ѓ0[^_]ËE44%y 4EDPf, y4D$ D$D$$S 4449)‹4L$ T$U؋MȉD$E$4;4U}dž4…f, 4xp4fǃ, +E$/t3E$=Ec0U$)4fǃ, E܅U 0tE@ U؋4 E44B%y 44D$ D$E‰T$E$y4%y 4 494114M%y 4;4$fǃ, Mԋ4D$ T$U؋ED$E$U؋M ~4y 4 49411x 4Wy 4 494@27ff, @}AEE܅U$D-E$ƒUE@ @MM MtU-oE@ U؋4  UfB 9 4)fǃ, &E܅{t=7Q)NUj 4}} 4Hx6 44m4%x4|뿃ߋ 4}} 4%y  44;E@ }fG Ef` -D$ D$!D$,$M $WdU. »Efǂ, ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSX guDŽ=7MV8у$33-EEt=7E(V8t@N<)tE11iE}uDX[^_]ËFv3@|=7D$x=7$#ǀ3E AX[^_]EE] (.t&KEEED$D$ F@D$EĉD$Ủ$UuQUT$4$ M)v4$ 33} -!EED$D$ F@D$EĉD$}̉<$P|$4$& E1EE$E%V88uF @t7~ 8t!F }fG %E g3t&|=7D$x=7$M1҉3E@ U赿 NUT$=7$]UWVS 苿 u}ED$E D$4$t} u [^_]r [^_]UWVS 7 u=78E D$ED$<$3tu } [^_] [^_]US uE$ []fffffUWVS 豾 FƉ$2n $诺…t"ׄtN<$tȃuЃ [^_]ÀF$F Ut p@뮃$<UVS ñƍD$4$3n gD$4$n 4$im vlte110B<1ɀ;Pt0tD~ȃu9mt(B< v-1ɀ;Pu1[^]ø[^]É묀;tD01ɀ ɉ떀>uF[uVmtÃt0ZcWKUWVS0߼ tUu :uP92tU$9LUF@fu2ML$ MD$T$<$S2MEPJ(N$JN 3\g$JD$D$$XFTg$D$D$$'FXV ~$x=79|=7NTt=7 p=72P3B0ozpdH12džp2E苂E싂TEtU܉Udžp2ELɉME*EEUwD$Eԉ$U:E܋U؉$MMԉ $BE܅t2džx2EtEJdžx2dž|2UtE.dž|2E؃0[^_]ËHt1@@Dǀ@l@hǀǀǀ<HHpF$B(KE`U܋ED$<$i U|E>U܋ED$<$i Uu p2EU܋ED$<$Ri Up22@@ ,F@f`L$ D$D$<$2E41E$D$E$h u džx2EED$E$h u x2|$E$Zh x2Et ED$E$*h u dž|2EtD$E$h u |2|$E$g r|2c~ LSMt|$E$wg u x2dž|2EEdžt2džx2dž|2džp2MzEdžt2džx2dž|2EbtW|$E$f uDx2dž|2džt2džx2$dž|2EEdžt2džx2dž|2E&U˵ d=7D$E$]US裵 8Ex=7H$ |=7H t=7HT p=7HX b=7Hl ˜=72 p2< t28 x24 |20 2$QC[]U M„=7tJXp=71]ø]fffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS , ǽ}ƉDHfx 4 [^_]Ëf=tnfDN4f>tM$]QPf9uǀFF [^_]ËEFf\Nu]ED$$]覴MME$ ]PUMtbf@f@@ f@@f@@]\]X ]]UU9uU]p$%$eF]-D$ D$D$P$; $)F]$̺$ FUWVS G Ɖ׉M$a ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS裱 <Eu^9t)fxf8u@$9u׋~1$]9> $]ϵ4$ǵ[^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS脰 }fǃL $Pf9uǀ2ǃP ǃT ǃX S2@tL$h_ =w4D$T$$N2D9u[^_]Í$$ CUS e E E„=7t+2UT$$UPE []ø []U UM ~*=7t2t 1]É1]UWVS 赮 JDŽ=7te3339}}<31 [^_]à D$$詯‹t!3333뱸빋33D$BD$$F 33]\33o'U ۭ tE=7t%2UT$$1ɋUE]ø]U荭 &M„=7tJTt=71]ø]UWVSY }<$mƃuOG @tIHk 8u?DŽ=73t-|=7D$x=7$yqǀ3[^_]UWVS ڬ oEU=72El EE$3=X %y P T fǃL LNfu f9qL fmffjMUU$ E$mE@ @ME@ M P %y P T LNfL X T yt鋓P X 9fL y [^_]ËE$At3E$8=DEMR [^_]ÃUfB X T 9|l <X P 9fL [^_]ËP %y P ;T fǃL Eu-E$E@ @aσufF t=7Q)=X T Ef` [^_]ÿ-D$ D$ D$$2 $=UWVS$X uDŽ=7M~V8у$?p33-M MEt=7BEF8V<F11‹FUS 貆 GE U@C7RtI|t7:T$D$$x=7ǀ3@$ 1 []Ëxt:T$D$$/=7ǀ3@$ 뵸 []UWVS ~EƄ=72tt_ [^_]@C7@tǂ2:T$D$$@$ [^_]@C7@@ttǂ2@C7@jǂ2U =72$]ffUS]E  }t J;}R ;~1[]ÃUWVS詄 >}tG8 uZ@u[^_]ËtG~W,EO(G\p;}@ ;~E9uՋu뭉<$VG8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtTx^F9}WҐxR)9H t7~,}߉ˋF(D$NQT$$U191[^_]É봸USEt"H~X,19t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًUI9u1[^_]øUWVS}] UuG9)9UtYW,G(tX] UG(uU r9|_9}G(r 9 _9}"E E9E |1[^_]D$OL$$bE9oƉ\UED$ PT$D$$]UWVS}G~CW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]t]{tVO~Ww,19tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]UWVSĀ R433x,}396F8 ,4};~E<E1uuuuủuƉMD>EED$D$ M3@@D$ED$E$OV,UD>UЉ$oUЋM;4ED$ EF,D$D$3$bED>$$EENjE94~WD>D$E$AE!эP$U- D$UT$ ED$D$4$;EE[^_]F,D$D$E3$EV2MD$ T$FD$4$D$M2$ҸEE[^_]ErUWVS8=} ҚƉU̍R4EԉuЋ4M8<$, ƀ?tqE4EEEEE'E$賄M9ErIUU)ր?Et7E܉D$ t$|$E؉$讂Ey8[^_]EEEԋ@tCuҋEԍPMulEEЀ4uŨ8[^_]}E)9ǃEԍPtt$D$ $U. U)uMtMȉ׋uԋ6sRtftE‹u)uEmut$D$ $U UIuE)muuzEfUWVS,C{ ؘEօE93}ʅD-?@tDG@uM$Ub* MɋUM4M׍MMu܉ƉUE$7Ut7)ր?t.ED$ t$|$E$聀Eyĸ,[^_]Ëu܋U)׉|$$ؽ…tٍNDvu4]Xʉ1,[^_]ø1ɍ1USy ÆEw"cqD$$=3[]øUSy C=7t3tUT$$\[]øUS jy =7t&3tU T$UT$$( []øUSy ô=7t3tUT$$[]øUS x p=7t&3tU T$UT$$ []øUSx %=7t3tUT$$\[]øUSLx U =7t*3t ML$ T$UT$$<[]øUVSw Í=70toƆ43u'3tU$}3${[^]Ë2Ppt%T$$ D$2$[^]øUS dw U=7t$3tD$T$$ []øUw U=7t~;3TR4]1]USv o=7t3t$U[]øUSv 2=7t"3t$Ut DY[]øUWVS Tv =70Ɔ43uj33~BE14u_uE;3|Ճ}tO3$y [^_]Ë2Ptt&T$$D$2$ [^_]øUvu U=7MMM ] USOu =7t3t$Y[]øUWVS u å=70E E4ED$ D$MML$${tiP$UpDžtUU UED$ UT$ML$<$c{t&E$U%Ɖ<$y [^_]þUSHt ݑEt3t$gS[]øUWVSt ãu3t$"3~#14$sx;3|ߋ4$Zx3ǃdž3D$0$s4t`2PtD@@X~:Ɔ3cq$G/2@PX3@$41[^_]Ɔ3UWVSr Èu3t$3~#14$Xw93ߋ4$?w[^_]UWVS]r3Y3KE ~443 u} })u}}11]]9t0z9u}9u]1~39114uu;3|ى[^_]B,B\4u u )lj<)} t7ƉL|G1[^_]ÿUVSp ÐutNFX32@@T%D$4$ E D$FX$1[^]øUWVS p EExD$D$<$dxƅt,)‹M tEt|Etuu)1 [^_]ËE tmEtYutREM>7 u)1MfT$|$E $xE 01f%и [^_]øzUWVSo 3EEuE $+wƒw]}E(1M149rEtfEt1[^_]ÉEE $v,} E9tl$vtEHE 103EE1MM9rMEtfEtЪW‹EHE 1uu1U7U9rUEtfEtE%}>7t]ft  ؉EP1u 9r[^_]ÉE'[EGfmHfmBЪEfmEH>UVSdm UE ӁttH@[^]Í 7ʋ JHJHJ H JHJHJHJHJ H R$P$ [^]UWVSl Xutv4$}uVȉ‹9u F0$,qF,$!q=79pt]9p tJ9pt2t$ $p4$p1[^_]@u@ 9pu@9p uUF4$p>9UtU?$9Uu~X24H90t…#ȋH90utJ$Bp2UWVSk lj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVSi 1Ɖ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u=uAuIu 1[^_]@C7@@8tf@ۃf@t4$t4$뭸[^_]USUh MU =7t%t X@t @@f%f1[]ø[]U h U=7M u]]]Ug vU=7M u]]UVSg HE Œ=72Uu0ÁE% úډ1[^]ø[^]USUg U=7M u8tHX2H@H@[[8u1[] ʉP@[]Uf =7U]QUf q=7U]UVSf N=70tFFX2@Ttf@4$4$@C7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]g]UEU Mu]3]USEUu2U Á ӺEڋE1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]_UVSd ÑutFFX2@Ttf@4$4$@C7@@8tf@U 1[^]d &@C7PT1 t t t@t̀t(t t8t ttLt 1c f@C7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS b Gu4$2 D$t$=7$) [^]UVS ub u 4$ D$t$E$ [^]UWVS 79}t=79zH}z}JP9krT9`N)9c\]u܍D;9u׋WE1MfFM9yA,U[4ADEFFfFt$A|M$]aTu([^_]؉9BT9H)9)Ɖu9EMAIB[ωރtftEEE}9B,}4!}#zuŋJ)9q)؉E9E]u=[BI߉΃sEtftzmEm9FB,M4!]؋#zu띉ϋMG9 u9|-׋GD$ D$t$<$]U9w~׉BtU$]U$]1([^_]ÉJ)9>70RM܋E9M܋E׋W~iU1E9w~MG,U[_DUPXfXf@D$G|$]Qu`E9EuM܉r9M׋GD$ D$t$<$]9uuE7fP 1fUMI fUT$=7$j]UWVSE89tZ@EOE)w~>EP,G(UW,΋M4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UEt@]ø]UEt@]ø]UEt@]ø]UEt@ ]ø]UEt@]ø]UEt@]ø]UWVS(G Àe}GDE=798 GH%EWUOMG,E܍40UunыpG9UfFE9svffEF%M ȉFt$G|$Nu¸([^_]ËOU9~VUEEGGE܋D01E_GD$ ED$ED$<$%<$ 1([^_]EUF 8d=7$]USF dE]  *t&t  A  1[]øUWVSu} ^(1Ʌ~&1 ~у9tT,y)у9u[^_]UWVS0E ~cE,Ex=7E   E1|=7EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9 ~#tyڅlE)e)Uǃ 10[^_]UWVSD tb}W$G(E~w1U9w(~hD,tO L$y؉D$D0$tuED,yD$UЉD$D0$ tD,E9w(E[^_]EyUWVS)D þa}G(~"1D0$9D0$=#9w([^_]UWVSC yau 1~019t% 9 uDŽ  9uۉ[^_]ffffUWVS C a]ƉE׉UM$2L]EPt MA +B A(EEuFF]^]^FT4$]j 1ۋNv]uF,MzF.1ɉU܉fGU9VUGfGFD$]HG |$F|$3Ju [^_]ËEED$E@,$]CtыuF,U)D$F0$]iCtF0V]K +J K( <K,[+ZR,UʉUrprpP 9MuԋEU܋zUED$<$]KUBEE9FEP1 [^_]ËVE}ǍD$uF4$]vBÅF4F0V, M܉ً]Ӊ]u܉HXXXX @x9UuҋE];9NG EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS @ ]E]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$E=791[^_]C:}x=7=79ˆ=79Œ=79S9M 9u M S E|=789E9EE)Dž#EÈ=7tS} x }x$}u UM su 9+E|=78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U= W[E~M ~„=79B$t ]1]ËE 9B ]UWVS }= [UE =7Ex$9}h=7P H4 9unfH$p <19} JBzo=7P H4 9u80H$p <19}  0%D$E$hu)=7P H< 9H$p <19} E}x$} x x=7}:|=7} :2u #vt@:u$wvuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVS|; YEƄ=7ǁ3~^U ~W;A$t^U T$$D$=7$t [^_]ËE D$$t$1[^_]ËQ 9U u1UWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVSU: W}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$|$4${D$<$茸1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8u ⿉P81]Ã@]UWVS 9 VE} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]7BFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HR$x9tC9uՋMQ ztɋQuut duH8 uX8UWVS(7 rUEUMQI$3ƅ1ǀǀǀE܉$3EF,D$E$7ljF0MF4EFXFF]^EF^ F$EFE F F8FQE}Uu eiE E Eu,uED$ D$T$<$UEYDž$ ]9GD>7t =7 GH?G(GE G EG$M1UEE}E@,]7t-QMT$$LM>7uӋP@#Q@tA(t7t.U:D$D$ $hbH@@UtA8t7t.U:D$D$ $"bH@@UTt3t)U:L$D$$aH@U t8@t)U:L$D$$aH@ Ut8@t)U:L$D$$]aH@U@t8@ t)U:L$D$$ aH@@Uƀt8@t)U:L$D$$`H@Ut8@t)U:L$D$$`H@Ut5@4t&U:L$D$$i`H@Ut5@t&U:L$D$$/`H@U t5@t&U:L$D$$_H@ U@t5@t&U:L$D$$_H@@Ut5@t&U:L$D$$_H@UuLt<@t-Lt#:D$D$$8_H@[^_]Ë@@tU:L$D$$^H@UzUVS " h@@C7Rt @u [^]$K:D$D$@$^ [^]UWVSb" ?Eօ}„=7@U}GFGfFt$G $)OfNfUFɋ>8~xfHf@uEfx~SE@uJUR#h2u>78}}$J t$JutE1[^_]f~E@t܉=7fy~ӋUBvuGfd묅t}$:J {뎁T$=7$G}$J G_UEPT$ PT$P T$P$11f]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]뭉U델[^_]UWVS "=ǐ=7@@Mt@C7J y:ED$D$@C7@$6[B@$27#B@t2ED$D$@$ZB@(27#B@~>7t $hD[^_]uW~udt@C7:Et:D$D$BL$jZ`@@C7:E*@C7:EED$D$@T$ZB@,27#B@&ED$D$@L$Y`@>7[^_]UWVS 6;}ƉӉ$N,4;]u;} t;E"D$E D$ ED$|$$]6[^_]uUWVS :E=7Eԋ3 ]Ð=7]ZJx< XHUE@8@u B8@B B@ ]:t$D$@C7E@@D$XEԋ@@HT D$u4$]Hf8E@PhtfEԋsEHȅuvϋE=7EP,11M72@ x]9]MϋEu GuE܉D$<$] uԋHP]\$E؉$EiU؉PX9]uEHuȅt]9]E]9wy1E9|"E@EčPE9E9U܉&b׋EԋHuU܋uU94]EaE܉D$<$]GEԋ]u9XMu9qXXދM|=79rM I y`P]]9]EԋEP2xE@EH };G}G(9~E 3tE}:C w|MȉE3Fu)F)Ǎ)ƅ~ED$4$]tʋMȉ}yEE@@LEEԋHE@8Z ZE0tED9GEX ]@PE9‰UMEȉ$]0 EMЉÉ؉؍])؋])9EUr;wy1E9U܉Ą[^_]ËE>7}]C]SX@#h2f ]:D$D$Eȉ$QEP EԋPE׋P,] R4UE9x]DFfFt$D U$,UDfF4E9u]䍃gD$ ~9z_{}~r}41҉9} L$M4$]MuՋE̋K,SB9E}E@@%ƋE}9})EU*Ct}EU9/EEPB%9uUEuE}ċE)DžyE9U)E9EEE}ӉʋuEEȋEMȉEЉ]u]9]1MEȉE܋ZE@,}܋xB,p1҉]M؉M9}L$M4$]TuՋM؋E̋]9]EEEȃE]9\]EE90}уAy9Ex$EaE̋K,E؋mEăpSBE܋]؋}̋7N,"XV9EM$^E@8MEԋP]CD$CE$]CD$C$ESPSPU܉EE$]t,M؋E̋E}Љ9}9}r}h}ӋBM E]ȉ]ȋ}MӋBy9nE܋U9~EċEBDM9l tSl BDt$B|$]gFfFEBLfF9uE̋sE;` _C1ɍl UL$D$ <$]U€w֍V)‰։L$D$<$]S‰EЋE̋@` d EȉE]9~]E])؉E؋UĉЋ])؃EEH,E9p]]]E])؋UЋUЉ֙Ӊ]1uu܉1M9| M9]9]9]E؅& 9]܋KȋŰrU9Sf E䍐l E̋@=vuEEE܋Hىωָ   tftEE =wEဃ)ȋ]܋Kωփ~ tftE܋]ЉXE̋BD$ D$ED$$]蚇EIeWdIt$D$$]D-d]:t$D$$CMčGED$D$ E؉D$|$$]M U܉ MDD$)ȉD$ ]؉\$EȉD$$] EE@T]:L$MD$$CU܉E܋ML$D$E@$BE܉؉}܃}EUqd^]̋R, ]9]uE]E@,E]EE9E|EH,EE}؅EX]@E܋}ȋE)NjE@X0ppuCpM}UčJŰ;JSHFEĉD$ML$$](d:t$D$$AD$D$ D$M܉L$U$t$D$U@@p$6AD$D$ EĉD$D$$U@|$$xct$1|$$@E̋@D$D$}@@0$]9ct$D$$@D$D$ D$D$Eĉ$&t$D$@@p$O@D$E܉D$ ED$D$$t uD$1D$ ED$E܉D$E$]1:U؉t$D$E@$]?U؃9uHvtHT1҉Ut$D$E@H$];?U9uUD$1ۉ\$ EĉD$E܉D$E$]|$E@$wa:t$D$$>E)ED$D$ D$D$E$]TE@|$$at$D$$c>D$E܉D$ ED$D$E؉$] H } D$1D$ EĉD$E܉D$E$]1:U؉t$D$E@H$]=U؃9u2 1E@Ut$D$$]}=U9u ppu;t#t}učNŰ;JXLJEĉD$ED$$]_:t$D$$<D$D$ D$M܉L$M $tt$D$U@@p$<D$D$ ED$D$$*U@]؉\$$]^t$1|$$5<E̋@D$D$}@@0$]^t$D$$;D$D$ D$D$EYučD>ED$D$ D$E܉D$E$]TE@t ]̋ ;qtE؉D$$]]:t$D$$C;D$D$ ED$D$EЉ$]E@E؉D$$]:T$D$$:D$E܉D$ ED$D$E$]SE:Ủt$D$E@$]c:Ũut$D$E@L$]):u 3E:t$D$E@$]9uLN E̋];X= iE:Ủt$D$E@L$]y9Ũu)D$D$ ED$E܉D$E$]|$E@9E؋]9Efuucfr 1t`u 9}tQpt$$]uE䍐l E܋HcfwZ]䍓l T$Uu܋F$NU 1ɋE䍸l E䋀d EE܉E9EBEEUWVS a]Ƅ=719X‰PtAC:uf11ɋCD$ CD$C D$C$KtB[^_]5C9u=7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]U =7$]UWVS ru] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]FF9u=7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVS óut$;#vu[^]UWVS À}GDE=798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$wD$D$<$"1EU G=7$]UEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVS: U} w to1t6~RutF$u1[^_]ÉU$t8U F@RuDžtÉv$IuG 멃UEU  HJHfJHfJU @ E]UVSV utv$u[^]UWVS # øMq~X1Q,zQ~>1҉EM׋q tMv$uME9xԋEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]} 111 ȉt %1ȃu1Lȉt %1ȃuڋK t4u14Ɓt %1uۋIuҋu9h[^_]1[^_]US 8E t$D$ $Vx) 1[]É$1[]øUWVS0G U  E싃 E@C7HApEЅb=7EE䋳 utayFEԋE%Ey E܋EԋuƋUE99ЅyBU)u܋UE)‰U.E9EEEƋEU)ЉE9gFEԉu܋ u)y ‹u)֋Uu9Guԅ+^x=7uu܍t9B~ Eԅ3D$D$ $/ǃ EЋ EE1ҋ EMM܀}EEa=7> ; ЋM)ȉEԋHAEЅzEEE9E| E9AT$D$EЉ$$/@P# ǃ ; ^J U =7UfT$D$$. >u Eu@@l8  ; J Alu (D$ E$…y )Љ p t}쉻 }艻 0[^_]Ë=b=7EEU싃 EMM܀})y uyFȉEa=7> =7ЋM)ȉEԋHAEЅ ; }xM9M M9M D$ $) ǃ ; t E܋E9 E"t$D$$, ; ~a p @@xu XD$E$,y)  ;  < t$D$@$,  ;  u؀> u)ʃ|=7E䍃 EԍEfșƍry )ƋE9@M؉L$D$$V+ EE0u9~1$  ]$uXE܉E ;  Ɛ=7u܋R,r@E؍ E0   u R9 E܋EP, 4v4F‰EEu@M؉L$D$$* yu9D$D$EЉ$)ǃ ǃ UNE;H@uRFuLf~-$ D$ D$F $?V f= @$  tD$ Eԉ$װ…y )Љ 덋@lT$D$$(  E9 EЉEԉu($ \] t'D$ Eԉ$$y) $ ǃ D$ $ǯy)  E)ȃ9u@D$D$$' 9  E"t$D$$^' ; ~b @@xuɋ t5D$E$y) $ f0$U됉Ƌ t*D$ $芮y) $ 1ҋ EUWVS o E苃 |=7M19|  9 x=7E@C79 9=7E:E)$ JEu ǃ E98.@@ltˋM t‹UT$D$$%뵉 PBh9}d T$t$$GƅtDE; t4$Ș U :D$D$4$%uU1  [^_]Ë =7Eu@@h9ME4M䉋 E;0 GE  @C7p >u~x =7U:t$D$$I$mtGUt @@tut$D$$$@@lu$ gmu ǃ x=7E 9P))Ή $ 둋 xǃ Uh U U U  U 11]U, U U U  U E1]ffffffUWVS v%=72=7E=7]19u9uV~sF,E1҉MEF~PCH1U 9F~59uuS9~S 9}͉9FˋU9VMIg[^_]Ë]S~Cs,~DUMڋXCӉu΁9u9uu9utɃ9u (@C7BH8~NHD~GBlthtËuu拐tt 1" @C7@ xUWVS( ƉEY@C7EBH8ˁ:ul=7u@D*= }h=7LJ DŽ=7Y\A`fAdBt%]:D$D$ $N EBt8]:D$D$ $ =7p2!P@EBlhzǁl2ǁh2BxT2@@Tƒth2t h2t h2t h2 t h2 @t h2@t h2t h2EHA\$fǁrǁt"fǁ~ǁfǁǁfǁǁfǁǁfǁǁtmfǁǁtLtfǁǁ~/Rrff@f@@ 9uǁp"ǁt"~&p"p"ff@@9u}苇 %ȋp"t"LJ  LJ 2=7E=7E E9tE9tE苘 ZHB~UJr,EEU܉}؉ϋ~HQE% ؉9u9uuҋU܋}D$$]_j1([^_]øEh=7ȋtǁl2wl=7Ћtǁl2Ntttǁl2)UWVS ;EU MfUfMf]h=7;7Lftvl=7949)=7l2tot"уt>]f9p"t"]fp"]fr" 1[^_]Ét"ufp"ufr"fMfvt]fufEftwft8fXfEMfCfE8fufEfEfE}f9r"*t"BfEfE'UVS ªEM ]f„=7;B`N4f1Dfl2t1[^]ftf/ftTfufft9#ft*fuffuffufffff릸yUWVS$7 U} uEEEƉEljEf„=7;B\ @ frftufv@C7 I ytX2RtE}|$}|$ ut$D$$-;:T$D$$1$[^_]øUf Efx?„=7;B\}1@rU f tUf vEf1]ø] „=7ǀǀh=7 t% ǂp"ǂt"  u1U勀 %1]UWVS} }M „=7l2t^ffǀh=7 t) fp"fr"ǂt"  ug1[^_]f3fthfufto'ftVfmcfuؾfLB %1[^_]þ뜻닻^ =7h2UVS A Ƅ=7l2tu?@C7Rt*:D$D$$027M!A@f@d [^]UWVS ^ tǐ=7} 3x@tOu f„=7f9pdt6l2t*ǐ=7fpdQ@E % ЉA@[^_]΍N} f_f|Sǐ=7UL$2@$7:L$D$$UUULf`L$2@t΍N} ff|ǐ=7UL$2@l$ 7:L$D$$bUUULfL$2@h$6:L$D$$UUǐ=7$UM fxGUǐ=7$sUM f 7=7f@dUWVS U=7pFFy ;F|# tH4$h [^_]Ét$${UWVS ðUu FFy ;F|# tH4$xh [^_]Ét$$zUWVS S=7x|$E$Ɖ<$&h [^_]UWVS| } |$E$kƉ<$g [^_]UWVSA U=7tJ } xCH9M ;X9}4xp,9"49M uM HP1[^_]Ë#ָ[^_]UWVSEM UtK xEpu9|;p9~4Xx,9"<79Uu7PH1[^_]Ë4&ָ[^_]UWVS Uztzr BEuNjEBw u)]ZڋOM)ʉ x=_]93O9},_w,9~ ! ΋M9u3GWGu [^_]fUWVS@ VE}E E EE E @$]^ÅxyGEGE؋E @ G]% upEp=7E_E))9@L$ED$<$]؃@[^_]û놃 uG1뼸@[^_]ËG,U؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9r)UԋAFAFA F AF9sڋMA E @EȉE E%AfYE HvJM܉]ĉ}}$]M \_ XG E9u͋]ċ}EԃUt1Mٍr}}ȉ8)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]Q<$vM1 EGy1G1 <$] E9GT G8  <$]T1E D$<$]v1 UԋUЉE  E9:]ȉMĉ:BD|$B|U$]-UBHGfG9}s*w tUv$]uUG 뜉]ȋMĉU UT$=7$&]UWVS xu}ED$E D$4$t} u [^_] [^_]UWVS $u=78E D$ED$<$tu } [^_] [^_]ffUWVS|- E}}M E $]EQw$]E1EHMGEȋGEEċE @M qMMMp=7M t[E2 $ ]AÅyEEę)EEĉEċt& uE9GTu G8 )EȋuڋwGEM)ȃM9EEċGEȋE ]EMp=7MU rUUEM  / m$ ]RDžyE]ĉؙ)Mˉ]ME Et MuM} EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9ZU@t)G$fE9r)UGFGFG F GF9sڋEȋUUċu}ỦUUĉU]ȉ]UUuEȋ^,EEEF@ED$ED$ED$ ED$ED$4$]&mmuE]4EȋQT$ UT$D$ $M]LE 8 MQA(TE@ 9}E <U1UĉU uKEEEEE E E$]yVMmEEMmEąy1EămyEF$]y)EE9EbEWMFE EĉE_$]QymEHU8mEąy1EċF$] y)E<9e}U&FHGGfGfG9}FD|$F|$]luE$]C|[^_]ËyQUEĉAEȉA $]{MyUQE9ATtNEȃE u{}ω4$]<$qE1|[^_]E $]xyMEu붋E$]=U hU T$UT$=7$q]UWVS 3uEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U  D$UT$=7$]UWVS |u}ED$E D$4$tE} u [^_]h [^_]UWVS !EE}=70E D$ED$4$t}EE u[^_][^_]UWVS ' üu=78E D$ED$<$#tEu } [^_] [^_]fffUWVS VÉUM-ljEDWp1҉]]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}‰ DOu냉1sUWVS( \EUM؋ufUވM݋U 1ɋU EEԋ}-Et$$UEx}P$u܀G$N Ut}EMU E1‹E Et~MލAf qCDXЙDžNE݉Et$E$Uu0Eu1([^_]À}. G}ԅ~Mȃf wCDXDž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ Ƶt$D$$E[^]ûu111[^]U }  D$ ED$E D$E$]U 5  D$ D$D$E$]UWVS] Nj2FEF<\<^t{Ѝ\-r7%Ӎru<: <&~Hپ!J'JP'EE[^_]ÍFFZ%P- QuJ{E< v^]v.F<-]1DsD]}MMލ[{D~Dyuu}M؍\u2<\u7{ESȍэf  ΍ f )ʃ0Qfv)f )ڍ)Ѓ0P}E[^_]ÍJ{P]1TQu<.tt]<*yMl1nVU}uf%p}O0J%}d J]܈ZQUdEVU}f%p}O0JJMf%ctEF =8}Ef%pPU}W0PUEtEHM%+%c֋EE&VU%p0%Bp0%{B2}%*fB %-}O0JJUECVU%p0%B{10}B%/%{B 16}%B*%p0B%{10B}%m%B+}O0JJUE'UB\E%p0%@p0%?}W0PPEUMU܉ȉMbËE%>%tEU܋EFt E%+%;E֋EEL1<1JfKMC|D7<\F=]EPU\EUVS ê@C7t t~9t $sK EED$D$E $`uI tG@t  >7  @x [^]É댋E[^]É @uUWVS(J UEtBEE@C7E}<$j UT$ D$D$<$u蹵N)),`U܉e)‹M),`UѸg4 )3 nD$<$j EtTH tCp$1҉}܉ 9t-~fuUE܉D$$mj UuF([^_]1([^_]ËP 3n([^_]UWVS( ÐUEtBEE@C7E܋u4$Pi UT$ D$D$4$襐}kLЍB)_UeЍBM)_UѸ>Љ)<;lD$4$Zi E܋tRH t>x$1҉u܉ 9t(nuME܉D$$i MuՋGy([^_]Ë;l@x([^_]UWVS(觸 <UEtBEE@C7E܋pu4$g UT$ D$D$4$Q}-?L) RЍ)ЍYGEeE)  IȍE) GE*SRЍ)<;`D$4$g E܋;`AQ tJy$E܉u9t(~suED$$g uދF E܃9u؋E܅t EDžEE1LD$4$e  u݉4$0e NjE$e EED8M9s1=MED$E$蜶EE9EtqPf, t$$UKU:EML$$K}UUED4EHUE]}<$Hd UĉT$ D$D$<$蝋uĹN))ƋE40e)‹E)ЋM g4 )3 nD$<$^d EuEEAuPEEU 9uthuJf, WT$U $MlJU$Qc MT=L$M$UBJM $'c Uƒ9uuEd[^_]ËE$i}<$b UĉT$ D$D$<$CMĸkLЍB)_EkLeЍBE)_M>Љ)ElD$<$b -VUE}<$-b UĉT$ D$D$<$肉Mĸ-?L) @)ЍYAE-?LeȋE) @E)AM*SRЍ)`UD$<$b Ute}tu}cu }uFEE3n$z<EEl$J=`$0>렃}u E$1҉UffffffUWVS1 E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUn Uƍp@Hπw09}맋E D똉Un UUWVSj 48,.օR@08G4<11$rD$ \$4$01󫋅0t=1(}J90t <u 90u狵(P)1~u,H]Y8^4~!%u~V%8H4X0@,q9r0t$$4V8C,s0K40u4  8$4ժ8  @0@4$4衪8G,_G0Gƅ`%4- Dž,Dž$Dž(Dža`0:~LJwDɋ44oXKJw! .ʋ DNt{,4ʍ\qЉ,'~>aDž,>~`B<=w^4oW0)?(t9,> z$t-.(M,Dž,Dž(hDž$YilP[J߸ V8uo'dwEOI PDEG/8W,G4G,[^_]É,] CEP0 ]P,&Vҋ4pE EP(, B08H4X0@,T9BtD(\$ `T$0\$ȉ$4Gt8C412<'urR1҉,,0O0PD]PEEP08P4H0@,Z9PJ8K40U{UJP,0$4Y 0,OPDŽPUw}7D$$">D$t$$-‰E$20UtYEE[^_]ÍZ$'ƅSE1ҋEEut$D$$eM$-@ x Utb}ut$JgD$$)EJpD$$$; Ex t;MEt$_gD$$轰D$$觰ED$D$ht@E$uB tEftUft IA(QuEt E1-$t!D$D$$RB(8$tD$D$$RB끃}@D$$ïF@$3F$(F $F0$4$ [^]UWVSS }wu G9r [^_]Ått$$jtw[^_]É4$!UWVS ǐU MuR u+ftO؃tXf;0t&nt(suXDuM 1ۉ[^_]ËEx DC볃UWVS x E 0@ Eu Ct8t\tɀ^tăt8uH[^_]ùx1[^_]ÉdUWVS5 ʤuNE|F9sXtd|$$RtH~NU fFF}t<]fFFF [^_]Ëu1[^_]É<$Ă렋}<FUWVS<荆 "E@ EE@ 0t$$sM4$E@E܋uFX1tftE$越u}D$|<$o HM|$E@ $E$a5 xDMED$E@$M;UBNju`P0@|$E@ $k$E4 Ǎ@ED>D$E@$zUu$ĉEE<[^_]ËMAOMփEtfEtǤ$|E܉$qEP p,@ @(@$@,׃ EtU?Wx0My ɍL L$ T$D$E$$t8}uWfUE$貈Ep@@LEMA@AHADALudfxA 111D$ T$L$t$D$ED$ ED$D$E$tam7GED7Mnts{HP|1뉃}t>px111rx@11buE4$談E<[^_]px1113u܉4$胇֨u8uDMUU)h$wEU r}fm몍h$8E0GU7UWVSS UJEtB9swt$U$iUt]rJ] fBB ]fBxzE:us:u.u'EBB [^_]Ëu1[^_]äftu%u0tۉ4$}U]EfUWVSH ݞuVzF9sHtT|$$it8~VM f FHNMLF [^_]Ëu1[^_]É<$|UWVSX辀 WED$,E$} D$|$]_xD$|4$] PU4$]/ = t<$/ = E$]/ = D$$P];ÉE܅F@ t$$<Et E 2t E D$,E$qEN EEE-E̋EE u<.tjDy@u붋}]9 D$ED$4$]赖ËE8g E E܃x f_EĉUED$ EԉD$E썈hL$E $@EċUڍwEJЀv)ύ)ȍlD$4$# u [^_]ÿU:s ǐE=w ]1]UWVS s Ùu4$" UT$ D$D$4$I}-?L) RЍ)ЍGEeE)  IȍE) GE*S)ύɍD$4$n" u [^_]ÿUWVS4r ïufF(}ȉ|$$ t4[^_]É<$C1t9LufV(4[^_]UWVSq LuL L >7fV E>7 4$@V(EfD$FD$L $U=UwDE |)ʉM싆t7T$UD$E$>U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$>7[^_]ËUыU|UVSmp utgF$tF$tF$tF $tF$$tF,$t4$t9L t 1[^]ǃL o L @o nL @tÍfffffffUWVSo 6lj$U D$$ * Et$UT$,0U$19UuED$$ * 1[^_]ÉUED$$ b* L$3UD$3UD, UWVSdn [8EE1EEƍLEE> tqE9D$t$U$1Utˋ$20$2UDŽ0?, 5Euu ;t1< tHv0FIU$20$1UDŽ0UWVS<#m ø8U11ɍLt6u* E+<ȁ<[^_]Ã0u@W@0ƃ:uVƅ/lFu,$ё9L$貑  Ή$k0D$Y0D$D$ D$D$o4$k{qD$@|$/$d:tRP:uVpƅz빉1$L/Ή$[2Ή$*/D$/$ /D$2ω$.D$.B$E$/i$ϑƅD$/4$%/tY1ɉL$T$/T$T$ L$D$4$Dt$iD$${B1҉T$T$ L$D$4$빉oivFUWVS $LuT$ U MT$L$$ L$\+u`[^_]øGUWVS ~d Exw|,M0t_ƃtAkƍLU$(ED$(UED [^_]ÃLu$(Ɖ [^_]UWVSpc d}EU 8uM1ɋ]p3,M0mQm8@E~Eߺ81xEM}EL )|$t$ʉUM$]M&MUЉ΋ʉU$]P'}D$A'UD !L\$T$$] ]U+p[^_]ê0f%.t&CD$D$ ]ԏD$D$@}<$Gj뉉f>~$E~LSC9u1Uf~7g] ];USta EPw*0tf -[]ÃLu$([]USa ô~EPw*0t -[]ÃLuU T$$[]UVS ` W~uD$:4$t!D$ST$$YtE D$4$Ɛ [^]{ - [^]UVS J` }uD$:4$t!D$ST$$tE D$D$4$# [^]ËE D$D$4$ [^]US _ Y}EMPw*0t - []ÃLuL$U T$$# []USa_ |UBw0t1[]ÃLu$[]UVS _ î|uD$:4$qt!D$ST$$谡tE D$4$蝏 [^] - [^]fffffffUWVS^ &|}E1E xt=1}t ƒu@u[^_]UWVSĀ^ ǫ{}E|8xƋE 1@ E0 E|1E]EH Eƒx  EB A ǁE9uʋE%u   EpxEPMHx }1E]uJ˃4x MN K u9uʋ]uE%BzBE9yxE+?1[^_]ËU 1ۍ̮U @t?Elt鸓$I )9uu1믋}@ E1ۍlE0 EEEu1}}}8ktDAuEƃ@E}t,ى%I$))9D E9u }u _]uE ^@]L1҃DD [ u̓E9uE, a:!@t$E Du۸@u܋} Ƈ LE}8 L8 0u} ]l ]E M }~Et M  ЋU 1ҋMDŽl  r1ɉ]] u]U1 L ȉу9uMՉʉ EMU1 L ȃ9uMՉʉ MEE@ttM Љʃ Љ Ѝ Љ ЋU‹Elt 1itEUEEt @FEǀ ]0UWVSXoX uuE EM8ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EE, EEEƃ4x  EF A Eu1E1EE܉}ԉEEƃ4x  NjF A E؃uĉ}EEHE EEˉuEE܋E؋uu؉EEuuEE]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋ ]3 ]3 ]3 3 3! 3" ]3# 1EEԋ$ ]3% ]3& ]3' 3( 3) 3* ]3+ 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}u u3 u1E䋼$ u3% E1ljE3 3& 3 3' 3 3( 3! 3) 3" 3* 3# E3+ }m1]E%MɁ ȉEE%MɁ ȉE1E1 EEE0Ãx  NjC A EuċE8upuE+u!1X[^_]ËMEd 4UWVSP4T qE̋uM M8EЉNjE19$}܍]]ȉ9u<$…E<_t:t< t<:tMAE̍=i}ЋU+ZP[^_]ÉUĉ}؋}1D$ D$E؉D$$u+EҀ09uE؉$tEԀ8*sx0iE̍@idEEEEEyD$ D$$<$]W9tD$ )D$|$E؉$Bf}2ae}sha1f}1 }argo}argo}argo}n2d}M̈l _ȍp l MEE Ȁ`QŃ?}<9E ЉEE9uËUċEEԃEM̍q MEM̍M/^Ń?}t}<9U}Ĉ  ڃM4`À@~^뿍^҃?뷀@~Q>Q҃?3}EԉD$4$p< .t&U<:MMEM̍l MME&}n2idN}DEԉD$4$대}EԉD$4$ nEËED$ T$EȉD$}̍ $,EfM ȃ?9K?9K ?9K8EfM ȃ?9K?9K ?9K8CEf?9K ?9K 8CC EEԉD$4$I2}n2i]UWVS)O lE8EEXUэuuUS1r 9uZ9MuߋU$U+u[^_]Ë]~UWVS,N JlE؋U8ENjE1Z}uU܍S1MJ 9uMZ9uڋU܉U} D$ D$|$<$uEUZ8uECу9uF9t܋E}U+u,[^_]ø]蝐UWVSDM fkU uU8‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$h @D$$ D@D $9sÁ t׉D$@BD$ <$L$ $?293?!~9.?J9)1?߲9%?+59#?x}9#DžTDžJD$$LD$$L(D$$P489ȉ )ڋ09<} D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$n$D$$tD(,481։ 1 <90Dž|Dž@mDž ^DžODž@Dž1RUWVSI gEu 8‹E1D$D$H $$zDžDž4$e8$u it$4$Ɖ$TDžD$$8vu[x=uUT$$ D$$p DžDžDž DžDžZ|$4$3ptjtmt2$FL1U+LĬ[^_]ÍT$$x*tT$$y6OT$$xۋ%t$Oi$uDž!t$Wi$DžID$$ƉDžDž|Dž[<Hv2BIڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/Ӄ? ЃA! = ЅiD$$?t*D$ (D$D$p$$]I 4$0|$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$tD$D$4$tD$D$|4$tD$D$p$ut$%D$_iD$-$UVS-C `uv$CE‰)Ѓ[^]øh`UWVS4B `ÉED$siut$u 4$蒅u3D$ ED$$EE8$E $]Dh`)‰UE E h`9tt$u+E E܋E$]NjED$ut$u t$u܉t$ ziD$D$bJ E$J t$|$ ML$D$E$_}v/lj|$t$ ED$D$<$/9]uىE D$E܉D$ED$ED$ ]荃iD$D$b}<$=U^D$O O ȉD$$9EPU9uD$]J J  J ȉD$$EPU@D$D$4$qE4[^_]14[^_]EWfffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSƉEfM䍾}܁H1۹1҉}f;]ǃ? u}19uEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uu9Muƃ[^_]ÉǻLUWVS< ƞY9ɍl  dH USHf`TEPƋ@D1\f;`6 uދ\19u111ۍhXdLD1` Ѐtfu Ѐu拕`1Љd1f< Ȁu1hXLTdPhxP9GTP0`DP1\f? uዽ\1Љd1fH Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@D98uԋX1ɉ`T1f|=؃ u9uѻ@TXO9uu⋽`E؉`]BbJ9uߋHfǂLK $2?ƂNK aHLK ƄLK $,T$ iT$D$$7D4$k`D$HD$T$d14U+u{[^_]Íxƅ??tOlEȉDRHuUWVS3 ÕPu(} 8E14$\$?$u 1H$9u勅)ȉx  @4$+$D$(|$4$D$iD$4$kT$|$4$O}<$$D$(L$<$(T$T$<$ $D$(L$<$|$0, $ $lj~T$,D$4$Dž0Dž4Dž8Dž<$,D$4$Wt&D$uڋ(D$4$1uڋfǃK $1ƃK $ D$D$K $ ND$xiD$ B$Ot$,$1s$D$(D$<$ ɋ D$,D$<$d|$,$B<$ʉ)Ѹ%I$))Љ)‰ :D$,D$<$ ɋuo$D$(D$<$9$D$(D$<$ D$D$<$Z $D$(D$<$3p D$D$<$  ?K K D$06 < ȉD$$K K D$17 = ȉD$$=K K D$28 > ȉD$$K K D$39 ? ȉD$$K K D$4: 5 ȉD$$wK K D$;T$$MK PK @D$D$,$]E+[^_]À$')MDž0Dž4Dž8Dž<Dž Dž Dž(oUWVSX, IMMUu8ƋE1@Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\E[1ۍT009u$.D$@|$<$董E D$D$<$x|$$袥<$D$@t$<$JD$t$<$0|$4$`E+[^_]Éu4$nUT$L$4$Ңt$4$Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\TkfUWVSQ( EutJD$ED$4$'NjE9t.8u),8"tE 81[^_]Ãu1UVS' tEEU ]~Í,у? H9u[^]UVS' 5EEU ]~Íу? H9u[^]ffffffUWVS8Q' DƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$t8[^_]É<$5uEĉ|$4$Eă8[^_]U& =DEt t&t1]ËM t6i]ËE ti]ËE ti]ÍFi]ÍWi]ÍOi]UWVS:& Cu} 4$9uw[^_][^_]UWVSd% ÇCu}$}(E($!EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$a…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$ <$)UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$)8UtE(D$}<$} E0D$E,$k <$(jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSv! ?u4$xu1҉[^][^]UVS>! >u4$@u[^][^]UVS! Ø>u4$u[^]}[^]UWVS \>}u <$ …uA}wLU>…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSXF =M $ƉEE$6ljE4$)ƉEE EEEED$ML$}<$1t.1EM $d$M $Y$4$Q$EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS i<}u <$ …u8T…u+t"11U2 у9uUɃy Ѓ[^_]úUWVSc ;}u <$b …u=…u+t"11U2 у9uUɃy Ѓ[^_]úUWVS Â;}u <$ …u=h…u+t"11U2 у9uUɃy Ѓ[^_]úU ;E##+pፂi]Í]ÍH]Í]Íi]Í3k]ÍKk]Í^k]Íok]Í]ÍL]Í]Ík]Í]Í]Í]Í$]Íi]Íi]Íj]Íj]Í-j]Í>j]Í[j]Íwj]Íj]Íj]Íj]Íj]Íj]Íj]Í k]Í]Ík]Ík]Ík]Ík]UWVS ' ü9EwrE$c5NjE $V5ƋE$I5E|7E$ 5EU׋E$4ƋE$ 5 [^_]Ãu$ tffffUS o 9U T$D$U$CL []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVS]u 1ɋ΋T11Tu[^]UVSW 7u Ee…t5҅u.URу+?҃/ [^]UWVS É։ϋMER)Ѓt$9uuE [^_]ÃEE9sDE11փE? كCwʋE9EuljUt)?UZsEE9rEE [^_]UWVSEUEEEEM4u}Ov(}W];;}}UM0~^z) ҍ^!ڻZ) ! ڍ~л9) Ӄ! ˃+Ӄ>΃/փ? ҃A! ځ}w ҅Uu}M[^_]1[^_]UWVSE0 wG׉1w7  r-у0 v9t}0t ؃[^_]Ã9t1ۉ؃[^_]UWVS * ÿ u} FEFED$E$O?$ug$EuD$EUT$<$0u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=u}tUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXY }EE8UE1D$E$wƋẺ$-E+} f$OME Eĉ4$rU9PMMȃ/MU)ƒ$v=yM}BEŰB8D$LUĉT$ D$D$u҉uȉ4$J4$ޚ‹E9\BPBMыE)Ѓ+$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$I4$W9M@}uȃoMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$H4$̙‹E9JBacMыE)Ѓ,p=yM}EŰB0D$UĉT$ D$D$uȉ4$mH4$E‹E9BEЋM)уf$xqE̋H@$i)ƉZf$E̋0QG}̋O $N1}E+/EX[^_]Ë}ȤA}f}ȃ0f0ft&"ffvE}}qM^rEM)M(W}ȃ}f}ȃE҈AyuӉfE҈AyuӉfE҈AyuӉ fE҈AyuӉ$fE)UMR)уtu]UVSU ṽщcw[^]ffffUWVS_ |$`Ѝ$$X03ps$X$\2z9uً$XA$\A$`A $dA$hA$lA$pA$tA $xA$$|A($A,$A0$A4$A8$A<$A@QD5т歁RQ$$AHQL5l>+h$$APQT5kAكD$ T$$AXQ\5y!~[D$pT$t$X$\D$PT$T$x$|$`$dD$@T$D$$$$$h$lD$(T$,$$D$xT$|$p$tD$T$$$D$hT$lD$` T$D$06_D$4:OD$8+D$ $D$PT$T$X$\D$pT$t$$D$8T$<$$$$$$D$@T$D$`$d$$$$D$0T$4$$D$xT$|$$D$(T$,$h$l$$$$D$HT$L$$D$hT$l$$D$T$$p$tD$ T$$$$D$XT$\$$$x$|ȍ$$X3J3Z3 3ZX9ue[^_]UWVS]u {@1ɼCg jC;ʄC gC+Crn+C,hC0kAC4كC8y!~C<[ڍ~@M]u 01pq]u11r9u]u 1[^_]êCf8fUWVSLS uE 8U1҅P?EEEEEEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$tFXF\FPFT UWVS]Es8U -ST SP!<}J`)ЉE< u zeSC@SDC@SD1EU19EsH{LS`#ǃE}} =%M ȉEC@SDEUC@SD1U9иEs11sH{LʉMM逋E)=w}U `< u s,uu1[^_]äftuauit11t&fuUu<oҹ`^PffE pE땸+UWVS tlj(UE u8, M1ɅH?fM?W0E1Dž2Dž6Dž:Dž>0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$$&$p 1߃}rMEuQEuHD$\$$$D$$(e1,U+[^_]äfEtD$$$($tBXB\BPBTD$$D$$$Ǽ$t맋(`UWVS\ )ML$} 8D$‹D$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$T΋9EAT AP1F@VDF@VD1FHVL%t$FPFT)ȍT`D$D$$dV`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$~r!D$0 r"D$0 r!D$06 ir"D$0Kr!D$0f -r!D$0Hr!D$0* q!D$0 6q!D$06@ q!D$0Iq!D$0 yq"D$0q[q!D$0v, =q!D$0Xaq"D$0:bq!D$0p!D$0|p!D$0gp!D$0Np"D$0kp!D$0Mp!D$0h6/p!D$0Jp!D$0,o!D$0o!D$0o!D$0,o!D$0m{o!D$0]o"D$0x ?o!D$0Z!o!D$0<[lRJln"D$0n"D$0n"D$0n"D$0n"D$0n"D$0n"D$0kn"D$0Wn"D$0rCn"D$0^/n"D$0JzAك\$02كJكzzك\$0-t$D$$5t$ D$D$Gn$8\-D$ D$D$4n$88-D$ D$D$m$h8R-D$ D$D$ n$68-D$ D$D$l$8-D$ D$D$m$7l!D$0-D$ D$D$m$7M-D$ D$D$Jm$_7g-D$ D$D$l$-7a-D$ D$D$$m$6-t$D$$!t$ D$D$Gn$6 -D$ D$D$l$6-D$ D$D$$m$T6-D$ D$ D$$"6-D$ D$D$m$54-D$ D$D$m$5l-D$ D$D$n$5-t$D$$貲t$ D$D$Gn$I5o-D$ D$D$[m$5i!D$0-D$ D$D$m$45-D$ D$D$m$4-D$ D$D$m$m4-D$ D$D$m$;4-D$ D$D$6m$ 4]-t$D$$/t$ D$D$Gn$3-D$ D$D$m$3-D$ D$D$Vn$b3-D$ D$D$hn$03-D$ D$D$nm$2-t$D$$$t$ D$D$Gn$2-t$D$$t$ D$D$Gn$x2-D$ D$D$7m$F2ffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS輤 E]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]K$dC C(1uиɸUED$ E D$D$E$]UVSEM tYX tRP$tKPtD;u@B-4?w3t)x6(r@1 w#EB?EEEpD$D$$]}}GU܉B0G??E VEX}E؉mE؋E@N?EX څ}wOE ]UԋuM؉]]BƃvUԋU]uM؋]EȋM)ȋuFMA :E@O?EЉEEE_ E}M̍}WPGX ,WTG\GG?} mmEԋE@H?}uЁxE܋UĉP pUԉxuUVߋuԃItftE@t E@ \ )UUԋEHDM)щHDE@uFDF:?9EP UR$tB1ҋ}G9?E@;}W$tB}GDG;?}wCE@Uԋ]uMBƃvUԉ]uM؋}EG< }E̍IU܉BE@Q?UBD?mmEԃ} wCEUԋ]uMBƃ vUԉ]uM؋}]SdCh s`}mw ) }E̍U܉BE@Q?Uԉ]uM؋}uȋE)} 老B??or]ԉu}벋Et1] 9uE|0C$tH$MtKD;H(s ACDEuEP)uuԉ E@??E21] 9uEE|0C$tHMtKD;H s ACDEuEP )uuԉiUԉ]uMUԉ]uM؋}uȋE)}ԉ]u}W4])Ëw89)W,ƋEPD9sȋ}9s)E)‹]SD}9u}ċEPD @E@R?E&А{9UsBE]ԋu}MCǃ9r]ԉu}MظЋ}!]CDCD})U:f*EEE@P?uȋE)EJ c M)ȋ]]]MYl]ftYt]9]U}E؋UMyQ?x ft }E̍U܉BAQ?EE1UċuЅ2 E}GDuGH?Uu ЉEE!ȉp@U9Us|E5]ԋuU؉}}xCǃE!MMȋMMHfM@M9r]]؉uu}U؋Um})}؋M}v]ԉu}EǀXPHX׋E!Hp9Es_UԋM؉}؉]]ZBE}E!u4E~v9rĉUU]M؉]m)E؋]艃sD 3Eǀ@??Mu)ƋE@D9E@#E@ u}UU1Ez@ t$EԉD$UB$]#cUB)uuԅ=REǀXPHX׋E!Hp9EMUԉ]E@`E@ 9t$EԉD$UB$]ybUB)uuԅR"EpHXL@K?9]sB}^Uԋu}MBǃ9rUԉu}MظЋU!Ћ}GHU)]m)E؋U艂rDE@M?U4}wC}]ԋu}MCǃv]ԉu}M؋Et }@$t@0NEB))9E}E̍IU܉BE@Q?}/]ԉU-}E̍|nEPD@B?} EEUԉu@}E̍Oo]܉CE@Q?QqItDUЋ])ڋ]ډD$T$ $]̅`EHU܉J0X xEpEu99E̍oU܉BE@Q?EЉEE}U̍nM܉QUBQ?mmE9s55]ԉƉȉs9r]ԉȋ]M)؃1u]M؃w-E̍Y&]fDSt9uE@lu荆4FpFPFXD$FXD$FpD$ D$FtD$$]n}o]܉CFQ?]ԉu}UT$UEԉD$}G$]F^GUzU}E؋}uȋE)BEԉu]?EED$ED$}G$]]G7}E̍n]܉CE@Q?} ։uU! yf}q<9}swU}]]؉EEIPUuU!Muu4NfMvM9rEԉ}ω]؋E]M)ȉ])E؋M艹EAD<"E@l@E?1EPL@I?]K9s5\]ԉƉȉs9r]ԉȋ])؋MF]tKrM}uMEE@G?} }uȋE)EEP$t EEt E@ E@6?EEfvPjEfED$ED$}G$]c[GGEE}UUԋuȋE)EE>Eԉ}]>@ WlaE@l@F?1E܋UĉP UЉPUԉUPEUPuuEtB0M[^_]äft.t&ft.t&u-uYu5urf } f떻UUWVS 軀 P}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$q\ML$M L$$[\9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ OEԋuu8E܉NjEEFE~@@}S?}GS?wH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃUEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]fffUWVSw 3E}Mx11 rtE xfDU9uEExfG0UofxZUWVS4h f}̉ÉEЋ@,E܋{t-Ek@^S,sɀ @\Yl])…A8D$ T$D$u4$]x-FlF\4@u FE@@\Yl])…x?A8D$ T$D$u4$]-FlF\1n1N1w1fEP}]ԉU}]ԉUt}]ԉUc}]ԉUR}]ԉUA}]ԉU0}]ԉUUWVS7 ÏU} EJEqEp3 Y}OE@ M苔M9~(uaE9tF}L DDF|EE[^_]D$E$E@FtFl9F\EXYtYVDFLfDBDD$D$$dž    9TE,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 5 ,SEuE EM}EEEEE U$o81f8]vEFF ^$}uEEG} }UD$D$F($V ÅUF0@*P@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]A|A13u3 eEF$EdF F( [^_]øCE-@F4$}U ED$ED$D$D$D$ D$E D$E$]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@ CL{DMqD-{uvuju^CMQ+QS $ | 0 E[^_]älfb.t&ft.t&`fV&ft&fu5AfY{8f3f+0f(-f%*$ E1E%>. K UWVS8$. KEȋM }׃}T uĉU 2A3؃u߉߉UθEEEE]ȍ ỦuEʋ1E؋u3ruԋM3JMЋ}3z }}3z}܃<EEEEE܋EU U҉3tRET  }9`U릋}>X8Xr‰]f9]s‹EƋE܉D [^_]ËEX8Xrf}U냉E܉D [^_]UWVSLÉ֋EЋJ9}A EǃPǃT=1E1M̉ыU"P\ ƄXE9tf<ufD9uM̃YẺMM}ȉuK}11҃P\ fƄXU)‹}}t T7)t4}뤉MMuEFM̉uȋuЉuM̋uȋPM}̉uu9B3XEfpfq~` UЉv}` UămẺP` ` }Љ6` MȋTMEUĉX MTMȉT Ѝ UȍUffXEX8*%MuET` Eȋ}P FE̋AEAEAEč< 1mu1 9r EЋ}fD}<ET PEE]<)ދ]4 ]EtD9}7]Ѝ DD]9}EfA9u|‹]fC< ]9{11uK: fNuExBuЍ|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]ȋ}tEčPUȍ4C: fEȉC< ftfC< fK< f< Uą$=uS< }ȅt>uă\ 9M|uЍ<L9t)fWmuȋuĉ뤋MċEcȪf1E*ȪfUWVS ERfDHDE1E69t*9}tuf| 1]9Mt>9|9}6}f| tK9U19Muƒ [^_]Åt49]t Ef| Ef u1]z E$f u$1ENf t1E*]1UWVS BE%Z]\ ]1һ}܉fMMc9t|~ | Uf UU)9fGHOOGPWW )UUDu  ډU ʹ)9fGHOOGPWW )ڍL0~E fOWZ_WGX_ )fEu99E1EM9MUUUUVU9D$U:^NjFD$U$1tE 8a [^_]1 [^_]UWVS - }GtUD$U]ƋGD$U$h1t+4$P=yarauE 0 [^_]É4$r1 [^_]UWVS E}GtUD$UW]ƋGD$U$0t+4$Ӥ=tciduE 0o [^_]É4$1 [^_]UWVS3 ED$E D$E$EtSEt4}D<$\ƋED$<$X0tE01[^_][^_]ɽ[^_]UVS 5ut$E D$E$貢t.yaraUFƅu [^]k0[^][0[^]UVS1 ut$E D$E$Ct.tcidUƅu [^]0[^]0[^]UEU E MMM] UEU E tcidMMM]UVS E D$E$vƉ$Ǣ=tciduE0[^]1[^]UVS4 E D$E$EvƉ$w=loobt 1[^]É4$ŊU[^]UWVS pE$ډt,ƉD$E D$E$vlj4$M [^_]1 [^_]US E D$E$uUT$$dA[]USH E D$E$YuUT$$A[]US äE D$E$ uUT$$A[]US kE D$E$tUT$$)B[]US 2E D$E$tUT$$WB[]USd E D$E$utUT$$`B[]US+ E D$E$8t,ƉD$E D$E$`olj4$( [^_]1 [^_]UWVS Z E$D$7t,ƉD$E D$E$nlj4$ŗ [^_]1 [^_]UWVS ÌE$D$y7t,ƉD$E D$E$nlj4$c [^_]1 [^_]UWVS *EU$T$7t,ƉD$E D$E$9nlj4$ [^_]1 [^_]UWVS 3 E$D$6t,ƉD$E D$E$mlj4$蝖 [^_]1 [^_]UWVS dE$D$6t,ƉD$E D$E$qmlj4$9 [^_]1 [^_]UWVS k E$D$66t,ƉD$E D$E$mlj4$֕ [^_]1 [^_]UWVS  ÝE$D$5t,ƉD$E D$E$llj4$s [^_]1 [^_]UWVS :EU$T$q5t,ƉD$E D$E$Illj4$ [^_]1 [^_]UWVS C E$D$5t,ƉD$E D$E$klj4$讔 [^_]1 [^_]UWVS uE$D$4t,ƉD$E D$E$klj4$J [^_]1 [^_]UWVS | E$D$F4t,ƉD$E D$E$klj4$ [^_]1 [^_]UWVS  íE$D$3t,ƉD$E D$E$jlj4$胓 [^_]1 [^_]UWVS JEU$T$3t,ƉD$E D$E$Yjlj4$! [^_]1 [^_]UVST E D$E$eiƉ$藕=gntst 1[^]É4$'tU[^]UWVS ÌE$'%t,ƉD$E D$E$ilj4$j [^_]1 [^_]UWVS 1E$$t,ƉD$E D$E$Gilj4$ [^_]1 [^_]UVSB E D$E$ShƉ$腔=atadt 1[^]É4$vtUEt 4$vM[^]UWVS f ED$E$tt,ƉD$E D$E$uhlj4$= [^_]1 [^_]UWVS o  ED$E$4ut,ƉD$E D$E$hlj4$ې [^_]1 [^_]UWVS â E D$E$gƉ$P=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$4UVS  E D$E$fƉ$ƒ=gntst 1[^]É4$A$tU[^]UWVS & û E$V"t,ƉD$E D$E$flj4$虏 [^_]1 [^_]UWVS ` E$$"t,ƉD$E D$E$vflj4$> [^_]1 [^_]UWVS p  ut*t$E D$E$%flj4$ [^_]1 [^_]UVS õ E D$E$ʉƉ$c=loobt 1[^]É4$yU[^]UWVS \ E$xt,ƉD$E D$E$lj4$9 [^_]1 [^_]UWVSk E $jxt%ƉD$E$蟊lj4$[^_]1[^_]US í E D$E$ˆUT$$/[]US t E D$E$艈UT$$F0[]US ; E D$E$PUT$$0[]USm  E D$E$UT$$0[]US4 E D$E$އUT$$0[]US ÐE D$E$襇UT$$0[]US WE D$E$lUT$$%1[]US E D$E$3UT$$p1[]USP E D$E$UT$$1[]US ìE D$E$UT$$1[]US sE D$E$舆UT$$1[]US :E D$E$OUT$$1[]USl E D$E$UT$$ 2[]US3 E D$E$݅UT$$ 2[]US ÏE D$E$褅UT$$2[]US VE D$E$kUT$$2[]US E D$E$2UT$$2[]USO E D$E$UT$$$2[]US ëE D$E$UT$$12[]US rE D$E$臄UT$$22[]UWVS 7E$D$#)t,ƉD$E D$E$lj4$ [^_]1 [^_]UWVS? E $D$(t%ƉD$E$llj4$豈[^_]1[^_]UWVS xE$D$d(t,ƉD$E D$E$lj4$N [^_]1 [^_]UWVS E $D$(t%ƉD$E$譄lj4$[^_]1[^_]UWVS $ ùE$D$'t,ƉD$E D$E$Clj4$萇 [^_]1 [^_]UWVS WE $D$D't%ƉD$E$lj4$5[^_]1[^_]UWVS g E$D$&t,ƉD$E D$E$膂lj4$ӆ [^_]1 [^_]UWVS ÚE $D$&t%ƉD$E$3lj4$x[^_]1[^_]UWVS ?EU$T$,&t,ƉD$E D$E$Ɂlj4$ [^_]1 [^_]UWVSH E U$T$%t%ƉD$E$vlj4$軅[^_]1[^_]UWVS ÂE$D$o%t,ƉD$E D$E$ lj4$Y [^_]1 [^_]UWVS E $D$ %t%ƉD$E$蹁lj4$[^_]1[^_]UWVS 0 E$D$$t,ƉD$E D$E$Nlj4$蛄 [^_]1 [^_]UWVS bE $D$N$t%ƉD$E$lj4$?[^_]1[^_]UWVS q E$D$#t,ƉD$E D$E$lj4$܃ [^_]1 [^_]UWVS ãE $D$#t%ƉD$E$;lj4$考[^_]1[^_]UWVS GE$D$4#t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSP E $D$"t%ƉD$E$~lj4$Â[^_]1[^_]UWVS ÊEU$T$w"t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVS (E U$T$"t%ƉD$E$~lj4$[^_]1[^_]UWVS 8 E$D$"t,ƉD$E D$E$U}lj4$袁 [^_]1 [^_]UWVS iE $D$!t%ƉD$E$~lj4$E[^_]1[^_]UWVS w E$D$A!t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVS èE $D$ t%ƉD$E$?}lj4$脀[^_]1[^_]UWVS KE$D$ t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSS E $D$ t%ƉD$E$|lj4$[^_]1[^_]UWVS ÌE$D$t,ƉD$E D$E${lj4$b [^_]1 [^_]UWVS )E $D$_t%ƉD$E${lj4$[^_]1[^_]UWVS 8 EU$T$t,ƉD$E D$E$Wzlj4$~ [^_]1 [^_]UWVS kE U$T$t%ƉD$E${lj4$I~[^_]1[^_]UWVS { E$D$Ft,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS íE $D$t%ƉD$E$Ezlj4$}[^_]1[^_]UWVS QE$D$t,ƉD$E D$E$xlj4$&} [^_]1 [^_]UWVSX E $D$"t%ƉD$E$ylj4$|[^_]1[^_]UWVS ÐE$D$t,ƉD$E D$E$xlj4$e| [^_]1 [^_]UWVS ,E $D$at%ƉD$E$xlj4$|[^_]1[^_]UWVS : E$D$t,ƉD$E D$E$Xwlj4${ [^_]1 [^_]UWVS lE $D$t%ƉD$E$xlj4$I{[^_]1[^_]UWVS { EU$T$Gt,ƉD$E D$E$vlj4$z [^_]1 [^_]UWVS îE U$T$t%ƉD$E$Gwlj4$z[^_]1[^_]UVS TE D$E$iuƉ$}=gntst 1[^]É4$}tU[^]UWVS b E$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS ÜE $7 t%ƉD$E$FtAD$$UaU [^_]H4$l [^_]1 [^_]ÍUWVS .utJ,9u@~ G$…t,Ft/D$$U`U [^_]1 [^_]ÍU0 ½Et ,9t1]Ë@ ]U Et,9uP@tt ]1҉]Í]US QEt ,9t1[]ËU tH Q9Ur@tD$E $`[]ÍUb Et ,9t1]Ë@]UWVS' ü}t;,9u1G $ƅtGt"D$4$_[^_]1[^_]ÍU XEt,9u @t]1]Í]UWVS ut ,9t 1[^_]ËU tM 9uFtA F EP$UUDžtŋE HɋUtOFt@L$D$ D$T$<$cF~}~ t$s븍UWVS Yut ,9t 1[^_]ËE FtE $wF EH $M…tFMtI} |$D$ D$L$$U&cFUV}~ t$o믍rpD$ D$D$;H$~US qEt ,9t1[]ËM tM 9uL$$)mUS *Et ,9t1[]Ë@tU T$$v[]ÍUSA Et ,9t1[]Ë@tU T$$=v[]ÍUS ÂEU tG,9u=t99 u5Rt@tT$$u[]Í@uፃٸfUS Et.,9u$@tU T$$u[]ÍfUWVS 3 u~(Ft  [^_]D$ED$ D$D$4$1tȋUBU$DžtFD$ED$ UT$|$4$t}M9Muu>uyF8"udF1M Z$ ƅt',D$4$eFF FE 0 [^_]É<$D$VD$4$ctՋMofffUVSUE 9t4J2Ht"JZxPx3H3X1 [^]1[^]ø[^]US ,x D$$L $蠍[]USY L $z[]UWVS41 M EpAQAtppD$ T$L$D$ uԉ4$^D$|$E$ipt2t$E$5mt|$E$^q4[^_]Í14[^_]ÉD$ T$=D$D$ uԉ4$D^yD$ ,D$D$$$yUVS! öE 0t$L $,4$1[^]US |D$L $ƋlD$L $1[]UWVS 2lj։MML$ED$G$YWVEU9ErfEG[^_]=8"u1UWVS élj։MML$ED$G$諥V!ЃtNEG[^_]~8"u1UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS0 ƍx D$$XL <$7t$L E$t $E4a<$ UЃ[^_]ÉE<$$ ˻Ut֍D$ $M`MAFAFA<$證t$E$YMt+$E`<$脉M $UЃ[^_]ÉL$ME$YM9uE<$HUЃ[^_]ÍpD$ HD$D$M$$vUVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS载 Rut9u4$^[^]1[^]UE@]UWVSz Et 9t1[^_]@t9H@1һ9ˉr|9[^_]ËP@Ӂw?Ӂ19ωr-9[^_]ø@[ QU誼 7Et 9t11]ËP@]U} Et 9t11]ËP@]UP Et 9t11]ËP@]U# °Et 9t11]ËP@]UVS ~Et 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVSm Et 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUS yEt 9t1[]ËHX@uȉwދE []ËHP9ȸsUS腺 Et 9t1[]ËHX@uȉwދE []ËHP9ȸsU ¬Et 9t1]ËHP@txE P]USܹ iEt 9t1[]ËHX@uȉwދE []ËHP9ȸsUVSq Et 9t 1[^]ËHX@u3ȉEU19ErɋE [^]ËHP9ȸsUVS zEt 9t 1[^]ËHX@u4ȉEU19ErɋE f[^]ËHP9ȸsUSl Et 9t1[]ËHX@uȉwދE []ËHP9ȸsU “Et 9t1]ËHP@txE P]Uķ QEt 9t1]ËPH9иrE ]U Et 9t1]ËPH9иrE f]U9 Et 9t1]ËHPwE ]U ŒEt 9t1]ËHPwE ]UŶ REt 9t1]ËHP@uxE P]U胶 Et 9t1]ËHPwE ]UI Et 9t1]ËPH9иrE ]U ‘Et 9t1]ËPH9иrE f]U辵 KEt 9t1]ËHPwE ]U脵 Et 9t1]ËHP@uxE P]US6 Et 9t1[]ËM tM 9uL$$[U ˆEt 9t1]@tHxUxU M3P3H ]U说 <Et 9t1]@tHxUxU M3P3H ]USb Et 9t1[]ËHX@u xExȉ3E 3U []US ¡Et 9t1[]ËHX@u xExȉ3E 3U []UWVS轳 N]1ɍuEEESt [^_]À{(uSU-tn+ti0u UzxtmMMti;t D$h`D$$~tU [^_]ù RAu_Uu>fUWVSP讲 C<$efH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$)fuP[^_]Ét$D$$_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$GeuP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPw W ӍPЀ w 0 1UWVS<1 4$}cB BBB$BBB(B8O)Bf^.t{BDžT$T$4$Є\?D$D$ D$|$4$D$D$ D$|$4$Jcut)B wB8|<[^_]ÿ"[upBȲSxauZxluTxsuNxeuHxBJB(zxru"xuuxeux̃+)D$D$ |$D$4$D$D$ D$D$4$bu1<[^_]ÍHJx"t%Ml^BB(Mуzc<$N1USEJv[]ÉuUS լ jE ;Et1 []ÉD$ED$E$ []UWVS萬 %]u}E E $[‹FUJv<F H!uix-x-PVHt|B-ttlB-u<-uz>tBFv1RU/}u*}~,Fǀ  *fu1[^_]À/t>t t  ủ)N] t9uʉT$D$E $]2u?/ F(<>tt uHvf~ t{ lqG u\.x$E]pD$ D$D$d$1b t=u)Vx"xPV HЀ"u c"tXuEF(>FFF F$GFV1u)щN$x><UWVS0袩 ;EEu }8X1t9s]<<{<&uKatAlt,gt{qu({uu"{ou{tu{;u"례{tt;10[^_]Kmpu{ouހ{su؀{;u҃'`{;u<M{tu{;u>4EMMt<".E<\tdMt&ȋM)]9t 9rD]6U멀{p'{;CEt)<>tuE$p(r EpD$pt$$t}(u GtXtA1(u~u EpENjE$r[^_]Á8versuxsionuE tE E D$E D$}<$t}DžmD$t$E$z<$D1k~WIUD$E$m]UWVS Þ$(lp$thD$D$E$zfp0xD$p$S>$MЋEԉhl!tW91!ȉh! D$D$p|$D$ D$T$p$Ƌt0<$fplD$T$4$KkE D$4$NjtPD$T$p4$kpT$4$t$ Ĭ[^_]ËlЉhdD$D$p|$D$ D$D$$Ƌt0<$ehD$T$p4$ajD$D$D$D$ D$lD$p$FptdtAT$4$t$1p$dt$1UD$E$]fffUE 9E]UWVS ÕƅtBD$$Et E$@DžMu% $X1\$@进DžtE D$<$@D$G$?kEG,w0G4G8G<[^_]US@ ռL $ai[]US ïCD$̲$DlL $#i[]USܞ qD$L $hD$L $v1[]US蔞 )ED$E $N[]USg ED$E $zN[]US7 ̻E$(jE $j[]UWVS( ÖUM܋p4@,EEGEt@E<E tpD$ LD$D$$OUWVS ÕuFt0 9u&x<$cƉ<$c[^_]Í4D$ D$D$$bOUWVS舗 Ƅt1fƅtptC[^_]ÉUx<$Uc1ɋU5ƅtpt<$4c[^_]Í4D$ 0D$D$$NUS ÄE xt"D$,D$E$C[]ÍqD$ `D$D$ $`NUS舖 UB4tB4R,…t8$ 8[]ÍqD$ D$D$$MpD$ D$D$$MUWVS4 ÍUM@8t 14[^_]ÉƉ׍@E$aMt9pE}<$6Ex4$C7E$a4[^_]ÍCD$̲$bL ljE؉$_UT$L Mԉ $,E܅$6<$V_V09V4E$`6N4F,E؋U<}Nj2UЉMԃD$E$DMԋU|A)D$|$E؍D$EF,}܉8MHF4F<E؉$^E$CE܃,}<}ܜ$AEMD$ $I5}|$MA$*EU܉PU؉$^|$}ԉ<$E܅$5U؉$]E@,vu1<$\0[^_]D$4$=t؋E EtɃF  E䍃E؉}} ED$4$=;EZM9U9PUUE܉4$<E܅UT$,D$4$3~D$4$<4$<U܋T$4$P tEO49H1ZEq<$@[Ɖ0[^_]Ë}4$(<E$5m1D$4$v9n}эD$ D$D$$F}E$l5n 4$;EԉD$4$J=9qD$ D$D$$#FUVSJ ߫E 0t$L $UF,v UVS詆 >EU ut 9t 1[^]Åt9 uH49H0r [^]WD$ D$D$ $=UWVS,% úut 9t,[^_]Í~<$RF8t<$Q,[^_]ÍMU tߋUUUHMN4MtpM9MV,U܋MM9UM)L$M܋U؍TT$$n4F<E$'E$&TqD$ pD$D$u$<zqD$ pD$D$v$<qD$ pD$D$w$<USʄ WEM t 9t[]Åt9uM E[]TUS{ Et 9t1[]ËM tM 9uL$$*U@ ͡Et9u]1]U ¥Et9u]1]US yEt 9t1[]ËM tM 9uL$$1*US蝃 2D$E$4[]UWVS p }U uFt  [^_]ÉU15t~(Ut [^_]ÉUE$.MUt E [^_] $$US u}><<E]E tE $[^_]Ãt}E9E)>E1}E9E)><<Nkr<[u1R}GEt"E9E7E)ȉ >}> qD$ ,D$D$e$14=2D$ ,D$D$,$3UWVS | Þ$xLD$$UUBB BE u Ѓ [^_]ËE $wUtJNju} s5E u%E uBE B Ѓ [^_]äBE B fE tM $1UWVS 9{ Θu} tEt=$2wt%LT$$EAE@px [^_]11UWVSz guE u@1$vDžtLD$<$GwE G [^_]ËE $vtDǃ} s E uE u뛤ƐfE tM E tE o1UWVS z êu} tEt=$vt%LT$$EE@px [^_]11UVSy DutGL9u=Fu!F D$F$tH[^]É4$[^]1UWy Et L9t1]Ë@ ]U/y ¼EtL9u@]1]UWVy ’Et L9t1^_]ËU tP 9Urptt} suuɤfuufUWVS]x EtHL9u>P pt0t{$UFtt!NjUs*ut[^_]Åu!1[^_]ftt鍃LD$ dD$D$$/tD$ dD$D$$_/Uw EtL9u@]1]US_w Et L9t1[]ËM tM 9uL$$US w íEt L9t1 []ËM9H uU tL$M L$@$է []UWVS v Pu>t=~(u7Ft=D$ tT$VT$$t F$ [^_]ËFD$U$11tՋ}O $MMrEtFVT$U$MUK9}D$]D$4$I$qƅLD$4$FEF~ E 0%3D$ED$F $jljEt\UF$F 9:" qD$ LD$D$$,E$y [^_]38"uE$y$pƅtEE$hy1 1Ut IEt 9t1]ËM tM 9u9]UVStt t$L $ƃL t$L $~ƃL 1[^]US!t öE xtD$E$#[]ÍUVSs wumD$$ AtL 4$[^]ÍL UVSs $ut9u4$[^]1[^]U^s Et 9t1]@]U5s Et 9t1]@]USs ÕEt 9t1[]ËM tM 9uL$$MUVSr MuFt [^]À~(tD$ D$FD$F$u_D$ D$FD$F$itWmD$$v?L 4$vE 0[^]ÍmD$$??L ǍD$ D$D$$)fffUWVSq FƅtBD$$qEt E$@mDžMu% $ v1d$@pmDžtED$E<$vED$G$<EG,w0G4G8G<[^_]USp ~E$<E $<[]UVSp IPt@9 u6p 9r<&D$4$Xu1<\\D$\4$-tӉT$4$tŃtaD$$BuύT$ T$D$#$` t][^_]UVS-Q n]u {u3vut&D$$}t,u[^]D$<$Su 1[^]D$/$6t6u Ht>D$$u뼍T$ T$D$D$/E >][^]UWVS

][^_]zUWVS N ÅlUEx } $Jƅ$JtzFFF E Ft.ED$4$ׄu`$S14$R [^_]Í<D$4$u뵉4$R1 [^_]D$ 4$ztFu2D$4$kD$ 4$ESD$4$-;>@rD$D$4$-D$ 4$Ex UWVS KM jED$E$5t>Ɖ$E $ U4$Q U [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVSqL jutFwyM MJ]ZMJ [^]$$Ht|] X]XMH ]X뼍rD$ Et(D$+D$\$ $|$ }_D$9D$sq+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )D$T$‹D$ ‰T$D$ L$L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1MD$9sFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$uy9r9,)|$ȉ뙅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ ЉD$T$\$\$ L$4$Ét$Ӊd$ƉT$9r [u D$E$(@t[^]fffffff$̀ffff'̀ffffỳrS[d[P[̀rS[D[P[̀rS[$[P[&̀rS[[P[%̀rS[ZP[ḅ̀rS[ZP[̀rS[äZP[ḡ̀rS[ÄZP[̀rS[dZP[̀rS[DZP[:̀rS[$ZP[̀rS[ZP[̀rS[YP[̀rS[YP[Ḯ̀rS[äYP[%̀rS[ÄYP[_̀rS[dYP[\̀rS[DYP[;̀rS[$YP[b̀rS[YP[̀rS[XP[̀rS[XP[ḛ̀rS[äXP[c̀rS[ÄXP[2̀rS[dXP[̀rS[DXP[̀rS[$XP[9̀rS[XP[Ḇ̀rS[WP[ḵ̀rS[WP[8̀rS[äWP[Ḁ̀rS[ÄWP[̀rS[dWP[Ḅ̀rS[DWP[̀rS[$WP[ ̀rS[WP[̀rS[VP[̀rS[VP[0̀rS[äVP[Q̀rS[ÄVP[̀rS[dVP[)̀rS[DVP[{̀rS[$VP[|̀rS[VP[#̀rS[UP[)̀rS[UP[=̀rS[äUP[̀rS[ÄUP[̀rS[dUP["̀rS[DUP[US7 (UE UD$T$ D$E$ X[]USZ7 TEUD$T$D$ ED$E D$E$W[]US7 èTEUD$T$D$ ED$E D$E$W[]ffffYXZQ̀QQrUS6 HTED$ ED$E D$E$[]US {6 TED$E D$E$MX []fffUSF6 S9E[]US6 ôS9E@[]US5 ÎS7u1[]$S1[]US5 TS7u1[]$1[]US5 S7u1[]$1[]USK5 R7u1[]$1[]US5 æR7u1[]$k1[]US4 lR7u1[]$11[]US4 2R7u1[]$1[]USc4 Q7u1[]$1[]US)4 þQ7u1[]$1[]US3 ÄQ7u1[]$I1[]US3 MQ P ?jIM  @tM:u DŽM с?x" P ] M \U1[]ÃӅ~M 1  9~:u뙸#[]U3 §PE@M M 1]U2 …PE@ M ]U2 hPE@DŽM 1]US]Cu U C1[]US 2 $P7u#ED$E D$E$u []$Y []øUS/2 OUS[]US2 êO$-[]US1 ÁO$US1 cO7u1[]$(1[]UE 9E]1UVS1 Out$E EED$D$vt4$[^]ÍD$ PD$D$;@$UVS1 éNut/ED$D$wt@4$ x@Eu[^]ÍD$ \D$D$;|$E른ffUWVS0 &N}u tKt$ttf|[^_]ÉuED$D$t<$n[^_]ÍD$ hD$D$:$UVS/ ÑMutD$D$^t 4$[^]ÍD$ tD$D$8$=UWVS/ *Mu} t~(~$1[^_]ÍCzD$ D$D$70$~(~$1[^_]UVS./ LutE F(1[^]ÍCzD$ D$D$7l$E F(1[^]UVS. aLutE F$1[^]ÍCzD$ D$D$7$E F$1[^]UVSj. Kut$&ff gFF[^]ÍCzD$ D$D$;$UVS. ÕKut F([^]ÍCzD$ D$D$7($WF([^]UVS- =Kut F$[^]ÍCzD$ D$D$7h$F$[^]fffffffSL$D$ t9tEA.&f€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US , +JP D$E D$E$5 []fffffffUWVSQ, Iu} j%=9~=@U=`b%ໃrGO%ඃwG%@=wK@vu xOG ໃrQඃwA%=0u xQAໃrඃwB\BBxf [^_]=us=@'s=t:= uoc=t@=u w=uFlzpp--sRdHS?4SBBTf [^_]ÍBB-f [^_]ÍBBtf [^_]uF%̃a+D$ D$D$9$AgABfUWVS ) GE(D$E$TE= YAD$ED$E${Uǃ!8uE$TOEtMEMED$UT$4$kMu E<=tX4E8E4uϋM9|>) ‰L$D$$蟺iX1 [^_]ÉM4$fSM랹čED$ D$D$>$넍UWVS' ÁEEhlpptDžxAEEEEEE|(D$ut$$k]E$D$t$$EDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$_XD$4$|$4$D$04$5U!8D$hD$t$ D$}D$0$"G,V4$G,48D$t$0$tD$(D$$D$$D$$D$|$$4[^_]D$}$![^_]Dž4c;,Dž4GD$(D$$yD$(D$$D$$D$$UWVS@$ 0Bt$0D$T$L$4D$4t "|$GD$8UT$$\$0uL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0V"D$8D$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0D$$T$ D$(T$,D$T$ $D$D$L$8D$9\$0}"D$8D$D$=u4$臒7)EE8EE1҉MԉU*}D9FEE>tHED$|$M $nLuى<$"}9EuEEE>uMԋU܅{UWENjp,-t$E8:tED$ED$ $xGx70E<-<+<::gB9FB 9F <;uEz8;E-0tE8:tD$W$ž7WE<-QEx:T?Fw E؉Gw t01]E8[^_]ËMԋUEE$XEMst$ T$UD$_H<$'EUMt$ D$D$<$>u4sL$ Mt$D$`H<$諿EM:L$ t$D$<$3sD$ D$D$aH$P <:z5E*E!w ]ẼuE MЋM؉<-t(E8:t ED$l$菜EEЋG217Eu-t$E8:tED$ED$4$&7zEEzU؉:P}EЋuAE $MЋzuE-8tE8:tt$${70-08E8:,ED$$=y:6}9E} }؉sL$ MT$UD$`<$ UҋUMsD$ T$D$a<$޼t$ t$D$<$Mns-E8:t$$LG MsD$ t$D$a<$BMu 4Mt$ t$D$<$McUWVST } uP u$ǃP E ;M8-p$x P -$D$-E$#ǃ P --|$E$tAx:ǃP >u[^_]Ír$ P :u>u t E8:?부xt$됋>uTx:tL9M$E8: tZ|$ D$1P $[^_]ÍsD$ D$D$R$usD$ D$D$S$譹跽|$ D$sD$-$誡E 4=:dUVS TutD$ D$4$[^]Í(D$ D$D$/$UVSW utD$4$e[^]ÍsD$ D$D$/4$衸ffffUSÈE$1[]UWVSaEtut4E@D$Ex E@t$9r0E@ 1҃[^_]ÉuU 9E׋EP @D$E@t$9s뿋E@D$M);u ED$1E U9Nj]C E@t$9ANE E tD$ D$D$l$e׋EP @D$0E UdesD$ D$D$l$6TUWVSãUB EEEu1u}u}9}EE}B269rz])9ErEË}u sHu(u J J ZR9r [^_]ÉftEË}u rucuk량UGD$4$uƅt[UB)ǍD|$D$$7U0MJB E4Xf넃BUWVSJu} D$$$…0x@@ lD$D$D$ OD$D$$UDžt)D$$[^_]18U$t$jϹ81Ĺ8US 6E D$ED$-X$ []USjED$ E D$ED$-X$[]UWVS*ÿu} t(ED$ 1D$|$4$gC[^_]Í#D$ D$D$4$`UVSNut'D$ D$D$4$B[^]Í#D$ D$D$A$UWVSKu} t)D$ 1D$|$4$B[^_]Í#D$ D$D$6$耲UVSnut>D$D$ D$D$4$Et [^]1[^]Í tD$ D$D$0 $USVED$ D$ E D$E$X[]UWVSðuttE D$4$~7蒓F0u D$4$蓓[^_]tYF0uҿ@F0뻍#D$ D$D$/X$]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSXE0x$Otu[^_]1[^_]UWVS} tE}1tGfp f@UPx$MH,UP(UPDUP [^_]þEu51UWVS à}u$ ‹EE Bzr EBttpE tZE )EU,1UtnMfH f@PM H$x,p(@DP [^_]Í)E뭋M tE E딉UEU$1 [^_]UWVS ßUE trB0~4r,txM q J$tE D$ E 0xt$|$$q[^_]ÉUtD$ (D$D$<$UY#D$ (D$D$;$蹭U US âED$E D$E$ []USqED$ ED$E D$E$Z[]UVS8uf~ D$4$F0tN@9t $F0ǀǀ FFF t1FD$4$ߎ1[^]ËFߍ#D$ 0D$D$<${L UWVSSEU tdP0~4p,t} r H$t} Lj $>M Q!Ѓ[^_]ÉEtT$ 8T$D$9$譫Eg#T$ 8T$D$8${E.UWVSbutFD$4$Knx$P8D$4$T[^_]É4$/ڍ#D$ @D$D$78$US BED$E D$E$9 []USæED$ ED$E D$E$7[]UWVS,lEt8uj}ԉF;(9؃[^_]ÍvD$ D$D$$몸UEu E D]1]UWVS4}utQEu@D69E r4E D$D$<$+|6GfGG[^_]1[^_]ÍvD$ D$D$.$AUWVS.u} t;~uaVL\WQWQW Q F1[^_]ÍvD$ D$D$M$輡뙸UWVS4 ƉEԋE} 8uЋU1҅x'PރT$D$<$]GGt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍvT$ T$D$h$臠E܅E܋]ԍvT$ T$D$i$LEm]U*UVS"ut~uEFu=:Fr6[^]ÍvD$ D$D$$ϟ뵸UWVS õu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍvD$ D$D$$EffffffUWVS&Ɖׅt18u9s1[^_]ÍF9rFލvD$ D$D$$=uUWVS ßt ljփu [^_]Rw%FGT$D$<$w[^_]ÉUvD$ D$D$$$UUS{E x[]ÉEvT$ $T$D$T$̝E[]UWVSòu} Et,tYPσF)F 71[^_]ÍvT$ T$D$b$LEuE wT$ T$D$c$ErUWVS_Eu}UxE ;Eà EME9؋M)1L!ȉ)1׉E8E 8t@‰ߋu s}tftËM؋})p)ƉnE0)F=^EX E[^_]EE[^_]ø‰ߋu rbEX]荃wD$ D$D$$oÍvD$ D$D$$>W]荃D$ D$D$$ f;{PUWVS6EuM}~ 9)1UD!ЉEUE)‹E1UU ˉM] E )P)‰U|U)G=Mw]_^ ȃ[^_]1ɉȃ[^_]Í^^ÍvD$ D$D$$輙MM]荃D$ D$D$$脙MkUWVSku} tt~)F1V J 9\ t+9sw[^_]ÍFፃ&wD$ D$D$$踘]vD$ D$D$$艘*UWVSfE} ux)ubHQσwWvPH Y 9r>\ tHډt'9s89t9t!P9r P9sݸ[^_]ú߉1[^_]ÉE&wT$ T$D$X$舗E6vT$ T$D$W$VEUUE ttuB]ø]UWVS xEEEM<v}wwٸu [^_]9]rE}t81ɅU t9u rEtuutit9A=QMVVD$D$$]oMEEFE 0 [^_])Ӊމq̉M]썃,D$ D$D$$M9ME]썓TT$ T$D$$貕ME.UWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉t 뭃먋E[^_]UWVS] U}EEt6u1]t7U9s tCB9rr9s[^_]ËEP8Mt9s܉ uM1+E[^_]UWVS] UЋ}uރstft[^_]uuBfUSOD$D$ED$ ED$E D$E$Z[]ffUWVSPÓƉЉ8U1҅SƅD$D$D$D$ T$D$4$5t1U+4P[^_]Í1ɉ  rFDžDžD$ T$D$<$eutjƅD$D$D$D$ t$GD$G$5ut$$tu<$!b $b4wT$ 8T$D$t$rUWVST3Ɖ8E1 ƃLP ƅD$D$D$D$ LP D$|$4$4D$D$D$D$ L$|$4$3;DžDžDžDžDžVDžDžDžT$ D$D$$btjƅD$D$D$D$ t$GD$G$2ut$$趆thuGtLD$ D$D$$4$_1U+uXT[^_]Ë묋$_ʍ4wD$ HD$D$t$qUWVSSϋEE uE8E1 JD$D$ D$D$<$=/D$ D$D$$2t6D$ D$D$$r[+$D$$D$$o$ɘD$=$[;$蕘$臘*y$舐$Tt$uPp<+<-iq<@pHLDD$ D$LD$r$l蜝؉DžH<+tj<--t$X$llPH;v31@U+%[^_]ÉFg<@qs<@PHLDL$ D$D$r$l觜DžHhUTd [4$lL uCF)<@t$X$lj DD$ XD$D$4$lܛtthKqUTqUT؉DD$ XD$D$4$l$ADžHDžL1bUT%LUT Lƅpl{xD$ XD$D$t$q0l_xD$ XD$D$t$lqPlmxD$ XD$D$t$.qlAUWVSu M(E<}88ƋE1`<ǃ,P U@D$D$ D$DD$<$薜@D$@ D$4$D$xD$4$74H0@@ $@P T$$,t@@$9"D$4$cX,t$D$4$,|%=x,P $K4$0$8E+[^_]þ뿍"D$x$W…tE@u_]Ѕu K[tA|$t$ E D$CD$C$uԉEȋUЉ$]=Eȃ@[^_]Ë]Љ$]l=@[^_]Ë]̍mxD$ tD$D$^t$Jl"ÍxD$ tD$D$\t$l]̍{xD$ tD$D$]t$kUVS(J8E1EEEEfEfEUUUT$UT$ U T$D$$RU+u([^]É~UVS(ƲK8E1EEEEfEfEU UUT$UT$ D$D$E$U+u([^]ÉUWVS,1uE EE E ȉEbQE x1wtftE @~uE1EWJЀ JJɉMEE @})șMU9ȸEjE H)ƃ v] ,[^_]EEEU9sWJЀ ?ɉMNEE뽍Jv u(JɉMEUЉE뉅uЃ߃A<wb j@=eyD$ D$D$$hE)șM؉Uܸ9ȸEE H9D$ D$D$}$ThE @}lj)W5wD$ D$D$C$hE iE9KM؍D$ D$D$`$gM4QfUWVS ¦Ep@}\G؉EƂV OE9ÍlV EV uKʀvFu9s\ H9sOpPE9s2E9s7F.Kʀwu9spE9rΉu9sE [^_]À?wglV }w]uCu.}Myt O?9s:}9+V 뢤}Mytft&?뒉tUWVS諭@ǘ-<$w7D$ D$E D$E$ZƉ<$w[^_]UWVS RǴ-<$sw 7D$D$E$Ɖ<$Mw [^_]fffffffUVS$ÇutXFD$ FD$FD$FD$FD$D$ D$D$V 4$}H$[^]Í~D$ PD$D$3 $dyUVS8QuEUT$UT$UT$UT$UT$ D$#yD$4$t 18[^]ËEV E䈃V E舃V E숃V EV E􈃱V V 8[^]ÍD$ DD$D$B $!dDUWVSEԅ<<$+4$<1uU+h[^_]ËEĉD$EȉD$<$EȋU9URf9P뗉4$Q<,f뎍~D$ 4D$D$Y ${`7yD$ 4D$D$X $L`eUWVSD虧.Uu 8E1$V"D$Zy$kHƅ1ty<$贫D$D$ D$D$4$NDž%8+x$uD$D$D$ D$D$$YD$D$$$ߪ<$ɪ4$P:1U+D[^_]ËD$L$<$aD$$U댉4$9t&c뀍~D$ $D$D$ $ ^$`V UWVS,FE܋}u 8E؉ËE1tstX|$}<$]\1t F TFuF }؋E+uS,[^_]$!]ԠƅuՋ]܍yD$ D$D$4H $][]4UWVS|huE 8E1$YD$D$@4$gDžD$t$$7YD$t$<$Rg҉a0<$Yha0u0D$$7U+u>|[^_]1䍃yD$ hD$D$NH $[ UWVSt1EUU8M1ɅtBE}<$WM L$ED$<$?XED$<$U+u:t[^_]ÉEyL$ \L$D$hH $:[ESUS茢!E D$E$[]USbE D$E$[]UVS7̿D$yD$V 4$RD$ t$ED$$Ss[^]UEȅyt ]%]]UWVS0誡CE؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]8ƅuՋ]؍yD$ D$D$F| $Y[]UWVS̠aEE EEu}8U1ҍ $D$@$ d \19ȋ})׉ 9}PD$T$$cc~3D$T$ $19|vH]0$+d]0t 14]0$dm]0D$ $U+uw[^_]D$ D$L$$VB$c1몍D$$:tыptvsUD$D$D$D$ E D$E$]UWVSxnEUU8M1ɅtBE}<$M L$ED$<$/ED$<$_U+u:x[^_]ÉEyL$ L$D$| $wVEfffUWVS躝S ]4u 8$ËE14ENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ |]Ћ~$x}ԋ^(p]؋~,l}܋^0`]^4\]~8X}vh}l1u1u1lj]11ωtdn߉Љp}1U1׋|1ljh11ljpu2n׉l}1u1x1Ɖω`11߉lhnlj}u1u1t1lj`11׉hnωU}u1U1׋p1ljߋu11ljd`2n}U1׋U1׋l1lj}11ω`n߉M}U1׋|1ϋh1ljNjU11\Un׉u}M1ϋx1ϋd1lj}uM11ߋMXnlj}M1ϋt1ϋ`1lj}11׉T1nω֋}U1׋p1׋\1lj߉u11ljPu2nE}U1׋l1NjX1lj}U11ωLn߉M}U1׋h1NjT1ljMϋU11HUn׉u|1Ƌd1ƋP1Ɖu11މDnƉًux1މ`1L1ÉމM11Ӊ@Mnى|t1ً\1ًH1M щˋM!ˉ! ً];ܼىxp1X1D1M !׉! M}MܼMωutl1T1@1Ɖuu !! }ܼ։׋ph1ڋP1ڋ]1‰U ӋU!Ӊ! ڋ]ܼЉˋld1ȋL1ȋM1E !! ȉEEMܼEuh`1H1u1MM !! u>ܼΉ׋d\1D1u1‰U ֋U!։! uܼӉƋ`X1؋@1؋]1E !! ؉EE]ܼEÉM\T1ً]1ً]1MM !! ً];ܼˉىXP1ڋ]1ڋ]1‰U ӋU!Ӊ! ڋ]3ܼӉƋTL1؋]1؋]1E !! ؉|E]ܼ|ÉtPH1ً]1ً]1Mt !! ً];ܼˉىLD1ڋ]1ڋ]1‰| Ӌt!Ӊ! ڋ|3ܼӉƋH@1؋]1؋]1x !! ؉pxtܼpÉlD]1ً]1ً]1tl !! ًt;ܼˉى@]1ڋ]1ڋ|1‰p Ӌl!Ӊ! ڋp3ܼӉƋE]1؋]1؋x1E !! ؉hElܼhÉlM]1ً]1ًt1Ml !! ً];ܼˉ]}1}1p1lj} ׋l!߉! }7ܼމu}1}1}1Ɖu Ɖ!׉! hul>ܼhhl}u1|1u1Ɖ11߉ubhUu1x1u1‰֋l11ʉub‰Uu1t1u1‰։ډh11ulbщMu1p1u1΋h11ubˉlEu1M1ȋM1l11ЉMh1bƉ֋UM1ʋM1ʋM1‰ыl11ډM9bU|1ʋM1ʋM1‰щd11‰hlbӉEEx1ȋM1ȋM1ld؋M11lM1b|t1ȋM1ȋM1E11Љ|bӋxp1ʋM1ʋh1‰щl11x]bډtM1ʋM1ʋM1‰ыl11‰t9b׉ :dpM1ȋU1Ћ|1‰11؉pl bȋd]EU1ЋU1Ћx1‰1؋d1؉l2bƉuU1֋U1֋t1Ɖu11ΉU:bM}U1׋h1׋p1ljىߋ]11ljU]b߉EU1ЋU1Ћl1‹E11U bЉEu1|1u1ƉM11؉uMbȉEu1x1u1bʋE11UEu1t1Ћu1ubʉ؋U11EU1Ћp1ЋU1<bËE11؉Ћ402މC(lj{8 F ,EF$E+u~[^_]Ë yD$ D$D$ $^@4< yD$ D$D$ $ @ 3UVSkut7#EgFFܺF vT2FFF[^]ÍyD$ D$D$ $?UWVSÂE[U Pu щHs H?J]Ӄ?@)Ӊ]<u EEu|UHL$$EU);MEƋ} T$4$dڃ@;Ur)]] U<u sRtft[^_]äfEuMEC] }|:}hyT$ T$D$ $=EU xEyT$ T$D$ $=ECfm2u KM &fUWVS(譄FE}u 8EËE11U1ۃÉу\u݉UD$]䍃yD$4$>F%=Ut,D$\$4$F%=u݋UD$T$4$t!1уu}E+uo([^_]Ë]䍃yD$ D$D$ $<]䍃yD$ D$D$ $;]UWVS0/ȠE؋}u 8EԉËE1tstX|$}܉<$]1 F TFuF(}ԋE+uS0[^_]$)]~ƅuՋ]؍yD$ D$D$F $;[]UWVSQEE EEu}8U1ҍ $D$@$E \19ȋ})׉ 9}PD$T$$D~3D$T$ $k19|v1?0$E?0t 14?0$E>0D$ $U+uw[^_]D$ D$L$$#$E1몍D$$tыptvUD$D$D$D$ E D$E$]UWVSxÈEUU8M1ɅtBE}<$vM L$ED$<$ED$<$_U+u:x[^_]ÉEyL$ L$D$ $7EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8puX]H MPUHMX]HMX ]P$UH(Mp,uX0]H4MP8|@yZ<3 h Ӊ 1Ή\uh3n\  1Ӊh]nh  h׉ ؋h1|9n ׉ 1}:nh \ 1ڋ}h;n ҉ 1Njxn \ P҉։h 1΋}\;n <P hӉ\ 1Ӌu0nˋh Nj\ 1u1nЋ\ \1u2n 1ڋt7n \ h҉׉ 1Nju\0n ҉ 1΋Unhމ \1ӋUhn  h ҉Ћh 1Un\ h 1Unh 1!1‰hUܼh  ωh1!1ω}>ܼ<2  h1!΋h1֋UܼƋh 1\!1Uܼ h1!1tܼ\ 1!1ًUܼh 1!1‰\Uܼ\  1׉h!1ω}>ܼ<0 1!1֋Eܼ h 1!1h]ܼh 1!1hEܼh 1!1ىhx ܼh h1ˉڋh!1‹|ܼ 1Ӊ!1ȉËEܼ3h 1É!1։\uh3ܼ\ 1!1Éh]ܼh  1߉h}9NSh  h։ 1t2NS ։ 1ʋu0NSh4h ։ ʋh1u0NS  ֋h ։\1ƋUNS>h Ћ\ 1؋UNSȋ\ \׉ 1‹}9NS 2 h׉ 1ʋ}>NS \ډ ׉ 1Ћ|;NShlj ׉ Љ\1؋}h;NS  Ӌ\ 1Ë}>NS ˋ\ Ɖh1u1NS4  Ӊًh 1]NS h PӉ 1ʋ]NS< @։ ʉL1x0NSPӉH pm h T։\ 1׋]h>pmNjT \Ӊ 1]>pmы\ 1؉hE>pmh‰ 0 1hE>pmh 1Ήh|3>pmhh ։h 1Ӌu7>pm h 1Nju1>pm׋h 1hM >pmh  1ډhU>pmh  1hE>pmh 1Ήhu3>pmh \҉ \1ӋU>pm  h 1Njt>pm \ ׉ 1U>pmh \׉ 1ڋ}8>pm\ 1!1hEvmzh 1!1Ήhu3vmzh 1!1Ӊh]vmzh 1ljh!1Nj]vmz  h1!1]vmzh h1߉!1ڋ}8vmzh h1!1xvmz؋h Ήщ\1!Ƌ\1΋t vmz 1щ!1ӋMvmz\ h1!1NjM\vmz  1!1M vmz  h \1!1ڋ}h8vmz \ 1!1hEvmzh  1!1Ήhu3vmzh 1!1Ӊh]vmzh 1!1ljh|9vmzh 11hMʋh 1ډM1ʋx M1ωx1׋U ߋM x1ʉ1U Ƌx ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11EE 11؉E|ME 1M1ȋt U11‹M UM 1ʉ׋U1׋U U L ׋XUzp4 <UrU1ЋU1Ћu l@؋uF ЋL ȋH1P]NSdыUȋUBU `HEĸ[^_]UWVSE}O_M]ʃ?@)Ӎ41u}Mqy9rdun?v91۾@ω؋]E D$<$Ov@9s]ËE19s-)] }|u s~tft[^_]19rӃ[^_]Ë}}]}|u skEu[EuREUED$E$U)֋E9r{}؋]HuVu=ffEtuVuƆUUED$ lD$D$<L $fffffUWVS.^{} 8E1}D$D$HtHE$"t=ED$D$<$|;Es1U+[^_]ø"㍅D$E${tt@D$E$Au[ED$SD$<${;EsED$|$ H%D$`d$T$U.ID$ tD$D$B $蜟UWVS \hzD$V \$E$qƉ؅u [^_]É01UWVSp\zUZ ut$$Z @B1E}E1uNjU:ME1uEHt$$xxZ @B1Ƌ}E1NjExME1EH D$E$qu(Z ]ٸ@B1E1؃p[^_]øp[^_]$'蜤Z +D$ D$D$H $UWVS#[øxD$cD$E$|uE-@t&tD$E$u܉[^_]D$yD$E${t 1[^_]ËEpD$D$4$u{E@<-u?EP-DPtEPD$ ED$$UWuMU9p9g^My+th)ƍF߃1BD$zD$4$zE@t<+ !M?!UYwE?w-t u]Ë u@u1]UFYvEP>w -]1]UWVS( Yßvu}܉|$D$4$xINE uG>wlH8EظE! EED$|$4$([^_]Ã>w2H8EظE ExkUWVSBXuuD$ tooD$D$,[ <$y) [ -t@ [ [^_]ÍU T$ t$)‰T$$h뵍(D$D$,[ <$ffffffUWVSWuƉЉυV=vlot ufus  E ] ^}+}-}=uFЃ[^_]Ã+t-uuXE #EFЃ[^_]ÃXtguy-t~F+։} RF F+֍R먉} 룉UyT$ T$D$t $EFlFaUWVS-Vsu ] EEEE}|$EԉD$$/$v$EvD$|$$EeD$D$Ẻ$wAMẺE0EU-DPuHщMEE1EF$381rUWVS vI gƉU,c tG$ ?uE8rt;F$ u [^_]D$$pn$ [^_]Ë$ FuEx+uD$$/nD$$nF$b Ex+uUWVSH=flj֋E8rMD$t@G$EGF$ MUVN ,c ,c [^_]Ë$EFG$ UMUVS(HeEu] WU EUE"E7uT]LwmƃtK]wEU $U7E@([^]Ë]썃D$뙍EU D$ED$]썃pD$ D$D$}$$](0w7t]썃D$'E$]KE$z E$o 01([^]Ë]썃D$]썃p D$ PD$D$` $w]썃zwD$ PD$D$` $:UVS 3FcEu2]YUEoEE7]ktht1EU$UE7E@ [^]ÍEUED$E D$E$] $:]07t]썃D$E$]IE$ E$ ;01 [^]Ë]썃D$B]썃D$,9]썃zwD$ HD$D$` $]]썃p D$ HD$D$` $+uUWVSDb} 71,c 19~uMU<$]UҋM}8D$|$F $t։4${HE[^_]ÉM썃D$ ,c M[tD$ 밍D$ c,c LzD$ @D$D$` $4$GUWVS\Cô`EE}|$ ut$E D$E$#t$t$E$eƒЃ\[^_]ÉEEED$$BUt։|$ D$EE D$E$Q#MtZEEL$ME$2eƒMtU $FUЃ\[^_]ÉMG8MtE9uWEE뤍zD$ XD$D$> $M$ M~9E~L$$d‹MfffffUWVSPA6_Eu}b]DE E AEEEdE{~ 0jM_U tEExGz;EGEkMddeEUMEEE EqE܋E$]6 8MԍD9E 0>EUM]L$\$ $T$],9tu׉EUM]ىeщٸ9и| E AED$ExD$E܉D$ˉу2΁ȉ%ƉƸQ)1ʉ)i)\i(\ø)\ƋE؉E]ʋUʉD$ T$])zD$E D$E$19} |P[^_]ÍEEEEEEE18[^_]Ãf~*t{uE9sfu!f=?tf=[t]]uuf=?uS`EuLCEFfEf=!E؍FEf}!&f}]AE܉EFE1]ԉ}ЋE܋}]f9uxf]t(fx-uf9r f9Prxf]u؋]ԉ}}ЋE9Su]ED$ D$D$ $eAAzD$ D$D$ $3EMzD$ D$D$ $FEvfuf]SƋ]UWVS"9÷Vu} ttFD$$K4[^_]Í+D$ D$D$D $du\zD$ D$D$E $6UWS8$Vׅtkt/tPWu 1[_]Ãu[_]ÉME sT$ T$D$q $ME뙉ME(T$ T$D$p $MEZUWVS7aU8U1҅tWF @D$$tV$U+[^_]!h㉅qzT$ T$D$E $nfzT$ T$D$C ${/cyUWVS$6PT]E։M5_VЍEF t =F}|$$]7DžF\~MfyuE)E $M]52ÅM‹EiFJ‰F u $[^_]Ë}E=v]ԉUE$]1DžUt߅FT$D$<$]' tD$ D$D$ $]썃qzD$ D$D$ $o$]9FVNUWVS4fRljdhlE`E XuEpEP8<E1h`Xphf?X9r9f>*uf~*u1f~*@DFH9`PD$pD$ HD$XD$`$lhdDž|hfDžDdf8$pD$D$<$sQp@ @<$P TTp@ @,Lt4l8\T$LЅpQ tPNy~ x .5 h\9lHfOfuት\9lD@u5p4d*4|%=H`h#W89sfG/fPD$pD$\$ld=hfDžHDž@DžDdf8tpdHu|%=@1P(X|%=@B9pp/%`2Y븋`fzD$ D$D$S $GM`Zk`1҉p/!UWVSDo(F8ƋE1Hf~uQ@ *΍f}f/sP9uݸz0fd"f*ffʃft@f?f[uZx!#qf92f[ʉfuffP u:!N f?ʃDW Ӏ_ Y9t fx*f*ʉك |$|$<$U+D[^_]ÍJfzuf[Qr f2f]u답f[!Vf]tI։ύOf%ff-uFf]fG-Of%fG^Vf]uH Af]N9D$D$ D$D$$ P f 9 9sVfPfu9t.P9fx*P9fx*ʉW 9B ;T$ D$)L$pP$覤f[!ʃoV- 0!t$xK…DD$D$ D$D$$Y@xf@!EfH9'?qz|$ D$D$ 4$|$ D$D$4$djmeUWVS"9@Ɖ׉MG tMA PQ f>{tBEEft>f{uED$E$quۋE[^_]f~}uf~uM[^_]qzD$ (D$D$ $yMUWVS0!N?)9YË)ډσˉHPftDΉ1ۉff}tYFftf[tWf{uFfuM `E10[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1=f[uSf]fً9CS{f{f,uvu91ҋLf fuM }1uLfAf}=s-%qQf]tyىC)D‹΃tfFrT$ |$D$ 4$=ɋqzT$ |$D$4$ qzT$ T$D$ $u=$SًfvSdfPUWVS([;u} UDžDžDžDžuBB EBB]uR} UfP9~ʅ\uVtM@ɃfH9Nuft ([^_]É\@x'([^_]B&} U맍zD$ 4D$D$ $U} UhUWVS79EtXEPtF@ *E$/ǃ\c []UWVS8 á*}u #D$$D$D$D$$D$ T$(T$T$D$T$/}t6t$ T$w3D$41 1ۉL$\$l$ǃ\$ 9r؉e[^_]D$ ÍzD$ \D$D$F $D$$D$D$D$$D$ T$(T$T$D$T$l|t@D$ T$AzD$ \D$D$E $C1ffffffUWVS )z$.3tƀ8u^UD$L$ J{D$D$`c 4$UE tE 8 [^_]D$ ED$4$*&xT}untHuG<&wht${$D$0{$t$z$`c Wu@9|w뵍=.9,n@뽍u2ЉED$0{ $`EEUD$0{ $7MEbffffUWVS 6'ljD$\t$<$Jt8t [^_]UWVS8a &8E11҉g r񍃌c `g D$ D$D$$g L$$stzg t8#tg g g g D$~D$W{$跞- g 8#`g Qg t8xuxxu xg 8sxwx|(=g <$g $g U+[8[^_]ǃg ǃg t)$Pg lt$5g D$g D$4$*%Z Dž<$9u؋|t΍| 7tt$$蟶uታg >x~x~61g P9T$$At&HUVSÂ#g tftKg [^]ǃg "D$~4$Ҧg ut$f$N1[^]UWVSr#uǃg g t0$t$g $btHu1v>"D$~<$2g uΉ|$f$1g [^_]ÍED$ D$D$ $EGUWVS/"uǃg g t-$t$g $芴tEu1>"D$~<$]g uщ|$f$1g [^_]ÍED$ D$D$ $pJUVS[!ǃg g t$H[^]Í"D$~4$譤g u҉t$f$)1UST g t$mǃg []ffffffUWVSLæ ]ԉljUĉM؅uą]1E-EEu؃EĉEGET]DCtE- ?*WЍL]DS<*E-}<* tЍ\]]DStڋEЀ*Ҁ[i\U؃B] ȍ{}}\\ ]]DKtE-M9L[^_]À?*vG[\U؃]]Oh}눋}].@렋]у]}ы]]}L[^_]Ë] ȃ]_]_]|}܋}D_]}E-M‹u}[}]ԍo{D$ $D$D$| $螵zD$ $D$D${ $o}-};EӋ}E//E/(EEE-EE؃E}}tÍLUDBt EE$ME/uEtveu؉D$/E$]NgEEÄ Et8t 1]ø]UWVS\x u8EE1*t$D$Ẻ$ig }e1󫍃g EЋM̍g |t:tEЃ9s EЄug t$~{D$Ẻ$+oFD$.gD$Ẻ$oEЉED$D$Ẻ$nx,uЍDD$4$補$h 4$D$:*D$Ẻ$Zt$h EԉEȉD$D$Ẻ$sZEԉg EȉD$D$Ẻ$st Eԉg EȉD$D$Ẻ$st Eԉg EȉD$JD$Ẻ$Wst Eԉh ED$[t$Ẻ$mEfg EЉ$EȉD$D$Ẻ$rXEԉh EȉD$\D$Ẻ$rEԉh EȉD$D$Ẻ$rVEfh EȉD$TD$Ẻ$]rEfh EȉD$ D$Ẻ$-rEfh EȉD$TD$Ẻ$qEfh EȉD$M6D$Ẻ$qsEԉh EȉD$tD$Ẻ$q>Eԉ h EȉD$bD$Ẻ$qqEԉXh EȉD$HAD$Ẻ$CqEԉ\h fEpxEfEbxEfEfxEfEoxEfEtxEE`a`h E؉EEEčEEEt}4$TT9u f9t]:/t9r 9֍vtJ:/u9u .t&8:/u9r)vli 9u(Ƅli [^_]Éր>/t>li ǃstftƄli [^_]Éڍ}ffffUWVSÆE$q}|L-DB-fkfbfg@菢D$ ED$E$JzEUE8E9t8u|L8"tQ]ڋEƍ EʋM Q1[^_]fmuAxn1bM]9ȸs С[^_]þUS*D$ E$轧[]fffUWVSa}tz?tu<$ؒD9u p9ti8/t9t`sc~/t9u)=vlm ׃rtftƄlm Ѓ[^_]ø€8/t Ƹ봸}US<;EEEEEEEED$ẺD$$tEMt<[]ø<[]fffffUWVS !ö8ƅt $輞UtE t [^_]Í}$8E uD$D$y$cǃtD$$D$<$D$<$~<$zpUSCEt=tU T$؉$[]$UVSÍutE D$D$4$蕤[^]Í tD$ TD$D$1 $;fT$D$Ít&T$D$.&&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  .&&T$D$L$  .&&.&&D$ffff̀rS[P[Ḯ̀rS[P[ḭ̀rS[äP[̀ffff̀ffff/̀ffff^̀rS[TP[̀rS[4P[Ḥ̀rS[P[<̀rS[P[̀rS[P[ḇ̀rS[ôP[̀rS[ÔP[ḓ̀rS[tP[̀rS[TP[`̀rS[4P[R̀rS[P[2̀rS[P[ḩ̀rS[P[P̀rS[ôP[ḷ̀rS[ÔP[Ḷ̀rS[tP[ḉ̀rS[TP[̀rS[4P[Ḛ̀rS[P[̀rS[P[Ḩ̀rS[P[1̀rS[ôP[Ḍ̀rS[ÔP[òrS[tP[ìrS[TP[l̀rS[4P[t̀rS[P[s̀rS[P[r̀rS[P[p̀rS[ôP[j̀rS[ÔP[m̀rS[tP[̀rS[TP[Z̀rS[4P[ ̀rS[P[S[P[.&f*̀r׋L$Q1fffffỲrJ!Q UWVS álq pq D$$pq xq +tq |q s$uu[^_]ä[^_]ft뻋tq Ppq D$D$D$D$ D$ D$$7lq 31lq D$$lD$$-$衕Gf?USBpq E)9lq t$.[]à T$$[]USeD$$Cq u !$k[]fffffffUSúQ)‰э)y )ȍ BЅyBut*$I )Ѝ)‰)[]i)\P ףwƒUWVS ÉUB< we΋EE11u v4B< w-ύLzЋuU<9EsNju9r9MrE؃ [^_]1 [^_]UWVSÁEU1U9} t?E $MOƉD$ED$M $uˋE8E[^_]ËUt E1UWVS$oƉ8E16-ʄt/}9tBt DK@t⋍t0DCu1U+u]$[^_]É $\`Džtҋ0F D$<$'_F$F(<$`떋UWVSXDE؋}E }x EEEE]-]wu8EX]E]܋DJ@u.<%uEUMYC}Ѝ~}E@}GEЅ>MUЅM E؍{E-D$ ED$T$<$ƉEMEU$c1ɉpƉEE M]ȅt)ExQ)؍)MEH}eMEoMMЅGEP$1ɉƉEM =MEU$nƉEE}GEЅMMU$5xƉEMwu?%}ЅMEU$ ,ƉEE}GEtYMUЅKEP$ ƉEEx @uMEЅM E؍{uЅETMEЅE؍{M$=1ɋU[ƉEEMEP$1ɉ.ƉEE gMU$ƉEM踓$I )؍))ыEHEMPЀ E MEEЅMU$c1ɉoƉEEȅmEHQ)ȍEE}GMEP$;1MEP$ EEЃ} uG' MEP$1ɉƉEEUMuDBuMU$c1ɉwƉEMEMpMElU$'1ɉ5ƉEE-l}G}eMvMEMEЅ7E؍9.%]ЅE ,}tz]ԋEpE@El‹}̉)ЍH$I )Ѝ))ыUčD)֍D)}G؃Eԃك}}}Gw}Dy@&V؃DY@u] utU܋DB@UЃ@)FUDBb3v%ME)EERUЃAD$1$E؍ډ[t"UB M)i]D$1<$ED-ډM]K U8cUu-D$ ED$E D$E$b]UWVSD;Eu q 9PMP M܋HP UPUPUElS * T$$ML$ ML$ML$ML$M܉L$ML$ D$|$4$^9D[^_]ÍMP MMIH??? F??? F?? ?F ?:??F:?? F????fF m늍 9gfff))L$(¾T$$ED$ ED$ED$ED$E܉D$ED$ D$|$4$]9T1D[^_]UOq D$E$]US8%EЉD$E D$E$LtUT$$8[]US4LEЉD$E$ MtU T$$m4[]USäE$cLtq T$$4[]fUWVS@fUE u8M1ɃtHMċNMȋNM̋N MЋNMԋNM؋NM܋NMN MN$MN(MMuăt,tSt9T~U+@[^_]Ét$D$t,$Ac׉t$D$t,$+ct$D$t,$c뫉E UCzL$ L$D$;0 $JxE UL$ L$D$:0 $xE U(fffffffUWVSQu} tQt!1t  9t)ʉЃ[^_]Í{D$ D$D$8l$w볍{D$ D$D$7l$^wUWVS趾KMU Etx $MnxMMEpEt';Uu"|$t$F$V9UtމuE tH9uMtFE]ȃ[^_]E千{D$ D$D$I$tv={D$ D$D$H$EvUWVS 螽/uU Mt;A t+ ÃutF\$D$$}O [^_]fUWVS 1MtU D$E$ED$}|$E$ ƃE $KlEL!80t6Eu1 [^_]ÉL$M$UTUM $…tU $VUMȉ׋usYtftE|=Eu stf`Z뉋E|떍ED$ D$D$C$tU b|D$ D$D$D$sD$E$Gyf5Ef,zE UVS UE UtuD$E$ [^]ÉT$D$E$hƅu E [^]ÃTt wx01lx 1UWVS?uE 0E,E(84‹E1wD$D$4$~jhDžDžD$$膃D$h8$ShǀPǀTǀX8<$/8Dž@fDžDfFHDžLTDž\dDž`DžX(D$ ,D$0D$<$苽ƅx <$6JuT4E+u[[^_]ÍD$ D$D$D$pfdvRvU$UT$ U T$-D$E$]US ÅED$E D$E$N []US迷TED$ ED$E D$E$L[]UWVS,腷uq}t}ED$4$Q4$HF0tN@9t $˻F0ǀǀ FF~ :\}EED$ED$4$J NjEtiUM E9Ut}uf~ E FUxSMN7FE؉FyEE$cE UEπ끉E䍋|L$ M܍ T$UD$LE؉$nEFEF 8,KD$4$PE,[^_]ËF$M\}Ef~ FFCFFD$4$+PE,[^_]ÃUML$ T$D$E؉$mEFHUE$2E UtGE#D$ D$D$?L$qm`E9Ut!$԰E UtUEmEUVS膴uD$4$OV(4$,EF u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$ND$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$_NqD$D$D$4$2NUVS_uD$4$MV(4$DF D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$MEUw0E[^]ËVPNTUMutt+FEUpTD$4$MgpD$4$MUWVS-}?euw t>EtB[^_]Í4|D$ D$D$M$kj?et[^_]Ft$JV tQFtB1ɉωMT:0$&V T:($V D: $M;NV r$F,t$F4t -$ϵF8t$4$踵[^_]Í'|D$ D$D$K$|iUVSҰg4$zq D$E$s4$z[^]UVS荰"4$zq $s4$z[^]UWVSN<$ozq D$$jxƉ<$Pz[^_]UWVSØuED$@$iED$E $aj…t?t$U$_Ut'zu Ńtt$$_uUEHutU$CEUЃ[^_]ÍED$ D$D$<$g7UVSñ4$=y,r D$E$h4$ y[^]UVS׮l4$x,r $h4$x[^]UWVS蘮-<$x,r D$$iƉ<$x[^_]ffffffUWVS0AUz-E܍uu<0 1E1M؋MLYtyu 8<|EuȋM؋uԍE99)11 ؃9ruu\M؋uu9tzwr<.uUy<0BÃ߀Xt\E f)Ǎ|uԄAEDX@30[^_]BM|D$ 4D$D$F$$eUTuԍE9t11UWVS aiD$oD$-<$LE tED$E D$<$荰D$$ ,FE$?USiUT$ U T$D$E$oUWVS 豫FUEtaEEt88 [^_]à "EE L獃X|D$ h D$D$8$cpM|D$ h D$D$8$wc:}}43 } ;c uuEU}#Ћu0u9dtt4}t>}9tȋEE T-EE } =U n}E vU -DPum}E 0} Ј3E T-&E 0uE E}E } ;U -DPEE DЍPE}} #}}E1EEu } \Et } %Et } &Et } =uE E 0<EuЈEE} ?U  Ћ}E} } U -DPE K0}E IEE 0<}Ј@E nwtEE T-ME 0u Ј} -} ^E-u DpuE EE 0uE[EMEEXE+E E6E E"E EE EE EE EEEEEE\EEEcEUdu_˓ 1cduY7E 7P-WEUE-WE EE1NEEtE fUWVS,֤cu }EEqE/O]}}؍}}܉MEމU)ߋED$ E؉D$ED$E܉$Uw{H GAM ǃEE@uUD$ E؉D$D$E܉$7U+E,[^_]ÍD$ \ D$D$8$ӉU;\Ua9EC)D$ \ D$D$8$ӉU[U3*D$ \ D$D$8$ӉU[UXEE؍EEaQFtM ƃUED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$s]UWVS=ҿulr />3)Ѝ)Ѝ:~ 9w$&tr um"U$Ѓtr U4$Ѕt?w$WD$ D$$UοUЃ[^_]É4$uw$Wt$ LD$D$ $U-=E Ut1҉Ѓ[^_]Ëtr t;U$(*NjU4$CЃ[^_]Ëǃtr 뫋U tuW3ǃtr \r ^D$$=lr Jǃ\r 1+1UWVSB׽uhr ))Љ):~ 9w$&pr um"U$Ѓpr U4$Ѕt?w$WD$ D$$UҽUЃ[^_]É4$uw$Wt$ LD$D$ $U1;E Ut1҉Ѓ[^_]Ëpr t;U$(.NjU4$CЃ[^_]Ëǃpr 뫋U tuW3ǃpr Xr ^D$$Ğhr IǃXr 1+1UWVSFۻ}E$MDždr fE|81ɃP9u/>3)Ѝ)<7ɉM~=~}|$E$MMAF$U 1[^_]Ëtr VD$ ED$$襻E$@F$맋tr u$Ѓtr $('ƉuE$@Otr at $Ѓtr @~u㋳Tr uED$$=ΜƉdr lǃTr ǃtr IUWVSGܹ}E$KDž`r gE|81ɃP9u𸿿)))<7ɉM~=~}|$E$KMAF$U 1[^_]Ëpr VD$ ED$$襹E$@F$맋pr u$Ѓpr $('ƉuE$@Opr at $Ѓpr @~u㋳Pr uED$$ΚƉ`r kǃPr ǃpr IUWVSGܷUEtЋlr t'Ǎt$衞9uǃlr ǃ\r dr t'Ǎt$f9uǃdr ǃTr ǃtr EE EE1[^_]øUWVS\UEtЋhr t'Ǎt$趝9uǃhr ǃXr `r t'Ǎt${9uǃ`r ǃPr ǃpr EE EE1[^_]øUWVSjpUE DžXE/tBD$E $p,E $Guv E t E tDž`Dždxhً]/]=Ut Ѓ/u.t+M L +Mkt/l+]utftl+EthD$E $p)%=l /=@_Ot/t?+Mu~.׉ڋt9E щ`p\`d 5lD$D$E $p]YDž`&$`pcED=`=A߉փsetftdl /tf\`Ut9E etE Ĩ[^_]Étzu \`l5p S?t9E tX$pk1nىf t~uf.륃8/utщ$prE tE XfE pRE /t/tpQpQQ?pQ>Q1UWVSb}E ttrD$<$3'xX[^_]Et$<$}`DžMtAt$$&ymt Q8"tƉ<$舗1[^_]P1fffffUWVS豒F}<$)Br $蠎r ǃr 7ty-E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEuE1[^_]Ër t$pǃr ǃr O yEUWVS蒑'u} u <:tu1[^_]8ut$8tu<@t΃}:t& u}:t;UuF~@t[^_]Ät<:u[^_]ÍD$ D$D$l$cIY sD$ D$D$l$4IU苐$U]UWVSqu} tb 8u$ u|:9ƍt&s :t|tu[^_]ÍED$ D$D$l$eHo sD$ D$D$l$4H:1UWVSl膏ƉE 8E10}!H Mu0r t |$$p$Dž DžUD$ ݁D$D$4$?*D$D$ D$D$@4$&D$D$@$QE8DžDž1ҋ9slxȀ %:Dž\1҃ t t DžN9 ΋9rD$D$E$P5xȀ Mp@<#D$$2ߍFkDžD$=D$<$… <:Duz)ED$T$E$EƋt'p<:tu))|:t:Ћ)ȉ)9 )؉D$\$ $MT$t$<$7$莏y?@E<$6Dž:΍N9))t$$n0r1eN1nCȋ)Љ)Ћ))ӉL$$辊ÉNjÉC:{DžtE$M)P9rg8E+~l[^_]D$ D$D$E$+DžD$<$诉xr $VNjhr D$<$D77lNj4E0<$ZE0Dž$"D$ D$D$l$?́D$ D$D$ l$?ED$ D$D$ l$Z?E$MKE$7KƉ<$6$5D$ \$|$4$V tBt(PuADž4$VDžDž$>5H $证DžL$T$$4$V18XED$ D$D$l$=<$舉tE$lIB <$IB 4$VB $ u!$냋E$HUVSòEM ut.t^UD$t$$P[^]Í sT$ T$D$l$J<M EuM ÉT$ T$D$l$<M ElM EET$ T$D$l$;M E1US#ør t$<ǃr ǃxr ǃr ǃ|r 1[]UWVS0ʂ_ME 8ƋE1Dž]xr r -"r tr uD$r $;D0Dq@:#|r ux|\u ǃ|r ׍:\tWut$r $:lDҀ|\tǃ|r ǃ|r r $l#Ƌr u$(ǃr xr Pxr @&L$$!r dǃxr ǃr ǃ|r f:wu<:tAt<|uD$t$$ƍ@E+0[^_]Ër $2"uhr $ǃr +xr r 0"D$xr $ r 5r t$~ǃr ǃxr ǃr ǃ|r ́D$ D$D$l$7tvD$ D$D$l$_77ǃr ǃxr ǃr ǃ|r $ǃr !UWVSX~u} tPtzr t$cǃr ǃxr ǃr ǃ|r } u[^_] sD$ D$D$l$f6úD$ D$D$l$86WUWVS$}"Eu} (TED$=|$4$ƅl$d]PyDž<:9}d]V<\ֈmt>}<:tkOML<^uF<:mu‹M])ىύAdD$$]}ljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]}EEM$[^_]Ë]뽸 y]䍃(D$ D$D$l$3Í sD$ D$D$l$3]䍃D$ D$D$l$3z1*E$]d<$]O]8 UWVSz"Eu} uE0D$=|$4$Dž$d]Pvƅ<:d <:tCZtsu)Cd]D$4$]1{Un‰ƹd<:uЉƍX)Ӎst4\$$U]zU@Љ)ӍsűE[^_]Ë]썃D$ D$D$#l$1E]썃(D$ D$D$$l$1Í sD$ D$D$"l$n1Z]썃D$ D$D$`l$<1)D$4$]yt-M14$]}։4$]|]U6 UWVS-x•}E uD$#D$<$R80tN 1G<w/G9~ƒ9G< w91[^_]ÍG<wG@tftƄ/DžDž)S$O9>:hfL2 81Ƀ4uA )čD$}pxr󥋵t$D$$%8D$D$$5|$t$$5D$ D$$5ED$ XD$D$E$+udurP1rBvBDžqfzOU r!8D$E D$E$]UWVSTr}U 8E1EtqMyu )čD$UPtMP}y:u}!8T$D$<$36U+ue[^_]ørffffUSq8D$$+Ev D$ 7$uLv []UWVSHQqu} }ԋEE8EЉE1pD$ $Z>v u}MfMUT$U܉T$ D$ UT$$AFuM vU܋9Eo} uv t%9v t1uЋE+H[^_]Á} u v uD$D$,$\E؅tdEċE؉$`KfxHuPPM3J$z 1 uԋM3JʀuNjPD$EĉD$$U裲DžuED$UȃT$Ẻ$;EsE؉$^ % ЉD$4D$ w)D$ED$Ẻ$G ;E1B9EBf9EwB U؍yM|$D$Eȉ$EċMQUUȍD 9E89}r5M̉ωփs1tft1HE؉$]3")UuuB r Ef&US[nD$r \$ ED$EU $T$u؃[]1[]ffffffUVS<n×M uEEEQEUAEt8MEȉD$L$E$*uUȋM̉NU܃V<[^]ÍuD$t$E$*<[^]ÅuUS,VmEEEEE܍ED$E܉D$$/uE,[]US,m×EEEEE܍ED$E܉D$$h/uE,[]USlCEEEEEE$/[]ffffff=̀rS[P[ḽ̀rS[ԉP[̀rS[ôP[(̀rS[ÔP[L$S[z -[t'L$̀rS[Q -[ )US k-D$E D$E$)f []US fkD$E D$E$Wv []US4kɈD$ ED$E D$E$e[]1UWVSjÈ}E 4ME08E1E(,hEED$E$z4D$h8$G5hdžPdžTdžXfDžD8H<$$ I}|$T$UD$ D$D$@$ыU'$ tLtF@Ht?|$T$UT$UT$ U T$ML$4$ЉƅuGE([^_]Í}몉U썃LD$ D$D$$@HU0E([^_]Ë$ 1ҍ}QUE썋 L$ L$D$J $EIUiT$ (T$D$}$E]tD$ D$D$[$UU=Z-D$ED$ED$ ED$E D$E$]UVS<RZE$ t:t4@8t-UT$ U T$UT$V$Љƅu;E[^]ÍD$ D$D$$@8F0E[^]U <Y-D$E D$E$2]UWVS;YD$oD$-<$Et8ED$ED$<$@|$ D$D$1$E $DD$siD$$E$US@;XD$ ED$E D$E$z[]ffUWVS8:XÉEċ}u t$E$5Eȅuu}EEEE̍Eԉ t1 E U]M!ىˋuM! u t뷋]u!M܉!щME܋UM t1҉EԉU؉ƋM̅t_Mx+Mw&EEԍHwq{E@N4$]Q?tEԃ0<Eȅu tEtJM\Eԉ0҉Q0A0q AEЃEЃ8[^_]E@uU\UƀtUMƍBEЉ4$]x>tU@^GE@uQ4$]y>uT tOFvGE Fv5 *-UЉrBEBE-DptGEЉ7EЃ8[^_]ËEԍPE-PUȅE\@sEU\B0E0<UE\@aEE\@nEpE\@vEUE\@fE:E\@rEE\@bEE\@tEE@0@ 0E^?iE\pEUWVS7íT}U EEuEE tu$U6E+DĔ[^_]Dž:D$ D$D$$D$<$Z1UDžpD$ D$D$$FLEj1UD$ D$D$$ED$ D$D$$$7X 1󫋝8Džp-t0)؋t9D$t$$R59.9Ëϋtft6tt$3$2$29&!Ɖx!։|x| t1ҋ9ĂD$ D$D$$J$3…t01DžDž1 t1 !! u e눋 09Ћ!ȋ!ȉ t1ҋ1 D$ D$D$$b2<$Y3t 01s^D$ D$D$$D$ D$D$$L" fEqX#111҉mldUVS4*ƹGEE8EE EEEMED$ UT$UT$$1!xEU+u [^]1rlUWVS)>GEE8EEEEEMU ED$ }|$}|$$xEU+u [^_]1kUVS-)Fu t44$D$ UT$UT$$1ҍE=[^]1UVS(pFut54$WU D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME|]UU E D$ ED$ED$E$MEI]UVS'ÃEEE8EE EEEMED$ T$UT$$1xEU+u [^]1;jUWVSr'EEE8EEEEEMU ED$ |$}|$$kxEU+u [^_]1iUVS&ÊDu t74$qD$ T$UT$$1ҍE[^]1UVS&5Dut84$U D$ L$ML$$E[^]1UWVSI&C}u t74$D$ T$UT$$1҉N[^_]1U%CD$ D$ED$E$M 1ҍE]U%BCU D$ D$ED$E$ME]Uh%CU ML$ D$ED$E$ME]US +%BEEEEED$E$E []UWVS$$zBDžE = tIƍʴD$D$ t$|$$%tyDž 9AD$E$>uƋI} t9rcJ8 uv9t<$c($Dž9t4$(Ё$[^_]ÉUE D$E$K]ffffffUWVS!#ö@ƉЅtK Љ Љ Љ Љ Ѝx|$F$%$tBF~1[^_]ÉU6T$ xT$D$y<$3E냸UWVS"@ƅ9N rn~PRuF$D$ D$L$M<$Ģ^M΃ډE:BGuETB[^_]ÉUy(MED$|$F$DMҋMUu~ LЃ[^_]ÉMU6D$ `D$D$<$MUMڂD$ `D$D$<$M9N r~y(M+ED$|$F$CUMu~ 1UWVS d>ƉυZF(JJrPf~Jtt$ $ uKLQthF%=@=\=DĔ[^_]Ptt38t$tB$Pt9z |1tft Ĕ[^_]fx t~B8z<~ ^z0Z4FB@zT.IBpDp@PDH41ًP01 uH<1t3P8 uҋpx9t<|1tftFĔ[^_] nĔ[^_]Ét+D$ lD$D$<$tt6D$ lD$D$<$tkzUtBT%=.8t f{f{UWVSF;E։ʅE@(tvBXU$U@PxTZrtftP,}WP@ @J@ @@[^_]ÍU$txTULYHP놉M썃6D$ TD$D$<$YU"U썃ED$ TD$D$<$!U1]UWVSi9ljօxlxD$$ tE3G4U3W0 u|3G}4F)uGHf fű~t$ u} EHDu@8/tF(t`F[^_]ÉUD$D$@$NǃUtq#F<$b<$ufF몋E@[^_]ÁN(i6D$ D$D$1<$F11UWVS%utp7u4E4$u(4$R E$F[^_]ËF$$뿋F$$F$$F$$ 뵍D$ D$D$Bp$ۿaUS /$-D$ D$D$E D$E$l$]]US À$ED$ D$D$E D$E$l$]]UWVS8@$Ɖ׉t,M.=U= =T$E؉D$E܉D$ L$|$4$KS=ƒu܍M؁ ʨtUEԃ8[^_]1EEkEhEEMdҺ뱺몋U른"ك8[^_]1U}#-U E]UMU E]ffff̀rS["P[̀rS[ô"P[ ̀rS[Ô"P[USx"EM u 酔t9u[]1[]UWVS:"u} ttB|$4$趴[^_]Í{D$ D$D$B$u{D$ D$D$C$轼UWVSê!u} ttB|$4$&[^_]Í{D$ D$D$B$[u{D$ D$D$C$-UWVS@!t$0D$T$L$4D$4t "|$GD$8UT$$\$0xuL$8ǀ-;+=D$D$4C0ND$D$$D$ D$( D$,D$4 11҉D$8T$<~09L$4xfD$$|$89T$ |$<O|$<1\$81؉ -D$(T$,Ë|$<ߋD$8d$(ډډD$8T$<NyЉ< uA< W9L$4jߋD$8T$e[^_]D$rD$4D$4FL$8D$(T$,D$T$ $D$\$0ǹD$$T$ D$(T$,D$T$ $D$yD$L$8D$9\$0="D$8D$E $]OD$@E$\E EUP ]萵]썃D$ D$D$P$uu1]=uUWVSã}G $wt6$uG[^_]UWVS[u} t"tL D$ $ͦ[^_]ÍD$ D$D$:$uD$ D$D$;$ԮUVS8-ut&== =@ED$E܉D$E؉D$ T$E D$E$B=t3w $Ef>@fFE܋UVtfNȃ8[^]FfF1E@EÿE?EEURҸFfFFfFs1]fffffff̀rS[tP[UE]UWVS$ME։ME}E؉Eut[E9UsH߉։]EƋE D$\$4$U~" HS9uE)9ur‹]ڃmu$[^_]Í0D$ TD$D$r$苬EQoD$ TD$D$s$V"UWVSX@Eu U E } XE EE̋EƉE$]nEȅ EE MȍANjEȉEԃ)֋]ދuމu؋ED$E$M#EȍDMԉED$EED$E$U1ɅM9uREEEȉEEEE؉E܉}ЋEM4u}؉9_u E9s#ED$ED$4$U9Etщuă9UM]+uED$T$U4$U}9NjUt +EMC1ˉUE‹E9rU]}M9MrED$ED$+E$UEEE‹E+EMȉEuM9M}ЋE9 EEE]ԋ}čGU9Eщ}U܉EA‹M)ʋ}č M9xȋU)Ћ}lj}ԋE9E9EM]ED$}|$]$U}]UEE؅:U!ED$\$<$UU9~ ]E9rՋE9M̅pU܋E 9r}G9D)EE܋M܋E}89uM܉E}9}M9M M]E̅uU܋E}Ћ029r}GU9CЃ)E܋}EԉE9DEԉEGED$E$MEEԉEȉEċEEȋE9EEĉ$]1X[^_]Éˋ}M 9sWEƉ}Q+ME }uڋEE‰]MĉEE HZ9Eu]M9r}M8E}ljMĉ]XJM9uˉM]9sMˋUMUuދM9U]3]M9ËED$\$<$UM9Ӊދ]19ME9Ms?}u}9us'<3ED$|$E$UU9~؉9urً}uE9Zu̅U܋E 9rUB9)ӍCEE܋M܋EU‹9uM܉E}9}[M]U9UU̅U܋E}ԋ029rUB}9G)XUE:}܋u9rUB9)]E؉ËuEߤ9uu]]Uމ+]9UED$\$<$UU9ЋUlM9se}؉ߋ]M ֍E9}s8)1ÍED$T$UE؉$UM9ȋU‰9}rȉ}EE%}܋u9r}G9r))]E؉ËuEߤ9uu]]Ҹ}܋uEԤ9r}GU9s/}܋uEФ9r}GU9rщ)EMċU9EȋMĉMȉEU9UrEЉE}ЋEMԉE؋MuuEU)ЉEĉڋE]XJ9u]uE}9EŃ}tuED$}ȉ|$Eĉ$]I}!]oD$ dD$D$&$躢]D$ dD$D$'$舢Í{D$ lD$D$x$WE*]oD$ lD$D$y$]茧NU]UT$D$ ED$E D$E$y]fffffffUWVS EuNt4~^ȉMtH1ًP1 uN9H u [^_]ËMM$]t"N^HXVP MF [^_]ÃUWVSu7uu[^_]=F$$膲4$*NjF$$q[^_]UWVS$ù}E wuq6tk9uFNW9V uW1ʉUW1 UtGD$ D$L$$GWG1D$<$StG9F [^_]ÍT$ |T$D$i$E LffffffUWVSAuE8F}9FiF FD$ D$D$$DFVFD$F D$$FtotfxWFvthV uAzN)91FJ u M ]z u F MЃ[^_]{1}i81F u1UWVS8}7t2G$$MD$<$ƋG$$0[^_]D$<$Ɖ[^_]UWVS \ΣEģ70E@$$ïD$E$,ƅ@ ‹} >HE@$$X0tlEM 1 [^_]D$E$ƅt[P } uuuFĢu蹢}8눋E@$$Ǯ蟢uJ蔢}8E Y}If뱤&fvftJ [^_]E xDE xfffffff̀rS[TP[ḃ̀rS[4P[UWVS$utoEEE Em8D$D$ED$ t$D$E$Sƃt 1$[^_]%8 u8ፃED$ D$D$<0$sbfffUWVS0VƉE̋]E 8U1xu2  t8u)؋U+0[^_]Í}1 r}̍]ȉT=Ѓu]t; t\="t]y$]uk1d]̍$fffffUWVSF}U utrt<Ѕt .t&HOtuxu)Ѓ[^_]ÉU 3*D$ D$D$=l$əU 뒍)D$ D$D$<l$蚙U \fffffUWVSvM} UthtN49t8u)Ή)t3ttu)[^_]1<$Ɖ[^_]ÉUM3*D$ D$D$A$ƘUM])D$ D$D$@$葘UM$USwEy œs(9~)ML$-D$E $1[]ÉD$ +D$ED$E $֜1[]UVSmEy œs(;}.D$@-D$v 4$r[^]ÉD$ +D$D$@v 4$X[^]UWVSÂu} taEtH-EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í{D$ D$D$? $u{D$ D$D$@ $踖FffffffK̀rS[ÔP[UVSzTu imNA90%[^]Ë9r [^]9r싋 UWVSi} P^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓L419|[^_]Ë]싃Lu޾ UVSP4$qTu U4$T[^]ËE4$=[^]UWVSÈ} EqE$T @}j}wMǃTǃPǃLG EG1E$荥E[^_]Ã}?vB}<6 )ȉЉA[TPLW ЉU艃EPU)ЉB}҃?}Ƀ}Ɓ}tUT$D$E $;Es17[^_]:"(썃ED$ D$D$V$|NUE U9r 9]ø]UU E9r 9]ø]UWVS w  w u w !8E1ɍPt-ωD$4$&t  w PEu׉MD$D$4$ MtMljMuD$|$E$  w 8Ftt$E$ 4$QuMEw 9t$$3ǃw ǃw [^_]Éw TD$D$$g[^_]UWVS:u} t%D$4$Itt=t1[^_]À=t[^_]UWVSuut4t$P<$ƅtD$<$ 4$I[^_]ÍND$ <D$D$$ UWVSe}G$jƅtx @D$P$f[^_]UVSíut/t$P$tU 9P [^]1[^]ÍND$ $D$D$$JUWVS 7U!8E8s7i1}ƉUE D$ED$<$+u E <=,E19MƃU;\tkCEZE [^_]UE [^_]L돋 u{Etu>E닉Lt9ur 눋}bM υtIMyED1uLC yvyEE)fffffffUWVS1ƍt$<$ru[^_]D$ FD$t$<$|[^_]ÍD$ D$D$X$Ok떍jD$ D$D$W$#kcUWVSx }u tt$<$u 1[^_]ÍF D$<$薡tF t6u$FD$<$軚tăt$<$訚뵸[^_]ËFE }F[^_]sD$ D$D$x$OjRjD$ D$D$w$ jUWVSu u} t tJD$|$4$菡[^_]ÍjD$ D$D$g$iuD$ D$D$h$iUWVSݰr}u tet$<$\u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$W뵍jD$ xD$D$$hq̃D$ xD$D$$hBUWVSÎ}u FFt 1[^_]Ét$<$VtFD$<$tӍFD$<$0tF D$<$tt$<$ 랍jD$ hD$D$$gVvD$ hD$D$$g'UWVSË}u  GtNu$G tWt)FF[^_]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ LL$D$$fE( GFG F[^_]ÍvD$ XD$D$$$mfكL$ M썃XD$D$%$U5fGUM6G EL$ @L$D$ $eE   FFufffìrS[ÔP[v̀rS[tP[VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS1u} Mt}t]MF9tDJuMtL} XU tz9ut@[^_]É11fu1[^_]1MD$ D$D$;$dMN{D$ D$D$:$cMfUWVS(óƉЉ8U1҅D$ |$D$$$|z<$DZ@9EED$|$$Fu1U+6([^_]E @NteulN u`L$$ $|YHN tD$ D$D$ $E4t9u΃tft%D0 MwT$ PT$D$$a%T$ PT$D$$daFD$ D$D$ $nDu-uFfUWVSéƉЉU 8M1Ʌt=~t3 E+ȁĈ[^_]ù۹Dž9FfxtvEtoEfD$ D$D$<$C<$V9E]ED$|$$-Vu5F~uN uF=tu ~tMEEhED$ t$|$$w4$U9E}ED$t$$M1@FȉC:9DžM9FF ftV ffuu҉T$D$ D$ȉM)D$4$=Mx 9=EtEȃiviD$t$E$ڿ1T D8D$ D$L$M܋E$G=M܅x9E4FD$ 뻋EYQEE@DEԋ}1E؍E܍iEЋE؉M؉u E8EЉT$D$ E܉D$t$ $M<MH9@)ƃu1q҉Ű}UT1E؍E܍iEЋE؉M؉u ET8EЉT$D$ E܉D$t$ $M;9M)ƃ9}u1MFD$ D$D$}<$;<$EOM9L$|$E܉$ԽMUU܉D$ D$ȉM)D$$I;M}9nD$T$ D$L$M܋E$ ;MUWVS@Ûlj΋E8EG uY$Mato|$$Mbt9wuҋtD$G $Nu1ffh$M@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$sO9Aff9't0G9T$D$G$5t$ |$D$$wbu8u Dž11fBfUVS 螜3ut$F $_E $MUYF t [^]ÉE4$^E [^]fffffff̀rS[ĹP[UWVSæ}E$exkUtD֐6t;F txu@9uD$FD$E $Uu 11$kY8[^_]1[^_]UWVSt ut7D$4$5FftID$4$5[^_]Í#D$ D$D$@D$S띿fffffffUE.߃At..t!.t+vPЃ v-u2-.u…uҸ]ÀvPЃ v_u_1]UWVS UE Hzu;9]苰uυ0qD9sDw]Y}D9~D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}ND9OD<]][D9^DυYDM9YDM}B4^D9_D(뮅f"f 9DupR?UWVS$E@dtfɍ<ʉ}ЍMԉu7APWЅt#xuPR#l;htՉNj@u݋F9]uAEF$[^_]ÍMUSoPt@uQPtuHuX uHuxu t1[]PtCu[]U/[]@ tOETD$ ED$4$'TuEt8u x[^]ø[^]Í+D$ \D$D$|$NqUWVS(ëƅt Ftt 1([^_]ËFy ([^_]Ãu ӉM܉ЉUUMxy=fuVfǃؔ ؔ f|M܉UD$ hD$D$|$MM܋U0u?FtTtG1M}|$ }|$D$$VB0@MQVd/볍HUWVS返TƉׅt4tdvu 1[^_]É $GuMT$ DT$D$|$LMuMT$ DT$D$|$LMlM(T$ DT$D$|$|LM7UWVST˓`։8E1tDžDžF F`FD$$D$ D$D$D$F D$FD$ D$D$<$u G @u}D$D$ L$D$<$gO @,1ƒ $QD$D$ D$L$<$赕~QG KD$D$D$D$D$ T$L$<$肖KE+ȁT[^_]ËQu7Iffft#fFPЃ6t?rED$ D$D$ |$I]tt1t dQD7UWVS(蓐(ƉЉ}8U1҅t\D$t$ WD$D$4$ ,=?U+([^_]É4$?PwstP|.ut$T$ D$D$4$+댉ET$ T$D$ |$"HO UWVS4[}8EЉNjE1A<<EԋAE؋AE܋A EAEAEAEEE}YQ,A<9u1҉M 9t5Kt-!8tyՃw9uˋMȋE9~UĉM̋ uEuЋE+u^Ẽ4[^_]Í}1f1҉9r׾tffEfEAE띋M1|]UWVSylj։MEND$A M$…tKX MH GBG B GBGBZJBB!F^ ߋus%uu Ѓ[^_]äЃ[^_]ftug5wD$ TD$D$|$E0)D$ TD$D$|$bEf mUWVS&萌%@<ϋE E(8ƋE1  ( @/ 11 r} !8} t } 0<Hf@fPffL< 8Px HD$ |$ T$L$$‡…L?@@ u+DL<$0ЅLDHDL} t!} t} tDDž6H<$~:=HD ɅLP9yHDžLDžu4 =81HP9H4D)ȉ,D$L$ t$PD$<$HDž@@ uD$0Ѕ[<$.f&G$ƍG$W 8f &} } l} 9U qf&!M8$覈f8G $蔈f,G$肈f&wD$|$ t$PD$<$+…c@@ ։<$O8=>$…(88,,D$|$B$触8 ,&Lt!9 ft LL1.Bvq'tlH$i}NjE $\}$~|$t$D$ D$ D$D$$%螑81H L)Pd8pT4ؔ DH8@@11HrLXDž\Dž`HTtDžxDž|$@(4)L$P#LP3谅1.} 1-D$|$ 8D$PD$<$ƅ@@ u<$0Ѕ8Ɖ<$5P9,| rGL"fǃؔ DfGljfWtuˋW҉N{E+&[^_]Í|G0DD$$Z(FF FFFFl 9u8΍ Gt‹@u iDD$$!H󥋅DD$D$ D$D$$%茍81Lx $Ӈ跂15M(18<pfaf14DD$$W 8FNN uuD4$1DD8wD$ D$D$|$b:5D$ D$D$|$3: NDD$ D$D$|$9($D$ D$D$|$9D4$0DD8,D$|$D<$"8ЉD1_ <$}w1#Lu .8t189 u拽,t t҉11UWVSp'üƉ8NjE1>$ |B${11 rFFtGGFUFq=~1ɀ.уu9`d9@ HDPDDžDžDžDž<$<8=}3G u$1ҋ~`{}$茂$~1xƋND$F D$F$Ƌ@ut2OD$G D$G$tF$ځ$́U+p[^_]Ë넅tJPd9\.$1ҋD$ D$D$$uu~d,@}뎃1@<tE12Dž$1ҋ. P{u@ {81.늍ED$ D$D$ |$3$1ҋgz@u6mwzHDPDE$B&z1jDUWVSxz EhpPt%={8DžthE11҉ rMd11҉`d r`VtA<$8iy^yt[^_]ËhMEEdUMEE$1u`11 rU؅tkhd<$7hE[^_]ËhMEE뀋hMEEd<$7ЉddiX07\P}`1}dX  r OTdDpPRHXLƋX9H`D$ PD$D$L$@%hL$P T$ D$HD$l$6xWE11҉ rlUEE!$\X;l${9T#X\dwc\$5U`U؉h<$5h(‹d뎋DA‹@uDn> t1҃me9Gh9wGw9uhtQl$|dl 9u`q@D$%l$h[l$w…hl)D$L$4$|XdX`phHP HLT v~u~hxv G<FEu11 rE@t`EEEE<$ ML$ML$D$ |$քD$E$twEЅUp[^_]É<$X MML$UUT$D$ |$ɄD$E$*t?E$)`_p[^_]ËUEtFE$_gMEԋAE܋A EAEAEAEAEEUԋEg{EЉƋ@ujZUWVS\ Zkx8NjE1`D$ D$ D$ $nƅ8#3D$4$D$4$xDž< < D$4$Wxt$$}t띋AAA AAAADžD$ D$D$4$~#|$$u@"D$$1ҋE+Ё\ [^_]Ët։։vt.t_tދ$닉D$ D$D$ |$u3ED$ D$D$ |$:MUWVS4WuEȋE0xU11  rŰ]ȍ"D$$qEЋ]̍EЉẺEEtCË@uE)uEЅt $]+EU4[^_]UVSVgtuD$F $VtP PH p[^]UWVS@VtljE8EG ut$t$$tӋD$$-tD$F $ ue$R@=wI$*‰@=wЋЉ==1U+@[^_]Ë~D$<$Xtu狵1DžЍtftȍtftD$D$ GD$D$@$)9OtD9AD$D$G$t<0L9_YB 9@3t9'9uۉD$D$ $kut$ D$D$$+u9u [u3fvfvBjUWVSR6p}utHt$F $E $UF t[^_]ÉE4$~E[^_]ÍED$ D$D$4$ fffffffUVSÉ1   lLLLL9r[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1Ӊ]ӉыU1ыU䍔2L*!1 U֋UȍB91UԍqU11 ‹M]"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1u uÉ_] GMG T[^_]UVSKìhut0FF#EgFFܺF vT2[^]ÍyD$ DD$D$t$HUWVSJ5hEWU P?ωM] 1ÉPHUʉP@)O9]rlڍ<u u|utPE=E);UEމE} ]7E@9rE)uu U<u sPtft[^_]äft.t&N] u]tugyT$ 8T$D$t$EU |ET$ 8T$D$t$kEGf2u S'fUWVS$lHfEE} 8E1WEEG?78)‰T$lD$<$ND$ED$<$7EX1tftE+$[^_]úx)ryD$ ,D$D$t$yD$ ,D$D$t$WZfP轉UWVS$Fljd}Ћ]E E8EƋE13-8}DGt`EE؉<01E 1҉M܉MLAt;}t^}׍T3y1]E+$[^_]Ã}u-t( fɃa) 3믍NȀw볋M܉<.u9twQ3ЋEDP{<0#s߀XtXEE1҉3)AtstEt)Eԅʉ s1EE EM M 뗁EM tEF]Ds@9o]xU ED$E$u ]ËE]f ̀rS[bP[UWVS0eDauE 8M̋U1xu1 t8t)űU+u0[^_]ÍMЉM11ɉEċEȉ rEčۃTЃut( tۃ\"u|1w@UWVStC a}E 4UE08E1;q,hEED$E$ D$h8$ hǀPǀTǀXDžDB$>8H"Dž@DžL0D$ ,T$4D$8$ƒ8B4D$H$wC4E+Ё[^_]É,(D$ D$D$<$n,,9D$ D$D$=$0,THt$F BULA^UT$ U T$-D$E$]UED$ ED$E D$E$y]U@^UT$ U T$-D$E$B]UWVS$@J^u4$5uE荓UEEEEED$-xX<$E؉D$<$D$<$ $[^_]UWVS@ò]EX8TE1D$D$$ބƍ`$1D$XD$$P]PT$D$i4$4$t'pTU+İ[^_]\$V\t~։P6tN~ tu틅XD$F$2uԋPGX$XcP$1A$]UVS>*\uF tF 1[^]ËF0$ CF0F($BF(F,F$BFFN D$$FtF 뇍"D$$t F ^YUVS=^[uF uu,F [^]ËF$WFF F tԋ$F F [^]UVSY=ZuF uetaF0$AF0F u9D$D$ D$D$$gF0[^]Ë$f 뷸US] $)1U C []UVS<@Zu4$F$1AFFF0$AF0F($AF(F,[^]UWVSA<YE@0} `ML$$IJop< t< tD$4$蔲?x4$fM Ay EpE pED$<$KtbP1tJ< t`< t\E@H9tTE xFE7ED$$tgPuuE @4E [^_]Ã됉U }OD$G$I<DžUtBExE xzt7@ D$$ ;ƋEp0E$01jUWVS$:XEuUE@ u*x(9P,ӃCtftEp(ff} GуbF9SNO F|>L)/9!A)‰UtEHE HU1EE.E HFD)ЍtEx9EEPB9uҋEPU@E]OED$UT$E܉$ \M(uTMEHE Hb@ ]D$D$ E$[]0E$E@$;=E@@@0$=E@0@($ =E@(@,d01$[^_]ÉT$<$]9DžqEx(UP,ӃuCu*E $[^_]ËEH!fZUVS7CUu F tcu.tR4$(tEED$4$+tE[^]èu?V$ED$ ED$T$F$ t,1[^]É4$tF F$F 1볃F$ED$ ED$ED$4$b[^]ÐUWVSh6vTE̋UD$D$}Љ|$ D$D$]̍4$vEЉ$2cD$D$|$ D$ED$4$ѦU"}91E1EUxu0P)uftf9XP 9rUEMȃ_UMEȉMȉ$]1EMȋUzUċE]މuL$D$Ɖ$]uUĉfEU{u7Su%uftf;s;s up9rU$]9MAu9rAE01h[^_]@t`X Eub MȍLM9Cu8fE9$e19OK fMču11҉  ruu؋SUU΃EtfEtMtu}ȉ}шUvtft}rMȍTUs!󥍊M9.oEE$]8~E$]7eH MEM1ɉ}f]}tZ߃ uЋ}]E1ɉ}E} tEuЃ̋U؋uVU܉VFSVs u1ɋ}tփ uE1҉]ËEt-EtMtm7E u؋]uV U9t$.t&tZ봻u}ȉ~ utftuN yu MuNEjM}ȉyutft֤Ӻ}E9PEƃEIEuȉp1MrEtfEtuuȃEM}ȉyutftEEfÍ̅D$ D$D$]$ }]]wUu'u M3fmJM뿉$]4!UVS0ÖMut4$4[^]Í#D$ D$D$/$S4$U4[^]US/5MED$E $_[]UWVS p/ ME}} 'v?NBCDt]e1 [^_]ÁB u$<C+ƋEEFGEFWUV O MN$W$=WV(F,}E=V-~U V O(N1t)NEȉF99U9} 9U4E E= =w=w=?w=ED$D$ 11 +D$$D$]WF4N:V;m]4$D2P]ۃV(F,}EF-~E F O(NEEfE= =w=w=?w=ED$D$ 11 +D$$D$]PGV0N8F9/r<11͸11UWVSK,ID$E$ƍxD$4$}и9ED$D$t$D$ D$|$$at4$SttFD$D$ E D$|$$t Ĝ[^_]É|$t$[1߉4$b1ȉ4$1UE@ ]UWVS+HEEU ;P snH,X<3t;t-?19r09Pr+HE)E1[^_]?SӋ?̋]Ӌ]UWVS$*HuF$ED$ F(D$ED$E $O~;N:]f4)ЉMЉF$)É]]]f4)MЉF$)É]Ef4E)MЉF$})lj}F-VMуtitT <ωf0ED$ ED$)N8N9^ )߉|$4$K$[^_]Z AuEU-]|Yc1tX|Yu]@t|Y@u]|YX1uEtX|YuEu؋u@t|Y@u]DY 1E|XDYuE}}.WDAE}@u DA@tDY@u]}EX2wۋE,1EE<2w}1}BRDQ@u DQ@tDQ@uM[^_]EEx}))u؍4)u)؉\)E؍4)EE܍*EEE"BDAuE1ۍEBDAt6Í}܍GEBDAu(GE3EË}܍DЉEBDA UWVSt  >ljE 8E`M!t0$.D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,ilDžD$ D$D$$?k uet[atL yr r; ut$D$$蘿u f})D$|$D$ D$D$$g)t$$$t$$ qG8H9$b'D$D$$ž$"E+Ĉ[^_]}wh  p;8u}w  P;8udt$T$ D$2D$$R8 <$!=!$(D$ D$D$$2|$qD$ D$D$ $Y{|$#D$ D$D$D 4$-{|$qD$ D$D$  $z|$+D$ D$D$X <$z D$qD$ D$D$4$z}艽EЉT$UT$ D$hD$$TAq-9gD$$)Ѓuf~fffrD$ftD$$謻1a׋D0D$D$$f9|ҋD$ D$D$[.$1D0 DAu.L$$Q9|ȉD$ D$D$$HaD$$ vD$ D$D$P$ŢfD$ u;D$D$Y$蒢D$D$$]1aD>D$D$$茹9ԋD$ D$D$[.$1-D>DBu.L$$u9ċ;$d!D$|D$$ǸZUWVS}5EĉED$ED$E $b&D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,yaD$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,aẺEEfEEEfEEEfEEEfEEE`t2 u&FUopU x;uED$|$ -D$D$E$E`t jED$$;E`FED$ D$D$$(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,_(D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,"_D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,R^rD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]ND$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\*E`Yl‹w puED$ t$ֆD$E$l‹w p8uED$ t$߆t$E$訲kWZ PH8uED$ T$t$E$ekWu Wz?uED$ T$t$E$'E`t tED$$ ED$$1ɋuEED$$ EED$$@EbED$$EEEf Ef Ef EĈ[^_]Í T$qD$ D$D$<$.o D$qD$ D$D$$UnU D$qD$ D$D$4$n D$qD$ D$D$$UnUP D$qD$ D$D$4$NnK$D$D$E$4Ĉ[^_]ËED$ D$D$҆$虘ED$ D$D$Ά$oED$ D$D$ʆ$EED$ D$D$Ɔ$ED$ D$D$†$dED$ D$D$$ǗED$ D$D$$蝗@ED$ D$D$$sED$$ IUWVS$ Á+uE }8U1D$L$ t$U‰T$$ xVD$t# $U+u#$[^_]$."1OUED$ D$E D$E$]UWVS Ö*}ED$|$ ED$ED$E $ x8Ɖ<$WuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$} *E8E1D$|$ D$E D$E$&…tD$<$E+u Ё$[^_]NUWVS )}u Gu 4 Gt*D$4$趞uUt E[^_]ËEtE[^_]UWVSy )uZe~M u ( ~t9uUt E[^_]Í L$qD$ D$D$<$iEtËE[^_]UWVS x(u} dVu + Vt!9>uMt Ev[^_]Í|$qD$ D$D$4$#iEtËE[^_]UVSK 'u,d Bt ;2u[^]Ét$qD$ D$D$ $hv [^]Ét$+D$ D$D$X 4$\h[^]UWVS )'U} tdUfc~U ~t;u[^_]Í T$qD$ D$D$<$g[^_]ÍUVS á&ubh Bt ;2u[^]Ét$qD$ D$D$ $^gv [^]Ét$#D$ D$D$D 4$g[^]UWVSU%u6bw$ wWvK B  v|@vF}[^_]Ávf9[^_]Á ([^_]Á v,d낃@t9u~+jtucTOJD$9i.2#^] p1t$D$ D$(D$<$ce6@UWVS]#}>`YD$t$<$`x [^_]É|$ D$ D$(D$4$d[^_]UWVS~#}_ rt;:u[^_]Í |$qD$ D$D$4$:d[^_]UWVSLq#8E1E <tmD$D$ D$.D$M‰ $McMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$MoGUWVS4;"EEEE$E܍U}}؉EUEEU t 14[^_]Ã?uuU<-E<+u JMB-DK~r1ɍ LH>vD{uU 4u<.}DCuuŰMэMܨ@uM1ҋMDK@u49rMԄMDC@&E DS@tc9rEu ]Ԉ^^FEȉFEȉFEȉF EuuEE9sEiEԋ}DC@u>1ɋUDS@u%9rUȄQUDC@NE9>DS@uE9&ENjUDC@ub1ɉUЋUDS@uF9rUċUЄEĉEDC@Eu9sEDS@t|9rz}BDCz}4BDCu;uJMBEcEE]z}DEBDC1.t&FUWVSǮEM HMHMHMXˁHɁ@ =+-EE-ENMb֍)É]؉л))Ɖuԉމػ))ƉuЉ]̅EEMbӍ)Mȹ))Ɖ))MUĺQEM)U)MEJ$CEE4$CEE $CEUM^]EaE}d\$DD$@ED$<]\$8T$4]\$0]\$,]ȉ\$(t$$L$ uĉt$ut$u؉t$uԉt$uЉt$ ủt$D$u 4$\E$fEt $UEt $DE Ĉ[^_]ú)‰UZEESEW) u RE ; er@ror:@ unk@ nown@ LOC@ RR @vers@ionE Ĉ[^_]ÍZdEZd}\$DD$@ZdD$*tQ<.tAx[^_]ÉȅyET$ H!T$D$$nE[^_]Åt<.1[^_]UWVS05VE荰EEEE$PlPHH8|$ x|$x|$@ D$L$T$ D$D$4$ ~ Eƀ0[^_]UWVSÐu h Gt-D$4$Ŏu?E tE [^_]Ë?D$D$4$ukV-DPtM肹D$ ED$4$J[ҋMyE8m1Ɂ]1VUWVS àu Gt-D$4$Սu?E tE [^_]Ë?D$RD$4$ukV-DPtM蒸D$ ED$4$ZkҋMyE8m1Ɂ]1VUWVSðu D$4$蝔FFy ;F|/} t)P}D$4$葔[^_]Ét$E$襝US9EM QQy ;Q|< tZ[]ÉL$$W[]UWVSREu E$̨EEEEED$4$賓F0u ǀED$4$"D$4$褓[^_]UWVS]mRP`8uWV@tWufFuFuFf~@tJD$4$plj4$$R[^_]ÉV@ut"Fu먉F룉4$xfF@먋FuxUVSÛ`8Fu t$-XD$ D$ED$4$[^]UVSG`8Fu tE D$ D$ED$4$[^]UVSd`8Fu wtED$ E D$ED$4$2[^]UVS,ì`8Fu *tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$,[^]ÉED$4$;EUVS`8Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EU`8U]U`8U]USoED$`8$[]UVSA`8Fu t$ED$ED$ E D$ED$4$[^]USY`8$-[]UVS2`8Fu Et2ED$ED$ED$ E D$ED$4$[^]ÉED$4$rEUVS T`8Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUSFED$ED$ E D$ED$`8$[]UVSØ`8Fu t4$,[^]ZD$$dUSED$ l D$ED$`8$[]fffffffUWVS aE8tj׉ƅt|$4$2Qt@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVSc}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$ET$ D$D$8$-EE룤u9sftuu_SfӋ]KUWVS0VE׉΋UU܋U؋U$9EM9L9MyE荃EEuuE9D$E$yt4$ME+x4$MyuE$EخE؉Eu܉00[^_]ËuE$Exu)y9uωEtT$ %T$D$8$E1UWVS$9 ]Uϋu M MUL$T$ L$U‰T$$EEdËUv‹9EuC9@@EJ}B$[^_]Ë]t*]t .]{<|.B]9Z.EM9s;D$U썂D$ D$D$8$-Eډ)؋ux$[^_]ÿ뛉댋]썃D$ %D$D$8$'뷋]藬EE}8UWVS(] ]Ӌ}u UUS9)ÃEM-U썉M u2D$ED$ D$D$E8$EJBs1([^_]É4$Epx%([^_]Ë]臫EEUWVS+M EuE(M,} M0t8xU1҉}$tt$$JNNƀ?E4$luDžU4T$|$E$Fƅ9s9D$D$ D$D$8$-7)U4E$NjE$|$D$ (D$ D$dD$$VJNj $‹>|$ $}Mtq}whM!򋽤;qt#t<.)z<7|0.M$GU$D$T$L$D$ D$dD$<$/I‹$9a|-f @)ȉ~ DžƋȉD$D$<$<9u׋)$$|o|$ $1ɺ0yf; F01x JDNu.9uҋ‹)‹<$9VƋt)xE+1Ġ+[^_]Á}e}$# M$7U$[[.VE4$x2D$$1ɺA.:f; @tE4$.~벍D$D$$U yƋt)92D$ %D$D$%8$gn}$<$wWD$'D$ D$dD$<$+E‹4$t$D$ }$4$fN~F$$T$|$L$D$D$ D$dD$$RD‹ $$ 9*4$3 $D$|$ D$dD$$C‹ $$Z4$$+D$|$ D$dD$<$dC‹ $4$PD$'D$ D$dD$<$C‹4$_t$D$$U b)D$ *@t$L$$94)5q1E)0~0 $09&4$ђ‹$Ly}$<$WIL$T$D$ˎD$ D$dD$4$nA‹$E$HD$ *@t$L$<$2'M)(q1E)0~0 $,b09`(4$z‹$y*D$'t$ D$dD$$D@‹ $GGD$t$ D$dD$$?‹ $DzG$D$t$ D$dD$4$?‹$&wGZ9D$|$ D$dD$$?$dy$Fƅmlj$q2}u9$wM$)7|$D$ $U <$qN|$T$ $<$WD$'t$ D$dD$<$i=‹$D$t$ D$dD$$=‹ $qGD$t$ D$dD$4$<‹$']9Z9D$|$ D$dD$$K<$yq9;$kEƉ9$!yV}+}$'<|$D$$U Z<$q|$L$$U <$zT)ƒ=э7;}$}4|$ t$D$$.4$V9s?D$D$ D$D$8$-։)׉}4GD$D$ D$dD$4$9‹$IG9Q$Dž1pŎƀu1$Dž |$D$ D$dD$$9‹ $^QP9N#$ 6@t$D$E$$S24$3‹$k}$L}4|$ t$D$$譪4$Ո9s?D$D$ D$D$8$-E$ VUUU)ȃ=l$}$fr@<h  }$ZD$'t$ D$dD$$6‹ $BxGGD$t$ D$dD$$6‹ $!GD$t$ D$dD$4$F6‹$GG<}4|$ t$D$$膨4$讆9s?D$D$ D$D$8$-։)׉}49)=G$B}$"4$F$$QD$t$|$D$ D$2D$@4$~4‹<$|$D$^}$c<$AWD$'D$ D$dD$4$3‹<$P|$D$$U Q<$q0|$L$$}$}4|$ t$D$$.@t$$=D$D$$U ) 1*9t؉4$nD$D$ D$dD$$K2‹ $yED$TD$ D$dD$<$1‹$R|$t$$U J<$q-F$t 4$p4$eD$qD$4$4$ 9E4s3D$D$ D$D$8$->&D$D$$U `9*F09\Gt1Gt`$D$D$ D$dD$$/‹ $LuP~F$B=  $u|$t$$U <$qQ4$~$XD$D$ D$dD$$.‹ $<$|~$D$T$ D$dD$$.‹ $s<$fF $F $D$|$D$D$ D$dD$<$-<$G$|RT$D$t$D$ D$(D$4$"-‹$}U$r VUUU)ʉЃ=p $-^E$X7D$D$D$D$ D$dD$<$^,$}$fR<$0G$"D$t$D$ D$2D$@4$+‹$']4$9lj4$q$lj$k$T}lj<$L|$D$$U xt9H2D$ %D$D$E8$<x}$7[.t9M $Z)_}3$q.x%YG GGDž====Dž$Tlj9*w>9Gt1Gt`$D$D$ D$dD$$'‹ $4juP5G GGG GG GGƅ=G GGG GfDž==ƅ=W GGW GW GGW G$,Dž====fDž==e)7RD$ @t$E$D$$ y q1E)0~0 $309 4$Ku‹$yD$D$ D$dD$4$$‹$p?2‹9@Dž@DžDDžHDžL@)‰t(19rE4D$ T$t$$˕$s9s3D$D$ D$D$8$-)U49V<$q |$t$b|$%D$ D$dD$<$"‹$s7DZ9D$|$ D$dD$$! $yD$ @t$L$<$8  Pq1E)0~0 $K09f4$q‹$yI)7 4$lj$,|$LD$ D$dD$<$ Nj$‹\T$ $1ɺi$ ~ B4$Nj$u4t$D$<$Dž9s3D$D$ D$D$8$-)u4t$$1ɺ`4$ ?$裿Nj 4$u4t$D$<$Dž9s3D$D$ D$D$8$-)u4t$$1ɺ]4$<$蠾Nj4$u4t$D$<$Dž9s3D$D$ D$D$8$-)u4t$$1ɺZ4$ 5$虽<$u4t$|$$9s3D$D$ D$D$8$-lj)Ɖu44$Ut$$1ɺm24$  $_<D$D$$U i}$M$7[.O$+:L$ @t$T$$ …4$ȉ;D$D$$U 9Ћ$|"yWM$W[./E$H7[.E$H7[.$[.37[.}4|$ t$D$$螋4$i9s?D$D$ D$D$8$-։)׉}4$~'$D$؎D$ D$dD$<$$ :k$[.D3|79$[.3i$[.37vD$ @t$L$$q1E)0~0 $094$g‹$y)7$[.T3;7D$[.D$L$D$ D$d1ɉL$<$‹$sp$wUWVS8E  U8uE}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UrM8E#LP]UWVS谵Eu}'|EtG9E r'Gf|t+E D$<$@yms([^_]9} r+Ey;}uENT$ &T$D$l$mE뵋E9E r1UWVSEEu} lj~P9rCffVP9r1PffV 9r1Xff\V t9s]r(?1ۉ}D^ fu61ɉLu}9uF$F(F,1[^_]ÉD$ \$ED$<$XxUWVSEu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$uF,F,^(NMD$]\$ D$ED$$]良7F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~GF$gF(F,bpM]p]o(UWVS ű^Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,NM9~2)щL$ |$ML$$F,F,^(NM]T$D$\$ D$ED$$]臻;F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9ErgMF,F(F(T~ 9~GF$hF(F,cmN]m]m(ffUWVS}Eu)M} OV~^m M0ȈE<ƒ?ك}Ou荶L&ULWm ]0وM<O ]O?9E]U\]\U]TT} uU u ;E}[^_]} Oσ$ˉM_MrUWVSI}u 'MYf0x}~E~p1M ɃT 7  ҃{T 7SƒuM9}{C.봋]9|Mȃ[^_]ÍH rȃ[^_]ÉET$ &T$D$g$^ME#G UWV1u o^_]ø1L ÐUWVS\ÆϋMM8uM1t$D$67D$ D$2D$M $MQƃM9r,ML$$$<7M)11}U+u\[^_]øUWVS JEE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: EE >u}: w( ]u#M EÉ$Sr?E}~=Ut3}--w\DAtu܋E Ƌ})x [^_]9u]䍃D$ &D$D$e<$s\ÍM U$WEM E$DxgEEM E$HEmx>EM EÉ$MMCxEM UWVSæu4$RH9MX} slu^uVt}} Tр:.utgz\t,р:.tU ƒ.} 1[^_]Ãt=z\tפftu?u&xU 몋E Pf} /`(qUWVSÑE 8E1D$|$E$xFD$T$$zxT$<$z4U+u [^_]fffffffUVSB׾EuUMx#L$ T$t$$<x9s[^]ÉL$T$$%[^]fffffffUWVS ѠfutcEt\E $F&ljD$4$'u?|$4$#u%džt$|$E$D [^_]É4$#fl^UWVS ?ԽutcEt\E $%ljD$4$V'u?|$4$"u%džt$|$E$ [^_]É4$"]UWVS 诟Du t\E$+%ljD$4$&u?|$4$f"u%džt$|$E$  [^_]É4$!S]UVS 'üuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS连Tu} tAv-u3D$4$$tD$4$`%F1[^_]{\USSEU tttu P1[]6\UWVS Þ}u t' t:@trt0 wvONuI[[^_]D$<$ $tD$<$y$wFw71[^_]D$<$#tD$<$<$71UWVSEں}u tPD$<$#tD$$D$,\ZЃL$|P/~ȃ9~D$$)D$,ND$(\$,eED$8D$< D$P!L$8iDI4N\$tڕD$t$|4$bD$|8(D$tـ\$`D$XD$XD$XD$(D$0D$8D$< D$P݄$\$`.D$(FT$H)‹D$<ЉD$PD$X~T$D D$XD$P/bD$P؉ƒtL$th(݄$4ݜ$D$P-otj݄$D$t'1ҋ\$Ptut ݜ$؅ D$P݄$ݜ$|$Xu DŽ$\$tNQ"݄$\$`$n݄$\$`t$TFD$`ƒߍFXj‰D$|@H0tT$TD$</[|$PT$8T$H 8t|$PT$8}D$hD$|D$,$x D$D$5$<$\$t$$]t$ $D$|$$$\$t݄$\$`t$ptD$|L$DD$`\$`D$`e[^_]Ë|$PȉD$|t^t$HD$PD$0JЃ w(D$PL$8\$| CD$|SJЃ vD$8D$H-0t ˃L$|0t)ÍCD$PBσ\$|BЉD$8D$PD$0\$TD$H|$8\$,Nq$$\$t D$`$ D$h$ D$8$ D$T$s \$P0D$tـ̯܌$T$`ݜ$D$d\$tD"݄$\$`\$HuD$P$%k)~&U1҉$4DŽ$pD$Pj؋D$tـį\$HL$H\$LـpOD$,D$H$%u=D$0[D$H#$$T$P=܄$ݜ$m1ҋD$ti(C$D$\$t'D$4$x$ $$$1D$XD$\𿃼$us$ue|$Pt%=/D$D$T$\$tD$T4D$hD$D$T$\$t1D$XD$\࿋|$P$$\$tL$X܄$ݜ$$C $/$%= D$Txu xD$D$T$\$tD$T|$h|$$$ځ$|$P3'p$\$t.D$`$"D$h$D$8$ D$T$$v|$0$T$Pܬ$ٞwq؋$ݜ$!$1D$XD$\?6$%=+|$\)‰T$\K)!؉$^$DŽ$M9D$0tS$$|$PtN%=w@k)9t:D$0ut$HSD$H#$u΁tz%$1ۉ$$D$Hqݜ$$DŽ$DŽ$$hD$,LDŽ$1ɉ$t'4$)D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USmyEM t.9t*D$ (D$D$pd $0[]USyæM E%t.9t*D$ (D$D$pd $0[]UEt t]ËE ]1} ]UStx UE ~;u;t5D$ (D$D$pd $/[]ǂ[]Ãwǂ[]USwÀEU tt 1[]5UWVSw?$ sEtc@@5D$D$4$Eg5u E[^_]Q584${B58EE[^_]UWVSwãuthF~O9tHNM 1[^_]ÉU4ED$|$E$蠙U4u=FUF맍3D$ (D$D$Z $/i|UWVSRv}t;t-M tWt1$z;wr$z<$z[^_]UWVSuÉ}tJWt7E1U9}t#E4E D$4$%u߉[^_]1[^_]Í3D$ (D$D$ $ .UWVScuE@EEE19ut|ED$ )D$D$`!$E]ۡD$ )D$D$b!$.UWVS\blÉEEE 8E1bt$h /1Dž9E9qA D$.$s$-8tGt3\_u<.uuy.u}fD$:$_tOfu:t .buـx.N}#~GUFw Uz@9t$D$$,@0@Ɖ $@)9T‰ ȉ@ M:yE4$ L$D$t$lD$ID$ D$LD$$U+^\[^_]Dž9E1D$ D$D$$WED$ )D$D$B!$>f-uix. fLD$:$w(1flmUWVS\]6{׉u UuU8E1Dn} t>M1U+y \[^_])$(X 9ƉyfQffQ 9>f4ED$D$ T$t$ $X@ u1$ЅD 9MPPHDžPGO9=uDž Dž)D$t$ D$D$$XWDž@ u4$Ѕw8L8 9v<$ZfG$ZNj$YЋ9f}}$} )Q t$$D$t$ L$D$$VDž@  99uQ 04$ =$]C{GvT'tO<$NNjE$N$O|$t$D$ D$D$$%b1t9s;)d}dDž1 019tl!9hu狍Ƌf4JuZtJ9}A9p@ ‰))9~V׋2$[<))9zrtft1mDt$$*x9P ]u,04$rtx99v8Љ΃tft4$=ȉB9}5D$ l)D$D$!$r DD$ l)D$D$!$: cD$|$ L$D$$P…s@ 899EP04$=+Ɖ<$uP)9| t$ D$)D$$%l]4$p)9T$T$<$tq8f<$Ѕ%WDž$8W1q΋9 GƋȉfpfJ2r 9t H0f9ًF9}랉t$ FD$|$ L$D$$M…@ 9-<$P9D$|$4$o1r@ yyy )ʉ (D$ $Q‰p<$%O\/D$|$4$an01911)fR9s<04$L2)׃ (D$$PljUWVS$-Olu}5EGBt $[^_]øEB $JE!M DžD$ED$ED$ D$ED$<$wI…xkF D$FD$FD$ D$|$E$MEEE$R<$ Et;$[^_]øE9E$R<$ F tWD$ x)D$D$!$RE$LRF UWVS@M#kMu8‹E1kFB FBPƋ{}ۉ\$D$ D$)D$4$~HƋ9s < tW< tS< 9sz~D$ $)H< u땸1$I@ 2m)փ (D$$:FtƉKD004$A@9]‹tft‰)‰ODžNtftR :)944$S@9o‹fBf 8mDž1 D$ <)D$D$^!$3P$~G9%f)փ (D$$C%Ɖt$Fdf\UWVS` Bâ_E‰Eu8E1FE D$ .u‰t$L$E$}EE4$ML$ML$D$ t$ED$ $t`E$EE@ U+`[^_]ÉM $=M>ʍEbMUEƋE$Eu녍WD$ H)D$D$!$B[UWVS(@'^uE>FE苳 }teքUE<$ML$ML$D$ |$UT$4$蹬t,E$DE@ ([^_]ÍɄ뙋MUEƋE$|Dt([^_]Í $ޫt: DWD$ ,)D$D$ !$nUWVSe?\ƋEtvF u>ED$ ED$ED$E $E1lj4$[^_]ËED$ ED$ED$E $EDžt뼍ED$ )D$D$!$A[E1UWVS>\t@ËED$ ED$ED$E$ًU EfƉ$[^_]ËE1[^_]UWVS0>ê[E}u  t/10[^_]Ã} uyMMUUUUu|$M L$D$lD$D$ D$ D$E$&iuE0[^_]Ã} tba8t{bPWPtD@ 7 E #5wT$ )T$D$!$_Ex{UWVSX<1Z}E EЋEEEE8EƋE1$(t81`E؍EEȉMԉ}܉<$@D$D$ D$D$E܉$iDžE؉D$<$蝲ƅtEȉD$|$$ MЋIt9pMЋI t9^Mԉ}UEă< t< tM܋E؉D$4$MPE tJ< < E}9yE؉D$$tPuϋEЋUĉP MH}MHAMQM)ω}9}ЉG)ʋ}9nt1ɉU؋}U9rU؋}ЋO E)׉UA4$@9‹}؃UЋu؉2Ɖuԋu)ƉűEEE6tftuЋVuȋMԉ 2M)ẼEE؋}9SE؍UȋU܋4u4$C@9Ern‹}ԃrjwt%ỦϋU)׃E (D$$:t 8E܋U Mԉ}M܋E$=E܉$=1E1uU+|X[^_]ËEȉD$|$$![t@ EĉỦ $yŰEωM[fPEЋPEEE$=E܉$fuE̋E_M#Mԉ $sD$ *D$D$"$E@0PSfffffUWVS!"ö?Ɖ׉ʅt5UWVS(.u} tdt0tCt 1[^_]ËEFUT$4$P[^_]ËFUT$4$tƋE[^_]ÍjD$ d+D$D$@#$rۡD$ d+D$D$ @#$[CUWVSE-uE }t )щʋUt7uzN|$D$4$Q tuUtQFU ,U u@ 1N|$D$4$QUt?tFU U u@[^_][^_]1[^_]1[^_]ÉEjT$ X+T$D$*@#$BE EM|T$ X+T$D$0@#$ EUWVS_+u}U 8E E|$4$_tz9Ur0tpt+uc1T$ED$4$6>t,[^_]Ãu[^_]É<$E [^_]ÉЃtE륍jD$ (+D$D$@#$)E SD$ (+D$D$@#$R}!<$ E 10UD$$Z NjE 8Ut E?(+D$$ 1UWVSh&u} t tJD$(#|$4$ [^_]ÍjD$ +D$D$?@#$uSD$ +D$D$@@#$UWVS;%}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍjD$ +D$D$W@#$,D$ +D$D$X@#$蹿UWVSã$}u tNt 1[^_]ËVUEGUT$<$Pt׋GUT$<$P[^_]ËGUT$<$tGUT$<$tE1҉¸M1 ډV[^_]ÍjD$ *D$D${@#$达,D$ *D$D$|@#$茾UWVSv#u} tt@} u[^_]rjD$ *D$D$@#$)uD$ *D$D$@#$UWVSS"u} tt@} u[^_]jD$ *D$D$@#$蛽uD$ *D$D$@#$mUWVSZ"u} tt@} u[^_]VjD$ *D$D$@#$ uD$ *D$D$@#$߼UWVS7!u} tt@} u[^_]jD$ *D$D$@#$uD$ *D$D$@#$QUVS?!uED$t$ ED$E D$E$~>.t[^][^]USW ED$ED$ ED$E D$E$B[]UWVSë uE D$E$t })x[^_]9u􍃈#D$ $,D$D$#$OE)UVSEPtY.J.tQ.t&.tPÃ߃Aubv-0 [^]ÉÃ߃AvXЃ wrÉȅu[^]û.HvHw@B.̃v XЃ v-u(rÉȉdJ[0 v1nUE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]USÙE D$E$[]USoE D$E$[]USDE$r[]US!E$@[]l`8U_E M7]UEf]UE]UEfU f]UEȋU ]fffffffUWVS(vu}E EEGE؋U l-uу<9M E9syQ.tf@t|E E9sT@AuwuFcO} o9](([^_]"E E1ɍl-EM[<U|$M $蹃Ut~UM)ȍ<FD$ $艃UUM)ȍE(\.uЋM)ȃE%E}9}EM؈vM؅<.U܃uwUD$]E$yUEE})C~x9F-}ȋ?DG~ruE9E9EEEE1ȉU}f]tEE:UD$ED$ED$ ED$E D$E$y]UWVSDvE܋EEpu؋EmE@u8uEU1Ã@;؍sL`uʋE EEEEȋ} EEEċEQuE;EM}ԉ‹EỦ]}?wxEËu)?fpхt@}E]Љˁ?@ ‹EЍpхuEEuEuŨ;U]M}ԈM]lMEFFEE]肬o+E d9] [fEp}1EpBf9utBt&M]܍ɑD$ L,D$D$#$:MUWVS$ E8E1D$D$|$ ED$E D$E$t>ED$D$<$&tE+uЁ$[^_]ú/UWVS$l E MU8E1D$ D$|$E$t-T$L$ ED$D$<$cU+u $[^_]É.US]E M9r 9s9su[][]UWVS EU} E9slUP0ك@t$tNt<]ĩ([^_]9sAAu@u;!E!29rUUX9r1[^_]ËE؃EȉӋUUWVS5uE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSJEEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]C uU270:ۅt9u1[^_]Ë][^_]Ë](1[^_]UWVS _u}E9E |2&6D$D$$ umtF;Gt1 [^_]ø [^_]UWVScU2E uuW1[^_]É?wZ9rBZML$ ML$)D$D2$x(9E~9}ljr[^_]É(뗉֦?UWVSFEU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É{[^_]Éd(F[^_]øUS/E D$E$k []UVSÙuD$D$$tD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]UWVS,~uE܉U؅Ot A"}܉MGEML$$]ou]NjM-+E0 EEډU1709~Kt$EU9)ߋE^SЀ vSW9U؅ttFE܋E؋u܉0,[^_]ErEJ0A@Dž|Em7mDž|EnnlwVwgED$ ED$t$$ڋpZdpZdd"ZdZdl)Љ$I)ЃJEED$ ED$t$$1ɉڋpD$EL/D$ ED$D$ Uډ$UXE]9M 9Pu1D$E$D&E\$D$ ED$D$ Eډ$W0UWVSWXy0E] ]ED$ ED$\$E $MUE|9tEy0E+E [^_]Éx"1[^_]Uʺc-D$ED$ED$ ED$E D$E$7]UWVS膺 -<$wD-D$ED$ED$ E D$ED$8$Ɖ<$2[^_]UWVSê -<$DED$ED$ED$ E D$ED$8$hƉ<$ą[^_]fffUWVS豹6uU΋}JЀ wK1ZЀ w( 0ҍ J9~]mwT1[^_]9| u[^_]Ë]DwUWVS-tX+tL1u$1ɉN…M)::t#tЃ[^_]Ã1믃륍B$;1ɉ…t4M)::uB$<1ɉ…tE1҉Ѓ[^_]USJMt50 wsS$m1ttX8/t}C []S $ At%8.u S$!t8.t:1[]S$mzS[]cS$1QUWVSvuÉ։M uXi)\P=(\_NQDDD);QEN My *)R)ǃQ))|gfff)DQ)))Љ$I)))GF)4V}Ou} }싌/)Ӎ\9K@9|)}] [U썒/Ӎ | )Ѓ9uF}[^_]øQ))ƒt1EUV)F}[^_]ËFPLLD)F}[^_]ÃF)XENYDDD)sB9At DËA+BuA +B uA+Bu A+Bu+UWVSB|$@ƉD$T$`L$D} L$t@^~ VT$8VT$(V T$$v$t$$D$XD$\}t34 )Ɖt$XT$\))L$t\$0\$4L$X\$\ ʁыT$\))șL$ T$$L$X\$\)iiƸD$P%D$TD$PT$TyD$PT$Td$PD$ yމ\$0t$4\$Xt$\y<\$Xt$\D$x|$P|$TL$X\$\ʁ??ыT$\)уș׉L$0T$4D$XT$\)iʫiЪD$XӋD$XÉȃD$H%D$LD$HT$LyD$HT$Lt$H|$LD$XD$0yt$P|$T߅y D$|L$(*D$8D$8)‰T$XЙӋT$XRT$8)‰ЉT$0y D$0T$0$19>kL$X\$\1ҹ1)ӉL$H\$LD$@/D$ D$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$ ׋D$XT$\19|ID$XT$\D$HT$LD$XT$\m1뷸n1뮁lL$X\$\n9>|$0L$X\$\L$X\$\1҃D$HT$LD$Pi)\iT$P(\ЉD$P)\L$(QӺ\D$8\$<9¸(\D$<D$P)\L$(щQ֣p=D$PT$T9 ףD$T\$@/)׋D$XT$\n9}8D$XT$\D$HT$LD$XT$\ m1미n1릉$D$PD$@/D$8t$X|$\؃!|$\֋T$\ƸQ)ƃt$X|$\)i)\i(\ø)\ykddڋt$X|$\)׋T$\i)\iD$X(\ø)\d$XQ֣p=T$L9ø ףD$LD$H\$XD$0 |$8-9R9~&)уD$P t1ҍR9ڀ|$Pt$$D$XT$\D$XT$\ƋD$XT$\9L$X$uD$t;ÉD$(t$,EaŃ\$(t$,D$t;D$PD$T1$D$HD$dD$8D$tD$0t$X|$\9}Éщ\$dL$hD$HD$ ED$D$8D$D$D$D$`Љ/T$0D$H]D$dT$h\$\1Ӊߋ\$X1 t$P|$T11 7D$PT$T|$X9Ɖ׉ӋD$\D$dT$h D$XT$\D$PT$Tt$X|$\1Ӌt$P|$T1ڋ\$X9؉ӋL$\D$XT$\T$HD$XT$\D$0D$(D$,bT$4L$8\$Kd\$T$4L$8\$$@+7Љʍe[^_]D$D$$D$E$T$(щ€|$?uG D$4xF~T$@D$D$$\$71ۋF|$0>|@u$hFdN-00tD@<@sȉ|$0>$@L$ @D$ D$49t$ G  ӉL$,iF9uڋL$ t$Ή\$4L$4щ\$0iF9dF\$,+dFG D$D$$D$E$T$(Lщ€|$?ED$D$$D$E$L$4T$(щ€|$?D$0dF\$,+dF)1W G D$ 9tG +t$\$49t$ \$bT\$a\$UWVS Σ_}썙]| uu [^_]Ë}|:dNu쉼PuMTډ ?-00tċu! [^_]UWVStG\$XT$T˅. 0xt$\|$`IXPL$d\$<É s {9 l$dyD$<D$dD$<D$ t$lt$D$QD$ D$\T$`$T$\$X[D$\T$`E.‹D$T|$T:)؍))׉|$d)À\$l|$<ljύ))É\$$t$D$:D$ D$\T$`$T$\$XP[D$dT$ht$lt7k9)ʍJ)Љ)))șD$dT$hi"D$dT$ht$l7_u)Љ))щL$\D$X/D$(iT$h)\iD$d(\ )\d$dQ\D$]E$1ɉڋE 6t tL0P([^]ÍH0UWVS@\E؋}E p]܉u]uGWEЉUԋ]܋u9ÉEЋU+EUD$Y`D$ $T$]SÉփiʐMĹEȉŰEEi΀Y`Y`EUY`EU]Ћu9؉|_K\9D]xT1@[^_]ËWL \u9ދEGWEЉUԉƋE܋U9EE܋U)ڃD$Y`D$ $T$]RÉփiʐMĹEȉŰEEi΀Y`Y`ʋM܋])ӉȉuVEdF׋dFEM $ ƅt&iFV hFdNN(]@[^_]Ë]܋u;_G% Hu;tut9|>dFEVED$ ED$ED$<$HƅL@U܋M;WW+EỦ9‰FA1EdF1Xn]؉PE܋؉ }<$11ƅE؍H0F(EỦ9sUWVSPx\$|ljD$xT$pL$P8D$TƋ$L1fBZ<:\$t\$X4\$x0>D$DD$\$|$ljt$ȃ|$dw|$H1 ڃ9t$xuD$hT$l|$HyD$hT$l\$tCL$\qY؋T$p\D$HTT$8D$h9ËD$l!΋D$HD$\L$pD$hT$lDT\$d߃D$tD$t\$x9D$D#|$t$D$p>11ۉD$x":tt$p>t$x9Kp9|ѿBG|$xkfat&Dߍ$D$xD$|D$xD$P{D$D$x$\$|1[\$|L8T$4<L$@kD$0. \$X))D$Ft>8t$|$pG$D$\t$pD$`k XPD$H1$$D$P\$xD$X($\$HL$`t$t ;C suyt$tD$tT$hFP~L\$t9\\$h}4=}H\$t\\$h\\$PL$x ;>VD$\9]\$x|$dD$d|$pdF$ tftD$dËD$pXT$`D$x$\$|~6ËT$`<|$`1>|$t @ϋt$xs&tftt$`D$x D$hu+uċ\$|8f1D$ht$t IlPӉȉnu6u\$xD$p@f$ $ f |$pdNeND$@1ɉL$8~$D$xUWVSp\$dD$tT$pω<<FD$tp@u1e[^_]Ãt>u)D$lJD$ht$t|$hwǍT$xD$`tD$lD$XGtt$TDD$Pt$p@dPdP`tftߤ1eD@t$p`Pp@D$HD$pf@D$`<9PHЅu>u)Ӊ\$LT$`.u<*t <-~0< wȋt$t)D$lD$hD$TD$P\$pCCD$x؉dFǃhFǃlFǃpFD$XC dN\$lډNjt$ttftt$l0e[^_]~~1D$HD$`*t -~0 wËL$`)ˉ\$LL$LY\$4\$X\D$x-D$|"D$d’$|$$58,,$|$8|$pGD$xD$؉dFLJhFD$|D$؉lFD$lpFƇqFfLJrFD$XD$\D$d/D$D\$@t$8ti)\‰(\= ף|$D4)D$XT$\9D$Tt$PtD$XL$\t뺨1ɋt$pD$dҒtlD$TD$P11D$Hy,;T$|| ,;_D$pD$TD$P|$pwt$dD$xD$T>7> 9iFuD$pD؉D$X1\$Pt$p>iF>kFuL$T\$X)ىL\dFuډT$X|$d9u\$PD$T؋|$pdFLJhFD$|؉lFD$lpFƇqFfLJrFGD$pX dN\$lډNjt$tsctftt$l 0D0\$LډNjt$`stftt$L0ɨ뀋|$xT$|1{2D$Xf ndPt$pdPePeP@f2|$pdNeNT$hfM|$pdNeNT$h"fQyT$4\$\$@t$8D$XL$\D$DD$d/D$8L$\$0t$,ri)\P(\wf= ףt$8)D$XT$\p:σ|$@p/|$T9׋t$P}D$X\$\L$@t3빉L$\$0t$,D$,|$,9|$|$D$(D$d/$\$t$i)\P(\= ף$)D$0\$@D$d9)؋L$09ȋL$d؋\$(T$DЙD$XT$\D$8T$<D$ D$8T$CD$(D$DșD$XT$\D$8T$<‹t$FD$(șt$9Ћt$H}D$,D$Dt$0D$XT$\D$XT$\puD$DD$,9}bL$T$$D$@L$T$D$dD$03UL$@D$drD$0;L$dJ\$t$pD$(Fu=|$plFpFdFhFG\$\$@t$Dt$8t$)=D$pf@D$,:D$,D$p1҉PyUWVSzǮ}ƅӀ:tyɉ‰Džt;:1ɉUF E荈M1= ||9}~z>dN$]-)=v޿T[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]ËE~퍖dNE荄dNNjE$9tUD$4$]lUu_ɉ1DžuUWVSx_Nj U$8(=EU~|$, $( 5}# L0TPdž _y>u E [^_]ÅxE P$RsÉ 2H0TPdž 1뒋WZytىugb1ɍ@0dN}D$|$, $UVSvÎ,4$B uƃ 4$B[^]UWVSvMEuM V~6hFhF1P9u dN9ut [^_]Ë]w41[^_]UWVSLvݓUM Z~/dFdFP9u09ut[^_]É4[^_]UVSuu,4$A$4$A[^]UVSu2,4$A14$A[^]USgu$[]qUWVSKuВ$R@qt6ÉǹUu [^_]ÉE$y3U1UStrE$ny[]UED$ D$E D$E$1]UWVSt",<$~@$, D$ D$ED$ $Ɖ<$:@[^_]UWVStò,<$@ u$貛E D$ D$ED$ $ZƉ<$?[^_]USs=E $11ҋE3t H0P([]USls[ $11ҋEt H0P([]UVS,su  $1ɉEt tL0P([^]ÍH0UVSrq] E$1ɉڋEdt tL0P([^]ÍH0UWVSr#,D$${>$) t1$JEgƉ׋D$$9>[^_]$1ɍJE/ƉUSqÏME tEJ[]$E1ɍJ$[]USq8ME t@ tEJ[]$cE1ɍJ$[]pUEt@ E]UWVS8qƽ]} tC }1ɍJ[^_]UVS0p~]D$CD$CD$ C D$CD$CD$C$D$(D$D$$D$$1ɍJL$xLL$ L$KL$ KL$K L$KL$KL$KL$ KL$$K L$(K$L$,K(0[^]UWVS]u } IXP ;r B}y[^_]ÍIlP)׉[^_]UWVS o_u} ,D$$; t[ t$RXPL$ ;p H}yD$$m; [^_]ËL$RlP)Ӎ$\UWVSET$RuXP$M ] ;H pDyE U $\$ ;A yyƉ;u ]|o9u ] $\$ ;A qyƉ9u ]|͋M ]11 1ڃ[^_]ÉƉ;u ]}# $\$ ;A y}'yϋM ]11 1)ڃ[^_]Í [ulPƉ)뗍 [ulPƉ)J [ulPƉ)RUlPE UUWVSm!,D$ $y9 t< tOUM T$L$$Ɖ׋D$ $?9[^_]Í$C uu} UWVSlÐ}u tstC-t(TSNLKf9t)ȃ[^_]1[^_]Í{D$ P0D$D$B%$%둍{D$ P0D$D$A%$$^US=l҉0 u#$, tЋE$(UWVSkËe=t:F$V FtD$$g,4$Qpuƃ[^_]UWVSk$}ƃ0 $gtCƉxtD$<$,E FEF e1[^_]ÃUWVSkîuE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍsD$ \0D$D$Hd%$#멍ݒD$ \0D$D$Fd%$"3sD$ \0D$D$Hd%$"D$ \0D$ED$Gd% $Mq"UҋMEsT$ D$D$H $B"UWVSi,ƉUML <$3EtC$yepupMH l l <$h31[^_]Í 1 #txu8u맍D$ d0D$D$%$m!O<$2UVShIEU Mt [^]MUEt$ |0t$D$%4$ MUE[^]UWVSQhօ}L E$Z2h l 1ɍ E0EMt"l Ct\9S t~ߋuMMh E$1h uMtω?$Alu[^_]Åt+l { uSUMCЋUMl 9uYh uE9rHE9sAZtҋl UMCK $ЋMUl 9tE]U11ҋE]BffffUWVSfcUE0}E,8E1M zhEED$E$^0D$h8$+1hǀPǀTǀX71DžD8H@L,D$ |$0D$8$B%8U+d[^_]ÅE ((hEED$E$a/D$h8$.0hǀPǀTǀXE (9D$ 0D$D$Q%$W(D$ 0D$D$P%$O((9D$ 0D$D$Q%$(~"TUHdUT$UT$ -D$E D$E$>]U dUT$UT$ -D$E D$E$]UED$ED$ ED$E D$E$]UWVSc1D$-FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$UScìE-Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US bTE D$ED$-X$g []USbED$ E D$ED$-X$5g[]fffUWVSAbM } }E EEED$E$E@ E@U~5M19E}EtfEtME)‰UE$5UE@몋U tE eMpTEfH @1[^_]ËUu G)77wWU<$UtًE)1u EEPCP@@D$$E[^_]ÉЋ}tftE@9y6UH&D$ 0D$D$&$E@U)ЋMAD$ $%E[^_]Í sD$ 0D$D$Q&$.#D$ 0D$D$=&$EurMuMu4UD$E$aEU)1u =fBfmyMyHMXUS 0_|ED$E D$E$c []US^Ô|ED$ ED$E D$E$c[]UWVS^Z|EED$E $ƅ DžD$ED$E$0"=ifGfw G$G,G(G Eu [^_]D$ D$D$<$[^_]É$"fG 1[^_]Í4D$ 0D$D$>h&$@UWVS]*{}t5D$<$w fD$<$![^_]Í#D$ 0D$D$;&$ffffUWVS]æzu 4$ 9EU9s 9ru׃s$u8u:Ѓ[^_]Í 9rU9tՉ׃ru$u,tftƤЃ[^_] zfUS `\yE9ErD$E D$E$m []Ԟf!̀rS[ôyP[UWVS\Öyu F0u ǀFFF tHNtA})xT9VnHM9VtnF t tc[^_]É4$N})y9u 'D$ 0D$D$W&$+Vr4$t늉4$uS#D$ 0D$D$<&$o fffUWVSZFxӉʋ} MM tau!ƒuމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]R{} x|1utv҉)Ѓ0CUtʋE9ut OsECExtE1뙸)0KыEÿEX0C[^_]UWVSXYvljօt:Fu1F[^_]Ét$<$VFF[^_]Í#D$ 4D$D$4'$~UWVS XkvUM9 ?p9s΃ttUUED$t$E$y{MU)UD$D$$E}E01 [^_]ÉUEDED$t$E${M uUEU JHJHJ H JHJHJHRPVU0U$\\0`UWVSLW-uljT$ L$L$,11 rL$$D$(D$ D$D$L$uct_GЃ%uD$wPZw001ҍTPЃFHЃ v$uЉT$…L$t$$|$9|$  |$bD$D$tZFT$| |$t$L$8w%082L$1L$ 9<΃t$  9D$uʋt$L$9t4$Z1e[^_]Ët$6뼋L$1L$ 9<qt$ 붋L$1L$ 9<IL$ 랋L$ t$ ~64|t$ t$ xL$1L$ 9<y|$ ]t$뽋L$1|$ ?<L$ y|$ 6t$ t$6t$ t$ t$ .t$6<t$ t$ L$D$D@$`QL$L$-~D$|$UUUED$;D$(i D$9D$sD$D$$L$D$ AD$L$D$|$UUUD$;D$(_D$9D$sD$D$$L$D$ AD$'L$D$K|$UUU D$;D$(D$9D$D$$L$D$ AD$L$D$|$UUUT D$;D$(BL$(T$$D$(OHЃ  1t$|PЃpЃ vt$L$<$|$UUUD$;D$(rL$(T$$D$~D$9D$sD$D$$L$D$ AD$L$~*K PЉ FPЃ vD$|$UUU D$;D$(D$9D$ D$$L$D$ AD$ED$fD$|$UUUD$;D$(rL$(T$$D$iD$9D$sD$D$$L$ D$ AD$D$ D$L$L$D$tL|$UUU{ D$;D$(D$9D$ D$$L$D$ AD$9|$UUU D$;D$(D$9D$D$$L$D$ AD$L$ |$UUU D$;D$(ID$9D$TD$$L$D$ AD$D$@࿀ D$|$UUU D$;D$(D$9D$eD$$L$D$ AD$,L$FD$D$i|$UUU D$;D$(L$(T$$D$@D$L|$UUUKD$;D$(qD$9D$sD$D$$L$ D$ AD$oD$D$f|$UUUP D$;D$(D$9D$sD$D$$L$ D$ AD$|$UUU! D$;D$(cD$9D$sD$D$$L$D$ AD$|$UUU D$;D$(D$9D$sD$D$$L$D$ AD$oD$|$UUU D$;D$(L$(T$$D$*|$UUU D$;D$(fL$(T$$D$]L뾉D$vL$|$UUU D$;D$(rL$(T$$D$tD$9D$sD$D$$L$D$ AD$oL$@D$D$D$D$0D$LL$(T$$D$L$(T$$D$oL$(T$$D$PL$(T$$D$1cL$(T$$D$+pL$(T$$D$QL$(T$$D$2UUU? ;|$(rL$(T$$9|$s|$D$$D$ t$1D$|$UUU D$;D$(rL$(T$$D$=D$9D$sD$D$$L$D$ AD$D$ |$UUUD$;D$(D$9D$sD$D$$L$ D$ AD$DD$ |$UUUD$;D$(HD$9D$sD$D$$L$D$ AD$D$ |$UUU{D$;D$(RL$(T$$D$8|L$(T$$D$]L$(T$$D$>9.t&14$COf"L$(T$$D$}L$(T$$D$uD$  |$UUUD$;D$(rL$(T$$D$DD$9D$sD$D$$L$ D$ AD$D$a|$UUUD$;D$(D$9D$sD$D$$L$D$ AD$KD$|$UUUD$;D$(nD$9D$sD$D$$L$D$ AD$D$[|$UUU"D$;D$(rL$(T$$D$)u<$fnt$1PL$(T$$D$PW|$UUUD$;D$(`D$9D$sD$D$$L$D$ AD$6|$UUURD$;D$(L$(T$$D$rD$|$UUUD$;D$(rL$(T$$D$0D$9D$sD$D$$L$D$ AD$|$UUUD$;D$( L$(T$$D$(L$D$$9$*L L$D$$9$ LL$D$$9$KL$D$$9$KD$@tb|$UUUD$;D$(rL$(T$$D${D$9D$sD$D$$L$D$ AD$vD$ |$UUUD$;D$(rL$(T$$D$ D$9D$sD$D$$L$D$ AD$L$(T$$D$^L$D$$9$JL$D$$9$JL$D$$9r$JeL$D$$9U$gJHVJЃ |$1tBЃD$D$JЃ v$q|$UUUD$;D$(rL$(T$$D$yD$9D$sD$D$$L$D$ AD$L$(T$$D$-L$(T$$D$xlL$(T$$D$ ML$(T$$D$.L$D$$9$0IL$D$$9$IL$D$$9$HL$D$$9$HL$D$$9$HUUUwF;t$(rL$(T$$w9t$st$D$$D$ t$L$D$$9?$QH2$|$1댋L$D$$9$#HL$D$$9$HL$D$$9$GL$D$$9$GL$D$$9$G4$GL$D$$9r$GeL$D$$9U$gGHL$D$$98$JG+L$D$$9$-GL$D$$9$GL$D$$9$FL$D$$9$FL$D$$9$FL$D$$9$F}L$D$$9m$F`L$D$$9P$bFC|$UUUwTD$;D$(rL$(T$$D$D$9D$sD$D$$L$D$ AD$L$D$$9$EL$D$$9$EL$D$$9$EL$D$$9~$EqL$D$$9a$sETL$D$$9D$VE7L$D$$9'$9EUWVSPz@^$]$} |$Dut$L}|$P8D$4Nj$L1'D$L'$@0u ǀƄ$D$D$$DD$0$G wf DŽ$D$PD$$$$$DŽ$DŽ$|$L$D$lDŽ$$D$HD$,D$xDŽ$$D$<$D$8$8-$%t >u$)؅$*$$A$$$j$$~Ƅ$Ƅ$FDŽ$DŽ$DŽ$FZ $2ዴ$4$$:+@F f B$fx0\$L<$$DŽ$DŽ$D$$$$D$$8$g$ǁPǁTǁXy 1B<,<tft$F f$f$Ff$F$F,$FD$$L$$DŽ$DŽ$DŽ$D$PD$ D$LD$D$DD$$$$Z5$@$fH @1ۍFЍPwFЃ v$>$FZ$/$Ƅ$$$DŽ$1ҍ$$D$|D$`D$TD$XD$h$t$$؋$9}$D$\s'$$u$$)tB$\$8F$$S$f$$tJƄ$0$t$<3C$$V$O$ǀ'|$|)υ$$$;Kȉ$$W$$$$t$$)-t$\$ZDŽ$$$$8$2\$ltD$l$$[>$$@ @ft DŽ$t$(9t$$>\$4$L+=$e[^_]9.t&S$$K$$r$D$h$_)D$\$${$$j*[,ۼ$D$h$T$$T$$T$ |$\|$D$$$$CDžl6$)D$HD$lt$$<<$$p|D$lv6<$w$$$tƄ$-$D$X=$$߃Gm|$h-($t$X\$\ É$r$D$xt D$Xf)$y DŽ$D$l$D$|D$`D$TD$h$k$D$h$D*D$\$FD$h$D$\$a}/X$4D$hP$$=$$$_$$"a. ,ۼ$$D$$D$$D$$D$T$ <$$>"$$$~|$\$ C#-vL$$$$$1۾ $$$$$$st$\$ 5$+[R$$Ƅ$1ۋ$?D$`$$ D$`$|$\$D$`$D$|$$$$$st$\$ !+[R$$ $$$y$$.,$[$$$$$DŽ$$Ƅ$1҉$$Ƅ$ $t$D4$$8@$4$8@D$x$H@87$|Ѓ01 Z0 4Jу0 vꋔ$$9+$N-v$$$ މ$$Ƅ$+ލW7*a4FЉ1҃ /PwFЃ v뉔$$$$$W$ 0!) $H$p$$$_\$\w*1҉$$$ǁ$Ƅ$x% ǁ$4D$`Ƅ$$p$/$ $$B%$$t A+$D$|$PD$|$y DŽ$D$\$D$|$$$1D$`D$TD$XD$h $ $$$$D$|$+$)$@$D$|$$$$$t$D$$<$$')$9~$Ƅ$$1p$$$$$$$D$|D$lt$$3$($@$$$^*$$$$$$*‰D$l*$$$L,4 t$Dt$$LD$ $D$$D$$ 5/L$lD$|$$E$@⿀ $n$[$$$4$$$$$K$$L$,4 $'$ I|$D|$ T$D$$4$$I3.$y DŽ$$$W$ $N$$$5$$$#$$4$$$$ʃT$\  &#ʍRR$$$$$ D$` $$4RƄ$D$x@|$h$h|$lt$H|$|$)t$X9~~@$$7_؉$$V$$y1ۋ|$X)߅|$X$|$x$ $\$0$$$3C$$Q$$$\$|$)$9~~@$$7_؉$$V$$y1ۋ$)߅$*$X$$ A$$vω$4$$$륋$$)߅$&$X$L$@$ ~UA$$vӉ$$$$$L$@$~$$$|$|)υ$$X~$L$|$ ~UA$$vӉ$A$$$$L$|$~$$$ $$;$S$N$*$^$$\$0$$$7Gp$$X $D$HA$$^ $\$H)ޅ$|$,y$$Y$S$t$($h$T$@L$ $T$( ~W1A$$vӋT$@$@$$$$L$ T$($2։Z؉$T$($I $$^L$@$$&$$$L$@gL$@$$s$$$L$@~$$:$$$$T!$h$$ ~U1A$$vӉڋ$&$$$$$3{$$$$I$$X$F$$W$$$ $tB$t$07G$$Q$$$$\$l|$H߉|$|$$$3C$$8$$$$$$ݔ$D$h$T$$T$$T$|$\|$ D$$$/ǁ$'DŽ$$|$X L$\9l)L$\D$\L$zL$|$$ $$$L$|,$$~$$B$$$$$$$MT$ 4T$D$^4'$$'D$l8N$$`rk$$$$D$\$DŽ$D$|D$`D$TD$Xc$$|$||$\$$PT$xT$$T$ $T$\$$D$`e$)~Td.$$D$|9}$D$|$D$`D$TD$XD$h$9$u$$1۾ $$ $‹$ǁ|$X$DŽ$DŽ$$PD$xD$T$ D$XD$\$$$$K$)$D$|D$\$$X$ `~UA$$vӉ$($$$q$$?o$ $@$  $RD$`$ D$`DŽ$DŽ$ $ $ M$[D$`y \$`Ƅ$-$$$1۾ $b $ID$`,$? $[D$` Ƅ$$11DŽ$DŽ$$$G$$$s$$$$$p$\$h$X$t$`l$`t$h2B$$K$dt$xt$|$)9~΅~9$r$$K$Q\$x y1)E$\$TCL$`C$|$|$9h$\$$$ ~U:B$$vӉ$ $$$$2Z؉$$t$x$$$$ql$xl$T.$$`D$x$$ȃ$|$||$\$$1h$$$g$qD$|$$>$$$$-$$\$x L$@$$~$$$$L$@$h$X$$A$$vω$Z$$$륅 |$hD$h$$ED$ 4D$D$44'$$#D$ 4D$D$34'$D$\$$$D$@$ǁ|$X$$ :$Pu`$3$$$$ $u$)ȉ$D$|:$$|$|0 u䉴$|$|$` )$D$|$$$Ƅ$-$ $D$@$%D$X$$R$D$\$$$$$ DŽ$$P|$|D$xD$T|$($\$`t$d$$ T$|$$ʁы$)уș׉L$`T$d$$)ii̍D$hȿƉ׋D$hljD$p%D$tD$pT$tyD$pT$tT$pD$`1L$`\$d|$|W0G$$D$XD$T<9 $$9~D$|PD$@GD$TxtD$T\$`t$d$$DŽ$V$|$()ы$D$|;$RD$`$BDŽ$DŽ$$$DŽ$$$~$$$L$@$$3$$$L$@ $ [ݔ$$D$$D$$D$$D$ T$$$/Dž%$)D$H$yD$HD$\$uƄ$D$lt$$d<$$WD$l<$$R$$$Q$$[$$$J$$I$$ $@R$ z$ID$`$@h$ $ID$`$$ $R$$$ D$`$@$$$ $I$$$$\ $ $0$$$ƶP$$$$$葶$$$$@|$ 8  $ID$` $D$\D$h$+L$X$ $R׉$4)0ȉуcڋ$s0O9$T)ډщ$$ǃ> tft$$)ЉD$,D$\\$, $$y DŽ$D$l$D$\$D$|D$`D$TD$X(D$P( D$PD$PD$Pn$`8E$Ƅ$1%t$x<1\$X$1<9)FuދD$\$03$@0)ً$D$|$^I$$$v$$$\$Xt$xȉL$T|$`$$D$l$D$|D$h$؃|$||$\$$1۾ UD$\$$3$$$̉)1ҋ$$$)iiщƉσ$0$O$$DŽ$$OD$|$P|$h'D$HD$\D$HD$\D$h$1\$P\$PUWVS|}D$<$ED$ E D$-D$<$豺D$<$[^_]UWVSî}D$<$蛕ED$ ED$E D$<$QD$<$蕕[^_]ffffUWVSFƉ׉M0itt[t@[^_]ËUuD>ttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSm}ED$E D$EE$ԉ4E܋\\$D$D$D$D$%-uMAU$T$ 7ƅXT$ DV 9‰T$ s )HFL$D$$>D$ NT$99sH\$T$9rڃ9uT$9Ѓ9uU@]} ;tL$E$UE tE C9rwN9ue[^_]ËD$%-uMEED$E D$p$6Ɖe[^_]ËED$E D$g$6Ɖe[^_]ËED$E D$$~6Ɖe[^_]úT$U~ t^E|tEXrUWVS, Þ}m|$D$%U <$p 5m܋\|$D$$%-BuM7U$T$=5ƅNT$DV9‰T$s )HFL$D$$D$VL$ 99sB\$L$9nك9uL$9ȃ9uUB]} ;tL$%ɋE$UE$tE$C9ruN9ue[^_]D$$%-@uMEED$E$D$p$-4Ɖe[^_]ËED$E$D$g$3Ɖe[^_]ËED$E$D$$3Ɖe[^_]ú$L$U~t^E|tE\pUWVS`TE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$6¿5፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$,5$.U:ue[^_]ø랸뗸1ffffffUWVSxNt&=E= =D$TEU D$HT$Lu 1ҋE%=D$HT$XzD$T~D$TD$pD$ D$tD$D$X$ʁD$DD$pD$PD$\% ?D$X\$`t$`D$$t$`D$dD$`أЯ܋d܃l݃tT$`L$`|$nD$n fD$ll$lT$hl$n؋|$P)׉T$h<h(\$X,D$(D$4D$hljD$@D$,} <$00D$`D$tD$ D$PEExD$0|$@t$0L$$ 3t$4$wD$8xD$0L$4ȅt~9 ))D$4)NjD$,tXT$0D$D$8$:yD$8"T$DT$$wD$XT$D$tD$XD$D$.wD$XD$h }~D$0t |$TD$,D$h   )ƒ& <)t$LE'E D$E D$p$.D$`D$`e[^_]D$( D$4L$hD$h)D$4މt$,D$@D$h} }~1|$Tƃ}B }}}D$0UD$@‰T$ MDD$P$-D$`O}F|$T;|$PwHL$t |$@ h(D$@ƋE D$HD$`P|$P|$nD$n fD$l9 ؋Ƀl$l\$hl$nL$h‰L$XL$Xv ɃL$hɉD$hH0Jڞzu؋D$D$rD$`9D$@}U E 0D$`e[^_]ËD$,D$D$D$vD$DD$`D$`e[^_]Ë|$P|$t2} x )D$`D$dl$`\$`t$`D$d-D$$D$TD$T1|$TD$TDD$T@)捊 ym1}} }t=ED$0T$hD$()ȉD$41D$0EED$ D$P_D$hzIl$h?ED$E D$$*D$`D$`e[^_]úT$4ׅMt$(vT$PD$0t$`L$D%D$D$ $pD$XD$ $L$h+0FL$hQu y 9|$P‰L$D1ɉT$hD$Tt@L$TD$D$D$uD$D|$X|$$vL$T6|$`94 vP9t|$8L$8=D$`0D$E D$g$)D$`|$PwuD$t(.D$0L$@h(ȃƉDD$XD$t"i(T$t Ƀ ɃuT$\$8D$8T$ D$PD$4D$,T|$8D$`D$4t$PD0D$(t$DD$XD$4$a'D$,0L$hT$8T$4$PsD$P|$D$X$s…@ fT$T$04$sD$DT$0$tkD$Dy}T$HL$T T$PN~}~L$TT$ht$D~HD$4$UqD$D1t$Xt$$^rT$hV9zT$,1t$4FD$hD$X$jD$h L$8tt$89tD$h4$njD$hƉ|$8D$8$XjF(MZD$PD$D$D$X$$kD$XD$D$D$qD$`p1D$@D$X$iD$8lD$hD$D$X$nD$X86+D$p[T$XBD$k¸ )6D$XD$D$D$pnl$@D$D$ D$D$KjD$DL$0D$ D$P8D$0~)T$4D$HD$`DD$8|$nD$n fD$lt$0l$lT$Hl$nd$HT$H0qٞىt$Ht$0T$Hكpڞ.D$XT$\D$HT$LD$tx |$@t$4D$0D$8i(D$Xr D$D$D$8$ZnD$81fu T$hvx0t|$8L$8 t$8F$f…Fz tftD$$mDžYD$PD$4HL$PD$h9L$("D$D$ 4$ hƅ`D$8D$D$ 9D$8$gD$8,D$D$ <$gDž D$PD$4D$8L$؃ԯ\$HD$HT$LD$-@D$D$8أدD$|؋t$`D$XD$8EЉD$@A$&fD$Px}ND$H D$P=N)ȉD$41D$(D$HiD$LZOD$,DD$@h(ƒD$X T$T$L$T$HL$L?i(\$81tD$8 \$8uT$D$8T$0t}D$`D$D$D$t$PD$tD$D$h$TW|D$lP1D$DD$d T$`D$t$OD$HT$`L$`A|$49g)lj|$t|$8D$`)DŽ$D$\D$D$t$SD$t}t$tFD$:QƋD$dD$\rD$0=P}ST$LD$4D$tD$8ЉD$8|$PE@9E  D$8D$LD$\D$0D$`u؋د\$TKD$tD$HEЉD$DT$lD$d)D$8D$LD$,‹|$4)T$\t$`$t$LD$tL$8Ήt$8D$4t$tt$D$H$RD$H#L$hL$$`PD$tL$h $MD$tD$h)t$4t$D$H$SD$H+L$l95vB<9tD$< |$PE@9E D$8D$LD$d|$HG$KKWx q tftD$$ SD$d~D$<؋t$lL$dD$D$h$RD$hL$tL$$SuL$dfD$hx,D$<D$DD$l1D$< ezfu D$tSD$dƒ80tND$<؃ԯ\$TD$TT$XD$$-@D$(D$<أدD$$wi؋D$8XVH؄tJuU tu ؃[^_]11USx EHP$D[]UWVSD=Eċ] CE}9G{}ELM܋uűUDE0EH1EЉE9uEEEEEgEU؉Ӊ1ۉMԉ]؋1ۉEE+M]+M]؃EEN9}s] }uAG9Es0uV+E)‰؍M9tGz q s7u/u(UE$]UBEUE다fuuJ z Mq ffUWVS<=֬E8Ex0E }Uxx}؉EԋE@EA…uA…t v0uAE)Ɖ9ME܉pE)E؉p$] )ƋE 9m1E ]9XE pE9)9E @ E؉$]S ]3E"P0[^_]Ë](EbNF10[^_]ʋu< ǀ0^0tʋu<ɉMEJE?$]j E@@E}؉8E @}]?D"b?)։Ut$E؉$]DžUt(N}#bUt$E؉$]puU3]K 8 t 9u~2U)49t$W0T$D$ $Du1[^_]Í~ u u 9}t$O0L$D$ $u뺋}}z1HUWVS0血6}u D$(D$<$\$ D$ T$$D$T$D$,D$4$c\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS1EM]E TsCD9sϥ9r)؃L9s&)D$D$ $]g[^_]UVSEPXM 9} u#9r1[^]Í~M t09tݸ[^]UVS~g0)ˉލ u썊ta)ˉލ u썊jA)ˉލ u[^]UWVSU} EZ]9BB[^_]ÍBEuLMuttb )E^M9uUM ЉFCU9rߋUM})}Lt% 9bE9rE})} E)B>[^_]ÉB$MUVSA}֚UBJT19r & 9st9sEE$Ɖ[^]ffffUWVS |v7} w+ M4tetB-$F2E$xƋEFEFuFF [^_]úMUE )ȉE w|-$'F"t-$F|UWVS{]ut"F w"7u& 4[^_]É4$+[^_]€-$UEN? 4tU$E[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɉu}u܋EDEd}EUƉ׉1u}D9Mlj t"E9C~$E}|C؃[^_]É؃[^_]ËC$2tKSx s stftE$]u2uʉE$Efx s UE=w5=w=w=?v=]1x@u ]Ã]Ã]U$7t UP@]UWVS<yØ} EPUw9|։E}EGU 9O}M$Eԅ)PMD9s2MM)ȃD$D$$U UMGEЍDEEp]D9_9]])<}̉UȉMĉ9stqutދ}EEEM܉]؃Eg1EUӉ1ۉM]FE9r΋EM܋]؋}̋U;9rUȋMą tDtEԉHEԃ<[^_]ECUWVSfw}u   -y}׉Eut?tDt|$E$EE$EEuE[^_]7 uBU|$<$UtME$@MpU-$@ɋUu량[^_]D$7D$<$sDž1U7u\M$"…M@q@ U-$@UM-$? ҋMu끋d-$?1ǃ u1UWVS$Zuu EHNj@EPG9~ 9U $1ExUtt$D$<$%UEp@]L] ]t~ )؉E1}U܉ʃ>M CFM9r}ыU܋]9rB+M uUEPE$E$[^_]å9sܥ9rչUWVS}u F_)u)ODT9s290tۃ[^_]UWVS0u] C~)u:NDT9x9t] sމÿx1F$E؅3x F~}ЍUȍtu܍suStuquԉu}11Ẻ] E]EEK1ۋ@1))ڃ1EEʉHM9MrÉu}E̋] {}̉)ك9 }ω}uΉuu9]Mu}EA1)EU1USE9r׋EM܃})}ωuʋ}) t}؉GE؃0[^_]$UE؅t@@E؃0[^_]ù9u9ur }ω1UWVSEx|$Pt~^$2 )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS $ƅtc] %t D$ED$uDD$$&T$V ~tbM5)NjE8e[^_]ÍD$$T$tI ) |$T$~V~u-2MD$=)딋|$UEM Q tJu]UWVSo.utD$E $wDžD$D$4$3ptt ʃ9t*xD$4$ t|E%=qt`fx ttpu ffx fp@³P$·P,P(P Ĕ[^_],1Ĕ[^_]ÍD$ 49D$D$E($&Q,1B,O1USnïE UD$T$ D$E$[]UWVSmtutFD$4$]nx$P8D$4$f[^_]É4$Aڍ#D$ L9D$D$=$)$%UVSSmut&nxP[^]É4$[^]Í#D$ <9D$D$I$)$%ffUWVSlvuX)$n$fUWVSkVuf~ D$4$0F0ǀǀ F 1F t V$ЅxF F0tN@9t $oF0$oF0ǀǀD$4$FFF [^_]ÿF tF$lop4$D#D$ `9D$D$8)$$#( fff̀rS[P[UVSBjׇut8F0u ǀ4$uAnP[^]Í#D$ h9D$D$;)$k"뜸fffffUVSiGut%V 1f t[^]É4$Y[^]Í#D$ p9D$D$;)$!UWVSFiۆu' 7FF <ufJ.t&fF FF uwFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $2mF0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$s+e=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$OW8t6D$D$ VL$\$4$ W8t6D$D$ V\$D$4$?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$?W8t2D$D$ VL$\$4$uwW8t2D$D$ V\$D$4$u7O1$[^_]ËO8,UVS W`}EU uMtTp4u 1 [^]D$D$4$f-u"udž0UWVS_o}Ƌ4D$D$4$ -EtE$!dGu͋$dtMtf~ 18t$c9⋎t $#4$cuu&E[^_]U98}]EUWVS^N|]tCƉ$:c[^_]þUWVSy^|ljUD$@$^:ƋUu 1[^_]ËOD$M$\^…1]~˃Mt|tatOt=t+tt9EGX<tE[^],[^]UWVST;r} D$$TƅǀM]:8bL$ ED$|$]$"mF8FF F FFFF4- ~D1 󫍾󫍕xT$E$]~^ $]F]Um]StV4EHt }Gu]Stt LV1v4s$≕@DDDHN F$D$ D$ IL$4$BF0F(LN,NV<~$Q9~s~]WEP IT$4$0}M1Q\$E$KT$ ML$|$}<$$ ÉX TUMQ D$t$$ËVnNNFVnNNFV n N N F V nNNFVnNNFVnNNFVnNNFVnNN F V!n"N#N$F$V%n&N'N(F(V)n*N+N,F,V-n.N/N0F0V1n2N3N4F4V5n6N7N8F8V9n:N;N<F<V=n>N?N@F@VAnBNCFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Z1=x>alV]D$ <$ ;F@7NF(șdž‰Dž=N V DDTNꉖD$ T$D$8$]EP D$4$0}4dž$$$|I>pXEP{x H ^XuPp[^_]ÿO$4$}Q 81Ë-f T$ ML$|$}<$ 8녋u 8"\ 8F8FF F FFFF4Ǹ- ~D1 󫍾 1$F~ j  811q [ 8ED$4$Bdž0$ 8! 81UWVS$JÂhuF(x~(V0!UN9F9MUD$N $JMUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$+FEEtlE܋UT$ML$E$ME)UЉL$D$$M $\NEUVU(_US]ED$U $ #C,9C(}#C0[]fffUVS RIfEpFtD$D$$F u  [^]UWVSH~fE0LHPH THxP@X~t=i`TIX=DHD$$$mHƅǀXHdž$$CljFXDt dž wnGG G G -G1GIGE UtAtCgFt$Kt$ 4$K1 XxD$ ED$E D$E$XE EuM L dždž QXPtt!ЋPDPP9X1XA1T=+ff]fXD$ L$D$$ 4D$D$$Rfxuu fx!D$D$$E t @E@t Ey [^_]=21DžT1"mDžPDžLzmDžXDžTc"mPDžXZT t$ T$T$$5D$$/h]8OD$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$ D$PT$$XxD$$( X%=3D$`D$$Iq` =b1щX`abcddefghhijkllmnoppqrsttuvw `b1uYduPh=w=u8t_u+X Љ lp;OX zm"mFTT$ 9T$D$)l*$TTUWVS$@2^EpFtD$D$$FUED$E D$4$]iDžEtwD$D$ED$D$ D$|$4$0!@uFЃ$[^_]ÉED$D$$sUЃ$[^_]D$D$$NЃ$[^_]UWVS}?]uE U VfFFVVfFFVV f F F V V fFFfFFfFF=*F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\N"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍD$ 9D$D$b*$F xUWVS@=ZuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\NɉHɉH@tH ɉH H ɉH "B9uȋF wD$ 9D$D$b*$F ƒv1UWVS(;ÝXEpFtD$D$$FE  D$D$$ݿEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$$&u 1([^_]UWVS9xW}wFtD$D$$\FD$<$tr$WtcFt$">t$>t$=E4$=<$=E$[^_]øUS 9îVE9ErD$E D$E$& []{UEtu]11ɍT9r]1]fUVS8JVUE X91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS47fUu|E@Et M 9H 1MEEEEEEMP}GA у@0fuft utpfu{Uzu@G GGBPWxG8GBWO ME9Oft DAfEtD$D$ E܉D$L$4$mVEE@Ex#} EHU ꋀEUEMƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$5E.E@ D$$5UBct MMU Q AUuth}OAMOMW:D$UT$D$ M L$D$E$h}E4[^_]Ë}GMOUW:D$ML$D$ U T$D$E$E ]M؉0fufE@E܃!‹EHM<E0E@}IE@wǓD$ 9D$D$*$/|Ex QD$щT$ |$D$E$z E@E܉413'U܍ǓD$ 9D$D$*$UB$7USEP M TH}[]UWVS26PE}9UNFt%O L$D$$]F$6FA4$]6E9t-F uFtUt NuM u6E9u1[^_]D$L$ D$FD$<$]tUSUE @@ @HKYXBP[]ffffffUWVS a1N}ED$E @D$E$t7ƅt|$$t [^_]!84$8UWVSD0{NuE 8‹E1t$D$ ԓD$D$<$k=5DžDžDžDžD$D$$<$4ƃtI<$D$D$4$4tntD$4$tSD$D$$VE+uqD[^_]Íw$NW8D$D$$4$_8Q?qUWVSl$/ùLE EċEE8EEEpFtD$D$$聶F }&Et&}U+nl[^_]ËEċP}O9E!D$D$$茳DžFfN @EW)‰UEċ@UB 9EGf~FED$EĉD$4$ׇ]fdž~ f}EF(<EċP}O9E}9rY|$ED$4$ʉEEEEȉEE@EME؉EEċ@E9s]|$EĉD$4$q?EEEEȉEEċ@EME@Eă9EЉEJ}3D$FD$$бDžFfEEGdžD$|$$ẺD$EĉD$4$:UljEoEf}}?} EEEċPMQ GO)MJ9MsLED$T$UT$ML$ EĉD$|$4$<}  1=f9Ms(UɋU)ɉL$DWD$DW$tUfGG)fGUfDWMċAE@BEB AD$D$$U"UBD$D$MċUQ$F( <u4WGu"f}udžfdžD$|$$  aEED$ |$EĉD$4$A1D$|$$±n9FOFf;EAfF5D$|$$z&E!}GD$D$4$`RE=&҃9 FED$EĉD$4$y~ f}t f}f~ }fdžG=w|҃9UdžEfdMUD$ 9D$D$b*$OMU>UčD$ 9D$D$b*$UOUMD$ 9D$D$b*$UMjffffUWVS0 (EEUE@( EpLB< _Gx ZU)ىL$D$$]҆f}Ufz|rrEXft)ۍLZ]f9sf]f9u]t^J_f+Eft" F]Ff9sf9ufjE@(E <t 10[^_]ËE9PuEP9UsރUfBҋ} 9OO;MG(  UEfEUED$D$D$D$ D$ED$E$]~U_HMUG D$E$]Ƀt_MUFMUD D$E$]蓃tUMUE]䍋L$ 9L$D$b* $HUEc} 1ut8UUEfEED$E D$E$]wUB=wbF9EEu!BB=bƃ9EUEfEXEH(U]䍃D$ 9D$D$b*$Mƃ9EUzUUEfEED$E D$E$]~U],2BLU1ɉL$D$E$]{ƅEfEED$E D$E$~UE@(EUUB(D$t$$]oUE}GEfGUUEfEEE D$D$D$D$ D$ED$E$]{UUD$D$E$]zƅE@U=UUEfEED$E D$E$]|Ut_UD$t$E$][UU]䍃D$ 9D$D$b*$UfE@(ExEH(EH(U1҉T$t$E$]ԩU&]䍃D$ 9D$D$b*$UUWVS !|?}u FuIFu 1 [^_]D$D$$tYVPD$D$$/D$D$$车t!VPD$D$$|{UWVS08!>ljU܃,E싗E9BD$BUD$$9ƅUBfEHMTFEDtU D$<$P~UF=w?uj>t$<$ut$<$ ;0[^_]ÉU썃D$ 9D$D$b*$UE EF )‰T$L$Eȉ$*EfEfFEDFfENUBft?ЍDVEȉMU؉uuMf9sfUf9uMU؋uԍLQF=f+Eft2Auu}}Af9sf9uu}fnD$t$$ǦE܃8tRE܉D$<$t#fFfFF 묋E܉D$<${nD$D$$W1QD$t$$:1UM䍃D$ 9D$D$b*$UMUWVS@J;}EpFtD$D$$F rt@tf ȃ@[^_]F(tܨȃ@[^_]1EE䍃E؍9EԉuED$E D$E$FƅEM}$f9t$E D$<$hwFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$b* $qE܋Uf9b~E@M=HfNfTf}܉u |$t$E$v,GD$ ED$t$E$7GHfuIfGE@=UEOfO`D$FD$$Dž@=FD$ |$D$4$rG=@MD$|$$MYD$ED$$Ϣ4=jU 1ɉȃ@[^_]ÉM썃D$ 9D$D$b*$YMKD$|$$B띍D$ 9D$D$b*$ D$ED$E$NuG}1f;}uD$|$$踡FEčMML$D$4$ CN9|fE}Ѝ9}̉ωщ>9RAEȅ,D$L$M<$8F,EE9NjM@9ED$L$M$EE9ƋMTFD$FD$$VFEQvMԉE؋EЉD$ ẺD$D$b*$TMԋEAD$ 9D$D$b*$D$ED$$hD$T$$D$FD$$耝Dž5D$ 9D$D$b*$F8@xf}܋98}fxXDy|8f@D$L$$"D$|$$貜1jmЃ}uf}D$L$$ڞD$EȉD$$g!VFD$ 9D$D$b*$y/}suuD$D$$H5D$L$<$ED$EĉD$4$h?[F,E׉J9OMUD$|$$賝U싲1M91D$T$U4$肝EM9΋U;EFD$FD$$…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$蛜D$ED$$(Dž@=wU܍D$ 9D$D$b*$+UBU`fU܉1D$|$U$1҉T$ED$U$菙DžUA։ffffff1̀ffff ̀rS[Ô1P[UVSw1ut5D$D$ D$ED$4$Ot6E[^]Í tD$ 9D$D$5+$럸fffffffUWVSN0UE pu8lE1ptEuAx=EGu4Ѐ:U)hx9׉drD$/$?t)1lU+Ĭ[^_]Ëdr,:d`%$>F 9dgƀ>Xt։`dD$ h)D$|$`$Jpd9r9>/utD$$d"B/|%=@dt~8u)с?h tD$ :D$D$?T+$hM+X\pD$E  D$\$8Xh9Ƌ`,:d)@u08p9hD$d$ޘuvEt)D$\$@JltD$\$@.89d`RfffffffUWVSY-Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfQfUVS "÷,̿4$CD$$D$F $? [^]UWVS s,}$W$W#1$WD$$D$<$x?t$<$> [^_]USg+̿$[]US,A+EEVEEED$D$ED$ ED$D$E$h~t}u E,[]ø,[]US Q+̿$[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EU܉EEE̋UUUUĉM؋EEȋMMЉ}MUE te kE2-byEnd 3Eexpau֋Uĉ|]11 É]1uM1EMEu1]1 M1ΉMˉ]1uԋM1]1 Ήu1U1ىu؋uU1M1 }11Ήu11 Ɖu1UډU1ЉUE]؍E11 4u11E1]؋Eԍ8M1щM1 :]1؉]1ωE̋E}NjU1]1 1Ӊ]1m}uuUċ|UexpaUnd 3SUԁ2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}CffffffUWVSF}lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]eZMUBfFF F D$t$$]蠂1[^_]Ã<Qʋ]C ^)fFfF] H@ L$J UL$ $]YUBeD$B D$$]tH D$D$$&KUWVS$=}E΋xfzfz:E~ F=/M9AfZfZۍ E@ EƋE@tT=$1EAfBB B D$T$E$]1$[^_]=ft1MM\A4f9rM=w(f21f]\F<f9r]UM]D$ X;D$D$b*$VUZM뢉U]D$ X;D$D$b*$UZUM]D$ X;D$D$b*$۰UMUM]D$ X;D$D$b*$蝰MUU]D$ L;D$D$+$bUUWVSLI}܉E׉MM  fMꋀEE=EffEGEfE=f}EfE1fE1EEЉ}׉MEuTF2 Z]f;}]9fEA)fAfDYt$T$UȉM؉$]UUԋM؃fuEf;ErEEȃEȃ]f9]xf;}E@ Eƃ=w/.t&E]TCڋ2rEuTF2Ef;}E\E9s|E]9tqf;}MԉU؋]܍D$ d;D$D$+$MԋUuEE\E9r}D=gU]܍D$ d;D$D$+$衭UEfpE@(4f;UE Mf)EEEMf9GE1fuuZEH fEV)fV]fT^D$L$$]SfEEUf;U Mf9Mu fEfEG sEHA bE]TCE}D=EfpE@(9H@f;ErfAf;E1EMAGEHMIuMA}f9}u}fGEL[^_]fEEMf981뽋]܍D$ d;D$D$|+$fJ]܍D$ X;D$D$b*$4I]܍D$ d;D$D$+$'M uNf+EfF[1fEi鏂銂f郂.&vsUWVS áƉUMED$4$gǍED$4$gÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(@ƉUMED$4$gEljEfGE}fyUzyAB A u.E B=f9PEU܋ED$$EUMEABAfAEfAB A BtHUD$D$$uU.U}HD$D$$wUED$E D$E$MU܉-E䋆U܉׋usOuCu1u9ut2U܋E$]EU܉E]E([^_]äu9uuΉUftt֋uBfF] fu]E떉UM썃D$ X;D$D$b*$詧UMEE$1EF z]fU1҉T$ED$$UvUWVSt8 Eԋ}uE fEڋE M܃8MED$EډED$EE$U N …%}t Bf+EfBMfDJ MQVP]XP AD$D$$UЋ]MFD$D$uEF$LuE܉EЋE 8G,E9HEEEEԍ]X;EэAD$AMȉD$$]r…MAfEfEڋN g+8 FE EXJB)9&E:D$ED$E$MUȉqEUȋMU EF 4?jEP])ډfPEfTAʉ\$ED$$Uȋ]~KUȉBE܉EȋEEEE 8u*E $MȋU u[D$EЉD$$]sD$t$$ls9MZuEȉE9E܉EȋEED$EЉD$$]'sD$t$$suEȉED$EЉD$$]rD$t$$rG$pt[^_]ËV]XVT$T$$]&J'G{ EJB)9^Mf9s()D$DJD$DJUȉ$]IUfBUEF ]ډ]U܉UfMDYȉEE@=`fP11ҋ]ЉutC3f9ruMEЋA]CfEf+EfCMfDK Vgf11҉MLFf9rMAEEEOD$ED$$]quEȉED$EЉD$$]pD$t$$p1t[^_]Ã(]CfEf+EfCUfDSЍL U]ċP[]ȉڃP]ċD$Eă D$ $]GM܉MȋE@WD$@ D$$]mH D$D$$]oaMڋU܉UfUDJЋUZ}]ЋPUBfEf+EfBfDJVJP{FEċA EE]CZ]u f}YEXEU]E\XËE ]MEčH MML$M $EЉE M9ȋUs XEEXE(EU]PURPEEPvMDAȉE@EPUDB(EUED$ ED$D$b]ԍ* $轞EUjEX 4$MU '$m171MED$ ED$D$b]ԍ*$3MwMUEED$ ED$D$bEԍ*$MUECEMED$ ED$D$b]ԍ*$辝EËMjUEED$ ED$D$b]ԍ* $脝UE‰UЋ]ԍ,D$ p;D$D$q+$5UTUED$ ED$D$b]ԍ*$EċEUMEED$ ED$D$b]ԍ*$MEEED$ ED$D$b]ԍ*$苜EXLt&@t.&v0tfffffUWVS,F]ƉUM܋ED$T$4$ NjE  &ЉUUD$L$$]jEGfEf}UB ](9tD$T$$]jUBD$D$$] h`XMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉ME\$ ;\$D$b*$菚E؋M7UE:98uDE܉ufp뛋PUD$D$$]RiUuQ,[^_]D$D$$]%iUE܉ufp8UE:98to$D$T$$ftfGUE]L$ ;L$D$b* $薙UED$T$$]|hsUWVS<\ }EpFtD$D$$=hF w8t<Jut(F(x |;Gv\Ѓ<[^_]F(6ǀ~F,}P/G DGDE䋆fHD$|$$_gD$ED$$dDžVPvED$ ;E܉D$D$b*E؉$G WEED$ M܉L$D$bU؉$裗WUԉEDGDE䋆}MԋED$ M܉L$D$bU؉$HMF,OG .GTU䋆f@D$|$$eUD$T$$ucDž@={D$ ;D$D$b*${TEfEEM8FtM$^F FMF(~UfVF(D$D$ED$D$ E D$L$4$5!@EFЃ<[^_]ËE @ME$MU Q‹MEfEE#tQMVE$MƒMɋMtEVUfVD$D$$@dD$FD$$a9TfC V(VfxD$D$ $ctTD$|$$FaPXOfM2D$|$$bcwSfEEMfMMED$ED$$cU.V(ENfMfMM}fEfEMgωEOfMfMMMV(uNfMHU7Uf9U=ǀSxD$D$ $abD$|$$_PJfMWE5ED$ E܉D$D$bE؉$ܒE EfEV,UMWD$D$ $aD$GD$$=_WfU9uD$D$ $_aE܍L$ ;L$D$b* $#EEUfUV,UcWD$D$ $`D$GD$$^Hwf9U9u*E܉UL$ ;L$D$b* $cE܋U뫃fU@  G OfPDWTUD$|$$`D$UT$$]Dž@=vU䍃D$ ;D$D$b*$蛐UMT9fQTP|D$D$$d_D$|$$\1҅^8@ tfUEfUME䍓T$ ;T$D$b*$EsfUUVS: uFt$F FF(U VUfVF([^]ffUWVS4v }G,EЉE؍;ED$t$$[…?G@=fGEfEU܉GfEfft?fE<Ufy ED$E D$ $M50MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$A]B E1뭉UE؉D$ EԉD$D$b*$Uȃ4[^_]ËEMȃ4[^_]É  u8f}u RA=f9uu AM܅uEEfG MD$D$$ ZEtfEED$E D$<$.EMD$L$M܋$\EUGW E9uЋM?E؃9E܉MSD$t$$[EM9}GD$GD$M$2YƅM^GEFU=oMD$ ;D$D$b*$(M:эwu  Ru fE^MD$T$$XEMr@= MfuED$E D$<$-EMD$L$M$}ZEUGW E9uЋMu7D$L$M܉$>ZE9uЋM EFD$FD$$WuFfEftfm10ufpEpxЉM荃D$ ;D$D$b*$zMED$$kYMfEED$$LYfED$L$$&Yuf3EfE苇0ufpB‹Uutqt1D$L$$XD$t$$HV@U=UmM܍D$ ;D$D$b*$EM܋U5D$L$$.Xω1mЃ}Dqt0f@D$L$$WD$t$$mU1u'D$ ;D$D$b*$膈M}Fpfu܋10ufp5ff̀rS[4 P[ÌrS[ P[Ḉ̀rS[ P[̀rS[ P[ḹ̀rS[ô P[ 4UWVSEU Mwv9tt*<9t!Xr8t)[^_]1[^_]ÐUWSUtmg jBgBrnV@Uȉ]ԉuu}}ЉMً}}̉uƋE ʋE؉E  1É1؋}Љ׉}!]!1Ћ]؉ 1Ӊ 1Ӊ]U}1!]!1ڋ]ڋ]ЃEEU}܋}Љ}9UWuM܉E؉]EE܉EEԉE܉MԋEEE؉EU؋uu]41J 1 ]ȉ׃]< 1u1ȋuԉ 1ʉ1ʉы]!ىu!1ʋMċuH>‰EЉ‹}؉ 1 1MЋ]؋M1!!1؋]؋M‰}̋]]Ѓ@E}x}x}x H}x}xX0[^_]UWVS+ E։MB R$ǃ?F V$$T$pF V$^(~)71-F(F F`F$Fd\$4$M]ȉ9uh1tft[^_]ÍGD>(8w68)|>)1ɃtfTȪLB@t@L>))t 19r\$4$)ߺ81tfff녪gf uhuW6ЃE1U U9rU6DfFf\7Ef렉ȪUWVSӉMp x$?tn@)։u|(9uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$G W$@9ue?Mt)ʍx(5tftM1H X$[^_]Ã}?$x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S+B,hB0kAB4كB8y!~B<[zP1uUuFu-u%BHBLB@BD[_]êftэt&f볪UWVSR \uFPEVẺUЋFV EԉU؋FVEUFVTXF V$N(^,M]N0^4x|N8^<`d^PP;}܃L}쉽HEĉUH]ux|]ċuȉ]u]u]ĉuȋ]ԋu؉]u]̋uЉ]ԉu؉ẺUЋE HE @GEU$T$\ Ɖ׋PSE EċUȉEUMċ]ȉEU11ډEUMċ]ȉEU11ڋ]3{Mыx|!ω}M!Ήuu}]!ىMu!MM]3M3]`dEUű}Љ11ڋM̋]Љ11ډ`dEԋU3E3UM̋]Љ!Ɖp!։tEԋU؉ƋM]!Ήh!ډlpt3h3l`dTXu}M]PE}܋M]TXx|`d9LE܉UEPpp)|>Q1tft:7~Qo1uDuQ1s^tft\$4$;ߺp1uwuh"t䪃ުn.f0uGu8rуM1ɉUU9rUif둪ofUWVS ÉT$ʋp@xD)L$|P9L$t$KD$-D$/|$41s@{Ds@{DsCHSLTT$T$T$CPD$$T$D$,CPD$B|$D$؃D$T$ |$ָL$F&tftT$D$D$$is@{Ds@{D9T$rCHSLꀋD$9wT$ ovjBL$D$1T$L$L$$C@SDC@SD9ƉыL$rCHSL逋D$9uT$t<Ѝ{Pt$tft1C@SDC@SDsCHSLe[^_]frЋt$ru^zfD$u[u@L$D$tCP{QBffl$L$L$BKUMt U E]UWVSí } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E"]UWVSw } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUUʋE ]fffffffUVS迶T EDžDž<|<sL?z DE5N@@=' ==D$D$D$D$ D$t$$&D$D$D$ 0D$T$4$6&tp0[^]=t*=uy늸۸ [^]ÍHúSu,t돃DuD$S$o&s̸ XNDd :0&iDžDžDž D$D$D$ 0D$D$$$ D$D$ 04$T$lz1vpDžDžDžD$D$D$ 0D$D$$C$yPD$D$D$ 0D$T$4$#0[^]ødj낺FsGdD$D$D$D$ D$t$f$"`&C0D$$0D$$h ~ m ^O@E3D$+*)(&%DžDžRDžDžm G6D$D$D$D$ D$t$$ /D$D$D$D$ D$t$u$O D$D$D$D$ D$t$Y$ D$D$D$D$ D$t$E$BB DžDž DžD$D$D$ 0D$D$$t0 ><S,BD$D$D$D$ D$t$$1D$D$D$D$ D$t$$Qup3``fED$D$EЉD$ D$D$A$u}u tTE E E dt dUWVS #ø 8<$Dsdt V6ug$Et+ҭ\t V6u<$rE [^_]設Tt V6uD$<$rE [^_]US$y L t$[]EEED$D$ED$ L D$D$E$tL uD$ AD$D$A ,$y`L mUWVSȧ] E U}0@DFƅtIFEM 9GJUD$F D$ $UBUtRFE VJE}9OT$T T$$GF]CE1[^_]ËM!@`B~ :MtEuVMQlj9~ MQT$L$ MQT$lj|$E$u;E]넍GD$|$ BD$F D$E$UME!@~ `UD$ $qtljGUL$$PtMVJ}OUWVSߥt uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9rt% 9t 8t)؃[^_]ËE)[^_]UWVS]E xS9sHы0t/}U x9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS n E}E pE0EEE90EuNEU9sщL$MFD$E$]=D$t$$+M)Mt2MVD$T$$])ƅu [^_]1 [^_]ÉUt$E$]Et͋]E0U=UWVS(v E }}8}xEEE3UHD$D$E$*U)MMuE؉D$E$ƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$*1([^_]ø([^_]UWVST }E pD$D$$u'tW@ u^JM"D$ED$$D't&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$Q)fffffff̀rS[$ P[̀rS[ P[US S EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[Î P[.&f̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS0Ž tMƋuA~8t:F4@9s3`V8F4@9r$肤F8[^_]ÉUWVS踟Q E}}u8ENjE1txF8t1ɋ}E+wȁĘ[^_]ËF4E@E$]YF88]E F4F0E|U1E} OxD$`|D$}|$ F8D$L$$]BUF8)UV4V0]BD$ D$`T$ $~4V81}׍ @rPu B8~8BX]9uE~t$]薢F8]R9Ëtt][8 t5UF8M][8F8$.[8F8M$]脙F8tgD$`|T$|$ D$xD$E$ uUN8].[t?][{]UWVS<ܜq EE M8‹E1%;E = 9ƅDƅd9D$$BƅC8DžD > BD$4$$)D$ |$t$$5Ƅ=DiYD$D$$wCƉ׉4Yg 8X9;-D$BD$d$诹D$D$$菹 {tD$D$$Ot X"U+ <[^_]Á}@ Džh1Dždd <$SD$`D$D$ t$D$$ ~ 9WǸ։BD$ D$`T$ $A9_Q((1ɋx9zz11ɋ)Y99vЋu@8RщT9PuQ(9P(\n$tD$D$$訵t`UR etD$dD$ $>tUt=6tftt\1Džp8H41`9t9F@FD$$Fu9;dt9FD$FD$$覴F D$ t$D$訳 tD$t$ $o9eu d3D$BD$d$ٳD$D$$@p8/tD$D$$蘲tPRBDž.D$BD$d4$ 89:y``9_$g}d$/C4$(9Q8 t릃O4H4W0P0W8׉P8|tP ILP`9uM$B|tD$DD$$tP?I‹uB8`9r勅9s$4`9u닅$蓖'$gAgtOtD$D$ $误D$@$`3Nj@8@P1f^$M@FU$-@=D$?,tLtD$D$ $m+_t΋${?UWVSЏe l<$YE D$ ED$ED$E$MU EƉ<$Y[^_]UWVSj lj(UuE]8,ϋM1Ƀ:uTtD8} Jtqu(M04Dž븋}|$\$D$ t$E D$$(P,U+F[^_]Åv }`ptu}`u܋(  $ ` 9tTt$_v߉ָ`tft`$`` 9uDž t 1U(1`; uR( Yt Z0$J@p9sˉ$btftr@ K0 97(J (Dž 0$ D$D$<4$(菪4$;HX 8t1؉ϋtft $`901$t $9Cuˉ0B$4BTG{r_lfdf91C$ Yu=a13Z0$ -1uufӋ(US Q EU BJ  D$T$$ []UVS Ò utEىM)E}|$t$lj$UED$}|$4$UE<ML$|$E$UED$\$<$UED$\$E$UmED$|$E$UM܉]ZGu]E؋} 8MED$ED$ ED$E1uD$E$uMED$ED$ ED$1uD$E)ȉ$@ƋE]XQu]E)ًU)+U9xNuUT$ML$E$UUT$ED$E$UEEML$ED$4$Uut$ED$<$UuML$\$<$UML$\$}<$UU܉u 0sHuuʅ#ML$ED$E$U(EEED$|$E$UDu:}"M2T$ 0AT$D$l3$E8E aE oT$ 0AT$D$m3$8E 7Ua UT$YD$ ED$E D$E$]fUVS "÷ EU M9Mr/9r 4 9r$9fu49rL$T$$ [^]}fffffUWVS$~V lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$2;M1 ЋMu`EUD$ T$L$FD$$F;u<tVT$VT$$$Ѐf1$[^_]<UWVS}k Ƌ; rEu =[t6CuudKStqPCS t[P ؃[^_]ËD$$}Åt@C؃[^_]Éډiu1V룃T UWVS }à u xD$4$E%=D$($}Džts@@@9uE ED$D$ EЋUԉ$T$E9EČ[^_]`:1Č[^_]UEU U U$]UVS|ƞ ]ts tWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D -D$ D$%D$@3$ U D$E D$E$]UWVS{ó E HMxPpt)rP@t3B E$1[^_]ÃMt P@u͋MAUWVS,z? }u ;VЃEljE@uyts;puXY LADTPPX Z O@H PWEuH@,[^_]ÉKE苏M1҉E܉UL$D$ $T$61 ЋME܋UD$ T$ED$AMD$$fB9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA,[^_]É\ LoD i61o61~BEH M}6O1WUE PMt ʈP1]UVS0xŕ ut PtH J H $|u4$|1[^]UWVSww uu #[tCtډu[^_]Ë$;[^_]fVSD$ L$t 8trtl@͉ .&vލ1΁ €t8u.t(8u!t8ut 8uHu1[^UVS wƍ U Et7Mt.ZYutD$D$ $E [^]UWVS v. } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Ku#ED$E$E܃ [^_]ËE+E13TEfH @jUWVS(uW E܋})u UE XBE@ S]KE] :}Z]ru}_]ϋUfBfBKMʋE9s‰EЋutftE])XEUEUE @E)Ћ] Ct8E@ MY ]ϋUlu>}~}uC1([^_]É؁vD$|$$х~~)ËM IM)‹E PtEH,Pu>^E$]AE@ 9E\$ED$E@$EP,…EfH @HE1E‹]9sڋE@][}9Os9~‰ÉϋutftU]$]Uq)UU)UE @E)Ћ] CE[UJЃtUMEED$D$ }<$]e)EE9xsNMʋE9sBȋutftUE}8$])}UEHE9m1)yD$ED$E@$EP,…K)EMu9EPp)׋E 86p9rD$$]4s]+SSUSCslj;C ЉϋutftE)P)UKUE$]1ɋU-[;Q]؋usStft]E)C=EE\D1$. *Í#D$ 8AD$D$Gh3$(u ]܍D$ 8AD$D$Hh3$(yfvBvBfvEfXfvEf]^-i]K- VUWVS oõ utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]#D$ DAD$D$V3$ '[UWVS`n utLD$4$F t$4$D$4$[^_]&, `-4$9=s${<lj4$9[^_]ffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSlf u 7t`F t4VtGF uuQFF1[^_]FF؉Fu(VfF u4$.t&1뮋V0 t~@9t $pV0F FV륍#D$ PAD$D$<3$|$DfffUWVSkS u}E Fft[xT$$<xEE%1= ‰UtIM VL=u*9F(uČ[^_]E Č[^_]ËE 千#D$ BD$D$4$v#E 4D$ BD$D$4$A# *D$ BD$D$4$#UWVS|dj u8E1F t)fF FCFFE+O|[^_]ÍED$ED$4$0EF u 9vEE$ek 8,K FUEFEuE f F vFft$t܋E f F Rߍ#D$ (BD$D$|4$!FfJD$ =D$D$@U$UU$ɐEF|D$ (BD$D$4$ 2F$螏X脪UWVSgP Ɖ׋@0$1F0PER59EED$$5F0Pt$T$8$2F0PuD$E$V5V0U4U쉂PF0ǀTu Xt$(1[^_]ǀX\D$$4F0NjF0TXtXUf5 M7u]1҉]UWVSrf u78u [^_]ËF0$x0F0P3V09t'Pt($F0[^_]ÃT1݉U3UPV0ǂT1UVSeb u7u[^]ËF0$/F0Tt$/[^]ǀP8$0F0UYe MU 7u]É]sUVS/eĂ u7u[^]ËF0$8/F0U t XtTt/$/[^]D$\$2F0ǀP8$20F0UVS8d$ 8E1EȉD$E$KU+u 8[^] fffffff̀rS[ā P[UVSdç u tt$D$t,@E$[^]ÍCzD$ 4BD$D$9H4$UUWVS4cB D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"H!D$=!ED$ t$|$D$($v D$$!8!L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]i MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍rD$ @BD$D$Kl$HL$(=rD$ @BD$D$Ml$E"UWVS]a~ EU uM] $\$M] -}}$}M] $\$M] e[^_]LUWVSEU ]\$ u}M] $\$](]M$M $\$M]u} L$ e[^_]UWVS`3~ u} 9vtGFfuUT$|$$#xFP^T[^_]ff [^_]Í sD$ pBD$D$C4$덍MD$ pBD$D$A4$x9vV\D$ pBD$D$B4$E'UWVS_/} u} 9vV Ft5ft\D$ D$D$$!Ѓt<V FfV fuUT$|$$O![^_]ø 8V F뱍 sD$ dBD$D$V4$R@MD$ dBD$D$T4$#9v\D$ dBD$D$U4$;UVS<^{ u9vu`FftAȋED$ E UD$T$ $M!уN tFPVTfN [^]ù뻀fN [^]Í\D$ \BD$D$j4$4qMD$ \BD$D$i4$=UVS[]z utO9vuFfu$![^]Í\D$ PBD$D$|4$붍MD$ PBD$D${4$mff6̀rS[Tz P[US\8z ED$E UD$T$ D$E$ []UWVSHb\y |$4D$ T$L$@u9D$@t "=D$ uƉFD$8ML$$\$4L u܉t$DL$8D$-+|D$0|$@0D$8 D$<D$@ \$0ۈL$D$8T$}1th9.|$ D$t$E D$L$T$ \7D$D$4$5D$t$$ &ljUED$ D$E D$E$4UWVS8WGd Eu}8E1>'9.T$ t$D$E D$D$|$ \7D$D$$u(u~5E+8[^_]:|$D$ ˝D$D$4$D$t$$tLKH󥋅D$ (D$D$$O:ǃ;$m…1A<+wlLuىD9u˃u뷃z럃b뇃Jl蜇UED$ D$E D$E$R]UVSb uE EEEEEEN>wN#T t$ED$EȉD$4$UxE<[^]EӸ<[^].UVS<DÜa uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^]UStC a :UT$$K[]KC` 0-f̀ffff7̀rS[ô` P[>̀rS[Ô` P[USBx` D$D$ ED$E D$E$[]USB5` ED$ ED$E D$E$+[]ff.&&$D$4̀D$̀fffffffT̀rS[ô_ P[PS[Ý_ [USAz_ 7u P!8[]&[]f̀rS[D_ P[USA(_ $1[]UVSlA_ l t t [^]É4$ ^u@1f1ø11A^ 1øUWVS<@Í^ ` tsQa}1f1҉9r׃uFh E̋d Eb fE؋l EЋE D$D$(Ẻ$U<[^_]f…u"uB=fb t4t$wuыBd =uًBl ΋Bh Ëd t2b 9s"8u +x 9rth K`ƃ` Uȍ7D$ MD$D$7$)UȋB7KD$ MD$D$7$ UWVS7?\ D$,]\$`u }|$<]\$08D$Ë$1  D$`D$HD$ D$(D$,ND$D$<<%t2/D$(\$`|$H9s CD$`D$<D$<<%u΋D$$t$`@D$\ۉ\$PӉډÍ@L$LL$0\$0\$0D$Xu}D$X@tv1D$;\$0\$0D$Xu_D$X@tX1\$0\$0D$XuD$X@t 111D$;)1D$\D$`D$$D$<$OD$<$=D$<$+>KUWVS,r& }U ME8E1GED$ED$ L$T$8$@L$T$ WD$D$$踣=E D$D$ED$ ED$T$<$fU+,[^_]Åx$=wttH|.uT$L$ D$D$$UWD$T$8$(qD$<$y9IUWVS(M$ E E8‹EE@ I\<]$&.&"T$$xE-D$ D$D$4$0 DA@tD$4$cuDJ@utSFNu tDJ@tEpt$|$<$V7$z$h1U+u ([^_]GUWVSLÜ" }u E8E1D$<$]11Ҁ.փu9rMd9G GDGDDžDž\x.uED$D$ED$ED$ D$D$<$zU+L[^_]DžD$ D$D$<$dt9^G#GDGD}1DžED$D$ED$ED$ D$D$<$+GGDGD1DžDžDžDž.UT$T$UT$ML$ D$D$<$t~8=^G1҃‹Otth uAED$D$ED$ED$ D$D$<$RtD$<$9ED$D$ED$ED$ D$D$<$PG tD$<$낀xbV1@<t 1ut$t$ut$ ut$D$<$moGDGDDž0ED$D$ED$ED$ D$D$<$)Dž;D$<$eDžDžDžBfffUWVSlV u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt[l[^_]ËE$EE$ML$D$ ED$-D$9$ U($},~r EEML$D$ E,D$t$E$6jƉt$E$_EEFD$ $GU(fBMЉU(E,) }|$}|$ D$t$E$Ɖt$$ FD$E$FD$$FD$$ U(fB )Ѕ9}EiT$ NT$D$(9$ EHE H E, 9/B B U(D$E$U(BD$E$U(BD$$U(BD$E $E U(t5BEE ϋus3tftuu )fB fBl[^_]ÃuuBzE fUWVS _ U }E@4E)Ѓ FD$$)FD$E=h$VfFE@ uN1T$$F D$$ G fffG )~ [^_]ø둨u+9u1 [^_]Í$赺U *U$蜺U뿸UWVSE M uU E@}ω}EE‰EPE)96UB9E'9}}|$4$GD$u4$W׋u$sxuXuQ}׉+u9ED$4$N+E~[^_]äft.t&9}u1[^_]uvkU$MUM 9}yd9D$ ND$D$=(9$jJ^MAyEpfhfffUWVS( ljUM܋EGlE8u䍃ŸE֟E썃E< t< tD$ED$4$;D$ED$4$;D$ ED$4$;/D$ D$4$;G$̷u< tt < u>:([^_]ÍF$~~d ʈdGtD$ɟ$Q닍F$5~GjD$ߟ$SD$ D$4$:tD$ pD$4${:uEO F $~GGD$$蛔D$]D$4$:tjD$D$4$9uXO@E܉D$ED$9$2OWL$T$9$yO >D$%D$4$9t*D$ (D$4$f9ugOD$^D$4$09u O@D$(D$4$9u OD$4D$4$8uZUm`D$4$ƒ?v?T$U؉t$E$~EUƄD$ЉT$L@$oLt׋$ˆL,D$ $L)&D$M7D$4$, D$.4$(oD$D`$8}DǀtǀxDž0Dž(9$胥D@Dt$D~DD$4$Su덃$D< tt< uDž0<4,LTDD|$@$n<NFVe9xDw@ut;u㈕$<,t$$3<$t]TDLD 44 $4,LTDDDLD<ȅy_%=tdwL$,D$ $rL{;$1!$tDž0pvLusL@DDu|uc'j&D$D$:1ɉfLu LVfqUD$E$#]UWVSXã }u hl3 3 t;D$<$t  F FX[^_]Ë 9puttl|Eq'9EttIND$D$ED$ D$D$t$OkBt  F F1X[^_]UWVSU E@ E~tE~mEX1&<1|1t_Bꀃ9E~E9Et=}ù{u֋ KJKJK J uv uꀃ9EE[^_]Ë OJOJO J uv uf̀rS[ P[UWVSdã T"D$$]@$DžDžDžDžDžx@ N L$T$ VT$D$$y\T$$r@ 9@ωփsUtfth@ lj)#Pd덋ptŋ t|$$ruf떋P04$o@9‹(tft‰)@0DžuY tftlj)@4#tF4$貍@9r1‹rf$r@ $Zś1d[^_]‹);Wh@ 1ffi$p00P@~~ <9V) 9kVʉ)ȉQ1ҋ?tftH<@ lj)99h΃r뀍ED$ OD$D$9$}x@ $oo4$赊@9>‹ytft‰)‰DžHtftR<lj)944$׉@9`‹yUff^f# PD$0umuTk@ $f+ f넋$(m@ 6UVSk @7t$`s[^]Í"D$$y[^]UVS @7t$l[^]UT U]UVS; ut$r[^]Í"D$$2y[^]UVSÄ ut$ l[^]UWVSR u}t5W¸t[^_]ËF [^_]ÍWD$ 0OD$D$|9$UWVS> }uENH NH"D$$,xƅu!yH L$UT$@$tEG D$GD$ GD$D$4$ u4$jG [^_]É4$j[^_]ËG [^_]ÍWD$ OD$D$9$֎UWVS + EC!88 -:)lj}싓 u2E D$ $  [^_]Ít$E$ht$ $ht{ t1= ;txED$D$KhuًED$D$ED$ D$:D$$ [^_]Íd:D$ED$ D$:D$$ [^_]ÍD$ OD$D$,:$EED$SUWVS  ''w} )ƉT$U$tn  UT$ $\tG  D 1 [^_]ÿ'y qUWVS(H LJ LJ LJ  11ҍ,WEE5 )Ћ  ڍAw LOD>ЉD>]T>ӉT>WMHL>@CD> C kUlUE֋ xzt =w ;OEt =w ;O tH~k LJ yM !؉ MeM썇Mg$  MLJ  M싗 1ɍO]MEUtwM<9ErMtu艷 Ѓ([^_]LJ 5 LJ D>ED>ЉD>]]Ӊ\>W,UlV;D> rU7UsD>HL>PD>HL> HV7Ë ; elRH P H HLJ V MULJ D>UMD>ЉD>]T>W,U]ف9OlRLJ 롋 LJ LJ D>ЉD>]T>WoMU-E!8E䍇 $UMΠD$1ۀ} ËE)؉D$ D$:D$$UMLJ D>ELJ D>ELJ D>ELJ D>EqMUD>@6UM^D>E싟 ]X] É %LJ lR f gUUxz Mt ; r tXlR H P H HV Ћ]!LJ $$ffUWVS0 EЋ u䋸 }9E \uԍlZlXu썰,Yu؍ [u̍ZEE]]Ef t1P}艗 P  5R}苗 D$ $ 돋 uЋ Eԋu؋  À8 u }胇9u}U - E苐 -X U苂 }]苃 D$ D$ D$ $RN  >E苀 P[^_]ø]苃 $$E+t…MtO1E-}-E7LEDXtE7<$]sƒ9r̉E!8R1KU} MԈ }ԋ EU}ԉ+ E Ћ U }Uċ:O, OŰU苂 U9E2\9ËU)Ӊ]W(EUȉ XND]荃D$$!_E艘 G,+UU]ȋU̍<Q9uUċ:,^MO uquF_ u؉G D$ $]Gt/U艂 Uċ:MO u#O)ȉƋ_uGE荀h;1uȉMȁ vE W18 M苹 MċKщˋMD9UUċ]苃 $SUuUȋ]苃 $cUE苸 } M< ЋAE̅+}苇 $  <EU‰ŰY9Q MỦ @D@Eȉ EăU2ŰEȋUЉEu艆 EȋU}̋UUu艾 fEЋ }ԋUM‰T$Uȉ$]MAYۋUBA ,Eǀ GEU<A,E苀 E]~C]苃 $Hb]}8B} $}苇 D$ EȉD$D$ UP$/] tU苚 <AEE苐 U }< Mč[^]  ۺt ʺc 蹺R U襺> U]U荺& U ]Uu U ]` UL U ]UWVS6 u"$ uމ4$薾LJ LJLJ LJ LJ LJ LJ LJ LJ 1[^_]US脹 E$茵[]USa E D$E$蒺[]US7 E$Ƚ[]øUSã D$ED$D$ D$PEDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$nDžH V€ʀ UTPtD$ D$D$T$YыU !ȃP{vltat0<$T|T$zDt01[^_]À Vt t0<${  PxD$T$QP^E E DžTED$D$ D$D$$`lDžt HƁ ZLsAs0E/s0 &m Gi G*G a G G_ Gj GD$D$L$9PLPP LЃHtfD$PD$L$;H  D$ $PP D$돉Lq8PLen  PD$T$CP@ ƒ@ urc b2b fffUWVSQ }EpFtD$D$$:F \  D$4$u_  t$ur  T$U4$Džu=U9B0E pp[^_]1UD$D$4$Mt̀N(UV$ED$E D$ T$L$M4$ !@MukF[^_]ËX[^_]F(V$tߋ9F(F$PD$D$$ 9[^_]UWVSU EpFtD$D$$8FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$C !@MuFЃ[^_]úЃ[^_]ÉED$D$$7UЃ[^_]ÉLnUWVS$ô }9EUEEEE;E MmG$Au݋M…tUL$D$<$AUUD$ ED$}|$4$8u7}UcE;E sQ $[^_]Ɉ뤸$[^_]ÉT$$Ut㉇1UWVS(߮t uE䋆EMM܉;E E苷EHMU$@ƃUtY9Euȋ})lj}苊U|$$腯U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$6u@EE9E 1([^_]D$ ED$ED$4$6l([^_]UWVS(Q EU9}] E苊;M 9EE܋E9t<)t29ut&M\$U\$$]>MUD$ E܉D$L$M$U]5M9M Ut%E9s.E9hw1([^_]Á ([^_]É\$<$jDžUt([^_]UWVS({ EE] ;M sf]]9suE19r 9t[:u)ÈU]D$ E܉D$L$ME$]4uEFM9M Uu]1([^_]É)맋E ([^_]ø([^_]UWVS EU EpLB< D ?ZU )ىL$D$$] f}U fz|rrE Xft)ۍLZu0f9sfuf09uut^JLB)wmft" F]Ff9sf9ufjE1[^_]ÉMU GD$E$]uU M̉EU ]썋DL$ \L$D$< $+bEU UEU ]썋DL$ \L$D$< $aEU U E]썋L$ \L$D$b< $aU EUWVSÓ D$T$$tb@D$T$U4$DžUu D$T$$H0[^_]D$T$$(0[^_]ÿUWVS g }EpFtD$D$$/Ftt88f [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSD薧+ }wFtD$D$$/F}   8CuD$4$D$ D$D$$NJ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$h;EtD[^_]ËMN$tD$ D$D$$}I!уtD$T$$7u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ_EE$D$ ẺD$EȉD$<$W3EԉEE؉ED$EĉD$$g‹E؃9tD$<$+jD[^_]UWVS+ u~GtD$D$$,GD$4$G uUEu@t*$8u*4$jtME[^_]Ë$0itE͋D$$E EUWVSD uM Ut'}8BEtbQLPD!@tHx9D$BUD$ $U]C1[^_]Ë]CD$$äM Udž9D$D$ ED$T$4$u>]uU|$ $PtUx?UWVS ̢e EE,E}1EED$ED$$]'ƅ@ @=fU1 9M rTVÃf;EuUMUfY]][]]}tH}t8MNDF,D$t$$]u)E!D$DFD$ljU]荃D$ \D$D$b<$ZU ]{_E}E9}twu})D$D$$](9utAFD$FD$$]<&tVTP‹}u뙋u]^}8 [^_]ËEpE )}fG w [^_]fffffffUWVS$葠 uƉЉfMy} ~ϋX9U)ω\$D$M$]bEfC 1U~U 93;DD"=. fLD$ E D$ƉD$$]]ËE XKMǍDUfTTQf[MfTftEff9؃0[^_]Ã9u}ԋGDC$GDM_=ƋC 9Ex}؍Oȅy¸} E PS$u}+D@=D$1]܍=D$$VOR1ۉ؃0[^_]ËC #C$yP}ffw$C4=nE1҉S4UEE܍\$ \\$D$4=$*LE XUE_E+w@Euus DDoDuED$ D$} D$$txDOHDVtRE눃E}i}{ HHhD1%UWVS4覒? E} wFf~ˉM Ef8LM fMMEHE@D9EmD$ |$EDFD$E$]@ZDžpft6f~wuftLÉEf>fEEԉEf}eMfyvDTQ9.ED$E$E@EMU EHfEEf;E}f]fD M)lj}]U)؉EE|$L$E$]@9E U5]f{vDTS9szED$E$E@EMUEEHfEEf;9]tED$E$1MUEUԋMf9MsFfED$E D$uF D$t$ ED$ED$E$]ruOEEtE@EEEt5@EEESpEE@ =ufufČ[^_]fEEEE]D$ (]D$D$4=$ AMt !EEfEE:M]D$ ]D$D$S4=$@MgUWVS$ Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$3ED$$辇Eu>E9G ED$E@GD$E$gE$[^_]dž(Efuhdž $D$ |$UDBD$4$O…t EME$EPEwD$ |$UDBD$4$N tʋ@f8 $dž mDUWVS,Eڣ uE xEFEEEE@ETGփ>VMM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$UU)UEftfDuf)tGfLGM yITGփVuJҋu9sM DG)fET$U܋UT$7$1U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E*DEfEfDU܍DD$ `]D$D$y=$<M UaM DD$ `]D$D$=$<M VuM DGƃ=Fu!Du䍳`]uDG)fET$UUT$7$U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUt[u9s‰9E8Eu;p)E9pEfDN,[^_]1,[^_]fE D$E$E tˋxLUED$ E܉D$D$=$:UED$ E܉D$D$=$:DD$ `]D$D$=$:D$ `]D$D$e=$Y:E@EDD$ `]D$D$k=$!:D$ `]D$D$b=$9FE)UWVS:Ӟ EE @u E1Oft{DPND$ t$D$E$]Iƅt|$E$FfUH]uYfwfuf|Pu E]M IM1M AKEfE@ =\)ځɋ]fTKMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfAfAF^[^_]ÍD)wMfTAhU]썃DD$ P]D$D$=$8E@ ] UfTK=UWVSS U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$F…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$bUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS~ Eu} 'D$ D$DJD$4$] FtDPfzuft,ˍ< fD$ t$MDD$<$D aLJ(@f8u$LJ 1;D$ t$DHD$<$pD…@ fEB@fE1fEE$#MAE9F ED$EFD$$M1U)fUN fMD$ t$MDD$<$C…ZM_LJ $LJ(14r9UWVS(G{ܘ E։Mz@ =uW)ЉEN MMȉEGfEt$ED$${UE D$ED$ D$t$$E9F ED$GFD$}E$E([^_]D$ t$DGD$E$\B…t#M L$M $MEEvE8UVSu]ED$E$1ɋU Ct1[^]øUWVS(y< uD$E$1ɉE/D$ED$E$/EED$E$M fA fJE @EEE@E;EEHppfEHuj/VZYtp`%t0MPVZYMu}] EEAe[^_]Vh "hU "h-+qUWVS]u 6_h$"VSj tfu 7-ۋ=-)u=-u h$"ŕZt- -$"hj5-1- @u5-h$"j3hXu4'h$"jMUW6ZYMtUBk @%u6h$"j~VKSWH%P UWVS] 3h!#juh!#Sui@t h("-DP$-Zu-y$1--@%5-@%jjP0- y 5---:=00-v-u h("j}d-u#h-d-("t-@%t-@%-%H%hPR/h- yTt-P-%H%hP5d-ңh- `- y5d-hX$j<}@-@-L-u-X-u-H-uj@-D--9ӡ--su-táX-`@-t--@-D-- -tp- l-t-%h=`u; p- X-\-l-X-%l-RP5h-t-P -t h("jh -Ph۫j%hj%1=-=-=--hX00-P00-V5--- t -- --9щss -- u15-5-5--P$ u15-5-Z- rPPhX$G$Y[-u5j5-5-5--P  t5-hX$XZ-------K-]-]-] --9Uu/9Eu*--ڣ----6esEUӣ-- -----t1--H-L-jC1=-=-XsE--EUMt- -EU-uRR ----=u=u5=ۣuE-t=H- X-9ȋL-\-s")1=D-X-\-H-L-L- H-t jI[Z-5- tH X-1=@-X-\-H-L- @- D-)։-5- ut-=h-ujPY@u$8th("5h-t-PZ@u h#j,xjhUWVSX ] 3Jh!#jFo h,"Suc G-$l%-1 ----1 --@-z- -1=-Y-J15 --3-$-1ɉ -------=-thT,"= 7tu hy,"j\v1nuou-j,P[YZFt@jVe-^Zu h,"W8pj,W'ZYt x>1>A!Ph,"h-Ij5--=-t t9h-"Buu/ -t'h/-"&=-th\-"--jWNT-ZYu h-"y;O-=-t11X=-uمtՋ=-jWSY[^t' 9=-tЃ=-t ]tljti ȉ=-\t 1Z01C P4jZP0P蹓t 1B"-~h u)Vb_Zu h-"js15-DRP藒ZYy0ƅu(3%=`u ƅu3i- PVPY_=-i =-t9PVYZt=-Vh-" }=-t%" r=-ughw$3h-" Qu =-u7hw$V3h." G=-=-u3hX$xXZ=-t4011Dž8hhP+%P -5-8i- 192t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t =-u1&--=-t50X";-si 7C1e[^_]USEEE EE0][1҃vU|r҉-UEh1"RP:[ tvpt.Et?SuF-Ƀstxu0-볡 7X---Ph@%h- jE-EE)ЉEEt9E8-u/-EH~-)EEEHEj!1ۉ$ZuYhxjXZjjY[hjXZh-Yt1h-h1" dXZh1"IYh?j[X_ -Et^E8tTE04YtEEj0YZyjdZ,E8!tYEh0h-{ @Et9h-h1"^cYXE8tjZuh1"MHXx*X-tPhX$Y[h8-X1y"=-th@-hg#h- uY=-=-h-h1"bZYh2"G1ۉ$gZ&f%-1-냋-| th/"GXf%-^1-$x(25xd-PRR! tt 1j1ɉ -h-h1"a[Xh2"G1$d=-ujpjZuh@-5\-h2"h-h@-hg#h- h-h1"aY[jAZn=-ujh@-5\-h2"h-nUWVSXu} 7>h|"FYZu2" fu 7h2"WVV utt -)NvXWE8}W ZE1% tAB9EsEUPQMWҜ UuMt6QWh2"j)kփ빅u Wh2"AE@t1j URPtE ;F|E8tEph3"jjE1~PS.YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW$ UWEffEERhm+fEEERhmW 1!EPhm8@W x E%6Sh "jif9tfuPh3"EPsh13"KU"UK UM3"U dUuuuuuhQ3"E$uuuuuhq3")uh3" uh3" XZQURPW x%uSh3" ,URPW yShX$jiPh3"jj2UWVShu E1E1ۃ}~F8-tEh4"_th4"PbZYu -h4"~_th4"P8ZYu h 5"kXjh4"h4"覙wEPn<uh%5"d0E_t<1ɉMMMMMMJh55"w 7PuZYh@5"jgEhf5"WE)PRE @}w}c}6to)}4E뷋Ed$(%}8tEKwn뎡 7Eh<5"5 7WEXZj 7E]EQEE--}uC-EuS-4>tj@uY[t8P}t Uxu)NjMMU9rxtEE xt}t1ۋtPZ\tSQXIEt'U)RPS sSWÃ~t C}u"h<5"h$EZYu hv5""}uEEuh-WuuEpEP\uX yj=-y h5"}tLjuVjhS y h5"kXjVjh5-y h5"kXh<5"vjuVjpS账jVjw5-衦,uu1ɉM̉MЉMԉM_1x%H>v  DGu΍EPEPj =-t}t.D1}tE܈jEP4x%/ GuݩEy h%"jodVh~f5-Vh~fSSMUEQ}u j uXZjjUE 0UjQmUVSEU #J .uc1E1ۋ4%Vh3H#uUC@-H@-Y^yh8-j XZ8-P8- Cu 1e[^]ÍL$qUWVSQxq14.4.4.4.4.4.4.4.4.4.DžDžDž1|h]"V N @I&/0$%S'$%11-1-1-s1-d4.jP5 7 :uy5 7h\"1-4. 4.4.4.4.4.4.14%4%h]"HC u4.w4.l4. 7j/SAY_Džu ;C3@;tGt7@:t%t@tj/[ZÅt8@tYt@t3t@tij/IZYDžt+{tQtN@tUt/{t"@t)tG|h#]"O4.Ph4.h4.h4.h@]"5 7+u 7<t hK]"jJ_=4.u4.fPh5.Ph5.hh]"5 7ĕ~! 7<u5.5.9shr]"뉅 5. 7j/SY_t6PS}_Zu# 7%=@u 1- 7.4.1-1- 74.}5 7'1-[=~ PZPh]"j^-)ѡ4.=4.t 4. 4. 4. 4.tW~=4.t t$h]"4t=4.t=4.uh]"=4.t=1-uh^",I4.u 1-iDžtDžxjjVjjtSr@t,GYtjjVPjSL@t=1-1-=4.u/RP{_Zu%=u 4.4. 4. 4.1 4.t1=4.1-=4.uRjhh.PR01-y'3 8uh.h=^"7.wދN1ۉ d9.h9.F 1ڣl9.p9.6.5x9.11ht9.@Ph`9. f Nt9. `9.Éd9.h9.@u"h@["X|9.1ɉ t9.[Ѓ<tπtʊt ȃ<uuutW119l9.p9.7t9.t19ƃƉDžDžf=6.6.6.t P1#DžDžPŃw 1҃.1҉7.t. Ҁ6.t"Hu7.1҉sBu t9.`9.19}Et3t*pu!{1ӉBDžDž4.=4.t u$1-9t9.Ph2_"4. 4.tO4.51-=4.|1RP1RPhX_"Zt=..;8u h_"EX.Ƌ@V=1-RPSQPvvv Wh_"G [j X5.1jhjjjщ¸_"5.5.1jhjjjщ¸`"5.(5.1jj?jjjщ¸`"5.ih2`"IqO=1-Ijjjjj1ɉz=1-$tj 1-_h8.ƀ8.$T.#h8.ZY8.t8.1tFh8.h`"&[^hR`"hy`"h-jdh8.6h&S"ۋuw1ۉ4. 4.u1-=4.=4.1-uÃ=4.uMh`"Ytpjh`"gXZؙjjjjjщڸa"h2`"`tt Sha"%^_16.@u 6.4. 4. 4.1=4..Džt~ Džh0a"6.Y=tk jhjjjщ¸Na"ƒti¶ f6.jt9.DP2f=6.?6.%t%u ù19rGD86.G6.@5.11ۀt,6.t#u;u u@ $ut6.u돋5t9.`9.19}{.tK;tFȉPC219u9t6.A뢡4. 4. 4. 4.=4.uYha"^=4.tl4.  4.t h9b"[hb"YtM`4.4.2`4.}~ hb"Z4.d~ hb"hXj񋅀Ɖ1ƃu h _"ϡ|7.11;|7.ÍPP ZYx+=w;)uv5.=5.55.jStPLU 1eY[^_]aUWVS}] 1ɉ1Dž1hLs"SWS3 rfq1stwz1҉j P5 7J 7 8t :tPhs"&78"[N5 7h,s"jFGDž-Dž-)OtjhP6P2Ãy2 h9.hedAP y hSs"= :.9 @f :.1ɋnXu uXh]s"jh9.h8-  tȸr"u!#Phs" ZYDžf:.h9.f:.h9.-k~PSyhs"Yu Dž2"h"u>Zuu."hP.W:-P^t.R$w[u jj'XG1ɉHwvtj9uPhx"XbWd$Zp- HWPF_Xu-FFDžBUt Y@Cu担)s P.he"WV P5vr$%P.j P5 70P. :t5 7h"h"Y5 7Iv.Zu5 7hԝ"P.QP.B 721ۉ1-%P.tRPh"ji%P.1ɉ 1-P.h "5 7`P.[Z5 7h"j=%j P5 7.1- :t5 7h("j$thB"AP.^P.OP.@-P.u h}"j$=P.u"( ,;..| (5. .9Ȼ&} VG9ƉS}M)Mt1jjs sM9ȃM} ~&uXSk&t,;C|Z(s^C tk"=.u!6>"=.tx"=p.t\"h`.5`.Sh>"jmjDhK"=.thq"j'=.t3hhh"ƃ xjh"PbVSh"jQh..h"2j)h.j h" [=.u=.x"r" k"e"EE=d.t E"E=l.t "=h.t "=x.t x"=|.t #=p.t #7$ T.PtPH1ɉ h,"jEPS^ 0Sh""j0Sh7"$ jjXZj&UWVS@u} E@h|"WV7 tTHth wT$@&ЁȀπÀ5 7~;-X뫡 7|;-1ɉM똋-)Ht\&4jVhu"H tVhu"h"%j h..jVXZy VhX$jL ]1uȉuԉufE5;-]SSjWDyh"^jhyt W迨 y8th"95|;-hCt W薨 yh"}tjj#Y[t h"j1҉UUUUčEPXUWVS8]u 1E6谬Xh"VS x`At$Mԙ.ăa$ &.ܙ.ؙ.;- #덡 7.!Й.v̙.kș.`ę.U.J-)Ӄ=.t=ș.t&. ܙ.t&=̙.utu@=.u7ܙ.+=ԙ.u =ؙ.t#u=.uܙ. ;-8-U1..hXUu h"j=ܙ.tEPWjj11ҍE?1.tjh"P胤[Xu5.hX$j1ɉ .jjh.jVÃt;tMLSZV+X"4~FMuLK1=.e[^_]UWVSE p$.EX1=.hB"zPZYu .'h "P衲ZYu .j轝@..{Mph6_ K;m5$.h "PBu h.*`="=h.t #P_tPDX~5+u!zt~Kh%WZYt WCuCt C^hM"_._t8u%hT"F.PZYt .#h["!.P^Y_t .d"1=.tjhs"_Z~Pvj/K =@.u&jtPYujj=h.t@. .ujh"VXZwj2bj^_=.uh~#5c-蜰Y[uZ<~jh"Ujn]5.yƊZtjR]貈,.0.Bu@t.4.6u΃=8.t$H~ 18.=.u .=.~jh"iSTj tO jBOk虨j\UWVS]u 62 ,.5C(.{ 4.~0.h_(#P| u.VS8[^~sjY1uh)#j9~!vu0P.h>)#VS u%/~k |Љ=.vh+)#5XZš-)Kutm-DPu^S(_=vhhJ)#hSh. ;tC0..5.hq)#j ]S)hj}hjqhjehjY Sǩ^u hF'#j>@uhU'#jh8-hw)#% u g-$.h"ƴ[= .t"5\g-"Yt5\g-h~)#jst Ph)#j= .u5\g-Zu€=.t8jj5D. y h)#*Pj5D.d xh.j.. .% .%.%.f .. f..ѯhX.Y"hP.O"hH.E"hӣjҷ )#=.t(#PhX$蜙1S8.^_C6f=\h-t j裏[֮E8g-ut訲Eڃ=.u*t{8,h-u1f=h-h-< t< uG< t< uMjEP5D. f=i-{!#} uo"Pպ_8g-u0EE5g-P蝯ZYf=h-tCۡ-t -fEjEP5D.X f=i-uEPmXoh #jw UWVS E 0蜢.W1..h-#"Y[t -#6-#h.#V"ZtTMBug 78tpjRP_ :uS1ҋ .buV.. .h:/#u uà uC$`L&5 7h'.#..먃 .륃 .뜃 .듺A.# 7G낃 .v 7u#hD.#hM&h0W .hS.#S^_À;1hW.#SZYƿ M&t&VRS@* u <2t&h%SM^_SPhZ.#肏 . G.O3u8=eRhs.# 8=tRh.#BY[\3h%S^ZƋtt ug(SYS#VW it1҉4i-t+:t!;B uBu 7B뵃Pr5σitot8DuFDž<늅u  7{ShG9$h=#O cDž8Tuedx1jSVzCtjjj6ǃuh%VhiP蘔 @u h'>#jWYi-7tvFtjNt^HuTItBQ9YZ.0QDXɋ0u h6>#j'돃넃8tX4t<tjMUWVS$u] 3/h!#j+ hB#SV Btb$$O&jj5 7o ,.<.L.0.H.D.@.s<.d8.U0.4.vBeR0G.f"$O&H $O&a.t..G.1..a.1. h.?.1.1."..1|.|.1=.x.t.p.l.-)Ӄ.=p.t*thC#. . .tbhC#jt3=.||=.t=||)=.||| Dž|40.jd.PCx<hShm-+=v Sh=D#<hm-\Ym-m-X/tKm-m-1hjXZ=.t.Phm-S,x/uPm-@m-= m-wPhm-Y_@u\8Uxt)o%=@xtbK=p.u=.t. .t P62P6_Z@u6hX$j8%=@t /t 1ɉt4hm-hOD#j. p.tDžt Džtt$PZPvЀ8/uj|Vx 1lpupCpQhm-^Zhm-CHfuFs Psh "7zpDžlpx-Xu$wfusheD#yY[ftf tt)m-C,-m-=~TShm-hD#y o{DsC(huTttCpj/V66YZpt)xphK">PYZphp>h)8/t z/t/Bсm-vPhm-hD#x VPRppm- m-= m-vx/uPm-@ߋp=.xt Phm- Phm-\^ZSP@xJ9|uD;u@EJ9Mu5;B u0shm-hD#j/W[2YZtxh%WG_Zu^h!#VS @ui-)Ãu]p0fZY@u jjKje;LtEPtIFu'0h'H#VSD w~fw$,P&100010000100t0e0V-4)Ã=0t0-=0t,0=1=0=0u01ɉ 0ttu#K%V1ɋP|=0xt)SW=YZuE%=u dSW XZt WhX$jE%=@9t ÃSp_UWVSu 6萄h!#jj_ЉÁp1th%VuC tVmtDžtptc5 7蘇Xu5 7hzC#jhWpW 딡-7hX$qߋ^Xt!DžtpS ZY_yɾߋuڋtVnUWVS}] 3h!#j hJ#SW tUit)ft5huP0σvu?01001500뗡-)ǃ4ju0hO# j =0tuϋVPFTtP2l pY[uNj|%=@luh2lQtà =lv2hJ#jVltx/tlƄ/CGh>WkZD>8/u 9tH@j/W+ZYtPRd5Y dvWhJ#nXZ"@PRl7 t DžphfpkUWVS@] 30-SuN]Sj6uEUEUSj"^_Sjh6ZYuEUEUSj^_SjD6ZYuEUEUSj_XSj 6Y^uEUEUSjXZhHj#:001=0=0=00P]1E؍}ȹE uVSj=xVSj- x"}ujVj y}tVSj xjVj y}tVSj˓ xjVj踓 y{}tVSj蠓 xjVj荓 yP}tEVSj n y1jVj[ yVSjI x莖y y0hPj#0j ^=u-tUjhK%贙u-[^y hpj#0j跖0 #=u-u=xu-t @h"aYt8uu."VZÅt @|/tCP0_uhj#jB0ZYtlj؍P0/h0h: jiu- t! ttBGuB@9=0t hj#jP=u-uu- t 00e[^_]UWVS]u 63|h!#j/ 1hU$VS tLtPt9-thRw#_8/u|ht#P#TY^ukhi#ST_ZuZPS?Y^@tHxPhK%)_Z@t2|9u;xuM9 u;Etjj(@Y^uj SÒh8-eXZD-@t h("jjgUWVS}] 3zh!#j 1hOu#SW ft]/WPtwR)d0벃vtbit6rtxu{0010p100Z0K0<0--9=0zu8QuthYu#hXt0؋Ht ʉA?jl0[0 0u t1=0t =0t@jPWݼǃ uhyu#C =0t.u)WxXCHHf $V&PDs Psh "j=0tC ?ƒuts Psh "f0k=0^KPSCHjSWC 1ɉK +C  Cu>S=0tCHSftYwifu`KPC衑usZ=0u&shX$p0Y[R蟍8XC=0useZuH1芒tm=0ta8VS8?HE8r50 0$10sBX 8t hC#j]W[hxVSZYu8=0tCjPSh ""e0_u=0EE%=@uB=0uShu#d0Y[묃=0t'E%=u,S萓B=0u=tىډ؏uh=@uS-=0u SܹZtXt1=0uShX$^Ƌ8 踋8?誋8u=0S踌X50!a1e[^_]UVS@jj虈^X1EĉEȉEEjEPjϏ 7@L¸9u 9E0j j-Y[Ȼ0H Ȼ0jĻ0$!#juZYh#sVw-1ۉ]$h0i^Z0tt3Hu:0.[001<0E 000t.U=v-v=0i`E=0tEPEX100tA:w-HyP舩Xw-H J hw-XǰEHm00v00!EPCXu uVXZu uY[}um=w-t,Eh€#@^E=0u PEuE=v-u}rEjc?^=v-'7=0uhh"c[u[&jhπ#PjEÃP<@$BY|=Vw-uL=0uCEPB$ـ# Zu EPiCX8tEPn$?XE$01ۀ=nw-t$=<0uEPBX<0nw-u'j4([&^XC̈́RPhZY=nw-=<04v-$050h"{$w-XUWVSpE 0!qh!#j1ۉ]- 1-] ;E9hl#WƄZYEWx_9Euphr#Su tZftatDeuI렃gu=j5 7螌EZYz5 7hX$j2^-E ]Su~dZYy hx#yEPhBt @uk y h#0X}Whht@uk y h# XEPht@ugk y h#Xt$FvE 8uVEPuWSsS^1ɉMME 8URu V}YZURV YZuURVr^ZuoE 0-DPt"V赡PSKVS覘E9jh#V7 uVSEZYVh#]QE E}tSjuA y h"j}t Whgtu*j y h#XjZUWVSu 6ynh!#jue0 xo011ɉhdt`p11ۉljhx-hO#Vu}lRtf(LtntMH1һ뮃PthtPdtXfuyDž`뇃vuhDžds= 7hDžpYMDžt@Džh1 -E)t 4Hubupt uY00t00pt$t*tt hX#j\ t)00>=0tzj:W@MYZt@0j.WYZlt!h0WP&_Z@lu BZ>t0<#u$0h0W&ZY@u ۉ"8xPWZY@u WhC#j=0tE0E0jSVٯǃ 1uhC#>pu jSWչ WnX CHHf wg$r&s Psh "ZDžl`=s Psh "YttDžl Džl`0ht)KPt;Qu0t;Au A<50RslЃ t"`ushX$Y[dsZـ8t hC#j*VgVUWVSu f00| 0 ʈ00@0 ʈ00̔0%0f00h-#[th֠#Yt&t7GtPSrYZu Sh#Wh#j 1hs#VuP A6$r&,0%00 (0$00= 7h{"W]qYZuh##WEqYZ;A= 7.j j5 7Qǃ u~8"u 5 7h&#D=0j j5 7Qǃ t =0~8"u5 7h?#jj j5 7\Qǃ ue~8"t=05 7hX#뺸Y5 7oZ@u^PA0I0=104 0(0 9tt؉ 0v jh#uh# 0tt h#j00ǃ;=0u/;0u"0;0u09rt1= x-$0(0  x--=0tP U)4uE=0t=0?04=0tt  1Ljhh0PQ苣PLy h0t=(0uJLxPPYZYLu&%=u$0(0w($|s&J0PuJPUh"@^uu."h#Ph_+%hS@YSdǃuShX$Y[hQs"PMXZthW蚄h0h@0Vk50h@0V V QX1\`dDžXhVXPj\ Džy0z8#tjVj:h%"TjI_jVjP#nPHhT"ƃu#SVhX%TP2{Tu h55"jjPh"hq$hq$ÃuVWYSxTPZZ9ujVjg~TH h"V\LY_uVhX$LXZ@0e׋H󫋅LLOXtPDžu V)[eh#]Xh8-L-H-ZYyh-PX-P-0 t+@t( -y h-P_-P-Ѓ߃NP蔦^ JPW=0u 0 =0u 0 Ph@0Y[J},0 0P= 0X= 0t @0%,h0h@0h8-^ 50h@0h8-h@0Zxdh"vZ[_uvhX$j(1JPhmdP h֟#jm^~WYu Wh#P@0eȺX0t jSRA h@0ZIPW~LUWVSjj]Sjjh|&))@u hB#j u觴YtjjSPjh|&(@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ+MQhX$MUU1G맅u) @-yh8-j [XZ8-P8- 1e[^_]UWVS ƅ]-ƅ_1ۉ000150001=0001h#u u ycPtJTtgxPl$ |& 0뫃 0q 0 e 0Y 0M5 70Ye5 7>Vj:V=?[Zuh#SH0t)XV3fZYXu C[Ӊ0=0t hT,"j 7tuhy,"1Ҁnuxoux-h%PSC^_t!#0A֋= 7u 0i!# 70Otrh|&PhϬ#h-wVjcI^]0 0t00t 0-M Tu)tP1ۉXhPm hk 50RfXRrRhv#RL6eZYTLSdjjLRPV9X}XTPT0VhP蘁à uj/SZYuShu"h"%hSIPV豯Xu"V̮Xu9S跮^ty2LhVà LVhX$juhH"LRdZYhS#LRcZYSh#jjhVjSǃu Vh!#jh0hzd@PV uWxX0`PhedAWwV @uVh2#WwVbH__9~VhP#(NE Xh0lh h0Ah0UWVS$1t1󫍽p-tT1k8h0u;JDž`0AuRh}-\^@uh<$h`{-G[@u h_$jhx{--YP-@uhw$ޅtsh~-XZ>0?0@0}u ~-x{-1ƅh-u u跥ǃ zI`Ntu&At/CcG6$&WBh$,?_11w1kA0-Z@0N1- 61*?01Pjhjjj j5 7F1 6Pjhjjj j5 7}F1 5 7h%>0_費t9ƀ0x蚻t!ƀ0l\m yugƀ0Ct_L1~-%}-~-`{--ƅ~---=-=A0uu =1Wjm½^G=?0:=>0-=A0uu =1tEjL}Y=A0t=1=1t Dž PPtVSE PE)P+Džuh&h#PV& @u h$6t*HkttWP蹫XZuh&h$GS SYXuV(Z@u h&h#SYuh&h#j迶V_Zuh&h$jx@ uh$h&h*WSй%1󫍅Ph$Suh#S_Xuzkh$SZYuhѲ%h&hqP|+ƍH_v󤍅PhiS" @uh$0YSɮj8V*Z th$ht&hih#\V+ƹ󥍅Phui S@uh7$hUjmZt h&jXh6 h1ƹh1 Uh-h1{h1詹hL h1~hxL h1}h1跹 h1ŹXUh`-h1'h1UhJV h1*hT h1)h1c h1qXUh`-h 1Ӹh-h(1ĸh 1h(1h\ h@1轸 hV h01蝸h[ h81誸h@1h01迸h81UVS8y h$@Yh%%&Zy h$&Xjh>$%F[^]u[jj}h$ u=jhp$EXYz$up$jh*?$h$Ph!"hq$/j 7jSPf @t-Et Ph$~^Xjh>$|EZYtj _^h$Yj N^ -up jj hgo jjjj j jjjhBo 0jjjjhn jjhn EEEE jjjjjjjj j j jjjuV8jVjc1EEEEEEjSj]jSj]$jTejMejFeEE EjjEPEPjEPƒ$Buy^8L1 -te[^]UWVS]} DžhDžT1L11PXDžDt h4$WS芜 u~fFt/RkDžPgS$&5 7DYu5 7h$Xu 78#t5 7kZu[ j dR@P~ d:uYZu1Xh%W1>_Zu 1ɉ 1:h1$hH$hX%Q= 7h$W=YZu 1h"W=YZu 1Whj$Djj5 7輨 5 7h$Phjhj 7)!$Y( 1 1= 7W*rZu-DPuWh$@=Wg_+= 7=1j:W;ZYuj/W-ZYth$ ?u h$j 1-=L-= 1u= 1 1p1󫍅l1AuVE)Ћ 1(DžMDž>=1qh$5r@1jxlP51ph$@uph' $1@th9 $( jr HM1󫍝`4󫋅 = 1u  1tJ 1  1P<[^@= 1 1 1s= 1u; 1 1}hRSN @uhL $P%&ZY@uh_ $= 1h0VWà uVh "jrPh0Ps ujhh1jPoyh1hu $!Pb%^_@tڋ%=`uh1h $1= 1jjh1!M yh1h $jP~yY[uh1h $jh1hu" 1t#1VRW9^ZtN xRjVhu" u ƃrVW8YZuSh1h $jʙ=1u@1`PP51h1l_@uh1h&1=11= 1u 1 h $Ytc uh1h $h#S7ZYu&1uh#S7^_t t Dž1?=1thl"h%S7Y[ths"h1h&Džt' 1RP5 15 1C 1 15 1= 119|Y<@ t  1SQRPC  5 1= 119| h!$t5  1 19sSQRPh:!$j赗td 1  1ˋ 1% 1RP @u+5 15 1h}!$js'0Pa_Z@uh!$胝[^ $jdhjZh>$gjdhi_vhV%Djdhi^Sh$>$!jdhi[0h9>$3jdhpiYhPhL>$qXZ3dh^HpX<wz<Xx^FLs3`ts)Xh^>$XL]"LtkXD- `FLXxFv89~88X`;H2uMSh 2L u5`t hf>$X8N)XLH2 2L󤃽`u!_hu>$_Dž` ht>$^L\.8LtkXDX ^뵃`uvhz>$5[i`uPHxhfXfu萺TPW$ZYXOFLXLe`t ^h8-Xa2;2)3UWVS}À8-uChx"S- ZYu 31uuu'h\"S Y[1ۅu 3πh>$u WCX t[dw<$&Eσ= 3t 뾁북뮁gEE돡-19tcM E1WtUP ZU<RWXEtPV-he*%V-ED>Ptj dPhX$jl}tVS hk"jl}LDžu{P@_ $t8= 3tj jhx"cWh>$= 3t j jh\"cWh>$jd8j jhk"c tVWh>$jcWh?$jc h!#h6>"h ?$djjh!#h6>"h ?$d }ujjjjjjjj jjjj jjw@u h"?$jjjj\ZY@uc8th/?$=j4X}u3j3_j jZY@u$8t+hE?$pY2 u h[?$eZ W3XVSh?$p 0bjjƒ !#Bu>$SPh"%jiUWVSDu]  '#3h&SV U v~j cStITtbLu<#3뼃dw$&H#38#34#3,#3z#3k(#3\0#3M$#3>-)ƍ藜\#3=0#3tjjhm %KT#3 >Ejjj"oT#3jURh@hPD @u h7Z%oY=T#3y h%jh;u=H#33 @ WnrZ) (    mt /  =H#3t1ɉڸ*j1ɉMhjVE؉EhjVE܉EhjVEȉEhjVEĉE hjVEEhjVljEhjpVEMU ʃ} ʃ} у} хuu h"E1҉D#38gtj5T#3h_X1ɉME!#E!#FEȅ"CEċS:-0BRUpZH3U$(&D#3"0-D#30-D#30-D#30- @#3uj#3[#3LP#3A91&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸduCEċSEP1ucCEċSEPM̸iECEu/CEċSEP1ɸiXL#3uCEċCUC_EuKMċs t^"3hw$&]1R"3F"3:"3 ."3@""3#3 "3 "3 #3 #3t# "3 "3"3"3t1#3jjVl1C RX#3u#EPM̉UOhEXUUuEPM̉UR9,^uCh%s2ZY=4#3uhC$hC$hD?%N @#3CHw)=4#3uhC$hC$hD?% 1@#3SEP1ɸgX]ċuX#3MuhD$5u>au uh&D$"P#3EġL#3}tuȉuthDD$jtbMu}t }EEă=@#3uMEȉE10E18 31atctguIE# 3E( 3" 3#3@#34 3X#3, 3H 3"3󥡠"3@ 3U9sHxt)ЈX#3t]E؊Hw uF:T80D019r)19r)1ELE؃9sIJ  3X#3tMutHXSVh 3Ү =$#3t =#3tØ 3\D$7]X#3tE}tHpVWS耮 =$#3t =#3tiD$\X#3tE}tHpVWS2 =$#3t =#3twD$\X#3tE}tHpVWS =$#3t =#3tD$M\X#3tE}tHpVWS薭 =$#3t =#3tD$[X#3 tE}tHpVWSH =$#3t =#3tD$[ 3f 3=$#3t!=#3u=X#3t~\ 3^=#3Sh 35T#3 u( 87t [PhB$XZ9~kPhB$Y[]d 83u =D#3tHO 8t<#3 8#3 (#3 $#3PSVr 11ɉډe[^_]P_Wae[^_]UWVS } bhJ$PZY…Uhn"Wu*H Ut.at"t=&3 7&3뽺붡-])Åt>um&3t&h#S]^_thJ$SLZYCt/=&3u&4&3EsujRKuEVhJ$h-VhK$h-xjd=&3u.&3h0K$Wu*G t@fqA3w$&z=&3u&3먃=&3u&3듃=&3u&3{=&3u&3c=&3z&3 G&38&3)&3&3 =&3"&3@&3&3&3&35 7m#&3X=&3&3=&3&3j=&3 7&3h%PY[>&3/=&3F&3&3)-E)tH:Eu5=&3=&3t =&3=&3]=&3t =&3=&3txt4h#W2YZ!hJ$WYZu/ h#WYZ7hJ$WYZ"h%W_Z,@JK EpÀ5&3jj5&35&35&39wt5&3jj5&35&35&3w;E5&3Sj{h 0ShX$j&X&3En =&3mEnjEPjh @u hFK$^EUuuh`K$s[Jh`RPhsK$Mt SHYyE  1SQ%1RPhK$G1=&3tou5SoXh%S_Zt#hI$SZYt?uj?VhK$j VhK$jUWVS u] 1hM$SVA tRtfu2*3ֿϡ-9td1ɉ`1|lPVj[ZjxPPuZY%=`=@uxh{uxPhM$[^Dž`ddPhVF O3Nj P5 7Y |3~85 7hFo$뮋5 7j h"W[ 5 7U_h%PZYt"8u5 7hZo$GujPWϣ @A-L3fDž1835 7TXB1=3=3/335 7IYd35 7hro$d37?u8- 1uPho$XZ- T57ho$Pho$/jjj53臄E-)ЉEE E 1d3 33@3tq13DžDžh3RjVt& u0DP_PVho$1ɉ DS3 @S3hh"c^t8t PXSZDS3,u@\P Xu;P' Xt߃=DS3uF t8t P S_DS36SY@S3DS3=@O3utuhqF%RZDS3ghPh@O3X =v&j?C$5DS3hp$ @O3hhp$h@O3~Y =w=DS3tj R$ hp$PX j h$V@Y h(p$aX Z$h)Z$aX!#)Z$h3Z$aX!#3Z$h>Z$aX!#>Z$hJZ$vaY!#JZ$yh4p$Za_ "S$]h:p$>aXm$#AhDp$"aX!#SZ$%hOp$aX!#[Z$ V=jWEXZhj)Y^hj)_Xhj)XZhj)Y^hj)_XEt7U ESRPà 0K3uS_jjk)^_jXE j:0Y[t*E 0JZuU ERP"_X9jh`3lY^uhj)XZh j (Y[E 0j@V_ZÅt @hPW2V E @1=$3t1ɉ 3 $3ER@PSXZ=$3=<3uu |3ujSVO =<3t 1ۉ|371҉d3Ph^p$53 5|3Y=<3a뿃jh`35XZhj'Y[h j '^_e[^_]UWVS}u |hm!"PZYtWhh!"SZYthg!"SZYu4)~3ltXnuzh|$VW3 du4׃Vt1PσwB0-뾃cu34 4h&hg#h-jh&hg#h-Sh|$h-j-9u*=4t d^x1*`Gpptƀ8-utxt t1J=4ttt{1{Nj5 4h8-` t h("jC54UWVSP}1ɉMM1h5$u W. t3gt!utGu. 7E 7;u 7E85-9t3SZt@E%UMM@uSh<$jB1}1ɉM}t E4E1}t6h%EPwYZt"8tu hN$jhBGDʋE 46wVZ@u6hX$jhBhK%Y@ttEPWS_Z@uhu$}tuY@u h$j"BtuRZ@uh=6$FtVRPvhX$jAh#.XXuq$jh$SS$@ShX$jAUWVSĀu] ~41@44o4%1H4h,£ t4a1X&?t2Gt&W =~4uRh~43!YX RwPN ܋4\{4<4P4T4hN?%HtH5P45T4=Z^_5}4ShhMjhMjhj 5=7衪_2hho4]E1ɉMj@e)ljxj@V)Ɖ|tu1 jPdq1>XZtu(xK%}u)x%xtq}tjUxY~jRt,XZlN tY_PSBXZt;t HxtyzP P?XRp1ɉ_VSy _ZtPݨ^B7S&S? SR;-tP[hƒ@tRt \tBhI%=h@Yu&j$RPR @uh&h<%=XZ)9>lh8-glh$tPRoh&hF%7h&h G%(%Ѝe[^_]ÍL$qUWVSQ@Y1ɉP4141,0<48hف%S@ ,H01$ ' 7% 75 7f41Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @f4F누0f4%$1҉Lj LP5 7ƉP 8u! 78tL8u ;Ph%pj LP5 7, ~ 7:t L:t5 7h%t4z 7@nl2tdh8%j" 7jh8-1ɉ - -$-^_ 7< 7j LP5 7,(- 7 :t L9t RhX%j!@=Rhl% 74 7 0LP5 7趏 7_Z8tL:t Pv)ݝ D1݅ tjePh%!%v5 7h€%AٽFfF fD٭D߽ ٭F $- -߭ %٭D۝ ٭F $-xy5 7h% uh؀%Х$-^ 7SQ0tIh%j LP5 7P*8 x 78tL85 7h%&,% 7 7 7 7 75-tDFu h4%1B卅(R$R RRRRR RRRRRRRRPh8$QUƃH1Ʌ~ )1 7h8$Y14@9u919~4Ph"̪GXZj 7t1DžtDžxDž|Dž:h6Vj5 7tPtPh]%66rJB6Rm 7@Yj LP5 7(0- x 7:t L:t5 7hx%=hh% 7% - 7k 7% 7%  7CLP5 7o 4XZL8u5 7h77$8LP5 7)4_XL8u5 7h%-@)Ht追 7j.SY^u SZ)؉@?wPSPL@Ƅ t@ -t -fBۍ1V޿@KjKPV9@SV,VdPS$TVh%j Hd`hSVjSNX 7t=0- h%ɠXt1DžtDžxDž|Dž:h6VjStPSPhX$j66BtÉ4ru hB%6Jr rrN6 y h%< 7@t"56h6PR t hRQ%<1DžDžDž:PtPj<tPaPxt 7t hx%JXppj0j)56[t h%NX 7tVDžjSj'j)56c[t h%jSj(j)56@[t hՂ%J)P$+?)P* 7؃^_u h% u00-1҃‰@40@s Dž@0 1ɉ @40-@ ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizeoutput block sizeinput block sizeblock countfile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/home/source/ab/HEAD-lint/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/home/source/ab/HEAD-lint/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/home/source/ab/HEAD-lint/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/home/builds/ab/HEAD-lint/i386/20250706084834Z-dest/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/home/source/ab/HEAD-lint/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. Explicitly specify beg/end address?The bootselect code is not installed, do you want to install it now?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/home/source/ab/HEAD-lint/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -An < LFS_MAXNUMSBnblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/home/source/ab/HEAD-lint/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCAN%8u %4u entire track defective%10u SCIOCDEBUGSCIOCRESETSCBUSIORESETvpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%uunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time format/usr/bin/wall%s -n%s: Can't find `%s' (%m)FINAL *** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/home/source/ab/HEAD-lint/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/home/source/ab/HEAD-lint/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x invalid console name, valid names are:Boot options: timeout %d, flags %x, speed %d, ioaddr %x, console %s console %d keymap %s Patch area in stage1 bootstrap is too small/home/source/ab/HEAD-lint/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/home/source/ab/HEAD-lint/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20250706084834Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-extproc-parmrk-onlret-cread-parenb-cdtrctsispeed %d baud; ospeed %d baud;lflags %d rows; %d columns; queue = %d; line = %s;-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfoiflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignparoflags-opost-onlcr-ocrnl-oxtabs-onocrcflags-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/home/source/ab/HEAD-lint/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Read failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %juPri%s GPT at sector %juSecGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableCreating new secondary GPT headerMoving secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]GPT part %lsUnknown %#x %*s index contents %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaxGPT not found, displaying data from MBR. %5dshow[-aglux] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/home/source/ab/HEAD-lint/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AFpltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-lint/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/home/source/ab/HEAD-lint/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/home/source/ab/HEAD-lint/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/home/source/ab/HEAD-lint/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab MBytesGBytesKBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/home/source/ab/HEAD-lint/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandLPSVEPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/home/source/ab/HEAD-lint/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVncan't stat: %s%s is a directory%s is not a regular file.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.99.14 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.14 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.14 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.14 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.14 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.14 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.14xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-lint/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/home/source/ab/HEAD-lint/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingmulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Alink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist