'VUmjP0mKNetBSD/earmv6hf ramdisk 08Pj<  Pj}tt ttPj@@<@T 08Pj<  Pj}tt ttPj@@<@TU PjttXX`APjPjPj$h PjPjPjAPjPjPjA.PjPjPjAPjPjPjAPjPjPjAPjPjPjAPjPjPjHAPjPjPjIAPjPjPjJmD5#PjPjPj (08@HPX`hpx$›PjPjPjN$dPjPjPj (08@HPX`K$PjPjPjhpxcM$PjPjPjFAPjPjPjLCPjPjPjMAPjPjPjNAPjPjPjT!PjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj4!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj B!PjPjPj B!PjPjPj!PjPjPj"!PjPjPj"!PjPjPj"aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj?\!PjPjPj>\!PjPjPj=\!PjPjPj<\!PjPjPj;\!PjPjPj:\!PjPjPj9\!PjPjPj8\!PjPjPj?\!PjPjPj>\!PjPjPj=\!PjPjPj<\!PjPjPj;\!PjPjPj:\!PjPjPj9\!PjPjPj8\!PjPjPj:\!PjPjPj7\!PjPjPj6\!PjPjPj5\!PjPjPj4\!PjPjPj3\!PjPjPj2\!PjPjPj1\!PjPjPj0\!PjPjPj7\!PjPjPj6\!PjPjPj5\!PjPjPj4\!PjPjPj3\!PjPjPj2\!PjPjPj1\!PjPjPj0\!PjPjPj2\!PjPjPj/\!PjPjPj.\!PjPjPj-\!PjPjPj,\!PjPjPj+\!PjPjPj*\!PjPjPj)\!PjPjPj(\!PjPjPj/\!PjPjPj.\!PjPjPj-\!PjPjPj,\!PjPjPj+\!PjPjPj*\!PjPjPj)\!PjPjPj(\!PjPjPj*\!PjPjPj'\!PjPjPj&\!PjPjPj%\!PjPjPj$\!PjPjPj#\!PjPjPj"\!PjPjPj!\!PjPjPj \!PjPjPj'\!PjPjPj&\!PjPjPj%\!PjPjPj$\!PjPjPj#\!PjPjPj"\!PjPjPj!\!PjPjPj \!PjPjPj"\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj\!PjPjPj \!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj$!PjPjPj4!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPjaPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj?\aPjPjPj>\aPjPjPj=\aPjPjPj<\aPjPjPj;\aPjPjPj:\aPjPjPj9\aPjPjPj8\aPjPjPj?\aPjPjPj>\aPjPjPj=\aPjPjPj<\aPjPjPj;\aPjPjPj:\aPjPjPj9\aPjPjPj8\aPjPjPj:\aPjPjPj7\aPjPjPj6\aPjPjPj5\aPjPjPj4\aPjPjPj3\aPjPjPj2\aPjPjPj1\aPjPjPj0\aPjPjPj7\aPjPjPj6\aPjPjPj5\aPjPjPj4\aPjPjPj3\aPjPjPj2\aPjPjPj1\aPjPjPj0\aPjPjPj2\aPjPjPj/\aPjPjPj.\aPjPjPj-\aPjPjPj,\aPjPjPj+\aPjPjPj*\aPjPjPj)\aPjPjPj(\aPjPjPj/\aPjPjPj.\aPjPjPj-\aPjPjPj,\aPjPjPj+\aPjPjPj*\aPjPjPj)\aPjPjPj(\aPjPjPj*\aPjPjPj'\aPjPjPj&\aPjPjPj%\aPjPjPj$\aPjPjPj#\aPjPjPj"\aPjPjPj!\aPjPjPj \aPjPjPj'\aPjPjPj&\aPjPjPj%\aPjPjPj$\aPjPjPj#\aPjPjPj"\aPjPjPj!\aPjPjPj \aPjPjPj"\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj\aPjPjPj \aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\ !PjPjPji!PjPjPj!PjPjPj!PjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPj B!PjPjPj B!PjPjPj!PjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPjaPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjPjPjPjbpf!PjPjPj $PjPjPj$PjPjPj$>PjPjPj$PjPjPj$sPjPjPj$PjPjPj APjPjPj"m PjPjPj(0$PjPjPj8# $PjPjPj@APjPjPjOAPjPjPjPAPjPjPjQAPjPjPjRAPjPjPjSAPjPjPjUAPjPjPjVAPjPjPjWAPjPjPjXAPjPjPjY p+S4҉|"[t'!\SsBLF^;.BTh!wTZ%c4mwZsw l=7>i(Q1\~ 1j5jJ #8?^.~VD@7yew kEn3sGzT0Pȃ 0}s/?]= ABrbB,iFlmzZRU; ,l!# ZƧ%Y %qd\?/^c5"$0[.,Cرa =W,`65?qB_aQ %?Sz*ez +,(~jww&(,ĽM^(G u6f5^x6dI p_DGWFݶ+u }HSFNƨ=q(?N]o#h@ ^{N]*HI.WU&co r4Yxatt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(@402#4 (d"d"@h"@&@&wLL@h"@&@&Ptdd#QtdNetBSDAPaX NetBSDearmv6hfA-MQ `10 `aP@@Q  Q/R R^P+ p`p`W*0/W:U d`aXPX`P`U*0/U: .&&&X&&&%&%&$p@-<@@8PPU*P`0/U:p*&l&0H-$@$P@PT*0/T:04%@&A-@TpP#`/7d \P@P+P PQ804 0S 0 A/ʼn !'ĈA-|tx @@lll`P)pPPU: ቈP .P ~㡾ψ'Ĉ !ʼn#!P@H-O-M`P$㐧y܉I帹X ᢹb@Qx            D , BP,  t $po`P    ^p taP \PDPP$PS << pPU (+P 0P(PP" p p`P` `PPp Y P  X V @`@@@P P X% DP U@ X X% P3X;*z P{`pP @P` :XX^9h Pi(&+@8 P]`pP @P` XX$P`N$`pH`pP @P` !XXM ^pt `pP @P` X `XIgIl `p`]MdpX `pP @P` XX--RpF ``@P`pPy P XX0 5p+(`pP @P` XX^^"p `@Y? AQ` p Qp Q X` X  @  ` `@ W  p`d˟\`pPU{P,D SЍPp@LPزWpU )P P g]pPqJ ^pj (  PsPPw}PpU] L]pPpUvWpf Q`V ^PS ` V5P ۅQ  ` ]P@ \p8@Y ]@Py2@LPU  ]p]`PUqS\x唅`V V`h=<3I `''t'p'X'l'h'd'\'.T'ܡ'|'mU )' x''@'r &$t'O-M`P<,t,D  0@QPd@Q)  `l         KPP  HP 6LP PP7 RP    XP"0Aq@-T@P V PX P pRpP0p` R p[pZp8 Q,RX`P ~k]p  uj@P @ `JPZP(P*PQ:p`@ P0xxPpPb င'P  9"$ ` o`T XZ XQ 9/P [ <՝`03I Y 'ܡ'.j ' F!ʊH- 0VϺ렧'ӊO-OM@P]ȣ4$dؤt؄ յePH@ Q' L0XHH<oPfP* iP- lP8(pP$ rP' vP/aP#xdph@DT[8 R Q # QR QQQ LQQ`[i[f[pDbQ +  Px +% PR/U P BB RR/Q  I%P\ \p)P!T|P TP PH [p  P! Tvp/UD 0 [p    Pp `V @ P$P:@ /R @ R@: A0`@/S `V  뎹3I ''''A'''''''ܡ'N'' '0' ًNj /ἴ'O-M` PpjPq @JPY 䵟ԅ Pp@P$$$$$b'  P如 ZU 0` @@ P \ 0ᘂpPLPPZ, P/1@P&P ,0/QV/Q/P@ E0A P:`S   P Pp/Q  PPP ZZpP0 X 0`P!0#0`(%0#P )Xp  P  :  S) Z U  PX : ZC00P%V0 UQ`PA b?2`2P5` PSH S_p2|b Rnp[ P  P' xPS ˁ  EP   P P LP  PPpPU PP#  -PPP CP0!AQ'(PP X;Y  倁p"ZPp'PЍ 06|| |0?~| | ' X   'D . 'uO''''?F'$,' Ɍ' F!A- M0 0@nP ᢚ ЍQO-M-MpP @Y XP, } P RXpt @XP hPX`P P`V`U(@c +4Xpn  P Q4~ @ p`0 {| (  0 pp  p-Y ,` A`⛟xu @`P$KT4# W P `PP  A,0 $0 `    @TP P $D ♹@PighPP $@ Y+(@Wp|pt`{F 0(@(W pZp3 A,`Scs$尀4 eWZlpj P Q A$D0 ,0    7(aWPPzJDPG @Pup P(@ YPL8V Xp @ Q Xp  BWP+W#Y@QP  vXPZ GPā4@P (P d8(W `pU WPЍЍP TPPPP PW  VP PP QPPQ8CXP ``PX Q|WPY@' '' '''''^'cW ''r''m''H-@P 0 <z0U0 VP`0VP `%`P ⭘`U V`VP ♘` W Pp;%U VdVp ,%-PP 4@x`UP` '̍֍'A-M@ `P,%Vp U PwWP l l P BVP @ Cۍ,P Xi ''0H-@Q pPLWP \PP,VP <0,P 0HA0 ''0H-@Q tP&WP `T"PVP <0,P 0H0 ''H- 0x렧'O-M`!V( 弱Q@PO =p$PN `QK   0pPF E 2/`V A $Q B B ~ ' Q'  Q ! Ѝp XT  < ,@@((|-X!((Ǝَ#=#@11=0[(d!H-M0 00  0㲫 0Ѝf((H-M( 00  0㞫 Ѝ跏(H-OΏH-M(!00 0㈫ Ѝ(H-M8 00 0wPЍB 'H-M8 , 00  0^ Ѝ((($/(H-  H-M(!00 0C Ѝ!(H--H-M8 , 00  0) Ѝ((D($/(H-VH-M(!00 0 Ѝl(H-M(!00 0 Ѝx(H-ld@P! AP R0PPP0PaQ8(((  /((H-  h!' H-  |h!' H- u' h!H- n' h!O- MP@eP jp@PE$P 8$(dId 8Sp(H$ I4,u0P: HU$P8$('d@ 08L ,Sp(80` ,$ 0 ,3/ p( L$ LsD< @P C` PR`3VP P#  h Q 0`@J!S#(`1#6/,$@@T "@ @彳"@P Y b@P*[ Z !!80 ($03/Pt p@!0$:`_@?``@ 0 P;$ P_ $g  8!(` `1/ $T\  @@@0``@ 0 `8 0 @`P 0@@0@ 0    B 1/wl@ 0x n[Hޱ3I ܡ'(!' mU '(((r(K8(BB(?((H-  P P> P\<!@  !pP0*B  P`   `Vp  `!(P 81/p!P 8(1/p0(0@11(((0(lm O-MLP DCDpP P g  80( @0004/ @p  PpP/  P`8@< \P!# 0@#    *"; pP̑A '%$  Q` $ fz  O pWPWQP p Rp0pRp r* @" " Ap  p`y Ѝh ЍO{$( L@-MTP @@@P@@@   ᓪЍ(3I }G-P@Up ؁ `'&   rp>ڨqPUꌑ匡  U0,`00P4 `QD@@ 0tP JP!@*+ ƪ  ⻪@ ``⯪lPP@H(h(`(p('UD((@((w!ʖK-pŃP @`` Pv Oܑ wGXP L Pqp>(?P  0MPJPpP LR /0` ``0`@@F啑 dd0`=P7冑 ((! .`(p(h('U((w!0H-@P@4 0  @@0((@-!Q ! 0P@R00-0 BRP0P0#0Q @00QQp 00AQX0^P,Wt(( 'H(((H-X P 00S S P RH(f!H- ? IH@PPPP P/P (7pP p tPl`P GTƉL‰@k`H((x( >p(' A$p@-@P cp|P``P H`dd p8@>卐0$$ '4pp(x('!Wh(`(0H-@8P 3(PP Hԇᅦp(x(H-DD Snp 00 P렧'(H(|(@-<<Q@ @0 0AQ00|(|(////O-M Q@` V VЍP Q3P봀` QʜPAP pP  0  0ToP5PJ`PU(n(((p@-x@xxPx`t t0````>`Pp<p L(((((((K-Pp@Q؀ؐl  OP `QAG喏 ``1X>P0((((('Uw!O-MPPP TTcTCT#XX pQ0PRGpPJQY   PJwP  R R `kPzPpQt" @ `P PdFH"PP IPf H`P,P(RB  P0,00@᭄PV !PPP@`Z " x! @ `\PP HAP3JBpP*J 8  P'JP @! `kU5  ` @PP PPPpPJhЍ PEp`寎 KXpP`  0( ((((('((((Uw!H-HL0S0 P0^(((A-P x xPl 0N^`pAT V@@pW`@V@@P@P(((A-@!PPP <`P/Jp!P'(0 ¦`p dPXX ⱦL`@  0$, ⤦  ('(!͗O-MP@  r`2 p P 챟p@@}pP&̡́@P4 `T ` l@P( PhN) VpPW#J@ `pTY WV蠟PP T P&$ xPETd 0pQ0W00 pT`R`Ѝ(((((((('O-MBbܲP P@P6Pu U0`/pZ Z0 <3  ςPC $2 Q `x`F P  R R0,P0p0埂P ``PQPKY  ! P00* T@Z%   00 0Q R P0@ `富 @@J8WЍ((((('U((w!A-@P!PD`=`P  9P-Jp!P r $s0 'p hP\\ HUP W0(,  P('!=%O-Mp`P @W% W#Ƞ@P& PWPP P PJA@P*`p P,P  Ѝ((((H-|p@P`T Q k@DPpʘ $$₤('UVO- MS`p@p PW%@jP Wژ吣 W0 <` TPo @L@P`} `@p Ѝ@  @@PJ肟GYPG`UG P PA p[ᘂ [ ,pPm `T P`p  `0  U4 @P, KY K@vPPZ= أ@PdN MHG ` Ep[@ 8a [ P 岀 P 0QP @! ✣ xx␣pPED@ 9^(((((('Uw!O-MQ䱟葟࡟@pP p @7Tp`@`` R R0,p00EP5 pQ(A <`@ V 2偊 *@`TЍhh \@P0   렧'((((((Uw!hs(O-M`@P PT prhlZ ` AQ` Ap Q; P<8[X B` A\P`  @^RQ'p QpQXX\X\(`V  *P 1p @`0AQ`0QX8X X 3`0p &Q0AQ`0X X X`0p Q00AQ`0X X X`p Q00AQ`0X X Xע@TPyH` AQ` X X X ĢЍ腘 ''+!O- M PPr@o䄟T씟tട`@ ᶚoPp EP# SP`xP sP# pPAP -P$P` ``  0`@ MP  P   壶`P"QP P !PP H~AP,P}nAbqP "ᑡQ XPPJ P P-P J2 P*JP l|pPTrPB P>-A,jPP) P`]`Pu u+ u AP dPPA@PP PP01 #m4 㓞P# P0  pwP !P^ h Xdd ((('(.(ܡ'`(((˜(U(' (((((Ә!H-MX @0H o@P JP(%@"% P%@"%Ѝ(ht@ ' 'H-$Q@0 E ((H-$Q@0 z ((0H-PT@P !P 8 P /IP  @0(D A-鰀@P`PJp 0  ;R,R ;Qp R R  Qp(((((O-MO 00@ P  00@ R @p=0G=SE`4TP@Xt܏pܒP䏟P8  W !WWP6 PPJ` QpR nR lRg   `Qt 0l0CS  QP`PPJG@oPyJVW`GWq`PpQ nQ lQc`^`pQ nQ lQa`@Q$`pQ nQ lQN`Q`pQ nQ lQD``pQ nQ lQ5`"PP J`PpQ nQ lQf`0PPJ`PpQ nQ lQ_`/ R /P R `, R@ FPP p`PpQ nQ lQ`+ R@ %PP !PhQx`pQ nQ lQ`_Q ` pR nR lR   `, PPrJ`PpQ nQ lQ`P P` pR nR lR   `d UPP@J PpQ nQ lQ  ;PP&J~蟟`PJ P XJ0 PV X``PpQ nQ lQ`8  PPJ PpQ nQ lQ PPJ PpQ nQ lQ @ <PD$3PP p`PpQ nQ lQ`P`0 A R* P N~P "P= ` QoQ Q gQx`pQ rQp`` {PPfJm弝p P_J P XJ P `pPpQ nQ lQL`,Q`pQ nQ lQk`Qi "  .PPJ1@PF   }lP9 "P` 4 ` @P  P ,P  倜' P PH wRPP 嘫E PFZL L PPJ( ` P 0`qW`P`Q` QP WP P Px p*PJ)P P} P, $*PyJ, 0RQ Pf PAP PT P )P W  QGpxP P:4 ,9 P P2 9 P P*8 ! PpQ nQ lQ (t' P P x80S<`P PVGGGooPPQ Plq) P000(0 P S   PP ' ( P`PJP( 0l0CS  PP P P FQs oPpPJ P(LL PpQ nQ lQ`P PfQ o%EşP0 WW HPYJPILH@ QR XQ Q4P )Pn"(P PTP!J PJP JP!P  1P R Pp@@PJn t$0@00;P PPP]   P<((0T[ $Py #Y P xy#Pj[  PJdQZ  " QpR nR lR  k  (PPJ`PpQ nQ lQ`P PwP t  }!P  o oRQLPP^bX ^qY  P Q`AP P<P D` PpR nR lR   `(!P  @o oR~Q| P P P *'GP8V <3PЍ`P((((((~!*(! 'ݙ(p (W=(f! (((ęn(((.( '((U' ' 'K-P PP`P `p@P  0PPJpPW@@((f!O-MC儳S `@ Z  @ Z A8 J6Rs0l\\\\\\\\\\\\\\\\\\\\\\l\\\\ \\\ll$xxxxxxxxxx\\\\$v y`Pek"Padd1;Z `!P^.Z `GU/Joo[`PPJ`Z7^Z; 0 @ S @%^Z-Z`$ ypP"P g^Zp-Zp`b`PJLd P VJP<0`Ѝ`(t'((((f!O-MY3 РаPpU W pWppW `P @tP  0  0`P pW Ѝ(((H-4$Ht'8(2O-Ma圑q嘡@P PP>  Q PHJ@ <PQ Q:P.Q$ P! PT R R @P UP  Q Pd  ЍHP ` ((((((('H-\ R PP < <0PP( Q((((f!O-MP`  P! ̰PEp @P  @RpP@ЍS((((((A-M$R R$r QDbL  tP] @Q5j/ e @  00@ R Rd@2@P+ !Q+P"J  %@ 0 S0 0pp pp 0p WP@@Ѝ PtFD~ pp.h;@P@ (t'˜((((('Uw!K-(a@p W\tP" PQ/+ ,BW G 0\S0S0@ Q  :~ \\ՖTP,e(((('Uw!O- M@`Pµ@ P1 Ă弒PP p@Q Q @ sPe T"Q@H  ` P`@QQq Q @ ksPH  @R[ Zt `]PIJDDATQF P  EP  Q) .P*;} %2P,{} |#P T @ Ѝ(4(0((('Uw!((H-P D, aA1S000t'8((2O-Mⴱq崡嬑@0 `PPA`U P p`@7 P P P P P` P-&`PpQ`p PB@€@P jd Q8Ѝ J((((((((H-Q:p@0 0S)  p#ʤ=P `PP unP @ᾆP/P /0 0  (((Ia H-4Q @0   (((O-MpqP@`0p`PV0Qp0  BQP?Sq0FPP$ `U ` PP P@HX@Q P<ЍK((((((O-M  pJ LEpPB <`P,U P ` yqP $Q`''尔P! !Q Q %QQ Z= Z, `PqP 8$Q`+,% XY pU U ,`2qP #Q` PP \R  PLQ p`Q> Q ` pPl "Q`,& rQQ  R& R< `pPH 8"Q`,~~  A Q P A Q   0P Q:;AUAAq  U0,`00pP `Q' DA,z {Ppz jwP @ P!@orЍP<"((($(( (('Uw!(W(((,(@-@blP 00z '蠧'Uw!@-H R <0AT B R @Q:(8(H-P  q\Ro MH-M (' 0 0ЍH Ѝ/(H-,! P P@?00 QQP@T5@1<@P- `PpP Q5kP @@ zP d '0<㓎fq@ @ y 00┒((n(((('Uw!PO-MP`@ P @P @\P [Pk@PR PQ  PP\`DVPP@@  V0,p00VoP PPpP (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx2& @P"  0ЍOBAy +8PP X  ('PЍ(dA (((('Uw!(H- ʌ^R ]R[Q Q]Q0.CQ    R  ]RQ@]QA-pPPP` VP2@5PP- PP%P1 @RPP ErP"P 4PgPP((O-MS%P R @PrTZqbr弲@Z Z 0 <@ nnP{ `"0Q@ `@`@ \Q  QQ o PP @PAP P)P P `da\  T0,P00nP PQ;; @,*@P% ! Yx P Kx xPHЍ @@Ls((((((('Uw!(ęO-M @qQ elP 0p`VaJ@V. PVJx!p@`P2 @V  `P$ T@P3"AXh 0(`PZxPl 1  VPJЍ((((((O-Mp`PU  P  01 @` 0ЃP D `@p[; ` V8 [䓟䣟 [< 0p lP pQ刓pP  0P3 \ @A `pW W<0  lP Q ᠒P  0 #  0PnJ@`pQ Z Q  0,Pi `@ R堡報 R,0p00alP0 dpQTLHV  P (S$P  0Jp Z  :v $1P ߍ)xv ``X P4 ((((('Uw!{O-M@0Ps弳弓弃 \P0 &Pe `PD R R 0 p00kP p$$sQ VhE 0P @^1@Q20@P. bPD R R 0 p00kPl pHHrQDV1E 0P @' PT T 0 <p mkP> pqQ UU @JPf8qT0 a   T0,P00=kP PQ**"8u "/P *yu pph!P@@Ѝ(((((('Uw!G-ؐPp`Pd P Du ߍ#l\@q   0!((('Uw!A-PAQ  1S@pT `el@VAQ4 40$$ 0pp 0(( ' '((O-M✢p㄂ptRd"d2P`mHPK0Ÿ0 PCpa@FT:V, V<!0 0 1`0'Q0C`!P PP Q!0@ !`PP` p`! 0 1p0``Sqp'q0P 0 1 0C`p22@@@ 0C PʔP l0 0X0DP LЍ '(( '((((((O-M`@P/P`BP#\prEQm*+pIbr㔒ㄲ CePrPf@PT4L,KPLP PP@sP vP wP8FPp!=0`PE-00 X! R R$q,1 aP P PI  N뻉@Q +P  P?  㥉 +P  PPP `P %PPጉ< ᧼뱹!($( (((( ((ܡ'%(P!' 3I H-K 0o렧'#O-uMM0P`P U&  + Q P $P0 P*? ?$P  2/P, 3Q+P   P \P 7+P   P PP8P4 /P "+P+ '   P  kpuߍڍ@+zP t#@0唊*P H k*P`P $PVr PVD P( )/ P /P @@/PppP D [G X Ta  @ \$c 0Pc )PC0pP   0 ᇊqX-尀 @P`Z` @PKp P YPXP   P)c*P L   0pG.NNS*PeW  O.B*PT 8-<="#L H-L="#D4  Q ( (L|' (b.!(ʚ֚((' ($(%(\\\ \H-XX0Dd T  V H H0S \\HH-XX0Dd T  V H H0S \ \HH-XX0Cc T  V 8 80S \\HH-XX0Cc T  V 8 80S \ \HH-XX0Ee T  V X X0S \\HH-XX0Ee T  V X X0S \ \Hep@-X X`p@tPp`t0 T  V  p\\p@Pp@-X X`p@tPp`t0 T  V  p\ \p@:O- MP@Ǡ43p`%P  pV)PPp`M(Pf /1@GQ(Ldlx L`h$,PXhxş%5`utt\%00|ş|%(54u{`` 0o mDkige@$000v `] |Nlğ$T4tq^I<tt   PL4@pğ0$s00@ß#3s93sß#+  ppX#000dX@  #0000Ÿ#2s p2"PP xP w\P\"\r`qL\"<V ``QT"X2p `W `P `00 `0`\`RQ X /PQ P P P&"P P PP dP | H` \4` \RX EQ @Q , Q !0 S!P  F Ѝ63I 8(ht@ '0(4(<(ݛd(h(((((((((((H(D((@(|(x(t(p(\(l(`(X(P(T(L(ܡ'Y Dp(( ',(H- ⩇"렧'O-Mp@"P Py P`EP ЍOpPbPR A娡p@PD`p``p$ n JN1LP \.PP$ PP † \ 0NP 巆SPX  pP9@F5@3PЍ@㷷㴷`(l(\(<(((?> ,(F! 5S \ S \ \  S / S 8 RL R $ /` S \ l((O-MQ `VpLPL(P$8<4T HD@ @0, ` PP $ n \MppV \.P PPp0PPLPP X`40@Pptp X  R0RD 40R3PP @Px0P|,pD  U  R0H pPS H * ) R,p0P( 0   Ex `B? 0`V1@ oP |@Q @Ѝ`P  Q -p(D(x(3I D Kt(|([h(d(0(X((O- xߍڍ8''y)((kx)'(x)ϭv>D -Pz) A-~MHP 4PP,` @~,P~܍ '( '0H-Mxx @P`P 0@QJ 0?pʗ q5@Ѝ0(( 'QH-PPT4 4Q$$0 4((Pz)x)qH-@P`p Pp@DPTWH-@P`p TPp@DPTWp@-P@T0 0`]@VT0 0T @  T`t@HH@ 4( 0 4p '( '('x)(O-M−@T|`pP  @PpPE`UW@T80 @  @Q *tB P@O4@lP4T  0Q*J P0dPZ#P P P tʬP P@@EP@@T JT @PT4T tڌQ  Q llp@ 3 Ll@ 04 D4Ѝ ' '(#((y)۠'MO- Ml@PSTPO LP\F0P(!00 !pW* 0〰PPQJ[PWpo ` 0f [0QZP Pxd `   PJ8@u3 Ѝ '(8'(((( 'ml< O-MPpPPP<PU8찟P@P2:@ 0`PQJP 0go V 0PP0 S P  P( 3PPЍ '( '(O-MMP`VJP@P PrUD3pV C `p~,Pp̲bᎎH/@@ pgH/@pt ~,zPr@ `~,rPp\H /``pB`aW ᧪WH/pcڼp`@UI  0X$4! UC lUPa 0q! P 0sH 0P8x`p!!``pq     2p`pߍۍH qp08 0 2 '( 'mr x)oС'Q,O-MMD pʪ($28 pʞ#x2@PPP ЍۍcP02PP P pWWNP 1\2422 2P0JhShchxp{@.P% P   㘽P  P$ 1111PZ*PtZ1@ @b<<2<W 1((W1  R111111P6J̑QAp{.P- P QrPYP SP=yP  `4p3d1sP. D 1 1 }1{1y1 1PZ @ @0 j1)@P jSŒX dP @U1?@@1Xz)Ǣ(((z)Pz)( ' '('/zU8'ţ 8`Τ '0z)-TD ڥ(d@-@(p )p<'H-@㞼P ,(X 21((H-p HH "1誧@-@Gp; 01@꾧p@-MP@p+@PP NPP  P P ` p   P `@ЍpO-M@PpJaH0/PjJ 0/PeJ@YT PTq̀㸐  X @Q @0`3/P< 0P3P2J$!P 0P)J>P$J/P PP, q 0@  0PP P (0/D )Ѝ k0y)('ӧXz)O-MP J!LL0# pW@pLP^JQ倱pLPpWPC GP@JY@PG 4/`PJ  2/pp(PJ  2/pPJYP /pVpF  @P/L 4吲" I Ѝ' '(8'5y)ZO- MⴡApp`HPP'$ |2/P @ R 80 3/PP Q? WP; M/ Pp[ P P pWP 3/NpP|(/ Ѝ`R X<1/P P,/y)(8'r((O-M`P7JH0/P1J 0/P,J&P)JR@lPP \P iD&C/4P $PJ@SP (0/, `Z'Ѝè㸰 p @P  @Q @0`3/P 0@PJH P   0@XP P P  P9 dPJrPJ " 00 @/P P@V 88 ]P P P 0QP^PfF e PP Qf tP P@Q:P P  L @PQ @PF @pf @03/0P@, 0PPz | @P m kF  RUG  R+JPQ6P>F =  0ut("PP p @P E A<)  0 @P"F  R.G  R# @jq0S 0@( PP $ Pq8y)y)<'y)(y)z)z),z)(z)z)y)0z)Dz)L'Xz)G-AMp/@P P`P:P 圀p /P x 0p-PP /P PW( 0n-Aލ((( O-Mb@PPXJUUNH0/PPJ 0/PKJ̡P !PDJ X "#P=J嘑  Jp|NP. (0/P`!P J$(AP C@P   :@ 0@,ЍP帰 EP   0pUP P P !PJX "PZy)z) z)z)Pz)y)0z)(8Xz)O-M⨔p Za P.J `P+J,0/P&J0:PDP "PJ(d P W 40/ ` RP t$ `ЍCPP\$PJPU PP !PJLi Z % PJ P a.   p (Pp@/P dP   (TʜP  p  @PZP"01,H i P (@PP P 0g1/pcP PP/  @P #   D03/p  0P,P  @P   mo q  doW J P PJ  P P J pP ,@ L  F y)y)(z)ʨ@z)z)y)0z)(Xz)z)H-LP  P JPJ(H0/PJHz)y)O-MMUp{`   P `+Ѝۍ@ /PY/P /@ p#   P'`PJp PJ"PJP PJdv P  `_  #G P0$`(+04T@dpGP ᰬaP(  /P P * P:  PJPJ ( P  p44  P` P  "Q + QP0P7F 7+.*PU @Q:P PF p 6|pnڰ pn hmf,F R G RzPtQ0P7F 7X!0`*nprPf Pb  @P   mOF R] G R4  $Hz)y)(z)z),z)(z)z)y)0z)(y)ʨXz)`B0H-@P  R ~ Rڼ~<  <)0lll0 pNPJL P@D0@P  0x)(x)y)'(x)x)x)x)@-0@ PR ~ Rڬ~<  t. .W@ P0@3^@A  Q :1>A0A TQ:0AQ*@/@-Q0E\ 000SQR%  PH* 00@C TB"N/ A@CTB"N@ a@CT1B"N`   \&  P"* 0@0T00C!\@? S 0! S@"$ P: @-0C\^: 2>! !W@ P0@3Q@N  ^ :1>A0NQ^:0N^*@-4@Q@ @ z) H-P(@$q``Q a` S HT`U4`-V$``````V ᑹP:VHaW|p``:PXQ! 4``,, 0^?`y).ܡ'y)t']/p@-`Pptt P XX@P0 ^P,,P y)y))'XPz)O-dM/PoP `o @P   0U0@JQ_\l<|L<ȓ <Ē|Tpt(08 ГTԒ[@:PP /0 !P4ȔؔdqQprPaqQ[6PڀOqoOoy qQg 9_30x)|%KI\L<,- 0 .( p' Q"*P -QQ= ? P P  p po/0 p'0X000 RQ[ R04/0#Lp'"P  唯N`Pp/  0R /PS0BJPTTș,H̘Dh\t(0XؗĘpph BP 琗ȗ R   i `{ `v  `ot lRmR oR pRaR eR8h,|p``y)y)H-`pW \P@PP` P  VpWy)׻U'H-d!PQ! 0 {@T @1`0V (10S Q Q Q -5PP0S P0SpnP `P/`ž @/Q @4PP/y)y)y)H-@ `p  W P 0/ /P~P pWxoddoP`8pP ePCSUSy)y)y)K-P`>Q%?Q( [QS-QJ  ! R/o `@` R? ]R# p-W pW]W Wpp#R@R*QSSP Q! QP P`*P P P  0P PQ P Q /PPy)O- MM PP `@.T.Pq PpT Q@@QP.QP.QP/P] P %@  PPT R P2 R @  PA Pr   PP*Ĵ帒帢r@ `K lP ኽ P  PZP/P wP Ѝۍ .P P P  @P 1 `+ʸVZP P 2.   +c`apW7 @/P PP , q@p.WP pW @ /P P  P P  K @ P.PWXPL'8y)y)Pz)[D  :*ay) O-MM@` &pP+IX  @'@P(P`'` [h 0GPa V3Q V* V3W V1: Vr P5 &Q \Q 1BQ0B P@Q UQSJ@PT IP.  DQ \R\&R Z:Jp '@` VBp+ P ZX  T D Ѝۍ V*' Q pP P   '0  V ` P' P   +'{' P <<'0 qS  kSy)'p@-@P` 0PJ Qp   0pp0H-P@P/TN@N TT 0@ U:UNAQ:0Q0N0茽H-@MP@.j`X0P8<0400P8<0400P8<0400P8<040ܱ3s|ßp tpt, 9pP  0PjJ *pP  !P[J pP  PLJ  pP  P=J pP  P.J P&J p P"JqP pNPP p ZP @PA i!C@ЍdAѺPP PE/Q }+`,V`  U ȶ   /00B B 2@P-  P qbxPdP㞂y)'uLz)lXz)P8'P!<'L'y)(y)#(Yy).}@-hh h0@`TiHP b|0P 4_KO0z)z)¾x)z)H-< +P 0%=P\CQ] PU hP  P#=0<BQH 0S  R> F:Gʁ PU U" @``Vp``Vp%' @` `Tp!``T @``Vp @  @``Vp @`V Rlz)/>3pz)tz)A-@PI `PVE qP= -P7 #V \V `#P` P`)P P!=)pEaV Q PO*P `P@ 4  lz)/>31޾A-@PI `PVE qP= -P7 #V \V `#P` P`'P P!='pEaV Q P)P `P@ 4 ? 9 pz)/>3TH-P `@V /pW PP`VXpP0 F R :,VU .V+P 'PA`V)P W`Pe bRCR MR mR cR/pP KR#0p Q LpUP R  `` ``0  (p RP 0 .4 .  8Yutz)xz)ӿH-0@PS# p .SnWpk0S>`W _Qp!@n>`pL@ QI 4444@4dPP!@k@d  P!@P!P!@ P!@!@> p0 t'T*0H-@P@P  ,P @0z)O-MY; CJP5 \2:BZРL JaV p !  !  p`P @j(P- `LgP% @  `Ѝ   + A P Q --- z)qvH-Q+ C.: R&: R@̌@D@% L LAT 0B  P "P%  `$p% "  @T-H-z)qvK-`P p |`AT Pt-r-@U`V z)0H-P@P G ,+P ll `PȉXp  D ꐻ0$ i @0z)y)!y)P'_4O-MMAQj pG P ,wAT `P K ! 7  P5  ᵸP5 @T u'P A` 0+QJ P* 0F.*p 0aP  @# x   F @ 0T <@  ,Ѝۍz)P'H-M@Q0@@0@!P !Q @P`0U0B`Fvp@0ET0E^  `pppW: @Ѝ0H-@P@P  B*P1 @0z)A- A`P%  ,@PqW P p &P) peP! `eP qPP `PP /,eP ,&,$, Pz)uHH-lp`P @P ,[qW ᾷP p 3z)0H-@P@P = )P @0z)H-B  PM-`@pW# P!=FP Р+0* R /&P  `P@q z)/>3 O- M⨲0S BʀCJR`u%s=P\p@Q000#0 "  U `p'`&p" PS0 R^ @PQ PXZ %PG    0  P "> `1 0(=@LR 13'30H1S ` p'`&p 00 0   "  LP@   Ѝ 0   %P 0p p ``  z)/>3z)"0H-@P@P = (P@0z)XG-MlP =Pp aV  0 $@ Pp(` Z Ѝz)O-M`V9 @L@8<@P!=KP ! # " # " (0@ %P p cP P @(q $Ѝ|*ЍO:z)/>3G-^ @D%C=P\@BAT $ `Ёp)P(PPЀP) p(P (P@U(  F*D*z)/>3/G-MpPP/P` `P$ ($P p~cP @0 @ `P Ip0H 8 * ۍy)z)O-MP@T) 嬐嬠`pP$P u  p p~P ))@TЍz)8z)D'@'H'  Q /z)H-l0S ^Q 000SQz)z)@- Q@P d  :P L<q 0D @荲')0H-@P <P0 Q* P0PR PT 0O-MP+ P`弐@p@PP P@PL 0<, ,00 0Ѝ`sj8'z)O- M@Ps`PJMzI( KAQ:D"D2P,",2   d  l , t 0 |  tpe EjFG  㓭/ JQ   1Q 2Q  KQ `LQ /R5Q  (,(  `  ` 0 b<      b ,`/Q``@ Ѝz)z)z)z)p@-@ Q PᎭ`V(peRe #p@聭O-EMP j@Q |$,`4<``eQ +@Q@P@dT   p d K@Q:P P /@12 d )0 | 0  'F!@p\ziЀd@Q :!P.1q0PPAP@WP@Q: AcA0 µ,\ ql@Q :!P.1q0PPAP@WP@Q: AkA0 㥵d0\ yt@Q :!P.1q0PPAP@WP@Q: AsA0 ㈵GIpD: @Q :!P.1q0PPA@W@Q: AA0 i(\PP eQPppQ :!.P1q0PPAWPpPpQ: AA0 @1 , @EߍI Ѐ |pQ :!p.1A0ppApTpQ: A{A0    h,'@PJPJP P@vY:z)y)//0H- Q @P x\ 㓲P 0X ㋲P HP8Q0  0HVꍲz)z)O-MP@PJMInj㰴( p |Y!R  +ݫp/  KAQ:`|#|3kF@5`#`3  + d  |  "p EFzGj  H )n Hpt ,kp   (npl  mJP1 @R0 h8LT  ( cK@Q:gPxP1xP!  ,`Q\QE KP    `@   1 ,  I  'PQ  !&"&p ( @ /R     <04KP4   Ѝz)z)z)z)z)L{vO-MP @Q :P P@P# dPP  @` dQ.P%Q#d@ApQ /Q @ X+TT }lT Y  㛪`/ P%   }U d ㇪0@ Sc`2 375pd`,HH(1 vX 4H ` &tOI@ XAQ :!.p1A0ppATp@p@Q:& B0 !&&WQpv0 @`qQ :!.`1q0`W`A@p@pQ:P& B0 ! ,4&0I0`< f  |QW:!.`1q0``AW`pI6pp0| 0 㼲PK d h``@|Q :!.q1`0``A@`W@`Q: A{A0 㙲, $p`pfL|Q :!.`1q0``AW`p`pQ: A{A0 r l @70 r00F<$P !   0 L`jds`Q :!.q1`0``A@`W@`Q: AcA0 9 x#e,l@rlp{@Q :!.p1A0ppATp@p@Q: AkA0  #E0LpztpQ :!.@1q0@@AW@p@pQ: AsA0  |"&!@Aq:P@@Q :!P.1q0PPAP@WP@Q: AA0 ұ "0@ߍP0 maU P  6X)`  6\PP}PP@@Q :!`.1q0``AP@WP@Q: AA0 ㊱  }B@PJ PJPP p`3 P J @ yPJP P@z)6Vz)E~vustay; K!y)3I z)A-MMMPM `@B  P+t U UX K<0 wMލڍ t!z)z)%0H-@جP P 0HH-MM A0 S0Q \!@ 0P `.p*V ?V.`pp\pp0` Q0/P @05C@P$J P0(CPJx @0CP JL @0C|O@Ѝڍt'ozK-M-PP  CPP 0+0 TP匀`p;P @ Q 0Aj`P @@U mЍ蠧' 0H-PJ|@ltPP hl\Q0m<P 0  00z) z)y)M0H-MP@ 0tPP h TL0P PTC D  Ѝ0HЍ/y)z) z)0z)'Pz) M@-M@@  0P  COЍ@ Ѝ/z)p@-@QPH R `A P  @@ߝP@@pz)Mp@-MP@P0`P X O tl0p `B CTH*@ B 7 Ѝp@Ѝ/y)z) z)0z)'Pz)0H-M@PYdL)\ap c;LP PPp9 P5* 嬡P& @/P".P)P+p &p 0#" 0"# Ԋ@PsB@@X⚞@?$s3I $ ܡ'P!'rH-Z dB?렧'O-MP@kYXp(Lg\L :eP qPrP vP xP0 VPPP RP fP iP! pWP dPp p |`VdPЍTQժpPW9 Pᅪ@Q  /Q@ pPP/Q /.Pp.PP .PP P ZQpWPTE?=DYn,PU  e0再p@JP Q PA P PD ?P@ P< !7Q ( s. Q4$ R$ $ R Q  P   P  P PP P$ CPU;`3Hs P0p YWP@ 㾠P4@ᜢ SPFPQcb貟p@ Q <lPh X Pb 㶥Z8Q X PP P P^ P 2$QPB pQ( $ 8 PQ+ P- (P$P% P?P" Y Т ,( DQPP BPQP !pP}qPP  aꨭP ?P Ph$qB'D0 q3I z)z)z)z)z)z)z)ܡ'ez)z) z)' F!RH-X g@=렧' /z)G- M@P Q@Al@P$P"D`P2 P P- P( CP$ `$2P `~jP @Pojp P Y@ob ЍpT PP WP4`4d 0?z)z)z)4,!'3I O-OMM`@Q  p  P p P}P Ѐ # "!Ѐ # "  P{pP 0㫣w pgЀX` XPzp X PXP 0 <ЀX` XPzp X {PXnP 0TЀX` XPzp X QPyXDvPq 0*iW WXj`  HPR  rpWPIWFPA 09РZ{`{V`: ZP `j PZz#pp`gP TTpp- ֫,,pp#Oߍٍz)' O-MP@UL-%p@a@ C7vPppPpP?P4 䠟Psp!PJ$p/ῴ`P PQ P Zp P1/㩴  ` P ;3I z)ܡ'' H-V O>;렧'K-P3rP  pR吐G'`;`k; f;DG!0 aS P K" A{){){)H-@Q  0Sdd`P@' @qW tP `pPA{) R 0 S$A'  A/A{)p@-P@U  QX`~PP Pp{){)H-lP@hp`Q `'VPP H{){){)H-@PQ  0S``@' D @qW P pT `A{)@-@P@ЧK- aK@:P 1S ppW1 0'PR,PP 80 Tp `u_c AQ ]`@T K:<{){){)'p@-d`P@Q  R @RP'Up{)O-M@/BQQ? `V; @P =㐗P x ^@0P p _b AQ {] `V( ^EЍĄ)''0H-`@AP aP@00P@P g @ p Ą)A-Mc@ >3pPPQqQ Q, Ql&]Q] PAU@l     ,          8 D`lPP @G ㍡"p|2   Gp ppH0B4 G@ @L9R 剠p@\^QO |Q[ ~QhpG$OQcpGN =RE H G <0&S= GpG"8pG#5 G- 0R'+S'+pG)( 0R(-S! GpG&=P& <P& G =P >P  pG% G0=S ppppЍ0|S     {)t'!{){){)VH-M@P9`PL6P  IRNP  )pP  #pEPP@@@8PP8Ѝ{){){){)0H-@YP )RR0{)H-  `{)9A-P$@. `p P Q @ AQ ʅ9T@Q@ AT  Qv9P`@ Qo9@B8@@v@0 0PB]o3I '')L)' K-0M@pЀ,(e`TV F P :(( 0$@P0ЍN@PWV  F008@P( `09 ^{)Q^G-@P넠 %Rpo`#U&P`DW@ 0W J{){)@-@Qs@   0 H T x        Y # qV PL 0᧢^R R ^" #o( ?@ d2 0TQS?@2 dS TQSQ!!R .," # 0Zp@-MP`)_@`P T, TP@ K@PPP P R P    RЍp{)L)'i!!L!K-@pPh`P7LY@0 0{){)K-MP@#` 0BS0P RpToo "WpP 0Ѝ{){)K-(MP`@p!PW$WD W_ WX 0p~'GP:$W= "WA#PukW9 WoUC ЀEVeUFaP'WP'pWAp&P <8FT 0o᠂; 0/Ѐ 0(ЍK'FPvU Ѐt`'V'VT P7 A\ (Ѝ{)Q^{)O-M8ȰȀP`pB@ <  0?@ DR0 0SR* @Z 0pD`PP PЍ{){)!O-MC=peP P̂@T& `V pW P Ppߠ5` E E)Р#*@0]@P~ .P.PP/P]P P[ P`p @5p  P [ᎢQ pp*XxP Xp85  PPA Ѝ-PP`P@P@@,  ,'YĄ){)ui{)a D!\p@-X`@PpHP < 埖PLP 4pp@{){)H-p`@p0PPP $ V t6QP \\Y @P(P sg@{){)'{)UO-MP|sUQ$CP lSPHP FP  Z Z@ᮟv4Ȳ(b@/Q PQ P@Pʆ5@UP U/P@DpWF 8R8 PQ /Q @mP P+  eP& @PR5@/P @PF5@Y\T1T   t/R@pWT p@g^5p@P5@/P5@P`P Yt3x  Yd Y@PDP Ѝ{){)'')D P!{){){)@P/ 0RS /S  00B /{)0H-M@P P/Plp p 0#" 0"#oBލ0P!0H-ALP|;pPP2LUi7PP0P$ @#W! !V AQ V W0S(%#!$ Ą){)'p@-@ \,3`)~P e3"P P3` 30p@T3TpԢ#P{)H-$Q  H%Y H{)%G-rP`V lP XPo`Vl P @T7 \T0@a DR03(44304843333333@4333H43P43X4@3\T1 0T `@ P0 BR6!Ar@q#\@` P,  AQ V `V@ @ @ @ @ @ @` AQ U @`@X  AQ U #V! !l'Y/ dH-P I{){)H-MP |l   DP 86P㞝Ѝ{){))' MH-M,  0 Q $|)@-000@Q#V{){)MH-M  0 H- p$|)M0H-MP@ 0坡 p@-`@P PQ:Pp RL V P  VV  VT JVTJ p|Vx@ AQ U <00 p@VUQ PQU'{)|)'{)"!' 'p@-@P`> M@-M@  0 }@-@w M@-M@   Ѝ@ Ѝ/0H-@P 0Ht MH-M   iЍH Ѝ/ a@-0P r R P  R @ >V@\!{)j!  0/|){){){)A-P$@0 `p P Q @ AQ 2T@Q@ AT  Q 2PPQ2@0@(|)'')|)O-MP @1 !`:pP P` @U ^PZ  P d`P19PP! 0V(ZЍP>p>>>(=\==>>>>??0???????????`??^`P ^`PPP" ^`PPP}lP Q^`PPoP PU[P0U`aPa``]P {QO /P mQP eQb9hP \Q0`!*(P LQ P CQ9TSP 5Q ``3o` 30 0P RPTP 6 ЍP`P^R'T)|){)')G-MPPP !GRRpW A ` MpWpRd'S p`FP D@KP R R SP6P3 -@p H`PP  lKPtP P RPR,RލF{)'L)@)'%{),|){){)6K-@p{PP) !@GmRkR`V Q KM`V^RWZRQ AQ VR RdQW'`Go"Q(P W' zPPs'PWPP ]0H9)PP JWPP 00 FQ8QK=R'L)@)'{)|){)O-MP@`p^P3P耟pP QP $P"  pP P P^P PP@Pp1 pAЍ{)'{)|)O-M@葟 ^Pe.UQ`p`pW  rP `!00[P p paxP& X=FjQHhQ fQ AQ cQ =Q AQ TQ Q S;^PP P P [PP, @ .Ѝ'|){){)L)@)'K- MP-a   p@W6 P2@PU   P PUpW P @PxP^P@ P  @T P^pP $@@- ЍL){)'|)O- M@P ꀑ3&pPW7 ``P p? R &PPP VIPJIyVJ`pWP %'` RDP ЍVJ띜{)>{)|)O-mM\8/? g0-@_ eT  eopP  ;P  @T pcW cO`:P  pW !P t,Q  01  ?6 <R PP<AQv DOQU2 ~=` @  AQ ʾO @@ᬉP @ P AQ ʨO ``OP @UQU M`  AQ ʉO `OP `U @T P]`v XJP@ `T M AQ fO OZP[ PK L`Pp P8PU<p!RI001 \ P @pP`@ -R -RQ ` pV`pV# TP@@p\ W@ 8P@F0 Z80CP xph p\Q @QC*p@P<P?P PPX*MPRzT$d| |]p$&PP d|!$P |JP8 |Pxt*d P LDP  P P t xG@Q *ipP d%P @ LP}D됹8iH $ !1pLɟ B  p D  [PP `PDBPpPHP@XP\  lR A QxPp%[ pAX[AU D ' 1H\Q FPP 1Q< HdH#HP3 1Q  -Rh -R RbQ\ Q[P PV `@HLPTDH (@P p_ ` @ <\TDT Ć`@APZ @!\ YQd|!0 `#d|!0G$P0zP |||PP| @p 00|0@H+U`@ \4SAP @@PK @PJL\8@P pPXP dD48 BQ| :CP0@ RP00D0dppp`pppAq!ß3p p4/c@P p\N(#3 09N4P T$D@@ Q  H4@p @P@Q+P)  P pP ~EP0  0 A<P <) Og)mߍ$K@A QBP P B@JP|OPJQdqp18 p `pPH70 20HP -EYS0D  p(p`10\pp0 [@)ć))|)|)L)@  PP zxP$XX P |)))ć)'|)@)'L!` {T){ :{)S4){)$|)|){){)d`'|)Li|)|)Ą)).'ܡ'''{)Є){)!v0H-MP. @ PP@P\\\\\\\ ]]  @TP   6  Ѝ0@-MP @PP 5P  0 Ѝ)p@-@PPP p PPPP  P p ` `pH- MP@ ^P3U1 N(pp)  `!PP _DU `P,P 5( Ѝ '{){)S@-M@P$ 0 p 'P X    0p ,=   Ѝ |)'PATH'/|)H-M/`PCЍlPNP6P-\pW B@JMpW@O$0P A3I Ą)'|))/|)/{) /{) /{) /{)@-@P,P@QQ( @cP@@{){)H-M`'/xPP @m'PUDDDpPPk&P&p'Ѝ|)Ą)|)|){)H-M@/oP -P%  P$  P$ PЍ HP P `pP   P' 3PP  )RU! QU/{)H-P~+PLL 0 QSQS Q0 |)|){){)//G-HM.8-?80 <( p@ @`DP80P ( @ `ZKHЍ3I 'H-M@P`pW'u`qp@z)F  B+@   (6P0P vp0Q P.R 0r0S , ܌@ЍN@ |))O-MP@/p 唃P {PP 0SʕP U8 ? Pp:9`P㘰WP 08UPP P  P p PPꙕP&  8`pGP> ER:UU ~$ @0 (|)$|) H-`@PqpW mpV T% +J̄)|)O-MX) pR%pPPP :PW @嶐`Q%&P`U@  ᰌZ/P/Ѝ p WQ:Q:Q ၐ@ЍOD%''(|)O-MtSp`@8-b@Q'ii|iij|i|i|i|i|i|i|i|i|i|ijj j|ii(jp`@PW2 ` RU pW P  ,RBP PjjjkX [ Z V pWdpo 0P PPQ PT P PPI !pW=oT pPU Pl(l4l@lX[ Z V poPQPd|Y:T@6HP 8GP PPЍĄ)'),|)'K-鬀嬐@p PP `Q QQ`PP|U:P P K{),|)'{)K-M RlmTnHnnp @P w`L$PEUY tI!Y%&Y$ (ZG$IAzT PmPP BG@G>GY 9G7GH P @ AQ NG *l@ AQ @G Ѝ0?' {){)IO-6)'SH-`@Q  0SCpa!(@r !!ApQU ᵐP" pPV `ᬎY#P P,P Pp,|){){)|)@-LL@ 0 0PP @|){){)O-M/@`P0寀P P` [P `xP* pP P P LpʒP ƒP ’   p P pp @P|@Yp P >PK h  p#Q 0'P P P{'P /P  W YA P p   PPe P ~VP RP Np@ pY( 0`@@0 @_G7 p$p@崐`W pp@o p@RPP W    Ѝ@崀`pPp@op`PI@D "!bP pPG#, )q'(|)r{){)z''!H-`P@P `pQ%V P pP@!H-XP@P `pQP pP@(!0H-8P @PP@P0(!H-XX 0P R RQ U 0|S:',|)K-@܀`'pPQ Q:P P:QPPPP %Pv*&P`:PPp@<@qVQ`UV Cq `)r'A-销P`@T pPR@p@T`|V:PP A{),|){)p@-`@sPP PQ  PpP p@p{){)0H-MpP@l0>00  mP P Ѝ0P Ѝ0H{)'{)H-0P QQwO-MHT`p@(oPP VP`ppP vP@0cSo  S R X s@@ `@YCZ @` QṍP4 PP8 @ `Y EXC }P CnEP B AQ C `Y ptCTCP |0 `@ P5 @ `pP}(~8~H~/}P$ KP0 ~@Y&؏' @YjCY|YhY <E @@@P /OC@XQ&YD@ p  B` @DTYPDhD@ `Lp@@Ѝx`pdd cS Ą)!U'#)p[E!  )03I H- ~H'G-P!`1 @`!@1q`!A`af dR\0P0X PP= @ A] ap` >Tp p` W p'ppQ;l  Q P 輄)|)|)|)|)'|)L)''|)@-0 r RSA sQڈ@AT :QQ0Q 0 0NO-Mp@  $$%  P`~P bpF Ԕ  `P<UځE P#x̄܄L`t p U :U U =UPtsPpP {pP  AApPPp PP pEpP p@Pp=P pP PPA @Q:pQ7Pk PbaP65EP {P  AASpPC p~P?=U PpP 5[p 0p P* P:9 p Plp PPPp UPppp [ P`pЍȇ) ''|)L))|)|)O- MD@Pu 48r0b@` P]P @Q9:P @P, T/@i PT3  U3*@T T`` @zP% H |P P `PzP PPU: x|@ UT PP ` U: PpW pWQ P   Ѝ|)ȇ) '|)&!G-PJ 0Q$a$(@ >RR4 *R[R?R p P  P ӽ MPP P P  R Pp@@T{)|)|){)0H-P ,P@@@@Q0|)H-t@P hPh`ppP P =P|){){)|)O-M P bAfB2p☠P[ 9[ ځKQ:[ Q W [ [ /[  AQ j1EQ ЍQ[Q cP Y DP8 EP టpZ y P p P*p P P$PPy/PU/PIe'|)')a !O-,M P( $o = >y@    P&  8P. p `( ( * `Dp6PR0C$ V7 YC0 e( @ yC( P `p Q( @P50AS p*P@P p R =p$P^ R"Q P PQPDV?<Pq( `F0V0`,PQ^ԔU  `p P PN( |PA( PPU`F R (,ğ0PC `倐@ c! !@PP ` `@BQ7*$Ph  0 D tXU o `Hu P ,P( P( PPUKBQ0\ ܓܓܓܓD$pP XP@2$p!W( pP 8( V%-( 10p0 0PApP q|!a 00 A p@@ A ( R @ 0S S@`VW   S S00SP,Ѝ  o 0DSʌ R #R  d \  C @ @D  0!h)|)'|))!'Є)L)|)O-M <#@@P0 s\( \Ÿ@`.E= [" ` 2倒p吢`<E @@PʼPoJP@P i  ㈺pfP TPR p@X X@`VPPV A E@QPE` `@PʘP@D`T`PʞPP  P p P *p P@@PJ@P P |PT E v4PP,P Ѝ|){)|)|)'|){))!|)O-$MXXD PHP,@c`@KA)`pV崠  BQ = @@ 0@S "R   @ $Ѝ|)')L)Q^H-hp`@PP Q Q (`P @P|)|)K-$QPD  P aP p@@P P 8P P`P  Qd`dp@@QP P P|)|){){)G-Pq Q:PP U PE` p@@T @R:PڊP P `P' P@D U p  U00 =P=R V Q V`F uP`@V hP!G-Rp`P@P   VPp  =| pAV P  TpLH0 0   <|))|)''UD!O-MpBW*(CQPbP   WP P @,hĠTȡ Yp `P^V`ZpW:!pEW}: `~PGZ`@P wQ  0S Q:ppW*]pEWY: ]P:GZP wQ  0S Q:pp`ET<* @PZ Q@EP`0 D` CW P@pPh`@Dp@@Ѝ(|))|)'O-ЍLcu0_qm{)ELF{)tp@-`@P4, MU1PP6,@P /TT 0D00 Qp,P p@p{)''$})}){) R/0S'0H-hP`d d0P 0@ 0@8 0 0 $0 })''})$})p@-l`PQ@PP.zDD D0@Qp(P p@p{) })})$})'{)p@-`P@PJ+P L{ PCXX Q0 `@@@P`@0p,P p@qp'{)$})}) })'{)/'p@-HP@QQ 0`Q QQPpz'|)0H-@PP 0'|)0H-P04@4PP PZ+0'|)H-4b@P(PT; rp C+CpP *++PuPRڂU >G/ //sQ P 㽯pM p$}?D \(Q P 㦯p/ Pp! *...@P-oP HpPUx1N}\ }< } ,))'0))8\ ' 0S/'H-H3I Ą)H-<QA @P= 2P Q`p2`pVP AQ "1 >2p PV,@PXP >Hd<b;} .[4)' ''{){)\@-@i@3I O-M(a$PCq Q A F`P4   F H2P ؐ ?2АX AQ ʬ0 1PPЍ($3I 4)Ą)8)5rO'O-M@P` %P  P# @VP^ QX!p 0S 0S`b#0SL ApQDP1   Q& PHP7@Pp`P PА?PP wP Wp"PE`UW%P -P +P嬀P JP| 'PpZ ЍTDp 0 0 b<)8)'p@- 0@1 S @@T P`V P@T@@Q Q Qppr $@T % r &`V 0p 0p8)5rO'<)H-@PE PC \Q`l  Q  p 0s S 0S p QpEp{P2pW$Q 0 pW pW 0@PP|P HTTDL44D${)8)5rO{)H-P@kPP ZP@lP pP@@T QP!t% 6QP@@p`P `pP P(5R%&'Ą)'' O-TMP)ؠZ Z P$ 0J p<Q` q@P @Q V V V R TЍO:00 PP@ TЍOZ @ `p W 0#K0   I0+P s !!P - "0/0GvP 0" @"0@9v q P P! q0S L"0LL  ,Q!p   v  @ i!/ Jv@.. P@@PA.@`:. P P@Z  /JpZ @Z@P.`@P.|@P.X p<7.P@ / TЍ蟜!8)5rO'RunningO-M X`P QP NPv,QP&@ p`P P T  Z  Pp`WЍX@`ᆬV `催upyj ,''\<)8)4)O-M좟RpP` @pyPP ThRhh"`VpЀP PD 0S8` ` pw$ Wp P pW \  \ `YPp ppWp P  Q: ``p[ RPR PU:` 0pPQ" P P 6 RP QP`  R XP0P Ѝ{)<)8))''{))0H-dP@P @P0P 0H0{){)0\  L\ \0 R\ 0 Q/Q Q p/ ,Pp//O-$M@HTLdP nP pP[@ X[  .P .3PPXpsP#0 `V ``@`0 P``P P`P PP PP pY P` PrP($hp R 0  R Rp AQWU Z Rpi pWZ  p JoP  P2Go" [ Q 0QA0! 0  pZ  YY P[ pZ  .p[  .l6Pp*p$Ѝ4 *.)Ą)a4)<)8)'5I KA-`APpiPP gPPjP pP`pPX*pPQSP@W DDTD0@ V P   Q ,PPPp`Ѐ~, AQ `V 0 0 *` V 0 0VP,:8mĄ)8)5rO!M 'q@-(@Q4P@`4)XQ @Q 8  AQ /0S /<)4)8)`6QXQ/HH0H P@ 0 S0 +')8)5rO'G-0BP P `PP`FPVܑP P RE APQP @:P|p`nW  0P R2:PpQ! P0`C0S @0GP%PP U@,.P0  XaPP$P /4)<)8){){)',)A-(MP`@ $ %XpP w   0 0`(Ѝv@ LK-P p@`S ' ! ' dXVV4E(B(UP*f"P'P NP UPdPPnVMp &&X p6P &&&TLu ,뼂){)),)''\q!t4)A-`@PpPUU@V  X@p8NP pV pPp 꼂)''H-@tPt ` 6 RN`P2`Lp`P.D)'H)p@-@ᏦdaPP TQ $p; P !DQ  , P Q0pT 4sPP0SQ PQ QpP PLP pt ,{)'\8)5rO'{)04 N RQ Q  P a'@-@QhQ XQP 0S 0RS Q  I(4)<)@)8)A-MPP @0P R0`T Dd  |P1 PpW SP pWPVP PHP4J0P Q P sPh|s`hP<@ $ HPSPT`V qQ<t 7 Pl`VT31c$-+Q PPPPP0S `(IGP  0s ڌ @( P`2PЍ,*ЍAH)V Z 5I vaJI e lgq[ l T!T\>BIP/ # :72-,!%O-MŸ` 0QxR| <[ځpK W$@$` #[ $['[ =[K \[ @[6B"[V\@/`  PA@0@D T: PA`F@PApA  b@} "DA @ T`,A) @ " @"p0QGT@p[@Q$Z @ P@ PpWp@ @[  "=@A: }Q"A0ЍH)D)R!# (!p@-P P`@PT P;8PUp,!O-MP L <P ,$R  PvAp` Pk pP` QP/Qd@⽤PJp!0REPBP@LaQ* PPP:PU aPP `i P~pzm i` P%` AQ ʷ%`P@ ZЍhmP))܇)D!X)(|)'')!'O-PP TP Q TPTn RT`TPK50!(Ȅ)Ą)'jXUA)0H-lP6Nb\@P vP/D/ߚ)(0( P$ 0H0')) =A-P``QP PpPp$P@@ @`Є)A-@P PT@ TpfP @7TX XT@R@LBLr`PE0 y`FvB AQ qA ` Q E P Y`Fv]tq`Q tfP `VH @!X P  1 PUR@p@ Q` Q  R `V@ AQ ʌ T 1pW`V PAPPU Rp'Uw"!k '+l 0H-l 1@T PHDQ R APUP0'U0H-@P P P*P0H$0A-@RP Q-Q\P9 Q-Q5U5PBQrQAP `pQ pG`WQ PMpPI GH@DX4aX< XBJX@D@ 1@hpp!PU:1S A@  0  R QB 1Q  PTP M8Ą))Є){){)@- 0SQ @T7 -Q40Q0 -Q@T) P %P# R@ R @ :R  @ R :R  RH 00P 4 )Ą)\)oP 0 @-T@H<QPP L{)Ą){)@-0A Q @P  @Є)H-MPDP0 \ 0 0ЍJЄ)O- M0pQ`V R 0S -Q`V  `-V0-`S PU 0BPp@1P?`Jp\ R 0 :R  0 R@:P R Thh P:UD  `Q1 @  P@@1  U!?`PP0p @ P,` ` PP Ѝ:U H  `:`$PPdm'*#3I >5I U0H-@P 0P  PP& P!P P@ @P^@P0 t'()PH- H()O-M \ @ TS P @ T*` @,P( PpQcP pP {P @Pa RGA@T Ѝ'E !O-Mⴁ@T P   !2W Pdp`P@Q* P pU [ PPFP*rP PT!TV @T\   L1 VTЍp'p8H-@   'p@-@`4P P`P `0p'O-MQ[@ @` P     @  B/o"D`{p @  pQ  bO  |[Ѝ'()!p@-@MP@ Q `` P x "0`0` 1"X `o`TUJ(8 1$ 0G P'!jRA-pP P@PT5@DP pd9PP @`PP%Pp`P @W !''H- 0'O-Mw D @ P$PP@;5P+++++++|,+++22t,,2222,,|-22-2- Q    Hj P KPEP2   sP5P!| P  sc&Pj  `PP pN `PPU pP pQ P,QB HT$P Z6 P -P 08A P0` P    ` P\P Ph)aP pQ`0     Rc   PQJ Q0P`p  4P1p QQ@p`0j P @Q* P QA P8 {  0P Q,QF f"0 00 0  @P%"%`P Pc`Pa P$PPa@ @ T Z P  (@ ЍP`P PܰP0`p  ` P P ptp @R*PQ  ''w!'H-lQ$@S PS@Q* HTP$(`,P R R R @0 @BT:R R  r R"0`8p     F  w   P `&'@-@P@ 0/0S/00/!H-P@-@S(    @ 'O- M Q 0 ``hR@p` P'0. @  W p V @   ` R =R    QW0p$@@#Q 0XQrPK?@> @?p@lR@@==PP< @PP\ [PZPW&PPTPl&U0@ET2*0Q0P@0Q~0P@/ P Q @@pT"0`00a 00a!0a!pf(Pc`P(V@A" @T"0` 0a!0p 0a!AR P p@\  Rx Qx< (7P9 6TPU @DP)P @PA 0P  @QZ @P@PP{P  `@{U@#P#P}P@)Q PP T PQ PL0T000 00! 00B pἩy)Pp! B!w @) 80R8xNp!R\P`P?p@Py  0yp\ ER0p@L\U\U\U\UM(DJ\UK$K\U\U\U\U\U\U\UlM\U\U\U0K\U P<pA5u P P9\P 'P3 P pP@j@d()' P@p@P'PP!%P%? %#@Q Q@ p B [%P%? %&@ R R@uV%? %)@ R R@?0%6A R RA?0%3@ R R@pA ?Qm Qk p B  dX `@!U]J%? %,@ R R@?0%9A R RA?0%6@ R R@?0%3A R RAp@? P P p B  A??P p: P pP 1p:*pP@P P P P@P ` @pP<PT F ,@  PQp @>@QPЍP P `P wpp "p WWp>U WpC!&P |P >P #&P >P <P@@ ` (-P(  @ep PQ$` @@Qrvn 0 oP*ljblfHdPb@`4^뼄)'''! !!t',)W!()YA*t}) })+F))O-M|P  P P<  4b4r4R$80P@@T:T D P@PVWWVWWWWWW PpTt 0\T P! R0G T T  :;T" |T>|P%0p ЍOt!)&P&P ;P    Ѝ'()'}) }) !p@-\\Ppx@xPx`V P08 0Q 08  E\P pY `p@;ꑘ''()p@-H@8Q 8P` AQ h`8  R8 p')O-MM0$`(@0  0A~,p PP!pFTW0A @0SP@PP Ķ`Vu ttpPlDlt(  P n `[P \P`[P P $P1  P  `  &`P$-p!\P `P  0 0$  ""P` P\P\@PP`@PP̂(p`EP @PPPtVP`?V P   }PPu PAP`q@Z   O똁@ 0@P\P $ 81 1SP  AQ K @B AQ ?TP@ @P 1@PEUMߍ 0 %U0P 0q$0 v'{)'{){)'')()@-Q @R@Q0H-d\Q T@PU U U <04 P00'3I ()|),)'K-MP@ 4@TRpPU ` NЍ`uQ X<1P ```''4)0)O-[M `p吡<րV|TP@P T@րL4`PD PD ,> @`@`P P0 P P Q QV  d`!V 0\X1hAp@րe8T`P[ߍ㳴{)'{)'{)3I !' R/0S /<\/0S  R 0/@)A-pW |@P`pQ@U U p 0PZᲇ-W8)H-p@PR T%gf`W VU ᑇV\Q@vLV0( k}  0dB('H-p@P`V @P`O-MP@   @ ?3 U ppcppWWpP Pt ,P @T Q @P ,Q  R XF P Q?  "P|C PXP @pI ,T @TJ @0A p ȡRP W PU~<P QB 8P Q  R6  㩆p3tU P PP/ ᙆ@pdUP `UP ㊆@p@ @T P|tЍ  Pg@U=U @)))D){)<)'{)p8)m'''( R/0S /D)0H-P @ GpQ  >p  8p   2p  ,p  P0<)'w0H-P H@P PP0 2/P0<)@- P@ T DPZT@@ P,, 0P Q10''gfff<)K-MS`@ T@P k8lHlllkkXkXk pWJ0P  R 0 ᧲`UP  R 0S T Wr!0po PdT0|VP p{pj `p{   P#@wpp eP_J`W i e  p ,O`PYJV`T  V P F Vo"0p!PP 6P P ЍP ЍK S4 fOSݲ pS@ S@<S̲ {)D)@){)'$|)'H-M@ ᾅp`pV`OP P  qP ҄`庱̄JOGODOAO >O k!'Sp@-XPX`@$PpP p@_p{)@){) P/8)p@-@LPU T `V PJ`Pp@)p@-P|@QQQU k 0Pp'S`^s D'^p@-`@ RR9  >PZ SP SP* R , P,UPU +@p谁)<)'0H-@ PP @ $0D)@-<@P  R  @D)O-Mp$`@` `JpR SࣟpvP sPV` 8pVG3  P p+P -P  MP00XU: OP  Q TPQm oᠢWg aQVo  % % [p@P0P`PMPk$WWcZ  01,p- P [ !+"00Q  Q PWFr FpB   R :p< Y  0O`VVQP J@@ 0>T@ ЍQxtQQ XQ < 뤿.ܡ'.o!!p!3))'O-Mp`p@ PW  0p䐟`[`@  PU[ P[  UPP 0 @S[U H <ЍOЍ'_k p!u!3I D$!-s o!{ p@-@Q? PAQp`R @P``D>Q <Q R ^D@Q:P P r dI RHp@P-`!5I C p@-@PP QU,pP Q  R p `p l pU P UpP (  D)@)p@-@P @(7P PB!0H-P @dPP$P$ 0P0H)5I A-@Q @PK x`xpP  ?U U @P.P@U'  O-M@P PP3,MPP/PMPE MPP#dtP@P TQ <PP )@@T@@ U`tMP dMPpPU`PE{MP I:lPPEYU@U%Y cēSă@p WWp@WPT y0  T@np@@WroᠢYPt@YP P @㰲bR@P*pY Z P  @P D8PwH D GP @PeP P (W q|PlP \T |8Qthah@pP P T  T@p@Wp@@WT p`@P P  wg@@T@Ѝ-PPUPE!T){){)T)'YG^!U'#! %K-MP@Q\XPP HpP UTT TTNP pPpTa T6pPpȑTpP `PWЍ Lp `VhNQI TG'C EW W W`` aRJp UpWX D?P:N 0p  oP\rJT6QLQ p6Q`PpX)T)T))'Ȅ)X)܅H-@P`pP P `p W:@ < P$P H'{)T)|)T){)K-Pp@HoሐR`P P FPP `P:XKT)T){){)HQ/8 0S 00S/ <R:/T)T)0H-@M(PPP< T0QT PP# P Q P  016P TPaII`TQ P<ꐫMP0T)|)T)'X)){){))p@-H`@PP@Pp82IUpX),,PQ /PQ/T)T)O- MqQ!1`Q@P(QAT  %mP᭬hPl0d `P  P 4P `00( @ Ѝ蘇))X)T)T))|)(? R3/1!@R/X)0H-8P@P0@0複)H- 묇))A-JM PPP !Q $@P|@a$@P \T@PHQ@TP?4$@nP@q `Vf = P@ PPPPN~HHF?PPPPP:L 0` }zHꔫꨇ)))|))){)T)T){)'0H-@Q P@PU PP00HG''p@-@ Q!- P ,Q$`P   J  AR \P3  R,P @p{){))@- Q @R P J Bpp Ӳ'G-@'P9PPP k`P3 P1 @P`'#CP@Pn"``E@P_`\'PpUWG 'W @PHpV @P:@P/@P$Z`P 'P p@P`V @P'PG7!'0H-D@1kP'8P @ U0P0!H- H''A-RP`p@ |P P KP  T@:pGWPH0H-T@TP P  P0P 0HԨ0{)'{)MH-M  0 ЍHЍ/@-M@UkP ^sЍި MH-M(   ЍH Ѝ/'Mp@-MP@ , `,0 P@PO!@Ѝp@Ѝ/@-M@ @ 8 0,@, AЍ)L)8)Op@-M`@P )P `f `PVH@H P@:Ѝp\!ȇ)|)pA-P``Q=QR`V X@' h @A@pW P ^%P @pPpX@A)p@-|\P@``孻`@@T800 4T`00 p@|)t{=) K-BMX@p`PP   p+PBߍ{)0H-P0SR0S `@00SS @0P0PSS@DR D0!H-M@P =`P$ pU Dp@pP AQ =U `!Ѝ ᏧK-BMXpX@`PP `PBߍ{){)A-Mp @ PPTPPD `V Oq R < 2/`׺P   P00  !,BP!,V V P!P    #<0 `ᘺ`ᓺ  Ѝ '{))܇){)H- M! 0  PP -P -P0Pc|Pfl6QiFQlHQpPs,  ЍЄ)Ȅ)|)')p@-``PU @5PUPpP p@qp{){)0H-P @PPU0K-MP~@-PP7  P p `  P0` ` =Qb =5P( X ' `= P? P!W  =Q A _ L P P@0P ߥЍ{)h))ć)''4){)0H- @P P Q 1/P @0p@-@ R 0`PU0=U=UV =_5Pp PkP ` Q 1/P |)0 R=R/="o/A- 0S p00S0W 0R:@`pPU Q Q 1/P`PpW:萈)H-P`@T p   @ W@p@T`V:Hꐈ)H-pW @ ?PBUHOlPl`'W W '4P p@ ?@;@pH3@+!' A-@`PQp5T W =P @ AQ ʆ 00 =PX xd@ AQ l 1/P PP'r O- MP@0P `̀PPpZ T    U Wp[:L0 2`W @ 0ppW Ѝ,)0))(A-@Q)p`=3P@=3@UPP@@Pʎ`P=P@Pʁ`A>'')O- Mr`P@rUIP pP nPVk@`rUfT`@ aT PZ V   0O ЍPQF pWC `   P=XPP T  =X T=X P% T U R =X   pW8 ጤᴣĄ)H-rP 婣姣wW0H-YP xP@MPP IP@NP xP@@4PP 0偣&Ą)H-MP `P6 @  R/ pR P   ۶P P Ѝ{)D!{)A-`@T. PW P   z< 尶\ R   02/ 埶 ᘶ@T4)''H-PH P 3*K-p`PePfP vP xPP ePe@o8p`hP /o"p@PPW BPPPJĄ)0H-@PAPPEAP0U*焫00P 0(S !S p o00)S R p0xv%~!0H-MP@!PP `P Q (P)P .P U U Uo!P5P u P vQ  @vQ oЍ0EQ ЭܭT(8HTXTtTTT     @  @  @  @  @  @pt q @av @uDP)H-M@P`tP2 Q/@PX XXXX0L|б$u@P uP@ `0pV @ P#P`'0Q(Q !Qop)QQou@P uP@ `0pV  P#S@`'@@nu@Ph uPc 0#"\ 0"#@@@P |@OFw@@P@?@`&$oB3x@`t&$@@(m`piV@c`p_P@Y`pUP@@ N`pJV@@$ލH>T)H-M0 -R  Q Q Q  x Q P@H P  <4 $ ,  0JЍ!!0!D!@/ 0Q@/p@-M@yB ㉛P`pBP lB "Rq*P P 00@RQЍptt'H-@PtP QC C `~tVA|tpPpN`rtP @QAԳO-M`P@ㄻT~pDP-PpkPPr -P)Pf lsP8 lP!PDZbZ<Y @P@DTD p@ P ᠠ@PPL PP P&PT尠_ppD?PP PXPZJt?PJZ]Pp @%P~`P5 rpv Q@UU)r%oA  9`P RP:9YAP pYDA\ B\>@pZᖟ3I i!'t'UE!bZZ!Gp!8H-M( 0  Sw'|)@-M @x9 R 1P ! PЍ ӟLH-mRy'0H-@M@T P=.P @Tq @0@ >|| :x@p 5sd0d P` ,PP, (H $@Ѝ0|)(})_/5I w% 'Un) =j|@-ПP  R@t   Q  PH@HHH H0 0P @ {)$})}))@)''''''0H-㾕@@d! 0@S @@QlP6X R@@TP,P G0H|),)''{)X){)0H-MP @  TP   nPЍ0H-PW a@PPK $D$$$$$$$ $ԽԽ00 %  pW pW Q;  E;PUPU PU !p@-P- P`@Pi@Ŀ@@@@@P@@8HH``0000000PP @G 6 Q  00S) ! 0 00S p!P/0H-P @P PU0p@-MP @P``P`U`Ѝp0  0R  /P/P/Q /᫰P/O-M-(MP l@U!%,P EQ [p\  q%Pr%P  ^*Pt ^.X @*P|@@(^@X `Xp.aHPpppppp`P j q" tV P  `P AHPT$IP $'Q"Q J A tH 1H>p$⪌$@ ` P  L q t# L p t  4+S +S t  0\ZXX hP`P s9'0S0 pQ Q px`ha,&QQ' "Q& 'Q\Q ' P  M   Q?^n vbtfreQ^@-hgP`P GpP @PPP \R R PP0]S 0S MS ^R+ -R PPP^S" cS} " &PP0@pp 7TQP @P%PPPA P cl Hq+ t,  0m$5P0p 'psp dTt  +S+S K 0Gt  A PDdPTt  30 , p@ T@ x <s0p w  0 0 wg   Z]p p|#pP\P PE `@]P 0P" MP^P -P `^P cP'   `#@ ?P `` 0pp 7S00CQ`n 84aR 6 \P \P ! A AQ ! 00 nP Pfpp$A AQ  ppR@!/  `p LPpp`E& $(ЍЍ˚%XNP pBT ` !:'\)X)y!ܡ'd)`)L ))h)l)p)t't)' x)d|)'A-P`p\@DV/V90FPF*@0PrP@0@APl `0Q Pd\F PnF P% @OL@xp@@V6 "V? 'V '@8EV@4@2 @0R c@& @$ @" @ @0pU``  A`GV/`aG6`3PV`3BAq PRd;XP@"@`EQR*Pt'X):p@-M`@T" #; 㶓PpXU @@ BA (PЍp`)t'd)X)H-`@P p R 0BR0 00p pR AQ ʐ @t)'H-Mp@T 'P"PЍHKP`: 3P`+P-PlЍD0 (BA კ`)t'd)gX)K-`5PAU:Do<P0p@E .@@XX))H-MP@ H&p5` @&p UP d\ XAA ><4 4AA $Ѝd)`){pX)p@-@P  P R A@tl tAA :"Pp<<DP`A"\F0 pd)`){5XX)A-Mp@d\Q  0 P`P8  0P`P5 pW1 P<U uU@7P P NP  PQpP ^U-P P?PPPHP,ЍL@4 x`t\!!T36p@-M@D 0h``Q TP `  QsPn Ѝp@}!O- M@:'P `pܑPPp = 'Pm   kXcX' iX2 6PO  6P(p  $?lX oX< 6P= , 6P  r (* 6P" 6P' Q) PX u6P QQ  K  P P Ѝ $!M !H-PQ Mp@-M`P 0@-Qo(@ jP ( R  Q4 1/ЍpmU(!5H-M$ 8d0 }ЍH-(Q @0h D9+̌K<8<@0 8D0< "8 < D,$@@-@ D@09+̌@K<,@8<@0D$@@-@43_0P8 MD0K,8C D/H-M$ 8d0 #Ѝ@-M@(<P    j,Ѝ`tH-@ p0iPJ8, P$i`< `p8;"3 .`,.P% '.P5  H`p0"P+ 4   0"P ` _XJ XH pP : / P@>x +Q *Q3 7+pQ('pp$7 0pS70S&6 0S &AAo <7pPp PMo<pQpXPEpUڈQWWaW&00;p pT&,P  bP  PG@P* \0U` :!%@5P0 p P)Pq)@UB<dU PP`U0P5 U$ Cp4PP@@P! U  pQQL  U @PTf/&T $  l@P @@`S#h pdtp@ L`Pp =/#PPH!PJPUi BPJP 2`oRUW (PO Pf.C`$V PPb rX@P L @P =p P NP P_7A!XPA` d2@Pd@:\ Aa P_e``a`v`D < )į)ď)()H- 0,S P)p@-Mh` R@4T[(0PЍpp4   į)ď)H-MPRP@ p`~p%&""Q  "QOQ QQ @Ѝt'0H-PP @P < P EP@P0LG-M@PPQ 0/P Ѝ /Pt` 0/p8pP 0,`pP   ()ԯ)Op@-M@PPQhwX` 0``P $h `Ѝpԯ)O Q 0P #:r/ Q 0P #:r/O-M-1MPlFኟ\h0p!X (  P p ((D `  "P> @T1P@0@aT=:aP90a @R`@š$ ,\C\蠀 @!P! p P$ ?P ` @ ᝞P `"V< wX " @]0S  3/e`@ " A@ mB*      p P' AP@haV :aP @< |xP4"*  0"q "Q<!Q*  , !A@ m  B*     gpK P <0 A { rL! H!Q <0  S(! 5,,C P $ 0 }PP @b R q R @T:t 0 ^(1ݍЍ%8! C! 7et)')M0H-M@P 0_\  ~P Q Q  N-Q  Ѝ0HЍ/ᠧ'0H-<<<@P p PQ `0Hf! p@-fMMx0@+p <4< SPP D= 0 P yP<<fߍۍprdAp@-M\@`X\ 0S  P nP yPqDۍp)H 0H-@(( XP 0Hꠧ'$))O- MMQD% XuU `P!TpY P ?P @P @TfJP:8M}  @@@  0/p4 P  ^  MT̄t `@(p P  P ᫵tThpt `@( p P  P ᒵ(Tt `@, p P  lP y,S堃s `@0 p P  SP `0`S<\s `@8 p P  :P G8S؂r `@4 p P  !P .4Rtr `@< p P  P <DR@r `@$kpp P  P Q嬁q `@$RpW P  P QHq `@$9p> P  P ʴ0Q䀟,q `@P  p% P  P ᱴP@倀` PpT P : P ᙴT Ѝۍ'$)d!+Qgz!2Wv$De"<"p@-M0@  0P  ۍpK 0 X)'p@-Mt@xpt 0S  PC@`P 5555Bۍp)_(0H-Mh@ PP yPP 0[ QgBۍ0oK=O- M@P P|X `@p`P@pX P`P1 9 HP`H@OTP:daP `pP @P` XXX شXp AT Z*P@`pP @P` XX Ẵ@T AS`@P`XX  ᢴZݒ Ѝ@?8'坚H-M@p $PP7 soP`P_ bQJQ#KA P[ 9:0::::::`:8:kA P 9:0::::::`:8:D * B Q CQ GQ 3P`,gQ cQ,A ,* '  *B+   Q`|PP8@ 0ă4#p `V00p d%Ѝ@)H-P@ᄳ R!z0 u0 p 0\X   0TX  0LX  0D z( `L, TH0 HD8 <@4 0<< $8$4$ 0$,$(P $T    0 l!R@p\`Pp  pWx 0 H]dP! o{!,;Mm#! O-MpW `S 8@T,PU5a 0β@ !R! ò@ Q>l?>l?l?X>l?>l?l?x?@ IP P=,,3: 09Gy@"T@ 0@嬱@8p,PhDcpP"@ 0@p唱0@a T0@8"  c8Q A Z<P@PPY+ yN@8 D Q TTH*TTD  8@  @ < P @PP+8Q @PP* 0 Ѝ++** o k! 3I '4HH-`@\(PбP9 0 P p 0pW:H :K@-@< 2/R f/:0WEVp@-Ͽ0 3?0/ 4@04@4@04@4 2/4 < 2/< $/$$/$$/$P 2/(0P T 3?2/(04T X ,P0@?Ͽ2/5_4O4X \\0 D,PT0@8@4O_>8@TDQ5_Q  Brpp0 Q5_Q  Br 2/ PH8R?O>5_8HP 0P`@ 4O2/@ 2/ *0**/* ^:p)@-@8P wf/ )@ 0S3?S q R3WEV)G-MP)ڤ 0P0 Kꈀ刐@p P pa [`;`@P`XXX ZpGwЍ) !?'A- dd0@°T 0 D DDP`H0pᳰ`F v(렧' T  @p  Q吱 `   t !P& @p ! P (Pu p6@P pX  'Y \Ѝ3X  T 4 `` l .ܡ'x     }D   ;B!yaratcid'U ^ ' 1 |D(  {D ~D  { zH-M3 ,$0    ٪R 'O-$M@PHXA    mJp= `P7 p  `Jp0 P/XpP`Y ZUZ8T  0XNY$Ѝ D%!,!  0H-P? @P  P P P P2u P P)ႎ P0H8@Ῡ0Hx 00H赩PTX7KP0㫧ɔ4 scidtcidrbmngntsyaraloob ' ' '[!~ O-cMPo/00@ϟ娯00/0p☏嘟o40,00000(` PTŚH=  R w  ?B   Pz:g`P /P pP  pI 0W[ /xP9 `6H@~D0 V7P GP6JDIp  4` V. V. *GP UP# G D`P  p ,V /,PP  p (l RP!a@QjXdXffR B ?0|(p,00 4p.n~,4(@00< l~?P\n0m@L~LnLΟ0,>0~`B`?0 R0Rl 0 P H U,uEp  均4ME @ T fLP 0-P P ]Ln/ o,U  @,| ,P P <|l\ PP,0p`0p`}0  P  P QQQ<P`@Q~( <0@DЍXULRP)3I ()) )#8)+)$)+#)!4)k+' ) )#)#$$$$4$@$O- Mp @ R,PQ-t ЍON-PPXH-@PbPP 0PUP  Q Pڞ 0 T * 0 ЍOP; -tQP5|t)`p ᶞ W  0*P Q壞@  0W   0*@plWP " RJQQt,duP ЍL ЍOj)) P)(),,_k ^,D,)/,H-M<<PpO<,!,1, 0@L0D$!1 0@$09ЍH31~,0P@ 0` p`Pk,|||p|` 0p@@ PpXX X ЍH)`'&,\'`)d))\)&,) ))h)A'4)8)'e&n&&()& M0H-M峘@@PP|P P p @P Y@oЍ0H Ѝ/ )*'^5G-M@Q/ Q, pP`% P%& \  p \   0 pfzR)P\  n)P@ $ (*d#)<!!  3I \' 8)!!#!W!!!!!!"C"^"(! #}"""""()P)!!,G-餐圠`P0 @x̚`F6X F @Q@R( G趚UR) )!! R/K-MP p+ @`V)ږr!! f? p  RЍK?9P\:9PUF,\ЍX'\'H)""H-@B^*  Qapa`?A aQpQP?QA@@DP@ ppW L aQ3P)O-LM8p$$,($儀P odD D<00 @4[<8x |0 80 <p@ 0X ? Px| 04`@@ 0Pp BbP8Ι"dHaP e'pHp$P P Q -P]H _`Hp@PDRP[P 8 m @PD@P$[E  b P  \ PY 3 1!0P`  [E& (0儀,S P4 p0`,PUPP` 0$P@ 0 U PD@P`@& PxD @0R|Ux|!>*I@0 4 |@`PD<<0 <LЍP?G$$) )\'N$$)'Lt'&!$; $4)8)$$^5O- M@Q\Q_ Q[ q PR[S0P4` P0R`0H<8PQA PU>) @⅄PEZ* 0>C$R% P` 0p a1P0Fp [RQ8Q t `CHQQQ Ѝ$8)()%)A%O- M408pQ.  P 0P0$(l@T@T`P@PTPPPPXPQ\ CPk oC`!R RR@Q QQVtS!@ $ QU=ご$C,Ap Q W ! Q 0  R Q\  ` IGR )QQStbR \Py\ PWw(OB\S BPGw(?m0\" # \d  ]0CS   B0p0Spr!R< ` 0 @ sAQ ;P\8 @tP4 U ,   %Q QP P댰Pꀰ!R$ @@0 Ѝ4e%%)P))%();&8)%#&%"0H-`P@T 2@ | $@00()O- MLp`, PPؠ*@AP 0U $ 0 W PPPP@$ DqU U E㊴` .\!` G l$!$1ph @`G Y Up@A Np  Q@( ?D+! ?8  Ѝ()@8)) )O-M p> pB1!?! goP 0%p  R,ЍO/5H5P 0  !  PG,P 5P ЍT'\'H)*O-kMM%嬵u崕eEP-0 800  wcPd @R/04ЮخdPP- TPoP :` p pP @T" P" @*   8@$,  @   7 pcC3NPQ nR R oR|[XCP   L [P@Cep# U A`@  pPp/d P P"2 Pp<YP P&  IJPi p\@P D}P 4xP\  0P`:AT @PY.;QpA  p~5P .x5p7 4^FPa@P/"P,*<Y+3밐(!(1`kߍۍX2 5 )xd.'.| |>!x))),.3I )Q)o!g-))ܡ'D$!, ,,' zd@)edA-X!!---}-H-`@Pӳp᮳᫳  p H-闭 0B㻒+.'!A-`PV p@ҳ( `0H|``蓦p@-@P3 PP P P#`V PP `VpP \P P`V PkP `V@p ,x)))O-MM0@TP `IP `V@@l>Pd \ Q vT p $ 0$Nē @P8  'ZP0 Sp@`@ F[.`P -P = qEP p   L qYpP @ @  a "V  ΐT JpBP ᵓW v\3p @P8 P r rV @ LtP r rЍڍ p P P!pPmt ,QP n{  Z @ P nP7 ?0010A4,Pp[`   P [  /t +t0SPPt | tp $P\3Z33I )Հ!)!o!d-)-#!!Z!b.!U-!-- ͝ 0/t)p)/p)/x) M@-M0 @   9 Z렧'G-p@ԐyQUP Ӓ`Q PȒ ᐍtz`弒UP |UP @劫 $᫒㰐t)p)|)K.0Y. MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    oO-uMMرNs2p@ @,  1p ppJc2P-JPJn@  P*  P oD vpP   p pP' 62PZ'%8%<5" #%P P2p   P 8D4(l uߍۍx);B!.' )....H-M oP DD 000け 0 yЍ). /H-Q 1/ 1)0H-U0P0 @P0@IP07!)@-C@P9@O-CMM@ (000 $4t0 0尀p,勼P ``P 4/P 8㴮P P0P  d4PY  (`  06/PR $P , P ,W WPYPYs C/; ɴ p 8 Pa1`/v ᐰ .H * @  `V P  PP `` ߯0ş 1]<0A 41,Q,! ⮎o8@`PᤎXL@Pp~p W  AQ n P  mWNW YWyWnW Y@BߍHЍ/$),)0()d0'\0H G-MP娣c  QTo -@p P  -@PJ4W P  P trqPP\"QQn\0/`c\p P:P   0`X  0p Om`M PU:P @`PkP4`P^ `WP! \`KD pP  @0` ;T, y,PЍP+`xpW"% %UV ( PP ` ` ` 0M`QlO, D )$),)0WR1,2112001"191T110O- M0` -P pW PXp|pgjPPLp +pW!URQ <Wl`lv @THP PLQ M 0 Ă1@! PX0@0 ,jPjP DpQD#9l 7l5lXYx `@@ PG ! `o 0D p Ѝ$^$(* X+HP#,30 40803 00 C ]+P;L#HCPPP , (pPR #0 U($!#0Ap 00 < +pP30P<@/lr X X $P, ,  RTPL@DPB QB* " ,B.0p40 40   *PA O A P3 X4$ P `0 R  `eV#3 [k Yk "  Q)* ,PL \*  0Pdh0l PPUPMPPHPEUPBpP>b@d@O2߯g2223RRaArrAa3!B3Y3y333M44%4 4322H-MpP`h@P p00* 00 " U*P0< @0!10 00  *P j jЍ߯3B3O-$M`lp 0@P PR#eP p P PP7 L P p@0 @P` j@0@0@@@ LPLCLqC Q@>P PLp$ P @P Lq @ QP@LPPPP@PPPPP @PLPPQD:P P p 0 0  y@ 0  m@P0  _@P R *0  Q@PPPU:ipi$Ѝ)554@5S54G-M@XpP4dP  d 0!  X )X Q $x ir Ѝ57j60H-ML@P 0T!@!@% t T llppЍ0T: tP0T:LPPL0 t0! 0 0<P H7y7P/ p5/1/gy[5о!O-MPpP: `p P 2R B p:C q&: pN qO*0 r," 1H @dC p,:AS A s:A@0 PJ!AR A r:A@ d P5  P88 ,P' P P'(rs#*@R r   1S @ s:@@0 P P  Pp`Vt: ` P PЍ 98_8gy[5о!888|87787!@-R8P P *2@T@PO-MPP:`"Q2 sS p @P`Q:Q*r@pTSPP`VP:PR\Bp RFZ:Z*0 b `V Q Z :A0Z:   z(bJ q : Z ! z:! Z :Z *@ 0WP TA,  0LPpW::  0  0<`P P UPZ *  V pZpGV:PQ *"0S 0@@@Q@P0@PЍ56O65gy[5о!b5K-@pP Y8P 0S *r` VP 2 S ``tP Y:P` Q*`Q `O67O- M`XP@ aP rUl L p $ P&#t 6 H0/LpPWPwPP   HgPQI: ,L0S s2Slpplp00PrP'tppPp0000'2Slpplp02#402Slpplp02p#T PP0Q *2SlPPlPP202#20P0Q: P @X !P0 !  P#& P @@ Y:@ff@ Ѝ6j6O-MPpP@P;:`@Q  Q P`V:&  e 0?@PTgP PQ *"0S0Q@0P+ <`ql Q(@q PQ*lP P *6P PP:"R PVB@Ѝ40`Pl`<@666!!g 7A-P W@B``V` `@T@ |P p!00|fd(K~`P& (KD8Q:PQ*" P:R R 0S% r:eel\`8P $ 2 p p p 4)8)X)<)9J::w:99~9Z9p@- @T 0@00T@@Q p 0S @0S0S8P8@@e(`e@@p0)\)<)X)4)@)8)G-`x0X@XPpP  0   p <)0)\)O-eM@0 !P R:PpR*h XL8oTHpP$\ 4@0P<@(DdpPR \0`0C !@Q@p0 L! ,`0PF w$ P@ 2 Y`0`\PL@(dp( Q Q ( @HP YF iP- L(dpp(JD"`PH@ @P< 0lPB TPD @ P* P: ```0PdphP(`0((^a@ PD``@@X 4Q$P; X 8TRpW p T1 K  P | Q@ P @QtQt9L@@ Q.  0 p R0 PHJ QFP B @ `O094X0 oS8T4 Tp 8PX TQD``P8@@p X @P< 0@@PD``pT  Z3q@ pq4Q X 8TR TX @ dPLq   0 T } ,4hlXX2 \ D`T8``pL p;TB\@< P P0pD``!T2 8|`0 @QR g(hpX;`0L@P"P8 X HTTP P   Lq  !<p q``0P Pw P    XpTd | X  D dp$ Q*T 0l@ AL``PpWP pE@P?p pEPT0U: @ T:U\PL`*  @A0`PpWPs pE P?p pEPR0U: @Rd:L`U*\P p0SPZ 0pW?p00PQ Q:M$\PPP*<  Q0 ; <D`b Vi XP v|:<u | v J!T 0PQ dPLp `EPN  `I E\PL`Q*@dpD`X _d 8XpRTp T@D`P `@IWTp@` XpThpXppw`0 @Z`q`0W:PPW*<  `pX`0bP Pp)W W% P PW!*<dW/* !T0`0P  ' ''$qp P P.  `)(GPd Q: xt`0P PpAdPD`Q*<`P B PR:``0.Q  rP+ D``P@TP R pP GdP `0 PLp}" vpP `0RV Q `lPc  PLp"  `%K[@P  K/>8$@P  1D`[P #`0@@PD`=\PD`\P<Qm4)Q1  dP PL`0p ``<`"PD`P\P`0@gPphhX!`L@(dpPDP>  L@P<@ b";+;dp@p0@,P 0a&` ! e"@3 P^0<@dpPPY h\ "R:P\ R: Xp0`TAb!HB7P<@0aX ` TR8pp:p@p P   0P@p PDP  0,@ 0! B PY\eߍxl 0E4):2;k;};7`)D ;<y<W<:<<;;<S5X)\)0)]=F==<<<>`>>;;t=O-OM@ &`P ܢPC RpWdZPT `ᰒ崂PW d pW*QQWD: LrP0:PP-*d0@` 0P" $G ! "d  sdPpPUP q P PUPXp`SxOxMhKh @! 0P5` d 0QP,Q 4 f  0 Lp0  4 4    P ! Dd  d`P 0o`Oߍ{:@)<):D)H)!P):::::@-@P _D)A-ppP@/`P `F- @DT1dPU@?d`)O-M@0TV:0 X18<`倠0 p PpTE*TDpW@@p` 0D#!pU 0 g ! * p P" [* p 0P ! l P ]P T D 0BT Ѝ8):t=O-ML@P HP PP+ Dp>>FF F@O-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q"X3\cs2/3?6o7"X3\cs ??j  p  p , p $ 0p ( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,e@ 8p < Hp D`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P !~!y0A-P d  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 )!$""D`6oD`#@`6o@`#H`6oH`L`L2/3?6oLX8<\L01`\XM`Mpp` }}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,&0ЍTU  +0 BR!q p/G-MM`RQ:@ + T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  Z[Pi` Vl# 5_ Pk  0AQ p Ѝ>LABLG-P@ p`C P CP  !  @T@@CP CP  !  Pp@A-@Ppy`P@ P$@q`AO- MMHQP(8 pB`?0 @o?T @4  P p PP2 B R000 i>YX"XŸ0<P`6o`@`o`T@p@p pW v`ov Q p p R?rp e0qPZ !@T p` Vk# l@1/p7 4P0PP R000 >@ 0@@ ` *~@P .^;  Pppp ЍۍQ0>)`))X)))))l)O- M @ ` 4  R000 =p0Pp Q  P 0PU 2`0 S9 0?sP/5PU  PP  P `bB pR0 @00 x=!00` R  W H  GP0Pr `P@`ᴭQN ULVI  dPB0P`៭p`F PY0 0  BP@ R000 +=0  R q p \ 00 P 0 U  $ Ѝ`)X)))@X)H-M 0ЍH-AM`p(@P/N w 0P@AU:P: @;P T0P ?s0@p:48 S /$/Aލ))&!߃ :>G-Mp@P聟Q p`V̑Z PPS 0pPO PEUC p ! ` Q p4! 0 P,U/ pF w@PQ u Zw2/P Pd;P Q P wpЍT D ЍG8 P wppЍG))))>)߃ :h'>>>y@?X))O-|MMBNX ^P` P /r 6* R . c pP dP`5 LtD:P  @V  p`$ 5U@ h$ $0Rp0d50S 0Rt01l1@0Rt0lpBHenPU'L.P<:PU 0 0T 0 H uP  R3  03p@$ P$`4 0S R AqR AqA"tvPQ Ov a  0 [ Q p  P+?PI p `@  02 t `@P:f V<S @  0 ! D0  f@ V.-!:P  0`@ " p@bO-t-p@@|Ѝۍ$R#X 0P/ ?@A PR  4` p  P |d1LX0 S( R- q)|}-x*e 0P0p$h`S?BL? @GR q?p9?   0T- p  0uP{ _ux)?:߃ ))@$?)h'b.?F?l')@y??M?X)?)D ?@? O-$MHp) pP@ :D`@ 04  0@T`d#P ; @Qp0; `400< 10 0 @00Q1 0` 80 =@ @pQ ptR |B(Q 8B r4 0S @PPPPB9P  @ pETQ p H24 P0`  0 4`V:P ,   PO @U`P o@?>`  0 O`p4>P .>PE 0 - `p `$p>P >P >PPP _  >P>0 0S R qR q $Ѝ ``)))')')X)p'O-MMZ:`P 0Z0*0V0: V* Hp@J@{`` T)`pLWpPH<0@X@0 W t0 0mWt  (`_ 0; W X U Fp 0WJ@X D F@ 0T9 Fp 0W  F@ 0T@ FH >:G 0 <  @<@4 ([@  P 8   & P0 pc0 S1S1QPS z [  ( Ѝۍ8T;  d0p`0, P$`(p( q`,p4xQE  ( 0`$  p78 p(,tP 7 `X%p 0 pR"  h 2/0h p7( $0 @¿d?`0@h $h p4P@P`P a16"! QX!Q0SPN_0P[ `- L0 0  `P 7PPPg J0 ,07PPPT JT0P q0?Ds`Dc00 Q(`  00 `V:P p` 0a731` `b4P A`V@``Q1Q`S pV N- L d0S/7P8PPZ P" p 0qbp`(@W`0P) Pॿ$` ៿P 0 8@pP 1qh 1H!0` R Ph 2/$B2/$`P $R?0, h PƟ$B0, 8 ; TG)P C5P  xd ̲QP $$! ",pm ~7P P $@$$ PtX$2 p PIP $  ! R  $ P Q 0 Q  0HP $+P  6%L1P1/ @T ` P$ ,ЍۍPnp  Q@@R P୺PHDD  `))))LCX))@@C\))O- MRPP@pp P P GPDb8P4Q @ @ 0 0 P P  0l`? 6\ś\ 0 00U5v\ p?p 0WH,PC va\ p?/0 @l\5)S A0 0   QxP v``\ p?L/ 0l0 0l Ѝ)`)x)@T=AVAAAO-M 3@`0p$%V:3Ѐ@R : 0P@@  ἰ%?k#"\5 @++`#S !p0ϠB'`r! xpHF d0! T!Q0ϫQSp ee7 @T"Q  2Q0BŸ U`SQQlrP 0P1P2 P lP `AP2 [l<D@`PQ p P hpQ LoPp7FPEuPp7=PEu@l T;T(EP<@[2T\`P`P q QQ 1P1PP` U TJ P  T:@ 0  1<0h,Q ЍT0") )())`)0)T4)D)<)@)8))H))))d)))AG-00`P@ +< !``0P0p P`H p8W P5a<W0pT 0P `0p@ P` SP  0d"8b"`)A)0) ))H)())@)D)<)4)8)A@-@P TJH)O-M  @p WR Q0 `B? P``P0V8DP]  ?ᠻt V@ #1P(00)0?o200 $,` p( 00W @`Ɵ@P 0 U:@X 0W `P`_`0SPP`Q ppHQ d 8Ѝ !))`))|)))) B0H-PT@ ?4@P !# " 0 0!)|))Bp@-`@P TQ HP`@IV*IPIp|)))A-MP@`pBW(P q1 Q! !G`P _H  R0Q  L P0p`` p4P , p-PPh o3T  $Ѝ)ZZ!:߃ )@BX)C)))()\)H-P 0@iU :xP:@XiTP HH Pp Q 0CP !  Pp P 1iPP qpiP i`Pp P ݶ l0tiP(Q 0!4HeiFB)OB)))#!WB)`BkB@-p @08@ T 2/`@0 &  t  D ZЀЀ)K-@@P`V D8P pP 1QT 2/ЀX:P 6oV P:pPa))0H-8 B@$|0@P@00H-M@ Pd$0  P @ hn2 AR: Q Q Ѝ0! uBBO-$MP@` P2Q P@Hv U *@2`P P@%$y 0p n'!% U R-: Q ``W`1EP p  ! ׺P* F00 R0uP Ga1`$\5S !0 0 t  ?[- g嘄Q P QP T  \ P PP 1 0 p! Q\.0 p؃pG pL$  Rp$4 G  $*]/lP  =*Ds  X  X  X80 p /W "pp R /} z溯tQL 0P(r z溯H<emD Rzd (0XⰠH!Z !? T pb;wr0 RSrQ 0 Z   0   p3P(& dⰠgHP 1 ? T pb;wr RSrQP ᵴ 0 0  ph||| 0Ѐ Q 0 $Ѝh))`))BT)))U B)l))))\)O-tMPs0P 弐4#@`(3\%R !0 0 S  ?, Q P QP kPP X@X(x dBPH" PpR  Pt 1dP1dh 0P t ddh `6P , P @ P$0`PQ d h0PpppP PK1P  R0V : 0 Npp!Q\.0P p@Lp$4 pp $   $*㴸-`P d(P P0@0/ PtЍ(`a`)h)T)))U B))()\)))l)O- ML`P0 PSVC2 c,3rOQU 0VuQS /r S00ZS  PsZP YP" 0 l? `R w Z2  R4 @U00 PW`0 U@  p㑉I+PU`PU  pPs*@Z  R  p,Q( 0 Y *NQT 0 J w*  0P  0xq@P p@  0fqP 7@  0WdP`0 9*JZ0 0PP Ѝ `))) CO-DMhh` pVWP ᫲,PV@Pp0 ` W ` p ᕲ  hW 0,P0  @c<D> 0SS>CQ 0t08P`PC p`T%$ 0,,8_R0PU %< R `,!S2 0TpS` $0P@㕨8+`VpP 0V P @ 0P*0p0P40 $pP@̐WJ  `*T Wp  # @j$PT@Q@ 0P@ Q< 4O:Q 0,( `0 0S R  0  R  9 0 ,  $h T 8P `",00 08?R00 "<@ R 40$ !   ),@`(  0#P  0! R   0 Q 0 1 0pp0 (4`VVp:8^PA pXL80 0/Q0  $,<P  _ 0倁, P 8 0 4`(V5 0`F4`P@`pDЍ@@Q 04 $Tu  0))`)%CEC\)0H-HP@8+  0 t(@0@0`)O-MP0@,P u$4dpppp \TP!a@Q'y@ztzz}z}}}}}}{@{}X{`{}}}}}}h{t{{EP FP PP$UPl XP BPzp8DPe (?P_  0pb  cX p "PI x PG hc 0XP@8r*&p m0  R *btpn  ghpaLTZpTdPKpp R`Y P  `P  *`pPUW PP lP U3@Q].{PPXX  0/ppJk`@T@bT@OCAJZ@P@Ѝ+LjT) d)`)X)T)\)C)})|).))P))| l'DDWDx) DDDt)Dp)l)a!h)C kwDܡ' l.DB0X)H-z b!`렧'Gp@-M@P` 1CQ QЍp  0!DO-MM$f@P6PP @ps PPn k%P P P P xhtP hbdoPPiP<c"P(] PW P PME$@  80pa!   6XDt@d!!/00b  0W 0Td@!!P 0L4$03 0 ̳bacPe s$ @R 0  LaPP 0 ,po0So7W'|c4@`/8P@`u/@p2'5P# ` X0u'  0  aP aPU B aPU `BP aPU B `PU `$"0000pRP A\b @04*8<y(0P # bP.' ,P ApQ @ ,pW:@1 0 S P pVlP@P& PDIP 4DP $(P (  00($0@$@P P)@Ѝۍ)x)DD)`)DD Ep)1E)OErEEEEE)F))4FVF)F)FFFx)FGt)))l)))X))GX)1GG;B!!gGO-MMdd0,P< L0@k;%\5Sp0[ p0p p 0p[ `P@`_`P@V@ON @@F`PVh,[:4@HL$00P(Ο_^A`NP`PAUP Q pX&, tt?mppRppppt p8 $xH((((@ @<4K 4mX@4!\5S 0`0 0 hOh  ?$  Q P QP  hlQH@P  X pd,`4| 0` _0PPVX`Az T*d@A`09P p(@p,ppu`:hp(\ l`pQ @TQ`P `P  (l0h T0  04%TP p` phpPW POK00!  Q :0QQ: \RVO:\P P 0^l`hp< 0o\@$"P Q, ,+؋V@(0 㞧hpPX X▧PS l@0 C}"PQ0 @,/-h ,` DP1  @@pwQGZ"hPBl pR4 Q% ѫ0# \l`dPY`:@hPQ ᱫ0 ? ? 4`_P`LPp0 B?qJ` *8pp R`Dp PPTPPL >8(PJP  RL :(Qv P<QLq*P P LP 2 0e V 1 ]: FPf8 F0t ORt#AQ2 0Zp-L0 RP   ;q:hP  (P 18 = pd 0T`"00a#P# P`hPlp@P L 0 `@]( T`pPh% 8|1p P PhP `p vT  V)ʆp( P (1_0iT Xh V8Pt@ V? < pP UT! X0P @A_p- QTPp P`L@Pd :* R \D tpPN6P> *l`L@h0`P`D 0>L:0ST0= P!  P n 0.* RT * P P [ 0 \t XR 1 \  P`L@D PB  R\@l`h0 L\@l`w PhpQ3 Q pP hp#PpPR 4P ,Q  pq0p1 p t 08P`  8p  ' R P t 1PX1d0 `)h))TPtXdpP4 `P TP0 `h@ \R 1Q ᠩᜩQ  0 Pn ?PT@\nTPX \Q 0PP  TP0 @tP@PU  8))L()$))' TR\ 0\% 85 =LpT ? pb0 RSQT   % R 3<0t p2/))@TP@ P 4ᒡp  %PP l$ R hp ))DhQ 0hp 0! +  0 P?P lG`bP  PQ # R ڨ))Q 0hP 0 &$( Q 2/HO[x-))P`r d`@0 0pYpr`:p%0&0tr[ X@Ÿ40P0003`PPS`Pad (r & %E Vt*A,8Pr pYXP*(D Tp/x) IJ@BP P$ XP$\T T0 P@T0AX`X)qX@`q,@T:T pk@T0gp` @0bH P:Ѝ؍| GCXX 0( 9H I`))U ))$))H)3H))))BIx)VId)I}IIIx)X)IH ))))p)J4J\JJJP*ImHIH)O- M؁H PX`RP:  @)P d"Y\ p R <h pW8@R`P   `PL.  H`00& !+a 0 P ;3PK Q | Q ` 0`& 0#0 QL"`0`0`00  # " `pW P $`t`P d lP@PPe<`P  ЍP WP)H)HX))N)t)p)HHJ)O-lMPX堡1 0 X,QZ x@P Q  pd,` ( 0`ZQ4 pT):P$ ` @ QpR Qt0\0Qt\`"P  @PpW:,X:lЍp)`))0$)J'))O- M `V7@ЀPp  PpP  ! "   Z ZQ P `Vpp Ѝ)Nt)O-gMMm"AP , v P& P *: 0S3 R ,: 7 Y P  t OT P   0#     rPVR , , MP "( 0|Y|I,x9 㵱 XT!DP8 78 X(p$А?@$P `pH@QdC$ 0pXp(P `P4`(P5E((PZ4(`  (RY Q_ u]A_  !'( R   GP 3@@d(P@ET(PP& (R Q )Q   Q      4 84PU [ (@ 0 @[- (@0* ( 0, ` Q1P  0`0`0 P, Q(: 0 @`30`$ Br0 (0, (`  R1Q 00 `Q`, R: 01 Br400` @0Up@0,0[ $U10$U ?@p8X:Qz <$8Ys* (`p4(Pg  XZ X (@ b X (@ Y (, 0R 4 0P00,P U: (, (0R 0 !, Q:0P@0 Z ,4p p@0 X Z(t2/%1Z(t%.8Y:Pp8WV*| 0(0S `0@&P#P0s8pW:= `  @0 M|QP&  @@@ 0 0P @|0 * @pAPP`PpPQW:pW*P    " pPgߍۍd 3K?KK))X)KHJ?)))($)hK'))K`)y@?K)KD x)KLK00@/O-IMM@ @P8P# P Q 2/R |,03? S *Q 0P H P*O  @`V PJ {Q 0KQ!(,% HHH|+_ R  `p  QP, 0 * ( ( SPY @Q+ @pp%JP 6o  = *+ 7P4Q 0/x +P1  ᝧ(@p ᕧP  ሧ A  PP@p`Y`Q 0\yQ!L(,ㅹ (( p p> P  P  /r PA0q   p0 P0 A pPG8 @0 B S qWpW ⯿P/ w ppqP PP6 + 2pcPPC  pPSL  0P J 0GP 7pP+ Pl &/9Pb _1P  PN`0`0P`0C h` >B&PQ `@p t pnP  0 A@ 00O R- P.Q`VP4% .P%PPD| 0 Q 0T4`V *400PPy(P* Q 0PP Q 0P P Q 2/P0t4 Q0 0qPL弃PQ 2/p`GP?*PpW \PH`PXC Q 2/ 0>BP4 PQ 0t Q /* R   * R   <P|GP:WR WxPj0 S 2/L2ebQ 0p0 P1  ! P 02/?0 ll!0 `P TFHPP$ PˡǡP Q 0 S 2/0p00|Plp@U Iߍۍ(  ))))P!KKX))L)L5LCLjLD {LLLx)MLLMPMZM)MMM2M):MJM MLLQ/0/)O-MpQ\`s/0 AL0 Q @K `PDdu 0`RP`(  @R@p00R 20S20S W* prP&P#J@P`  PT 10S R @ p a:dqY+ 댑PX (PXYp    `" \"t!`"`!Pp R Pt1d0"ؐP#*Ptdhcw |P "Q M\@LEpK[5*ߍ))$)M'))) ))M$?))aNbO-lM@Xc,Q B Q pd,P  0PRQ p@U|:LL2 0RpS R0t01\1RX0d0`1R0t0\X0d0```X``A0V_4($(`t`V )P tP6 h!R0 8*HP'  0`0#`&0 Q#P P  0P ` 0`0 E0 Pp@Tx:,`0@,XO:lЍD 0!`)$)8N')))NN>x)`NNx)NO-,M<(@p`P? ᘹ$P4\%R !0 0 s  ? ḵQ P QP |P(p(pP X0P YKp$P BpPo" pDa P P  "0* M Q$Pd(pU  ?"H0P?`.1$2H PR L 4P0L(p  8 QU 0L$p$p Đ$p$ 0 4   \!R/,$P p@`YpUW(A*FP &P P@ P,Ѝ(@ 8P `P?ᬸ2 L` e"cc`c `US&Q0`)h)T)))U N)p)))l)O-MMLLPp@$@$PdpQXP-$P'NP 1PXP N.$``*ơP v `XPv$eVVqVoğP` 8Pp0U"q0p_~PO1.10!$P` $eNMP < p 0on 1!$eV`P@Wu_~qq P- Pp`L0pP,Pi L,pPP*L  P , PZ pLq P 1PpQ؋Q$5!SPQT!ϟ`@PYDU B_ `!>P!Xa\QT!1XBPZd`0  PJLQ qATd ADG%|t?H D8 < x@㼻$o PP0 XPUH%@㨻 8 0o0SPb`/0`P`ΟONapPn@p@@D@@P@,P2 TTⴐ4pT\lXPXBL mhp@pP d>,Peh0 P{Np?'!\%R !0 0 P_Po  ?  t Q P QP  FP P pP SP N x儇P @P @P 4'\P 0p`dPh@ e?4r5 pU%7Q Sj 4!\5S P`00h |_o  ?gP X@ h 婟 P ]/@\Q@\PPP$ LP `6'\xP 0p`dPhp@ e?4r5 pU%7Q S,Pl,)@ RQ@pp@X lDX p %QJD,A\QJ P Ձ@;Pd$P8 ,P`p(@FύT@! S0! R !X  xPh PPD,PLܹX PJLp P2 PAP!L@@@Ll+@QL!pPU:W:PP0J/qSL!0AV8P= 0p_^Ap~Pp0C7 0HJSP0pQwpq8 RPQ Qy1 `9RP 01 2 + _P]  PK dRX)QD! !0)QHPE `)h)t))O!O))PET d  ŶPp  EP ᶶ$P`\!08 818`VW$̷P1`P. \X0 p`  l))Q $UQQPQPUp0r@8O>OjOVO0`Q`V:Q $%Q! !t / a| /Qx /ALs %/  P0 P · A(h 0@K\P  aE*\P  < )P 崐 ?|e|E p,pW:d)U d  `P%PDQ\T P# XkP d $P\TQD  D ))'$)P Pf P0 `4QLpP\P @ P\ !P @T`VTP/:`D@3P`pQPP @ P\ ! P @T`VbPLp"Q\  8P: PP5 0,"P\QL  a!OT))OH@%^ ؒPK  P D0<@`400 000( 0000$`,0 0I(pP 謀0 * J|P   ߍ؍p)l)h 0 |)`)))l))~O)U )T$)))Pd)8 ).P)RPx)oPPX)P)PQ%Q@QOK-Q PPpP`gI`@bI@T #IP V: !QO-Mr!n bR@1% P#  9I*CC儛P 4d  ,  P P@P) R %, %*SP 3  iPf@UIT ЍЍOAP P P,`))QQ'Q)l))X)QQ 0/))/)/) M@-M0 @   I F렧'G-p@Ԑ6QUP H`Q PH MCth0`yHUP 9HUP @Ga $hHmF)))K.0Y. MH-M    ЍH Ѝ/ MH-M   ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ,FO-uMMرN0p@ @, p ppJ P-JPJn@  P*  P toD 3epP   p lpP' PZ'%8%<5" #kP Pp   P 8D4(l uߍۍ);B!.' )....H-M ,P DD 000>G 0 6GЍ). /H-Q 1/ T)0H-0P0 @ @°P0!X)@-@ 㵰㲰@O-MPO``(`pVڤP 0  P  P `pEPK P "G尯o         /@ /`X` {/p v/PT WV!<담. ꅴ. Fߍpڜ|Fر P R `T~p 8~LR> JpA@@PV 4MPU/F+\P p)ʒP!" x  RYP9 %, %*٘P  P jFI tQ>Y< `PvH/H0DSm4`PhX PPb8 r? L@pP= QP @ PI  '>+ ,0p0 lt`P\~<8P?@o_pA  #`pW.|4 R ( {Qd PdJ P; <zW`P AT* ౝ[^ `4P\ X[ QY >0p8 8Ė<\S$ P -@$PA` P9  @0X# *PET : H P h @X RQ!  @ %_ P0 < %  %*ϗ  P  P:= P *㰗0  $ P ` <dQ:( P < *㑗  P Aq P3Lq+ QQ%ڈG R haPHP*^  P > P 0 Hq& F0 aRH 1P P*.( o  P  4 Lq& , o F4 aRL P P*xC lP  PZ@唟唯F~ \4S) R& PQQ PUQ P8 ( K R  : XK QДtP DP | Pp .P*㣖 P S Q,QS 0"!& 0C04eQ pP P*m$ P M ( (R xQ+<Q) xCx P< (%P ;P P*8Py DP  H8%<5#"( u8BH0/S8<%  PP*G |P  @L@%D5#"G BlQL0/S@D% <P0^P2*ӕ P @ @ @ pP )T))\)HL0N-H@?@@_!0/@QP,%R{PPF G)|))BRRR)))))`)Lq4 QQ-0N R ePP*b P B d)PkRR/RdRPz |.HPL0P4e00P@ XLPݭTs *%P  Dxl``PTp 0PpR 1@LU/Q `V*Q:QsP hPX'P y q Qt  cP {PPb W [ V2V@0p @p 0P@w@@`D l F? Ԩ@D`P T P$"Q    YSPPT"2rRBpP@?tpqtQ QLR@  ?! !1`pppppWV0 p0pWP!p01|A0 R  h!s0?`AP@P0UP t=T)\)H)))`))h)ZWTRuSl))x))))t))TU\wUKd))|VV)VV).WX))))))))|)h))0)LBAL\X{XJJPX%\XXX$Y)W)) X))5XWWkWFWWRRRR!S:SWS[[e[9[[O- MPU to*  0@P Vp'ʈuppphh@ ?ͧP` 0P 5P p WPCP PPP PP3W렓P `P @0Cps*P D#D\Q8\  A$o h Y(*@ Ѝ嘂d 4pG1%{sW!\b ? D PKU! lRBF,PPq Q*宐P _   _, @?!\5 S A 0Q ?9@PTP 8dAxq h v@P *,!\Q\UzP P T@h Q p耟aP0 R D=P@pU:P@@]00nh)))WY!)jY))Y|)Y`)YYY) Z`)8 T)))d)x)\=ZlZl)p)l))#Z||   p \Q d Q\H\PQ 0 \Q , Q/\/l))8 TT 8p)! RV  0SP 0SL 0SH 0SD, ,0S@0 00S<4 40S88 80S4H H0S0L L0S,P P0S(T T0S$` `0S d d0Sh h0St t0Sx x0S 0S  0S 0S\\Q//-RJL%R-)H-P` < @0X@\p< p X@@0\pk?φu/c _h Hp@-P` @  ^S>Q`p'`&p @T@T  @  0 00P@@ЍE)`)\K-M@Pd p``2wp0P PpQ`S! 0 T(D D000 0r`Ѝ`)\))`))O-MP PX `@V T po@!@1V< 0Lp pT9 R4젟0@`L3 BR@Q  8H$dPL @p e%705 U1Q S P  0@ `RЍ)\\3I )`)))O-M`@@P0r!p   *P0 PS X0 ᅧ@6:TB4p   _* R+ [Q !o 0%@ / ' o ?  p 00X@@d09P  `Z 9Ѝ)K]P])F~]O- MPJp`0@Pᐢ!( *P Ѝ 0P9T P) P n 009 P`U ЍOf9) ]F)G-PHP<4PJ,(PP? DP ,PP  ?Q 0ꬓFP$ P PJ bn ? *㭋thP ] }0SySsp@T TQB  PF rARP TbpNPcapU @ U`P# P"  @P$T$X$*@NP . @ P0P 't!@@*'\hPP ׻ @PP D0!00*IP ḻ P @dPm0 8>(_G\LA)X))))h)))\\)`))l))0)))]\)X)91"1^l)p^)p)V^x)`)\)+]A-\%U?F;R-R#J + u??΀ CNLU 0`pp ,u p`0 P%0p`P%,0p`⍊p@-`D@PP 7( 0Pp'6)B^HO-MPD0p8^ R/P 2xNP`C YJ.@!2 @pS @000 R@0 TPUppPl"\5 S !0_ 0 pb\B  ? ͜@@Q P QP  ' P PqPl `Yϊ0P @!p 0a"!o P `n q"P@T !DA `P\8p ? W L#`0r`Q#F`@0T00A 0\P  L$p  pG$p R? p G @*p||`嗉P Hx P P PЍ, h)`)))T)))U N))l)p@-@P@`@  +(P  p@茻p`)h))H-XM pP`X@HP` @/XЍO-\M`"p&P@ m!Q@P*  X!H$% 84 \ЍOG& P' `D : @`@D - ᯟ@K DP/  T `X H P4& ?eH+Ո\Ѝd)bD a ;B!0H-@l P:\0P 7D D1S00 0)`))']0H- Q$P@--<.-@HP TLP @8 P 0q' )^]]/$)O-M@\PUFP PJUM PVP V.ZP LP8 Lpq|Q `  ` Z pWQ  pW ׸ ښ 80H  \ ?p  `h / C΄L0P_?q`0P Pߍx)^))]H-P|@paV Q PR (P  `@)&^< 0 0!R  R//)O-M`PL:@PpPE!% !3S 9 # "5 ! oQ,P( `40,(Q  R  tP 0 `pP Q D |  0pЍ`)^F)h)l)) @-` 0!% L#R 9.$P% "  / #"o  `)^FO-8PUp$尐q灰p> XxAa pWQ\ 5_P5_pPQ8PHhp@`WXH!!$!H-`0S4445 0 B A@o <^_H-`0Sd55x55   B o ^_H-`0S5(6 6D600 B1 B ^-_H-`0S666600 B1 B ^:_O-M$uW Őlp|hh79oNQ`vSvq$p p|0Wp!@4OW:0p P[N` A0VU P 0f PX@``PU0@B D  E`T.Q  `R   N` PP `FV0D R| !  P !! B!Y @2/P 2/ ! !2/ BY2/! |Y 0@0ЍG- MpR `d@Ph ud@X ]P `P P  pf (`V`p @0 P3pnW `2! ݍO-MMP`pl@PJ   P)  P/>P rQp#0@p2\Pzp Ƞk≟ _P `pWiW~f Upଝl~XP `n  -@`PTSJhPNJ  !o ሃP?J040 #Z\P6JP2JY"N 01 @P!J̑P~  4pLʓP!01 @PPZ` P /V TJ@ߍڍ   P ` P _0o1m@^`{F~PgZp@`s[ TJP \^/p P X z>>>FF F@A-M@)`PpP  0?p0P  R KЍ0 0a lp0cS@ @*㧃@P X @)`)))l)O-MPpPlh@`T ~ 2|QTЀ  ~P @0$" 0  ?  0 РP `~ j A0 Z)*?`@ `币 @pTP` H1P  0XDP`@ 2V 2~.~@P 0 0R@P) d# 8@V p` ! `Q 0 R-JXP 03?R! 1w R o pP d\P pPT0pp`))p)))ZbDb)\KX)O-Mr`V1( !V   嗾P 0D0PP !V p+XЍ`Hp 0Z ppPx `pW 0@ P X `ZpX  0@  0P zP  Pp W@)Q`)Q))Ya Ra)baX)O-LMp@Xp`P 70 PB ,pxP p(PРP8`U Ez@p '0$  p $` p @p z$`z 0 P`,  `NP rP d P y(p y(p $ LЍ)}b)\KX)0H-Q@!1 #R# @@P 53@@# # dP@L@P 08$@P5*`)^Fa)HbbO-M(`,@P 0|V` 0p|P @h`0P " Z hyP`pUЍA-M`p@@(,0'P\(P\pP 0Prp]0 Xpp!0,0?P(P 048<p@ЍF^^F :O-M@p 0P `R py y  y y x p@A@Ѝp@-P@`(( XU 0Xp0H- @0PP* S30 S * S0(( P,$0 U0O-\Mp`W0 W1 3P1A2P1A2P1A2P@P  0 0+@VYJ WW: Sp `y@PDp&Q:  PRPX+( DD @,p,p(D@ `p0$D @48<< 0$`@(84 ,@  DP 0 ồ  x*O@% \Ѝ K;SSQ;D44 $80, (*,DS;!SR00;S%PU:AiU0 @@<`E4Pc' &(@,TpP`0@$@ H,$ P0H`LpP,QW Q QPD@ p4a"0SQ@<8p<< ? 3400P P@TpX  # " P@D@X p8P8D@P 6@[48ppWqD@@ PPPTP PTP` _ T PPUW D@PpT`V ! H PPp!T P=P:D` A "0SqW*P ? ᵒ40 0P 00#`(0 D08 R* B8 Q    D`PUYD`DH Hp'&,(&' @ t 0E)O@Y@4@ @0 0b0t)bLBAWb_cd$d!c.dAdMBAWNBAWOBAWdid@ed@-@,P ` T宷,,&8P0@ 0 t)`e_cdd@-@,PTP @ 0_ccc0H-0@PP 8 R B8 Q   p04PU8P0(( ,02  0_cUdiddO-M,P/ `p@0 QU    0"P  PPU@@4[$Ѝ 0F ~_cccO-MpQOP 0Р ``@`Z`Q` @FT* `:[0 P@[Q?Q P'PEР `:[0 P[Q?Q P p`PpVQ 0  Ѝ 0K _c0edH-,P @NQ CP\ @`P'`&P @TQ$$ (0 0a _ccccG-M,P+ `(pJ(W @P P # "  0EPP pG@ `WЍ$$ (0q 0s _cdccK-0<S 0@ pTppp@W@`LQIWPQ@P @ pQp࠳^0  0~ z_cddH-M@\$P p` DD 0'$ 0`Ѝt))yeH-M@\$P p` DD 0'$ 0`-Ѝt))eH-P ,@rP NPu%\PPQT`T@p  T \'P pW|)ex)fHt)/f@-,@P ,Q x)H-M0P,^Ѝ Ѝx)0H-P@ApX Qdd Q 0 D`QaQ 0! 0))`)H-MP +P, R@!h `Q a AR *7.` @-H5T8P ,$B `d# %ac, %*(yiP ة @!. p   0[P" OhPQ \XTA 5d#, %*x47(P ᦩA @d AR *a#BP(:RQ% Q UP $@ d#a#*xl`P t<@ @Ѝ^$x)t)`)\fHwf)l))fx)fffO-MPt` (T P L H D @ < 8  Q @E$@@ 0@@ +  0@hP+  @MU   0X   0 @ qpX DH:p@(@Ѝiܡ'!ijjiG-`P@tq fP p rP@@P " p  `P  U G1oP S`W $ ۏ p VP$ ͏ p Z `P$ 徏 p S ܡ'!qjjjUj8jQ/H-$ r0Q0#1"$#!O-QM p`V pQ^@ ఠ?`p@>{6 W  pp?{7 Wp|@TpW&*P@LpW pW*`$c`?`@P ` \*$Vp$c PP?@PP@ ` V@:O-MXP͠0@`pWT ?ps@TP5T P@0S6 @TP@&@TP@ @@TP@p@TPP1WP1U:@ℰp%7{p pp@0p0@S VS*BЍK-Mp($D` YP f$P 0!  ; PЍK-MP$Dd' 0 !`   P`ЍO-M p@P p 1jP `t `Ѝ  Q 3 P`rQ "$  R($HP  ኋ  0V qP PV " t 0pP`V0%1 # PP 8  0P `P $ 0X PkQ0$!0  $  0`@ `P [ a P`| [zP@`Tv T( Z+ iP/ pD 0 PPT $@ 0@P  A P P PA P@ PZ:9Q $ 0#'*!jk5kJkNkT"' RkjjM0H-MP@ 0@ 0Ѝ0HЍ/M@-M@P 0 (=  Ѝ@Ѝ/G-MPp`IP0 @d`H <0@$LT8P,40$ ;4Ą(Cp ?p H  P)$tЀW|p b "@+rp p~/@ЍpWP Ѐ X   0㮈`pP 0P  0` Ppl 0b p   0ppqp  0pJp P2 V0>간崔  0o  (# ếp pW' ᯿p Ѐ  pst P P $ R~*0pwl hd@d@kkkklPl4lkkyl~kMH-M 0 0 ЍHЍ/O-M PP% @ UP!? "R R$ P PP 0 P `  0H`P @  0P   0  0 @Pm P 1SS@[ prs,|` pPp| 0v pXP!D! ^1S SS@H L0  0 `p* 0 P P @ \ 03`A 0 @P`Ѝpqq.qUqgqKqjP/@-M@BBQ L ⅾp 8$ Ѝ@/d@llK-@`P p7 ||P 6 LL< peT $ K Kꠧ'&@-@vP pP  jfQP(( =mmlK- @PT0S `pPu 0S"%T  0XS pp `rP0S`%a"$& @p ;q H!Wmmm$$ 0H-@"ȠQPRPSQ@@0 T /$ T! /$  T! /O-M` @P T6 P؀p0 @T(06a Y P㐀p0PPpp0 0T :H`@D 04P@TЍ'y3I mmmH-(4$$,0PO-$M@PP |P $Ѝ 0P+ $tU` H0!p *SY 0 U0P`p\0h pUppp R0W0 Q pPp\ 0R`_  0Pp $PT p 0` pPG pZ0  W 00#8 \    8p| $$p`2r"3,H0` R HRP `T p`pa P`pV:LP PXRM 0.pF 0  0  0 ]P  4$$  Q $@ `mnPARTEFI nbn=n#nmO-Mp@Q W PPB$-P `  0PPPP I< $ PЍ`*pppp@-M|` @PRhuPp 0r   cЍp謿.nnn0H-hRLR aR bR*#iR sR tR! P d@PeP@0: RP2 ( Ep @$&@0T".nnp@-MP@QL` PQ Ѝp謿.n0H-P@Q 0,3Q00謿.pA-M@`Pp+  P # 0RS sS bS SS pW bS S BS R dOPJ $$2!PЍ謿.O-M` oR r 0(Q0Qy @pPr Pn jPi P P^P[ (QQW R 0#"N R " 0#D$p@0 PT + p8$ m0i0 pᾅP- cP   cP!@ @  9/$ p'   T 9/$  p 40 ` 9@PUpЍ@ r _cPzpT" oA-`p@^PP  7/$|p  7/$ qp 4 PoH- sR iR aR Y p%oA-M@ P $T`p 0  0P,(p 0` XP 0`ЍW 0j`booNoO-M@f P p儠刀P`P `V    G PP Ѝ謿.o!!oH-0p0P@` 0`V!oO-$M @+~P`   PRp NpPU \ `/8 P$8p 4p$Ѝ3I !k oO- M`Q 04@pP < ЍOP P0S* $0D  T0#+ *bP#   Sp $ 0 T0 У0  0 @p (  T"Jp.pppH-`PP a@P 4pP  @T".jpp@-M`lP  @U6p8 0P  Ѝp3I p0p@-MPP0($,4$$$(,0@㝁 0&P ` "r "#| P80 hP\(Ѝp@&@@Ѝpܡ'P!rrr>srrr5I s!sSsO-DM@P8`År<  rP>aB P?TTTlP\ ]눡P  PJ  P5 , 0e@0,Z B  sPsBP:-LR fp%r0S P t WPZ B@ DHDЍss.' 0spܡ'Td! 8$ O-$M [ L p P@`Z` [ $ЍH` ` Q pHp  pn "0# H  @ '0%  PPQ$ QU <2Q 4"!U(1$SP@Q QT H 0@ CTX@ $(``P_ TXpHPLP $ .' P 0@0R 00 P ``  $@00$ @T@` P`{(@P]P$   Z@p@Hp 0 Lp p0`P00P`P T00Q  O Hux!ttmtttP/@-@$P Q@NO-,MX TP\0R, `Pp @P  0TPTP  0@ ` p 0@V 0  0 $X(F P=@T9(P5$P (PR`pjg  0cgW0 `P p  VV VX,ЍRKV0 000PyO-MS9Jv.vܡ'p!!ZZ!^vJvp@--l@/l`d \0dPP L  0o<`<@PPEuyvv'vv!!O-,M`P(Ls(@  pP pp&ePp AP fP sPP (@P` AP   xS,Ѝ  0$ @p   `P$Rr@s` p 㰠P1!Q P!@810  7!HRR&t 8 H0X p(` P@‰XR R R Q R  (  00 p| px $@\ᆀ 0 pl@ b4 ^7w!ܡ'!)wWwX8Lwpw=wO-M` 0pP 8QQ  RЍ(庨 Z @ 0S 0 0S000S@ R@P< 0뺨$$ 0p{Z  P0#S:@ @l01 kB<0 3/p (8 H0  (唠$D}  倀PTPpW:WEVww!)www@-@RR R R @ R R@@@)wp@-0@P R CP琽$pL̽ pSp#S:``` @ pp pppa  0 p!)wxK-MQ @P`P <ЍK{ ws$R 0 "0# " *  Q   o/o"R P 0 ЍP U0ap  Q P  0P  0p $Q 0pp,)  0pP# p~U   0 0 p p 800$D!YxxyjjixpxM-M`@Q V$ĀP ꬀P {ؠ `  hP p T 0 D ,  Ѝ`*yjyOy=yO-M`Pp? V V2k쀟䐟 BЀА Bn@0$$  v p H  L 0$@{p L 08   Ѝ`*yy=yA-8M P@8`~xpp4 p p @P4 0D8Ѝ}zX!ܡ'D uT"O-LMP`D@<840(,@s8@,0@ bP p qP   0:p$ (P8<PP 8< 0S0S @p"`!p PTPLЍ,00@ D04,p pPp @@D,`5P pF $YP $$ 0p y P pP pWth Y " # # T 0 0 x 0 0  0@!$ + !(PP$4p  R.pv $ |Pnezܡ'l!T"zzoz.pO-TM(P`HLusH@ sP  0[pHp qP+P%HL  0P P\@p1 T  @ D$$0^xPp P  , D @0PH L0 $ ` < P   PTЍ0 4 P* P&  $ p,   QP D @0,'p! P `p  % 哒 Y8*`pT  WP  V  Rp`8倐Y:D p@0RV _(P<pVZ`,pV࠳ t  V $V @`D  00Y PQ;08 s@`D <0tP(0  @`pT  0  V0 0 P  4$$  s  h%d2p )0@D 7  0 Y0@  `R\ $@0 `@P p 4P$ (0 r  #  R000 Pp0$zܡ'!x{T"{{|.|q||P|{V{lB{{zO-$Mq@`P   =aP bP iPTN   TG TA  p;p NP7 lP1-0P`P  0S0S `p"`!p P 0T \P  0  MK$Ѝ|!!ܡ'O-gMM|ipP @  tPa@ Q&,,,,,,,   puP xPpP Pgߍۍ PX屛,P P  0S@T `0"p!0 P @T$ P `P `V$  PG' .  '* w|| P \GG`$PpP    0 `pP @P` XX X `pPP @P` XX X Q   `@P`XX d  `@P`XX |X  %G_ 0% 0wP )q P `%l5PT DP (%0(E  $4p## )pڴo $4##h `@P`XX X j 'p8$ m0`P XN # $8唚GX O @Q* #80 P  $0   #$  # `V HCH#   8# 0c,, PP clp @    `pP @P` XX@X `pP @P` XX@X Q  `pP @P` XX@X `pP @P` XX@X   `@P`XX X pW5 P $$@0@$$@ 0@ $!GO0 !`0vPG oG@ p  0h '@8$ m0^ \ # $ @h堙P}!ܡ'}!kE}}'$}' 5I !*}U})}}3I p}~@~~r~}}"~~A-MPPI`p@L HX    0̌rP@@ @$L 0@S; [ |!80 @VQT >C@!8! P0@\ЍA `  4 V86  P0+&ЍA  PPtq0d W| ЍA  P8$ m0Q P, 0  Ѝj~~5I ~A~6~~~3I (!r~d~U~@~F~i/~~H-M0P@4ppb #  'p8 0h P b  & Ѝ3I 0O-LM P@ 8`w$8 hop4 n kPLBP PT 8%p sBP!*T  lppLЍrT P8 SP PPD 80lR`pT"` !!ܡ' oG- Mq@`P  aP bP iPT  a T T  p_ ЍlPp P9P  0S0S `p"`!p P0T 8P 0 *!!ܡ'O-LM4嶀ᴐ `Pp8 0sP㰔00<0岄(PDP,`E`F <@ P _RP 'Z48 mp+lP`p<@P HRP p'W48 mpJ`FG `(`H0Ip4 4800KP`,`$P `LЍ! G-8MP' PP# (L 00 `@Q0  ppJ P!0 QQ1"2(p40,( 0pc2P  0p P`8Ѝt@p`sP p'W1 00(pbRp`P0 <!O-lMP$ 嘐p,P0  @ $ `@ @`` A @ @a :/p'WlЍ! H-0p0P@` 0`'V!A-t A `pP@ `Pp @PP@TR 0 A~!A-MPP )+p `p @ pG PF WH:pW@+p`0< 0?p`9p0$704$0p`0S0.:8t00N , 8 8$ :  0p` P p0 P` PD00Ѝ耜Sؼ׀̂O-TMP+ P@8`Buq @L  U@P  "p'P LR  pTЍO]rxPl  0P P H  0H DTЍ,90d".ܡ'X@-@R  R 0 l  )@-@R  8 )O-AMfvP@ oPpgPc`P $$rt@Py P7 p @@P-TT|TTPa 0 <P vPX ePp@pPPa P/  P' !YP! !SP !MP !GP !4AP  !l;P !X5P !D/P  , 'P r  P   P s P WpP P @@T Wp @PP` tP d  PI P #80 P P rڼP  ]sP &P $PW @P X  PP "`0 ZPy "@ 0 MPl  0!Pe  x0P^  `0PW @$ m0P ( )PH {PC $ H@ T: P4 @ ԡ`P@ pWgP9 p4 $qP#  P& PkXU 0AߍO{\ @`s @`o 8XL@` 8^AߍX HH H04h h0 ` `0T.ܡ'x"W*5I 2!n! x> ȃes}g=!Ճ+:GUi'0O-AMp` \L iPp FP P$$(,0`nPP`@pP  AߍOo  P  @ bp(P ]PB P $$0UP:   P   P, s/ P& tPsU , 0Gh!  $$ V$P $P @SPV 8 0( $D`pt | mP |]P8 | bP |$RP$ P  P @ P , | EP | $ s ,{P !R$@ whP$D0 g!  0$   P$8 4@!1#g!  $ ̡ P$ 0wp< 0$ , ,0(  08  P0 ( ,( `4 \ 8D @PH0T L`X \$$0`zg! Y $$ ቡ$PR,<`(4`8 \}$4#S#Yg! : $$ h$P3ppAߍ|\hXp<NpgE| t\0UɄ.ܡ'"̈́Yxe1gUnL2!T"! oʅi=!Ճ+:Gx> }EFI PART\=؅@8'O-$MMP @P Y R`#FmP QQ| 0o   NyP H f< ` PpgWbo +g$0P @o { `+P#  #  `  0 yP T jfP v` PpgW#o #f$1P`  0 xP  ?f  p;%V   jYa㬓$Ѝۍ@@ 22%))3I  †ɆֆA-RMx`00P00 0D(0 00 00@00H40,0$000 00@0LPTpp<0!1X\h0\0d@8``l` \0Xn@n 3Rߍi@i3'p@-M `@Pn   Kfp < cp Ѝp E2B2'iY?KO-M@`pnp PLP pe eDP P, PP PP P  uP PhQ @  ppb bP ohZ 0 S 1e pp P P P![ $ Q 1  [gU  ,0(S 1e0P Y  4Q 1  Y l1HQ 40L S 1ePZ @ h᪠P n1P l 4P 0 S 1xe@ `ᓠp@ `ጠp p R 2/p 8 X~p Ѝ|p`` LDd <\ W1 K1 0 x^͇' i?K-P! P zP pP `.@ P dPy K-M@ P)P ` D`p p PPUЍ m  8 p !0 `ꉇE iH-M PЍE @-M@p ( zQЍE H-@P_P pxP/m?,m` `v dDlH-@PAP pZP *`` dDlmm?`H-M, ^P lЍK-8M, PLPA $ P 0     P `V q 0p@0 P PP q@D8Ѝ 0Q!Ti0H-Mx@P PP P dH Sp Ѝ0 0V0TN^i@-,@,@@0)T'8) A-(MMA^@l #p P(Ѝۍ @7`CP Pg@P$P @CP 0Pg@Pi@-M\ @zP P p8^Ѝ 0!i@-M\ @YP P p8=Ѝ 0SN!iWp@-M@`P 4P uPaP PP p P nЍp88 8086/( 0/gb!qɏ@-@8P , Y@ 0ۏQW!0H-M @Pp  \P H 8@Ѝ000 00( ..xQW!p@-M@P `AV*yP P 0*p l `PP8kЍp4(. .֋i-ѐH-MP `ᴝpp9P @ p墝px.QQPPp`W Tp`W Pxi ' rYO-4MR @T @`P0ݍp lpa`H. `0`Vv <oᠲ@ PpW`VdQ pWQ   @ 0"0 PP1/PQ 1/P 㤛8P ˜p p `0  ! P6W30`Vpo@崀PP00PP@ @ U0 P`t0崎 PP@ɏPP @`d@`$-)8")ɚ;6eʚ;'н!%p@-M`P@P  p -\w:0H-Pl@,t@P OqPJP 0$$ $0u- ɏQW!0H-M @PNp `P H0H@Ѝ0,, ,0  N-0 QW!p@- M@P `P P 0p l ``P`pp Ri` Ѝp(- -#i p@-(M@ PP- VPp# $ p0   `q0 ``Q$` EP P` @2PD(Ѝp 0fcʉ"!90H-M @᣾P P p qڸ !0p@0 pЍ0 0C2Љ!i0H-MX PrP  @p((Vh@Ѝ0׉' p@-M`PP @ Yp o,M:////00 /|'00 /'00 /'00 /'0 0/'0H-@|]VPP hP00D PaD"P# *@P d?Q:h ADPP*@0'H- p P)0@ Q:a@QW@ A@Q=@H-khH/O-M(  hppW df@  R 8 Q P gt ,04pW px  p\e p<+@T u @TYout%ttxU`@0000  pVP BWCW NWD aG QsGP& tCAW wrWWX!   9Y$$Q :p 0lW`W;CWI LW@ vW9mW; sWVV`clt!   X<#Q hifaW lWHcawW zW]V`XcV@`RbNQ   x20S0520S1420S$20S*(" R@" R  $Q  10 $ $00 I(0 c P P !*{tx *$ @(` p$PP PP ;PP4?`p` pPxP V  R 2/-0x |0*ؽ'@)'d'L'|'')))''.)W!))))))))ܡ')Pݸ ފl?C('''ˎK-MPP *`@m=TpL9T`尀W00 P   c|pW 1/pmPP`  0PPP PPL8''đʑ3I 'Б(( R/0S  /'0H-M P@e ፻P pXP } pp ]@ p,rЍ0 0/3 i>+QW!0H- M|@2P PK PR P {]L p Ѝ0 0iv)9,ui NH-喆0H- M P@e, p Ѝ0V)i H-M,   PЍE)i-H- lSP'O-MM@Q  [P) )\`⬈P,`Y  ^<0884@0H,P(X$` hpxpPXP TT bPDpZ bP: 0  ᥼P4 pP- P&P P pd p p P `P U VTPpY L`p 8Q P HH p \P P ` &p Z p ኗp Q tJl6 H gvpQ 07 XPD@@\ pa PV * %:ХP p $`pP<%:P p`pPL\pW  2/pW pf@X@ xP r P  p P Xd 䤍p H p@@D@P a^c   $&p R\ HP 0\  3/^_ >  PX눃p 8ppc`S X"k$ @   ,"X4  "J  "<  040\ p"( 4  ",  "(  " `V_  1/`\P`V 0  3/`VLPTP  Q\O`ߍۍP &| R&%iE )))))''i*@ƍ؍'i+)x "9)U&b!3I 6)k ^hs'I2s?JjH- MP@`DP i\ p NNNN $@ PE Ѝ9vi 0H-MP P @PTph A  DЍ0P"448@P,0PPP7Ѝ0?k 3I 60H-M P@rb8 pAooЍ0ip@-M@PP P|P lll P0 ``>bD `X p Ѝp$ & ;t0)))7iH-M@P  =P lLP XPXp `A @P Q Ѝ' D$!o!K-M@P P>Pp p`(a M뜂 ǔp8 PV P @ Ḕp <x4Q o)0 .P? `b 0SR+ RT+ Pa pZ @TJ xPC QRR T@ Pp36P᡻2!' m7P# p PP`! RQ@  + `V UP:MЍGxPD%TT %8i(,!/ : "!D$!3I  ӓi "HD?@-mP$@$@$)7 0H8Oꠧ'\@-M@L ᱶPHH0 Ѝ 0U뢔D!)H-(MP`P& @SP  p(` paP\ $P D(ЍD $8$  $ ꬔ)8i(ӓӔH-@P `@p;P- P @Pp,   0 )D ^!0H-M@PT 0P<$ p@-M@~P @P P d`@ PLPQu, Ѝp 0㥷;)) D! ^!p@-M@JP @Pk P \`@ PDPu$ ^`Ѝpt)) A-@xP @pP; P @P`p `,, ,02D a0)| D- ^!H-`P `@Pp 0p A @H-M`P P p@  0P P  0p @A__ ЍH- P Q   Q 1/pK-M`(P ( pX@Pp:_"Q P _Ѝ TP_"IP , 0 gp A_ O-MQU$& Q P Q @PtH ˴@PHp_Tp@W Wf Wh W T_@ЍW WX P ·ĄP@Q  /`hP@@(@ ^0($0  ,p}lP `P$@( [ {~P (QM VK( ( 0_l`P$QD ^@@``P`^Qp0 :R Rw a`Bv`VW B CRp0A`Bv`V7 B0 Br` VwSS0pSor0PxP:i^@ @ `V  0 Q Q@P:^@" NTW T4=@ 01P3Q0 !P-P* P(  R$ *% `P@! CRp `PVP@P``P p@ U$PP k.`V  0@p PP @P `@T  PU @D8 0@!( !o!i!̕qA-@T `PplYP:]P  0p A] O-$Mp@]P @UK H`pP#  0@`4/P( P+P l]P _] pH`V 0{  PPUZ Z ]Y] P ]-]z]$Ѝp@-$ PR p `@$@V PP QPQ 1/p `V@pO-M(PU$ $`V p@Q gP 0P -PZP ZP `V(]%]Ѝ @(@Q AQQ 8Q R-0IdIlIxIII ᯽bP P0 0  0p 4 \ Z ؕp@-MP P  0 `Ap $`@ @V P4P QPQ 1/p `V@ЍpH-P@$`p(P p`$@ "H-`P@pP pP @B"0H-@PP  R$ Q  0H/00Q /  Q /K-p@P`P QpU tP `PUP QpA-p@(`P P@ @p P"A-MpP,`P T @$ $0(0 0Pp@Ѝ"O- M0Y$ P 8P J 4Q44 Q Q((8YP Ѝ`P$P Q(`pO- M@40PP)U' `@plK0X* @  04/PCPYU@A  ~[@ 40 BpB!0 X!*U @Ap  ` 06/P@TD0X*PU D400 ЍK-R @P`V`V {p6/y P@T p@-@`PP RP V  P PT  [P pG-FM@#PU`P` ŴZ@&8P5 R  pF`Z pp PQRppPƘ JR@ @p(Fߍ ?*Ji_ 0H-D@D4@4,P,0H)')R) TG-NMMP@Fp`)u(q@Z [V pp/ ) +4 `P*(k) 0pd 1JO 0pc0P,0Q,* 1U(() *0Nߍۍ)Ki%o 07+Hꠧ'H- 1pIi 0H-hP@P p T p @fT@ 㖌p@@0,')O-Mp@(Q0 0X t xQxAoᡢ@X8 `xPW GP2Z    # V.*   W B V&*@ 0 HW@0@@`X `\ @p PFP@kYP$劳@Ѝl't'ؖp@-P@QU 0PxQ  000  @UP ` XUQ p@,U `PUpl't'  QA- M `Pp@YW W# `@`Up@JV:U` X  R@gP P`  P4YP ЍH-p@Pp `P  <  H趋륆CH-M pP`@X @ЍO-MMMPc Pp` `K|p] @FX O`,\qXpYE @KVP9 P5 pp NP $ dp !@ !P 0 o" 000 3 ;;bP 3P t3 ``Y, }Mߍۍ<0$ 뱹!Gi) 0 !?H-M`@Bp pP)X  pp Ot p AcX@+P H[X@1P VX/PtЍ iP0!H- RH)`A-Q P`p@UP PP`V@- M  @p l {P T q4X Ѝ y9i@- M  @kp&  #P   NP p CP T q8ZW Ѝ P낗y9i?̗0H-D@D4@4,P,0H)x')^)$_@-M@ p  QR 0R@ Ѝ֗ 0#jEꠧ'H-`@P1W$P ` pTPLU, Rp萗t':i@-M\@ P L  pЍ0 0N\A9!i@-MP @ᏬP  1pЍ( 0M>UV!9<!E@-MT @rP IpЍ, 0A w9`!j0H-(M P@!VT  0p < p(Ѝ0r fM!iߛ0H- M| @=P tP p  p Ѝ04M 0q׭9!iϛK-M <pn \XH` 1P PP> | XP XPT :Q00@\p@P`0  `XP0 @P TP 0 @DP AAq X \!PdH qHAVݍ(( LȜt'o!ќi8)@-0M| 0@ p P L! p0Ѝ($$  :iR( p@-t@tlP!P@PHPH@`@#p@')''()e0)j8)jG-BMPP(U` pp `  t8yU8vU`!rU p !R*cW%  zp P P  gp P l\P X  T)p |p Q$P I >p QP `8 Ur 'pP { pZ PQ pOH!PPPP pm `V !RAqpP!0   :R P BWPppta@T ,/EqS`o@DP0V $8P p$ $ p @ -0P\P  $5Q 0 Q (BߍX$kx>8i(i/i6)@ISf^uli8|t'^i+l ii"/ 0xBꠧ'0H-M P@?T$ ZpЍ0 iR0H-8M@ P 'T$ Bp8Ѝ0i8)O-UMMd8 @2p*   " džp$P QPJ+iPJnP PiP +ZPZ o  PpS|  nappڴ(Y:@ p!0(  P +PP@pG`'W[ :j*PzZ  `([(Y:!0(!  <  0'04g2P8 P@T: 0% PIPO 4@^; |f @DpP `dPN  *PEp U ADQ) Pxp4 `@``v\T DP 0  @T >k4euP )P  0@@TPUUP  @0P@TP>P Q P=@QGXtvvvvvvvvvvvvvvvvvvvvvvvvvT:%PP[ P P  P  @Q $wvuvvHP| PxylD@kP( $ <P 0`<% S %*&S# %*/&S"""KPE@ U$K @{Px;PA 44딲嘢@R 0 p   `'b 0 pp`@T>aLrth\ P D8, P  K[ ,I'Y.0<Q  20fp3H'   0 ` P/ " 0 ` P /S "@-M< @OP  LЍ 0^뛛9!@-M< @8P  5Ѝ 0GJ9!0H- M@ Pp t P  qDc Ѝ0$$ $0iś9!ϛO-dMⳁpʼI pʬCpWP 2p P < <py <Q |.TCPh"hh  cX@` 0 P PV( 0ppM H40,( (@ 0 $Ps 㣀<@GO W H- <렧'0H-MP @N RQ pЍ0  0<@-@wP@@-@ P@ @-M @#Q QpЍ 0H-P@ P /P0$Y0HU /H0H-P@t0H-M @ P0 ' 09up ZCP P  L L,JC噽 (  0!\mO-Mp,P( 尰尀`@ oP 0LP @pDEQ A O뤿.ܡ'T.">H-> c렧'ƨ0H-P@tP /P0$0H輜 l/H0H-P@0H-M PAN0 & 0tp BP P  H H"(B A>.!\mO-Mp,P( 尰尀`@ oP 0P pDEQ A O뤿.ܡ'T.X">H- T렧'ƨ0H-P@P /P0$*0H& /HH-0H-M@AP" 04 0tp wO-M,(帠帰`@pP oP 0DP 8phDQ @ A +8ЍO dT.8">ܡ'H- 03/V렧'0H-P@gP /P0$᳛0H诛 _/H0H-P@A-M@ PA> )$0spt 08@ D `L,<\PPB"FIO-MPp @08Abx LPg@Q!ط    <L d   t9P GP8||||MP' UPw| ||| 0hPc \||h ppPQD0Z  S S  Z`PY[` usp' [<pY@tZ (Z PP@l$||Ѝ [ W4.H">ܡ'W H- )렧'0H-MP @; RQ pЍ0  0)@-@dP@@-@ P@ @-M @Q QpЍ 0H-P@P /P0$F0HB /H0H-P@a0G-JMM 4P@00 0 0H$rpa4@Pp?@KPVP S QP0 P Y0 0rp 2@E P!ʎ8P 0<p 00 ; pIP SMޙ<0 dh@D L0\`dpl`pPt@TX P$@`p QNJލڍ0 0jI )!"۪ Ip@-@ P PP p@}(P`s?`pG&X)(O- Mp`H@0^?H '7됶娆堦 /@P@A@7PؿL LLLLDLL̾LLLhLxLLLLLLLLLLLLLLDLLTLLd8HlLx2P3 3P:PM4Da@ IX( RK a98 y|tp l<g#PD4P a@]Y 0'P P    @B P  P  @           z"  r $ h     p^ $ LT <  (J 8  @ @  6 , ,0} @rd$ tW, wK xB0P ypGQQ0`+44R 3 ЍT-' '.'")))Z+ )D>ܡ'H-mL0H-M@ PiQPЍ0  0Yh@-MH@ <0 @  00@@/몫ī'*a~0H-P@;P /P0$ᇗ0H胗 3/HH- RR돬A-M`PPJn opPJ@@ RR0 o nP 0pЍ돬p@-M`P@ unQ 0ЍpO- Mp@PFp8 p0`pF<8<$ $  04O79 2/< &   4@K<0 p P 1Q 2/R 44m=H Ѝ @)8H-BMjo^# 0142/10 >p0p @0 0 P <* ,,:<H<Ͽ Bߍ ŬA-MP@` p$< XPh 2/R1QP5_U @4O<@< 0 Ѝ)Ѭ(0P0/O-Mp jP `@ p{P`DH @0@3/p@r<P;p@̯WP ` p@y)0 @ 3/ qZ㋐r 㪯P P jYR*$$05<<ЍO-M@[ 3@)P p:JEPo pP0`P ; d,@8  0hIP OI < ٕ$Bt`p PT P p  P 0  p8 ;R7@ P @!0x S3 D  0zp PQ 1 UP ,P ;Q @~P+Tt Pyqp` hD U 000  Pߍ0* L)))O-M-M`p(P;T 0 ؚ݊@C 00000   g@Qlp  0NPy B@@ y8P , s8P ph  @ 3 0SPb@ ] @ 3 0SPZ@ SI P  p GQ$A+1@  :mp, 0(<S00 p@ Ppp 0ЍЍ)+` 'dXL 4 H 뤿.ܡ'o.ЮBP{?t"">|H- e렧'10H-8MMA.NP$ 0 (0;lp. @' P@  ( P ((x0,1P ` ,(L00@8Ѝۍ0, 됉ح4$B̭0H-P@0H--MX 0@3P     )Ѝ몮0H-MP @x RQ pЍ0  0f@-@ᡣP@@-@JP@ @-M @MQ QpЍ <0H-P@7P /P0$დ0H //HO-LMP8 @H 0N  @C E$S4<CE(S8HD9ⲟ9揄, !2/!A4q-"X3\cs2/3?6o7"X3\cs ??j  p  p , p $ 0p ( X1X\ 13?1 Br4 01Ѐ  ŕ$5(u,e<Ͽ3?76o ń$5(u,e@ 8p < Hp D`H%L5Pu2/3?7H%L5PuT0TX0X\0\LЍ0H-@P !!0A-P }  P<Ͽ2/3?> $(1 0 0$(XXdpd012/3?7pI-P0 @ `/o>3?<Ͽ `0 B!="8"D`6oD`0#@`6o@`(#H`6oH` L`L2/3?6oLX8<\L01`\XM`Mpp` /}}p0"S/"!03?0 R/O-M 0` 2/13?: 0 $0$(0 !(,/0! ,02/10 044 p 01?71p13?1 R\Q LpS tx\ 012/tx\ d 2/TpXP`0l@hd p 75_3?94O2/TpXP`0hl@p D!Z 95_7$P  13?1$5 R\Q5 0S  13?10 RPP$ 0?0PT T0pa6oa`@P`@VO@p W,?0ЍTU  +0 BR!q p/G-MM`RQ:@ +. T+ 0P BR!(q!(0P p!pT P/3?5_70P p!rP  P,r!_T_ ЍۍLABLK-M,(pQ@Ppp  sP2`6 Vl# 5_ P  0AQ p Ѝ>LABL Q 0P #:r/ Q 0P #:r/O-MMؿp[/@x1P PP $4PpGPPlllo ,8 Q`40,( #B@4Q L0PPp4 0h@3Pc 3P @ὡP+ 2 10  0#DlO 帩8P `D` 10   0 <-@Q  $$/0DPP 8 v 10   0 80  *0l4 TL 80   0 c00  0 @>3P 93P q#[ @Q vP T 10   0  10   0 0>@q#@ Ἇ@2P@x  0^ 0 < 00  0J O 80  ,0<`@  10   0*K@@:"PX/"PSPf PJ<Py/10 1@@(.  T [, sy2P' t2Pe !  !  0 T X L [( F`  Ap8 @x P P D HEJ%#pP[otQ_4xB AG@P T@P UHH,H<T @   x00[?ffp+X z34/4p& P\P T+| KP pp W,ep`T @ pt z Pz? J p$ zfppxPt @#@z *P;PJzpfpm*l j ?S/P@@[ot   zp PfpTf) ?7/|)@Pt@x$ P )P*   0[Y$p64P$pBDI8Y$ R!Q ʨP~`, zPp}yP+pP*+pR j  P" P$i 1!#$:p $@Up ٦Z0$Pl, dp$ D[LP NPt p3H `q!'P  0P$@V U   Kd`Vp V po+ QʌPtfP  RL+P  Q(*fPPP[oQ,P VP &0ڌQ 0Q 3,80(  @w W  dy dP BP @p1) =**ï}e%0Bd~dcccd%0 Tp txB@ [?dpP2,%B d0@{ȀB_<` Xp- /PZ /P P)  dp! P< pP p0B/pPuPI@4B/X묿.  k}*C*$'**f@d  PT*[`Y p, K/PrG @  /Pm  /Ph [`Fy pPV聟ܱPp [oPBt ?R   Jpd4"4** $"0QSQ% @PP*   [h ' **  P  0QQ[oXQ <$!@1H!05[o_[oPu  0 *Xp ''* ***.**t'n*հ**> >!ZZ!*u*h '*l '****i*ĵ*2d '**ܡ'~l*,*W#"ffs>'#"̱ ݲ b7;B!*L>͝T²Z?A-P@ T0,x(ht @0pXX`P`P pPW*'ù $"TO-$Mp 1``   P@p0S$ P| PaSKC P0H0D00000@kC P0H0D00000@P PBS GSPbS gS x0J(P` \  ` b R40rbpSjQ72VP0ZƟQVQ"P) ()% @P W P%  p@oH0L S P  p`0^$Ѝ\ 0@ 0<p@0p`0  0ɸ *,\O-M-]MMԠԠ1b P@ P< TU ZA`@0: P`P P`pC 0p: P P`p bb0 D: pp# Wp"  kP @/ P / +P Px0 <0o (5,%(,D D R$, <$ P @P 1 P @Z B0 4   P @4A  P @4D Q X P @0 Q*, P @0Ql( P @04 Q@ P ,`@TD ! / P*0\PB\C0\@PXPU XQ`XN;͆PP$0 4@BN_ȟpbnRHpLP@0pS0P^T0QTR@P`@80pS0 P` D1qP9 `4  (08Pp8 hWpφW @ T d威 dQЀY48R T?QYQQP0Xd@Q4!U:8 ,P `4@&8T<4 p01:3U?F;)\5<0@@D00@x@|pQ$P0LEPEXt 0\)$x !婡 H@Q1tpB?p) 0A0E HP? ) !p@!G0Ep/(50$u 噚z"@0S @!1R\Pu DP x@8P@+8<pPo!xpT@8P 2!0 0aq# 0Q0#Q0Sr8< #pPo 0[)? A@pQ`1; P PPP*!1?)PP! !Q :A*Pܑ` 0A.pN$!p!P 1!a1Q``@ 0`<Y0 P?QYQ?@0AQ0`@0p0S Fp0B0a1QpP!a!! 0`PpWp#Xp1G 0(!0B@1(Dᡞ@/X0^ 0a@/.!PV`0PT3_>QQ10Q0U@A!`? (p 0m0a@ V㸀!` 1ؑT/ a!R, ********d '**l 'p '*7**jؑa Q c@Pp$ x帀@8d<`P0) GH ˌ0FP8p`Vß@p T%_`?.P>$U1!!0U08!L 0 0R,p0| p 4 r? 0:  T_Бp 4M,?@ so H44p0o0 /LP0@%X\V Qph? +S~,`A2P0>~  P\% R\%R`d~ ꓺC*UUUU3333**~ ~0: P`P P`Op@J P  0P P`<p 9+PDPl`F r0޽TP R&0 댏`H pJPE@T`VA P !1L%H +0`'ꖻT׻>@ 딇Q L+0 P L* +0j@PV."P f@ PJ *BP%xKP , 0A'"\u W A0 0d/ 0`p130 P/0QpSp0_ ,Pz/h]#QPP\  P0R0CP0R1,@,@'Tl @`XAp@8<$Ϡᔆ P0QP\PZ! @Va dJ\j *4 `@, Z !/@ ZJjK Pf pz*E h [$Q`0pP tx R !x * PJ,@P TX\`/$%R0Q@h$l` R/dPJT P  Pk P P P` <$P plQ>d&4-QTT! !-QPeXPeV d! ! !'@po&!!G  'd&$N n8P Z:L^  0R NN^Q n4 (n|~4 d0P.4(0P  UZ 4P   0x 0S0# !T P`\u;Wl`*^FT**P\X @Tq/7"\5 S A0 dp0 g`6P0   pW0QSQ aP\PK`x 82$PC@ 0p@Q A尜DL`lP`PD !LlZ?#\Q @0`d0 80 0h93H $ XaAQ 0SApTP尫Aa[ *d唫AP@ aPT@TK.㺹DT@@Cɼ$"a<{T[?&#\uW Pp 0pd ? p``2w0 P`S0Q !`0ȹ@P`*PaP ,  PP q@`,V:T g PQ &  R P _E EP: _I` :*#_A EYUY0 l dR 07E\@!U04@0vPLj @D5Lp0? dL 'ht@Y@`AL&Y_q10q/l0q|E0q p`GE04 0 , ( `U!p`43@P@$ d0@ŒDuL c`p4d 0STQ1{SpqP4 <  0`p 06S`V`pp hP@a  +YmU X0- AF0q Q0 ,Pp@X   ` @ PTP` X  2/X  4  O0 XPq#P|QXp  `@ UOFK%\\%R/0 QO?d`\TXP 9t0}(qPLo @DeL / X4X dLA!QAqݯ4 0 , ( 0 1 qa  t 00CAq @DUL / !jXp W @l أd0 c4 0SSQ <O  0aȁCAspP@P PP40Q ?. ?{0p4 嬂@A*P`V.VDV%P PP\(` PJ $ ?  0AP 4 0AdpHd4 L g6P pWSQz0PP 4 0Tq4 daDW4W(KЍn _0E&a%_(] X*Ud ''RP*aHFDB@><:86 4******d '*T** ****** **,!3I B t '"'*8 p@-M@P`P   R tPt!"$! "PЍp$ў, 0߶$*****ýM-MMԠԠ@`PSTQ LpW@@! 04#'p( P P;T P*06 q`V 7Q  QW@_l!\ F0KMq*0hK*$***** *%"H-M@`P P #!p_'"$" ቦP #8T 0F"K(( !Ѝ*****`0S D. p. . . 0/PP ⬶B1 B/0 //ᠧ'p@-`t[@P\O#TPC/EBp*d 'O-ME0d` p f7P `VSQgP 9倵 QMQN QG DT% 0P S` `` o b9B RUrQUQR`0 x0 0 0 `@1 .Ha@aV&`aV Qd\8 _Y0<LHCP Ѝ S`R h1 1 1 1  0H!0H 0`C`$P!0lp.0Hp`@(0@#0P@  ?  0 PLdp g?9 pWSQ QTT! B! QPuXPuW&d  R  b9 Q?S먠   0 H? ᄡ !?A0 P9 4{@80 H  8 A ? $ $8A4  4 `8P `?@>p T`@`A~0o B0"  l `8 P`P  8`d@ p d7` `T0QS_***U 'U*d '8O- M\T`0dP p e7@ PUSQDP sP Q BP Ao" 0R\ 0C 0!.0P 0dP p e7@ PUSQ@0$Q $A,X: 0P @ث 0`?ᐛ#"2++\%R !`0Ϡ|' r! xHG0 dp`@P 0d `T036QPVS `g0f WQ0S NAU/F+\Q%x 0pSQE `z(1!2/pG w( X q13?A qX0/x 0 @XTQ% @p`p !p`Z`p@!p@W   z l,r8@P0 0 ЍO;P N***U **sT *p@-t`P@P H@P 0Pppd '*G- MpR `J@Ph (@X uP `P P  3Spf (`SPT VP 0Np0sPU vPdPP 09<< 00(c 0& 0i e p]hX$T,0p@F D 1&88p 6p.(`Eq&P#fX f ,pP T pW Op"'eD aP& ;fPJkPp @ &UaPp8 KPe Np_ P P,@ u 0P@@th l @D 0@P@tP(P @D.P*  0Xz*$倄PzPh Q,R /\@8`PV.Ve`P64} # p, {R  h0`P!v@LPPL RFVB( pL| mzHP0 aP`UlkMȰ  P{aPrJ pcP ^P I @YTbfA0"  / Nz Z N:4pOP< O@ b%dP  0pV W  M`V_p.X.8aT?  ppL(!PpP (P @D QV$ P P  0| 04*#.0*onH*uD*$'_@* (*f,*iĵ<*2$'8*$'@ܡ'P*,!b%">'H%"ݲ T²ZO-M+`` ;u @P@Q 0SU0aQ JQ 0KQ 0MQ SQ jQ 0kQ 0mQ sQ0pBQ GQ 0{bQ gQ0`pP p`"P 0''1`0'#Qw "0'  P 8p<0 W ЍH 0 0N$$  ɸ \,@- 44@᦮( 0 nN렧'%"O-iMPP@Nϟpo  G"1  "" ? @P",R*?`0F|?0V:@'T  W W O@尐TY R0@ C ! OPG oo g & f f   ! Rv$PVCo  `@wP WP< W $R,f f2! `VS&Q W01@( @d X X$PY `0,0PDP U:T P QR !bPQR` ( @P, *$$`,`($ @P@/M0C0 (ࢂ0 0`fR `$`8< dPN\ fbX(@DPHL \` $(0,04<pp`ML  T@<%/<PGh@zPU PB*x {LY\`\ ᩆP0' ,0@PV Kp` Y  d V:VK  0Q RS 1c!QRSTK\ 0 0 0 P30, VPE0V A0p 0`0V1 Lp㸟O pPh(d_`P!:!&{0;qa P8e 0 (@0"*\ $O0 : PUP 0@P rRp.0 n Pp GR pW  P@j:P ,.  㻫 ^ ,P4 =L QPP PR00CP0xR0$]$TmT. X@Pp((,PLPd +㺵 oRp &#0   0+'+,l6%A0sv @ P  P+" AR*1p71 @ p 'P`P:P `PX:P U:k 00 4(p VE [  P0   0 (P P$P pᗐ$$pdW:0 & 0(PU: P00@,P[j LPdK$P'\ Pb$PUZ.EUPPR[8:[_ P1 Q R. !b P Q RN0@,P: 9U  PP(` P!  T P[:[ P Q R !b P Q R$ ㊪P[@U なPLP \ JP JV %"e%aq' 'd  `l(4miP\ gFvBP$ 0@<P  VGU $<U*0 UP*  6 d$S( ,p&:wP U Q:QP YX h PYXRM* @ tfQ 0PR*Au, 0v < (PGU0<*!!U:LD&^,*3333UUUUT *P *(*<* @5q0 ;003S ;B0V@`%P %P@0@~,AU1P\ $'$'X *H*D* 0p'U*$A $P  0  0ALP ``PFp 㰦`I V `#P p l h dzI&ẗ" | $P V0P :@,pPFP PUCУ& 07V㴰$:,pF ` PV1  {  0 ᴰX pⴰfH$'QS0*` 0?0LpP`JPA\VI @`Pd`plhI |GPPr &X2@` 0 Eob@U+%&0#p0%A0Iiߍ+!    ; 8 0  0 8p   Ԑܐ ᪨,*(*<*X *H*2J4***8*T(" 'ht@*,!3I B  qA''3c)'$'\bc9 @-L(ƞP d Q:Q0 @S RT 0Ad!SRT\  X *H-MP`PTp`H%G!  `PЍ G8*<*T *G-M@LPN TL8QpW,appPq`V5P P+02 q`V 7Q  QWL\ D0ۍG9+0ۍ8*+X *<*H*,**("H-MPLp`@%G!  PЍ <*P *.G-`p W @ ` pP @  PUB@D`Rq@   X **G-x`0FQR vWO:$PK P 0@  T 0Q0 pW S Q @p0 pWᇆ`! 70fF&0r0 A0 @ `  )X *`!O-MlpVĀP} ` W%:( e@0Qx  0+u06&000A@`(`WO*@WP 0p&!&T $&0f?#0(  h0" XQ S 0$&?qLP5Q0ᒀ$   P ((5&d 0DЍOхhT PH D4  00 X *R$'W.G- MpR `@Ph o@X WhP `P P  zFpf (`JP Q7G@ Qg@ P1w x x x w x w x x x x x w w x x x w x w x x x x x w 'a 'k 'fkЍ 0H-@`pPG P  V  0H-t XX@L 0 ~00E#a00~#20~`Pp#<0$0`僠\0tጠP04pp0H0orl0G0ppp03pp080~pp100pn00pp`pX0 0e~p(@dpXp00< P00R<! Lp1 @UPT   P*V [aAi/K  p@p 0PP  @P 0APs @p BP0 p[@e(QP @ 젍 P QZ rPPV ` Pp pFo Pv  Pq  P@TPV젝q0(Q  @oow A 0  00($sU @ P! D@TI@@P쿟`<8|0(,D,@ `T  "! 0@D  T, $  < ( V 8 @@`RQ08100<,|(PP /P@0S  000A B0SR @A@^T`Q P <P8P Q@NaQ:`PxPP`?pLP젍 tPeP r>ap d(G,w0gP nAp `/ [PT5 T@7*<?W?p#PWp `@P(  P 0@0 )!T T  iP A$` 0$T@40A H PW RX /@P ` V`ZDPᡂ@ pU Pk! , \ 3q:D嘐40Zo  @ p  P P d! , ᘐZD40M:|`PV S `S SVU UPP U PURP|` R: H, Y"y@   H[ w  HꘐD40 RH  R^:Z [H @U apX0R?pPP PPP  @ > PH  @ @3  a  $ V :X:UUUU3333aPPU* U 0  V :$p pP?F!!H "Q0 0 0 DX/?+`qPU/ U+Z U @ p Y  ! 05p@HYA$  `@ P[^:0U< 0 U0QV*V@@P匠`P P H e e e        |  0e ~< ,|  p h | z*"(  xlhpP(\P,p QU U  A!| A , # !;QH˟@ @R 0 廝 P 00X P`3`#W Ԡq U!. U(P't*" al c p l d H+S\ @+PL  | dߍۍ( +Ct' P X pT  !0pjDQ 4 eAV $ _ \Y W <8 0RT MY`l 0 E CY|@㼉LQ: 8PP2 @ QQT e(=PTnH LPXPTn⥌弰vP ^04` QV@@Y PP P'"P HR@(Z  V  [ ``U@ac @0C :x 6h 2X .H *8 @)$ :$ $*P[P000 Y< z<QuPsPqC   TpKp I @ eP P 8PR ^A Z8PN8P8PI Q@P AK( (@@ 8  P2 HP`  Q8! Q/GP- 8 PD6h T+SD.( &, `RMb@A{Gz???eAGQW7,  0PPZP H'z8![ZppZp PPLLg@@pr8P @   W!DppZF0SXJ  W &Jf0 vD0g"Q"\P 8Fȕp  D0 g8pXhyU D0 W8pXy D0 H8pIy D0 98p:y  0%00<000%00  \E @( 0 00'a0 U@(0<0;D0 8p  @3DC`p pp0VPP  p0Pd  0 7pL[ 00 A 00SQ: !Q8H@(0 0, $084p0P@ 0<0 0 4$ P pP$Q (#@0D q0S0pPd夗U BDpᛗpPU \  HH0 t7pʠV C0 f7plx 0 V7p0ܞ 0^BP`p\j 0p=7p P1 *,7PAPPP P!!\P PH H@LPPPTPXPzP,A 7PUm++.+4+1++ ++++|cܡ'+AQm,,3I +++++++t' +  ',-@=B' ,>(,P,T,g*' X,\ h,x,KA-pP! @#`P T  gPP gP QT P A!0(0   +6.H-b ㇔렧'PH-DQ 8Q ,(( R,, ,+H- 5ph,O-M-Mfv @% $=; < #P!qE 0 6pLt 0< P4pL @w0 P5p35< $  D  1DP@#0H头<` R D0p0PpW d4!(q!( #H4  A<$0@  0n4P Pu 0,]v^C ,3`Sp 's  `ß `P pPdXs`P4 Z 0B:   A 0A Z@   ? {A Z A pB `  Pdڨ2 ]  PptBp- Xtur $` PXH P  Z H A*  0I Jl| L%@ q  * P| x1PB$`##p3p@ A81BPp@  \  R 0Ap `D0g"Q"\P ЍЍPDeA,x,, + ,+++NK-Mb+T,++r+k'P,,,,X,+,,ɚ;6e5wK+,-@=B'O-M-8MN4ϛ@ - ˟   A 08˟I۟帍席]`p4@   A  0@:Q3@˵0  P  A B* 0 @Pt M P  A B* 0@INH˴LN   1H @M  ~P  A B*  0@8H˴LN@ b2p  ( *2PUx<D.T c|B|_tRt[lbQ `UP PHM @ w(+   +SA Qh r,(b  * R + Z;K1+ B+4QR+ ; ;#K!|K$+S K 6 m@+p`P/t0 \4 0Att ,3,<ܡ'' g %dwRE!3I D$!p@-8@@P0@,`PP 0ឌ,'3I (  0PwpWBAi$b l  3P xX0 V! P HX0 88 0M J  P hP X0  04H,E,,,.*'p ,,*',*',N,,,,,]uܡ'\ ',@% *',@ 3,P!D Rm (0H-麢@XX PdH `< \0 X$ T͇렧'1:O-MM/?@@`,, l`ll|<M∯\x``T@PP P LL @@  P ,P NQ/P5=ꈰH븎n~P  @   P  Q P@P<_@P Q Q @̌Q-  ` -͎@0߈ @@ 0p%P,0⫉u u u h D` L < < 0 } PP  ,@ x P Lީa@Q?⌌ ,  T , , , , , h , , , @ , \ , ,  @ Pb&P# % @ 嘰P x#   0 물 ꐋ?PY DPoP Pf[P} F@, PV(& P] @ rP@}PN Prt ^P,w  P H @@] IP * :$(,048<t th,寈@- PV P: P P @1, d PP% @ P P @ `P aP Pp `P$ @f(0၇P PK o ``\PXPLPt @1 0PP DPP 0P PX^0\ P   +J  >`Pj P@@ tPBPD  @w 0@p \P* Pd PPVP% |0 @@PD <P @E (1Pe  ⹇0 1y` 2 |0 sM ` @PP @80 diP` 됕xV[ 4  'V` @H!A0 p @`  P RP ^ Q  3R V`1RH Y 0:/ooBRHP TL0x`% $#t |P@R QC 4Q0 Q   ?  `N e 0@pQQT@l@hnPyppdhPn 㘷  @們Q p ۆ d |P AQ  QD PB   &P AQ  Q/ P-   tP$* l` PP*l@AP @PѸ ڰP@ThX  M[x弱夀P @ P:@D M ,e`=  p` P @`)Ѝۍ;B!  l ` ,,`!,d!,' X ,x#,J b.!/(k!@w,}rii,FXW * UC~@ ,?%'!P!D | p  9q /rIU~j  !V!,*'@ K-P_ P" `p匐@QQ Q  0B01F P 0p0  p,,@ ,h!,0H-P @P hQ\ 0 B 1 <QP @ P0,@ ,,G-`P*P  P /P../ pPP* dw Q 0/S/Q Q P/R@P5 I@ P  B0QS/SpDr0.SAvPp`FQ @P@ET@EPP/Q@@v@ Q   0#)㱂P!'D H-<iP0P$Y"P㝂,d!,` ,A-@ R R P䀟`!R"R'Rp?o2QQ QQo2pS R R R  \RpQ  " 0蠧'sPA-@ 0P h pW \\!?0`V`p`p 0`pW!@ R  A0 % P *  ^ R ( 0 8 8 0 8 H 8 P 8 ( 8 X q P / = #44v @%,t',@ ,'H-MpP B` 0 d@P P P0QLX$8< X0pDV`Ѝ@ ,*','K-pMll`@B 0 &P8iP0PA $吐P! d`P4Y  0n .P*  X$! P p vP  0 P  0 PYIT@pЍ*'@ ,,,*','@-\\0 B@0 1 D P  R T@@ ,*'O-MQP  X0 P# @P pt X0dQd`pA 1 0"  @WP5:쀟@PXp P# `E 0P  [PW  `$`VP@U:Ѝ,'5D ,@ ,H ,,Gx',O- MPBa @6PT F `P7pVPpp 9 `P PP P`PV W  P  XP@0  P P PU|   X $  $ $HP$H 0ǂW ] QDP nK `V  墂ZdU  TpP $PX $C(ppp X pP B0"  !d"X W> L  0< @ZpPu BP/ 0 )pf{ 8 0 @Z@=|pM@ZpPB 5 0 @pP1 F$ + 0`$ @ 0 @9\pP  \8 (0 X0 Ѝ@ ,S,'kP',-|NIL !x',|INOFNDm0H-@P |0x   `0\    D 0( 0H ',|NIL|ONTAPE|INOFND !0!O-MP  X0[뀑P0:dpp@PXp}PQP@U: E 1 `V P P  :9 `@T" `圀堐XP pW PP  P   p$@TЍ,'H ,@ ,,x',H-P  X0 P@T `p P $p$J `@TV4@T (P$@T,'x',O-M  RRP  X0" P  X0 W D븁就P` R]*唑唡lp1P` U *@P  0G  ᅀ %0&  @P *  " 0XPP 40 R:Ѝ,,'5,H ,,JZqO-MP  X0Ԣ `PPp@`P pP P:8DR0  P *`byY:eS*P* P e R0  RKa T *P  PU@ T$(P:P f- Q4@ `.Cp Ps` @   0p P v*Ѝ,',H ,,SZG-MMP @8P ,, X0N @TP  X0 8ȠP':P ^P `pV  p@T@ `PU:Ѝۍ,'H ,A-P  X0딀P8`@PP p RFP pWP@U:,'H , H-P`pZP @o"@/o"PPoR T 0RP P ,t  ~P<Q'"O-cM@P  X0t$0``}c rP~ S0#}ỹp ۧ딓P T @0x#0} rPTD~ @C0@#}ᘹp 帧P s AP/ $  PuJ(8 ТZ`PI@/0n`2x0aS0-  $ (,p(A@pp 8 0<,QDp4 p]ύJ` X8h̡刑HAQPF! 0P [eP P2@ PH  P P6P#e }P קP PcߍcߍOHX`XT$ H0 9,'jP ,,*',',.'',, ',k+,$  o ',',',',,2'=O-CM@(PP& UP`p㰐Y A*P y jn py@T:]U[ ptXp `P 0<PP P `X:P*P  0  P  0 0SP l}P SD [:P Cߍ,O,I,,'H-$ 0S  P/',.'p@-P@`  P ll l0 a P  ``4`p',',',',*'H-M< ]P,0 $0 $|z,'@-H@p `  UP p@`Ѐ*'@-$@   P,O- MM`@P/0 [ !  0 01/ Ѝۍ0 01/P ! @0a{댁P epP dP TT )|pW 0P  |rp` 0W @`尠0 P  { +&0 0} D`p 0@`W+,%'!',P!'\D p@-M@P 0`@P `Fv\\ {P ?  +Ѝp蠧'GO-MP `4,㰠Q +P+Q!R 0KS p@TP T:P |  l{pP T b{ pP 8 0IpЍ;B!H ,,'O- MM@lD/Q 8@pPC @P? `P/0젟 !EP. # "  GPqP pU }P cpP  P@P @(0/Pp Ѝۍ;B!Mb+,',H-P /0`@%HqW !  p@@@ +,@-@@YO-Mp P  X0& rP#@0#0y#P 0)z먓P `E0 P` &z@`@( p`@  xPU T T6YxPSP@`@0T A@  y@ $txPiPZO P@G $ TP@Z 0P4p lP h x0ST ! 0z $02   6 3P h0t x nt 0` y@v SZ$ 0 TXЍ>a @y y) 0ЍO|\.ZtXD(ZP P 0< 0,'),P ,,.' ',0,,dy,!CfPK-MMP@`/0pP # "  0Pp ,p(tA @PTD` Tp{ p# P ip) KT @IyeU` @yЍۍp P@3yA`l PTpL P@$y2` (yv+,',,,'p@-/0@P`L8P # " `Vp+,@-4 T#P D@ 0hr,#P@ 0h@f.'*'p@-`@ dPV*P ?<P # " $@pH ,\;,X;,p@-P` U: 0 ?0P  " , $P 0@0#@$0$0$  p 0p@H ,\;,X;,<G-M@PP-:P ?qW!   $p P@`@`TV/VPW P pV pWPۍH ,\;,X;,O-MP0p`Р L@DZ: 0hP " $U /dP$ T &Ѝ`;,H ,\;,X;,VO-Mq(@PT̡@1Q`P @@(@V($@@`Q(@A$( ]P `/qU ` @$ >  P  2( #P!: ?P " $ PPh @ \0@ ZЍ`?,,mH ,\;,X;,A-/@/P PpPP `P PPO-MPt 딀 q`P P@Phc  BT0aP@U ЍOhQd?,,[H-`@p V: 09| ?^hh`1Q$0A$@T @P! $@TH ,6\;,X;,,Pp@-@P P P  P ` PPU U PUP` R P{P<400 P@$ p 1d?,`?, R /R  R/T_@-@ @d?,p@-@P`P>V  ` @/`PXP `uo p@d?,O-tM@4PP $$ X0<PtЍPYvP M] 7vL@P` @`GP p 0 @ p@WPP`[*P9 @H  #P( p ||||HQ dQ\ `   Q 0h$Ql(pWX@ T *P@,` Pq ``D@ 0QD`V `@ 0p@@ pp @0 08p@ \ (TuL tЍO襟,'v,H ,\;,X;,,P ,,G-MPdP XX X0\U[  `p p\ Zuop `\ Ju_x0@ Q@PU ᠀fPJ0 `p >\ D\(uT=Pk@RQ* rQ=4" `!P `8 Po0n  0KQP 0Ѝ1tt!`PQ`PHLP p 88` P 0C(AR`PqW qqq R( R*0`pS1100aS110 0aS11 0$0ppS11`$0( P0 r,'-OY{,,P ,,,H ,X;,\;,P!0H-P(@([P P@0-"H-@!0S Kaq:p(P P@2P qPctPW[ P0@ttTtP lP\He?[44 0)t,,hA,X ,'lA, q!pA,tA,p@-dP@`@QpP`P REMP @p$$ 0&zq 3',tE,'G-M P  X0 DP  yp?[0\#P  S刓嘣 00+|P0 `%`V Q % P "% P XsB PbŸ"0Pp0CA00G0LP 0& kP d"pk0 <`rR pp1  R8"BP$tP } R ` p4ڈ  B? P B2 P2AP P t!( X4sJaP"A|PЍ O3(wZ 00!p0cZ Lr dd00{pr0 ip,'lA,tA,pA,3',,,hA,tE,nO,Y@,,xE,|E,E,TI,,P ,P!3'/B,dD ,@ ,I,!H-MP" QQ @P ЍHtt RpʱZ <LrЍ$$ 0) p,*'pA,'lA,3'mO- m|* 0ll$m 4 ,< DP. ( P tc_\P@P  c  p#mDP PR 5k,#,ЍۍP`TT(P' 44 S4$s( p!`"pc@ p'`$p( $匬 p@m儬 {mP $", Xpm 0[Lem@B` #0 0Q a0 XNm(P%tPPW (P  PP(@PEUʐ[Ps x `U! V0pG V@Q  1T0Ѱ mT`G(@n`FVʴP``(@a`FVʧpA,I,I,,xE,,,']!'Ig|X ,:tA, lA,3',hA,P ,,,|E,3I 6@,I,1dsc P/AQ y 3'lA,H-h``PP QLLP l@ @0@P@P0 ㌁,I,H ,I,O- M3p R cģCȓPXQ0 U0SWluP 5 P  P [Xڗ# R [ P 0 6[P[} Pl  pGWt"P{Bx px0pP P P\ DHP l ,, l$ 0P5 Pj  P B P ZU? pK [(lP 0 P-lqPP<0p RPA P 5 k+ +ぽ 0  Ѝ  t%+hRl kiO,hA,tE,,lA,3'pA,,'w,,,@E,,'xE,|E,O-M4@P,P0p $(`LPP<8H`@0P@ @(p 0, 0D pP A  Py`@\ \ ] ] ] \ ] ^ ] ` ] a (P d X8kP9PP   Z? pK   ZI @   0 @x>PP D Xk<P(P  e p:   ZU P@   0@ PDH 0'P LP  ,P   XjP : P-pԴP@P 1/T  `  p  D@$rZ 0P 8[  (2/P pDXP`)0 ejpW`P @SP 8P @ 0@C |8x# PP @P  @ `PU M8J  Z 0{Pr p 00P $ XiL `PP  Xi ЍOE`P=  Xi76Q0|& P ~8~dPD tt Up@8Q0<Q0 i `Ѝ, vU ~8~pP tp@ 0,,'/,,N,,N,N,o b )@Ѝ8͒,3I o!A-MBzbP x pP d \\]fP :8P &zP| P@@Ƽ0P Q !0  qpWcJpp_Q-Q\0Q0!|p ^qP@UBJp* Q%  r  * 0p@PLZ ` @ P  0 PJP * 0``@ 0` 0`PЍHo(_D@4 W,\ ,W,0W, ªt'$W,,(v[H-;A-BM@< P`0`  Bߍ(W,H-PL@`p ZpWHR$W,@-$@P (W,m H- Mp P0@G`X PP `!A-BM@`PWE@Q*PV  @@FQh  APBލ@DPP Q@C (W,@-XM, @0P_ NXЍ%QC/Ap@-BM, @0_ :Bߍp-5A-M Qxp`P@ P  P `F@V0h$eЍ$W,H-P $D'x 0W`]'\-"O-LMPNoP@ XcPRPSP TP:n@Q| ( ( Ĉ ( ܈ Ј ( LPfP dPpoP  , " nԏ 0)EpF@p PD@TK @ QR D D D D D D |P   <P< K<$F<(A<`,<<@07<p42<X8 QZ VT WP%L P   pLЍ)P /P  <4$> 0   p  gP Xo   P`qE@-P*   >P @PH @P\ \\- XP2 @P$ 00-&`FP@:Pa0@3S) `@BKĎ d d Ў d ܎ d $ d < L d d d d d ď ̏ ( 4 @ L d h d d d d d t d d `R 0A@@ S3 А  @< 0@K@< 0@K@ 0@K Q Q  @w s p@R < 0@R  0@R  0  @R  0 @R}  0 }HD 00 +  7@Rc  0 c X $@RS  S   | ",)      , @@ 0@ 8@  @ (@ @@xhP`0PPp |xS`   P#!X  aQ QP 7o/oP" Wt`Q pp@ptaT gT cT\'  p(P ` p(  (@AP @R p pQx `xp@@P@ 8P PD  @ P@@  P P( @ P@@  (P P(t , @ P@@  P P, 4 @ P@@  Ѯ\P LP4  0 @ P@@  ḮP P0T`K`Q PP $`@P`XX X I]hp@P_ p7P `P 7P P  P`L\\CT#3PP 9p@PP2p@P- <P R' $0 0B` `QV1A*V0v QV  `\-"TW,\W,p@gPD P@\P2P " 0[P  [V3$DP TU 7U ULW,HW,$c[ Y[L H @W,PW,`W,XW,dW,DW,ܡ'hW,pC4[ :$:(:,:0:4:8:xq!㒌lW,b`^dW,XW,PW,LW,HW,DW,@W,lW,p]!|W,3I pW,@!H d i! 3 W,W,W,W,W,xW,tW,4'W,Z,' 4 B P a n '     0g!! 0!     0!0H-0P@P P/PP0 3'O-4Mp`P@P,P!,0 $"00 (P PPPP3Bp0P 4P P00 !Bp0<P 0-P Z0pPp UX*` P, R  PyPP `V::x  FpB7P ,Q>8  PP M Z0@P  |Z9P 7P P|SBt!p4ЍLX }|W,lW, dW,  @W,PW,LW,* U!      O-\MM@`P QH 0@<$\ЍۍO,Z*Z'Z@P}̞ ̞ ̞ ̞ ̞ \ ̞ \ \ \ \ \ \ \ \ h \ \  \ 0Z#\P}tX`TdY(\s {}G8Y  o}; x5 8Y!p4,0,#W W\P oHV}X!  YQ, Q-)"Y"\P9}0X\ЍۍYdAP笠 ؠ 4 D YWYTY ~Y zY Q\ЍۍO8⇾j@Q:g@P189 :0T;p<`=Pp`P[Y%8;=E4@APBpC`D9 :0<>?($ `pPP4?YjP8 @04Y \ЍۍOX\-Y P)Y dW,4 8,_ h-"e  ."' -"             k    ,/"Y/"-"n 3I ."O-DMMQ `XPXL"@P|4rXI`@P`XX  Y 5 R00pRpa0ypCppSp` RQqA aV= ZX Y Y*C^hX qQ忽4`0 .pA~hX pP妽  .04+ 0 .,X |X ZP@`@P`XX X zYXDЍۍ /"'`Z,' LW,#!O-Mp@`V` ` GP   < $ < < < , W W` ``0P; V? "VA j Pp 0`B V0 a0BSWBA0BS7B0R00S`P @  ( 4    "Pp p P@ P:0WW``- \( Y /)P1 W/`P @p!`Wx 0`Zp @`Ѝp 0  zЍOC/`P WP  p/P Y(P  ԩ _`P9`W  ?( ᅈ|W,4'pW,xW,  p@-@`P R!PU e1 E opT P|W, pW, H-XP0000 P<P<P<P<3?0> 0ASR   7S86S80 S :S40 S44 0< 0pW,0H-P@U U C^ DL[ 0V0  VX0Hb {  'O-dM 4"p(0P$8,$<0 0p=p<P{ \0P~ $<0 =pv<@Te @@pQUWyQQY NyQ pwd\1X @^V xp2 0`C`S``0p01 P@pP" H `0`bD 0`\ 2V `@P`XX X 3W@ T:o5(idЍ@9(6 4'  I   '  H-M8 ((0$  UЍ  I  P P Q$UU %  >/ 0H-P@Q  \0t4 0HU$0HU  0HU(' p@-M@PQ`nP .P ,%P `V V NT\, Ѝp@r0$$ 0-U ЍpZ,Z,[,M \,@-M@T T Ѝ@Tq( 0UЍ[,d \,H-(ML 0    R 0 Q: HU(Ѝ/"E p@-MP  4&P @P.ᅰP X`6P@T\@@ P,᣹ЍpZ,[,@-Q R R  RR@Y@Y@0 T[, p@-lh0 @Q   A.@R$B@@@@@P`@ BU:  p\,n 0H-M@Q P5_EU_oP4O T ,PQU ʠ $<P,9U$$BP@ PqT 8   Qk@R@6J :RPqȁ`lLPG ]Pe Q UP:P@Qd Sd , !@!!@ !@!@B  r  dpPq\㭃  ],],],],],],],],],],],.],ܡ' t'a, T*a, ],'a, Z a,% ) ! GZ | @<PT(<@Q3 P18E> X5p PP%  P|  N PP xNPpWP 80 T TH<00 07/P<AQ P $ ` H 8  d 8pW P 48 @<'P @P<  @05p- \ P@'@PP`00(M<@P @X 44 MD#MB M@MPHppp$p \G GP,4,0GpppP hW,&`,"LGp  ,W,(,Gp  V, ,Fp  V,,Fp  V,,hFp  PV,h,ܣ\0Fp  V,ң8,Σ,Ep  U,ģ,Ep  U,ᶣ,㲣Ep  pU,ᨣ,㤣PEp 8U,ᚣx,㖣lEpW \%@P 0zLt,ᆣ,ィ$$$LHQ L(L |L[I8@ E> @@@3pt @ 0G8 @@PE>  PPP3pM P4 Pj8P@ E> @@@3pN d@ 0!B&8PH @E>  3p; P$0H8@ E> @@@3p+ @ 0@_0VLPXT^ 8Pp 0`L PP&P @E>  p3p i7"L18<@@[@T' q+$4Y3i+4匒@P@ hR8  QQ  <0  <4@`pT:,(TЍۍ $P@ 0 0\)8PP A PU:(QP 0 $%0 PP  Ӱ0 PX4 R-3 Id,g,]!P!3I 4'D$!D5'dd,hd, @!  Q % $h, o! L \^!|   Xd,Pd, @5'j xd,Y > ' O-MMp=㴦P @TT?QD@;oP.PQQT o P 弿 (c$,,$ `( 0Pp+ , Tp oP  00@R   00 SP W, (`05 P( <PT=PD P; =PP4H=PppP `P`d00@D,dD`DDD,@pP _@ = @P  t嬵P W ,Pz @@ ᜵P p@  ᔵPI  ᏵP^  ኵPb  ᅵP  ဵP  {PT @Pt hBQ0 aRm p p QrTӷ eP PķP@{ @pQv U@T PY  @PW PV PU  PR PO T ! @Qo PlP8 gRi3Ts PP P@cPUTdP @ P @ Z 㟴PL@ =PPF=P@P 0P0ܶc` X>FtM.᭝p ``Xȶ `p0 `d0`F> `0p D`@P;!9Ut (`0wd LP` =PP[ =P  =㓤P  P9 =㊤`0@P`0}c <BM. Np  FnXg 0 A``P`d40 `@0p hP@ , % P# `V ( ,0 `0  6/ ЍۍOK(0`P PЍۍGP ,(P  PTTTYP <P`ppd L"PH0 (P P7 P% ( { @PUPL(,P喱@pW`,P* X d0 L Ll  Pb Q vQ Q Q \PTtR:""PT ``F> /p H`4 G 0@ е0  =UO $HJ(HB &&PW  @Q s0{ppP ppy pP.` 堠幾 P  n PJ 0pPI c 7M. 0-  q 5 q'  @P LQWP LP &  F0 ̔0pT@` A$ M> P.p @@_@PT!L_/  G @Q  xd,PP   `PP D5'`PP PP  R%  |d,4'd, ФZ PZPZQ)Z&PxtL 44@P\d, `  ( t'ᱴ PP P `d,cM `0 1.p P P, PC 0VM.0(Z vP |C 0= 0*4C0 0,F.0% # D X 3дp㭯[ [*  ᢯3j!j 2!k~ !% M:d`Q PP= \PLJ   PP P  6,3@POUJTH TP@PU*%o , `d @ PP, @ PPW !F @PDΔ-- tH |@ H+j  `d,d,hd,ld,! r M Xd,|d,g, j    %3"8   N     y j!j /  q     H  6 [  |    ' M0H-M0@P00^E 0P P AAЍ0HЍ/K-GMP AN` XpF` 0 @,p`PV`v  ៪XQ:$X`Gލ Q( Q7`O-$MPP/ᴠP tPt@` /pF  o 7]Pⰰᜠ`P$ЍO7D5'd,f,O-\M@ `FQqX: -P 0b9P P  # " P@*Xp\Ѝ` @0A4` @0xA 0vf, 01" Mp@-Mx`@P]d pEX R LL0gE  %F,Ѝp@ Ѝ/@5'\d,d,9 d,@-@P ^@Q 0 %  N, pp@P PP >, 80T(PBxd,Pd,B d,!\d,A-M`P @1P(p 0 WЍRWP& XW 3DЍA X0ЍAݟ`P P# PE  nX3 DW W HD! CD XX   7D# LX  0+D    0|D  l\\DWPЍA D ЍACld,pd,hd,H5'D$!td,n  g ҆5I !ʜ'K-`pPP``1@ p 0 WRW P9 4PW CKd X0KKP CU`PEP CQ P CU PE@W hKCW W0C KcC  Cld,pd,hd,H5'D$!td,   Qʜ'A-PLP <@ Ѝ  q  Pd,D5'pd,td,hd,k I O-M⤢P`P 먐V, x x0 'pA pwX@T p X ~έP2  :Pn.>` 0 `W'p VP\A嬐  V 0w%4Fo5B `@xp|xt2 P0d@?0V  V"   0Cx@|x L2T Pd 0n?0  Ѝ\d,e S ld,td,pd, K-M0p`P 0 &p3 9bP,  0 &p$ P ? `V  儐Pp@2  pw? ` pV: 5?Ѝp hd,H5'D$!3I  k 0H-(MP8@ 0&p P&  0qtPh2? :*@ ;AB+@ +S+#?(Ѝ0 ;p pd,td,hd, O-$MM@P = T9 WP `@ZHTw1P, PX2<``8 0`T%p VP?Q qV<QQ  0to6) 1 "  0V PP  0T !!  0 Ѝ\d,w ld,td,pd,H-0 l 0@  @ @ \R $0@BRt'O-MĀ弐`Pp @` 0 T  0 p @`VTD/V@P Ѝ n H  3I  O-dM`PP 㰪Z8 p@ ^|]J 0=  0  < 0  .[0<P }@Z P { dЍO'=w  t'| 0H-P @P08PU 4P 48`PU:[XP0PQ4P8P:RXP00,Q$/  ld,d,L5' d,O-MMP`U @P @u앟 F쥟 5TP0U@%P` t t t t t t t t t t t 0 t  H t h   t t   `   t  t   t t t t t  PAP DPYPwPr@Pi PaP[PS PMPG 8P1WPspP#jppW  FP P:   L8W`V LP,P 2X WWP P PWGP;  l ( l l l D |PgFWڀWI  WV  WpBpRfPj `P P8 ;v W; @Wr!0 0  0=Wd A  p[ A XP) l\P'ZIH D!00 0  0f8 '  p  0P&9 r y;**@s;T 0 !$!6q0pd;f9  $i,Di,.!Hi,aPp'D Q Q`Q@@eP! @P:9Q@T tP dPS@HH P;8 ;8 3Di,.ܡ'!C @i,'2 O 0H-S@ Pn; j;| f;p b;d ^;X Z;L V;@ R;4 N;8렧']       7 ^ H-MM@P  WP* P%J   `pPP 7P ``P   `p4m`Ѝۍ}8e  (i,8i,4i,' 0H-M@  WP DPP 4  pHPۍ04i,@i,' O-oMM 0@@@P 0@ڠP,P PpB ;]p $  .PpI @(,P $P* P: @$h  .8p0P' P!1  `9P p,danXaP R 9,аX:"(P.  .P(P% @P 0a P `a9X `7|`P R 9@T: o(,PPkoߍۍ3",!|dD$!,@i,/ [ edA}!O-MMcdP7`d D t PtP oP VP cPY  ?  YPY T PP B3p4p0 EP `P 7Pa ,{P P Q`, 1p*8  ` @ozPBp1 Q`V P Y p"p2@`8,,P D f)8cA$H  "28@pPU o٣o `A`qc`PTEY @PQ U ` 08<PQ U  8  0)9@p V   09l@lpP +P PP {6y68i{ !~ @i, Di,!CZZ! 0g!   ߯ [ '# K   ' @-@pP dZP   p Q, @8+4i,/  O-M-hML PH (0@tPpP- `  gp(@W  U$` U U刈 Rh` LDP @@dP P( PoP`VT $` PpUB~P1`FV PP0'gǟw `7 `T4P$ċ@  P0`LP HpP /PV{ 8P<PD @@ V;$_` ` Tp ;$Z `Tp G; $UP`Tp _P0\4 o7zZ 8   b7@D <0`8P 3d ?4P04 N7d,ʿ 0$P G 0 ,z p   -7 @D <0`8P@DBTpP (P% ; $p$@Ph ZP ``PwTp ;$_`PlTp Z_ 6Y@$PZ U P T;$ @_` p`KTp ;$Z`@Tp [ ;$ sUpP/Tp  Pmp` Km A{F_ZP0tl#"   dPo 0ၟ 0z  0ᡫ t `P; D @P_ 0Sp ;$ZP@Sp} D[$ ; UPSpm D_Z U0_Pd`U fhd@Q$_ 0'  0 p 0 0  3@ Qd`P$? H0pL ll AKHP $0 @ 0LP0 @45L@hЍЍhg|Y@    r3I 0     ? I K & r `        O-MM@Ppb .fPpp RPqPk !Rc P`p RP\ @@ }P AP  a@P@ 3  P  P O@@ FP# < 5PtP LQ;plB R< Ѝۍ $ ef+ Li,ܡ'. H jR ' H-N 553렧'] O-M@@PZ ,q^P! `P ǀ`H~A@U U @B P P `FpV`ЍP@P `@`P(B.!RP ePi,Ti,Xi,' H-P P P||| R5t64hh h0LPd@dp`D50 SD  H 4,~ '--4",!Z\!D$!:l0H-@PᣟP PQ 5x0 RP\'&H#&P0< 00 04"Z\!4,5) -  '-0'-,'-H-P@P@T`p|T Q\ jeTDP 80 %,%P@pؐ,0'-D,4" '-  H-P H3  -H-P H3 Z\!-H-P Hr3  -H-P$$$ 4v34, |'--H-P$$$ ~4d34, X'--H-P$$$ l4R34,  4'--H-AM@P 6 DPL PTHAo"<@,0T@Pp0   `A 0V0aWp0U0R0%!T Tp 1@P P H &@P PP 2AލF Q ----b g ] O-lMR0 Q* `P @pp pQ T@: R R Phepp p   AP R S(  0S R :@ T T0@ pW T P@ B P@TP* \< $M@T9 X4H$ p$Q \Q Q ,P1U:`T 0Q0p@T1EPaq`ap`W@PTpaP@UTp0 tj$0 @ZP]\Pr [P|$P P `` 0P 1@aV,P ]Pi $P  P+P\P $P`p 0V 1F!R H !PqR pP Up,P]P> Ps  D Ps PU P Ph $Pq Pppp 0U+ PU6 P PO R  D QEPC  D P?u B\P P0  ]PP 1EQ HPqQ pP Up PU P PHPaQ `P U`XXSP +s lЍt'l'-- - #-4,H) O-DMMP<@l P$ <w>Pc @@ :x%GP <<\ PT <@ AP 0 P3 <P. < 00< B@0Qo0TA0 #PP <!@P@PQQ,AP> < P8 < ,0(<  < a0 o2@R@0P`"PP < @aP@< 1Q@PQY 8DЍۍl -/-|D Xm,d,,---Đ,g -b 0,,x H-8<P 0 ,,P (E0,4, Xm,A-XQPQ DPD`p@ Pp@/-0,Đ,,O- MMP@P\ |PXx`Vpqdp` 00L0+?PJ0?P 00 00ڌ +0?PZ0$@@00oPaP nP@pP qPt t@l8 @@ 0H0 ^ Ѝۍ,Đ,r) 4,d) 'l') /-C ) ) ) @- 0$ 0 @- p G-KMp@P3`@PI 8"0P$0D@?oT@Q2P 0M@WT  P0 W2p@pCT Th!@<P P @!5<P PP .@3   0/@+P@ r( @ R @Q  VTt 07)P@@@Kލ(7@Q F ----'-.-4,  @- 0$ 0 @J- O-MMP P";P 2B  00$P P E7Px]DP t\r P>Pt P6-0Ѝۍdh 0/ - -/-'-|D Xm,d,,'----.Đ,  0,4,  K-AMP-@.P) `P ɒ+0Ѐ``=p pPJP  0`E+0=pX -8 4. Aލ- FK!- 4,  P/᱖+l H-P ,,, ,0.l-4, 0 ; -p@-P@P Po`t P `P K-pU , `P$00 R.p豖+l 4,D H- 0 ,L -H-P 0P $$H-ؐ,4,V -H- 0 T, -H-P P!,$!A?o2Q@0!`@PP pP @P( 00 ,@P -h@P \h -\PL  D  -걖+l -,4, ' ܐ,-H- 0H ؐ, -H- 0> l, -@-(@(0 3  Rܐ, ! --H- 0# Đ,! -p@-MP P P h/o"Q ) @a/o,F@PP a Pq<P@,d@@T P x` h0P t0@  T0J-LDL 062(0Ѝp輐,+l \n,,,,4,^! ! '! -H- 0 ,! -H- 0 Ԑ,! -H-P PP@PP P ?0pʨ ,+xo200pP`TT @S@p L`@``0`,Q D,+l 4,! ! @,-H-MP) P'P  8P P}Q xP ll\P PPP 000+Ѝ! " -ؐ,4,! " +-/-'-0H-P P  P<P @p ;ll0P \T s, 0HV+0< ($ V0H( -t,4,'-5" N" $" H-MP PPL  e8P 4`P$)+ЍQ s" '--O- MPS PX!D8PK HaHPP34@P  P ;P0 @pP P P PPP pPpP Q;pP3P* Ѝ -/-|D Xm,s" '-0,Đ,H-MP$ P  7P P|  7P PTP@P4P * Ѝ{" " " " '--G-Mp`pJoR@ P WC P㌑P' W4 lW&To:p`pZH0P( PP0Q$V/ ;`P cP%) 0,ЍG;W`p**Pὓ@ :|` +d0  $V ЍG Ѝ-+ " a" '-" " -" Љ4," O-$MP P" 7P{ P! 7Pr  @@ oP |P ;P^ PY @ZxqxPP2@`?P  @P3 %,,P6%Q<밐,d,,-\o,K-MP P!3P +P p\`&F&&HH!p P 8%<P(/@% P P$.ЍPKP `ᨏ@ xP P @2/LP$.d$ -4,$ $ \o,j ,% ,L-$ H- 0~ -% -H- 0t h,,% -0H-P PP U@  p%`0L @HH000 0Ê,U0 0H蹊----4,F% 0H-MP< P @  y3P,  2P( P%ʴP Y@P  P  @M@d+z P L+sP \%Ѝ04,-S% -^% -d, - #-p@-P P!0PoobQP``@'`@ P P P  P )%|| hP  \\ @HHP 88 0&& p豖+l !А,̐,4,e% -H-,0, (0\ 0 ؐ, ,% -,H-,0, (0\ 0 ؐ,,% -,H-d`P` `0@P0lHpPD D0``P0_$`ؐ, ,% -,% ,,H- 0O -% -H- 0E -% -O-MPPR@Pږ$Ѝp`8 P 3 P p. P`U ^8PJ`U W8P:-6- U`T P 0 0p S pe% U`T pP x0dl `p0h`P S `K%, ,!FK!!,,ؐ,% 4,+l ,,& H- w-H-P |CPt}Q hP \\T4PHHH 000# M& -ؐ,4,R& }& +-/-'-@-MP P@ Q P QJ R  $#Ѝp| 0/Ѝ@L DD@0  0 Ѝ@$ Ѝ@'--4,& & &  -0H-P ,@,PP0#0ؐ,& -K-MP0 8RQ4LtP%" 0P! PP Xܑ {P !p p W'P X#Jq p||AjPNpF p P  W2  WR3 pV@ AQ N P p AQ N P\lhЍpG$ꄖ,' Đ,4,*' /-<1-'' f' & -0H-MP  PP| 0P K4@Pp @ 80#t"Ѝ0Q 4,' -0H-MP # P!P /P 4p `@ PW 5L0 #q"Ѝ0Q 4,' -H-P P"(HH' -' @-00 @P 0 @#4,' H-MP PP  /P 3P @(P PPPC"P֋`Ӌ`2 pDP wy sy,ЍF " Љ,!-O-MP  PP  ;/P (P PPP!$Pᒋ`d2|@  lPll Ѐ`pDD0Kp`ЍQ " Љ-ؐ,-  -0H-P)@Pm P h P c PPPP5p 0PT0H004 4"! 0( O!( X,\,4,( -A-M─  RPx0S lpl@lP` Q"0`SЍAo! Ѝ-<'4,;( 3I H-@`pt&P PP 5k10@0PT,, H^" HX"ؐ,4,Z( D( p@-|`@PI&P PP < 8="pp@ ! p@2"-4,q( D( 0H-P \P H@LP:P0!80   0,0H}ؐ,'-( 4,( -0H- @R: 0`  R L@ PP @ 88 0,0H|P0ؐ,'-( ( 4,( -0H- R R l@0 PP ` @0@@ 0,0H| P0ؐ,-'-#) ) 4,( O-$MMpPQ %P $ -P XCP` P P@XPU  !$Ѝٍt)v`\ A@T @D @ Sp$Q \Q Q> 00iRZ @)B ƉP@P@0 0@ @ AQ`@)硉PR%o%P Pp  P P  T@pP Ha8 @P   c!` Մ` 2/PP )$| @P  P 0!Y& Z2 ' ,/-,t'$,4,$ -$ ,% ؐ,,,+ O- MPl@[5P LP P-( *(P Pp  ЍаАЀ:`P  {P `P"pW pŊP|P PP `|,,xC C <,`p,,p@-MP @eP  _P P ` SPU PP 0PЍpd|%PPЍp@ 4 5P F0~P+ + + + + ~+ G- M p` ׃p. S P/P:P" 5p P P  ЍPP `A`pD@cP'`PX'p hp. 啃  u ㌃ /p˕P p. P :㿕P p`{./ PPp ,@cPP IP+ !-+ ;B!O-wMMp`qq|qxq`T```tq```````|`hpx`l`h`gppd``0`` ``4P p &p  &|p |&xp x&P; 5= x@0  p x.|d.h-Px(UlpP'PQVPQUy U}Qy - _PG Ptp tPP 1/pQP x d P yP rP kP dwߍۍ(P */͔P--P P XXX/p`pPP``\`X` P/P/?04P  4P@~ \ X^ 4 p<q5dP X_ T8@  <14,P PQ `pQ P %x%^ R Q OP Q P QxQ-/|@p |%|#P@P' HO m5P v gpeV ڊ"P WJ@n Q;Q  @n qQ Q+PwW p@nPP j  R ? 0  R (` U/? (`͟(荟` R 0m S썢 Ρ0 ,4P  P 0( 0 `p Wp  Sp N#PP   GX`Č PP t̟P (P P P&@5y(P  P̟ R 0E nS3 nH0ppT0(h:@P0 `#p @P  P  p  R `@]#p0 P0X+ P@ @@=R$ 9j/5ue0SG/ rP@H4 %j/5euS FPP T&@p 3Pn P``@8P y 4PR PQVT PP`@P t: K4_x,ZQPUQPM PNJDxApƆP |P$ #@R7P (, 0 %0&   P 0 '0*%`0 P& #  P P  0 vl! `Rn Pj P帨xPq!P RK *pm`nwP8 $pLn_: P  P j sQ Q P CV:  AP FPPL$pXPW kQP PP  P +P"x/P x`%OvP  ! jo 0 FpA PPPKj2lp,\ 0 (0) "'* $PeP ,7K? "F P}P" -/ `QP) PP% P ! P @P  P+ #p @P   xi1P R, wh.X\0S ! jO`PaX\ 0!3/`ሹp@Xe ,  pP" pD Z  @ 0R~=, #, ,--qW P P1^ )n `Lx|PeeeeBTUPv?  PeߔP Pi{f- , ؐ,4,, ,  \,- 0 dp,ؕUYP^ HOP b[jo O  00 0P  9~ 5~P P  0- 㨹p0Po2  .ppm[.k?Y#px Whp,` kY Z0< `,,,, `P UPU kᧆP UU ]ᙆP P -tatp1d}!\^|Q<e!DtZ0T1\!P<X!нP  PP P: x0-x `p0x| p< /x// P tm pv/P| l$ B 0g/ j [/d P <,QL/ PHxP  C/-ܐ,,<;/똀P` D|YpQ`U P ` .P "/L@ PV P $ P /UP T ߸//p [ȰpV( `j?t&,0 4` 0` p <Pn? @P 0 p P ` 0  Pꜱ" - - - - h- 80KCP#  Z@`0@4P,pP'  0s . ,. ) {\ e&S S3` O ,0 4 0$ Q  ,0 04EL. 8 1RP   x0 P  P@P @`#^P dL x P ,0 04JY. >`,0 4 0 P; P , 00 p4e P 0 p],0 P R;B! P,0J F 0pHu0 P ,h ,0 04 P@`pH@ P0 D4V 0U ,P `W: W, Wx| p<% P400  pP@`~ ~--ؐ,4,c/ 3I Ȑ,,/-,/ $,,u/ J/ L, 6- / / / / / 0 8,R 0 .0 H,U0 h0 0 0 0 0 ; k 0 0 0 0 Hl<'t'0 1 ϭ1 F1 U1 _1  r1 1 1 1 1 1 `p,2 l2 L2 !2 1 2 2 ~. E- - O-LMM@  P0P(P,PPPRP&P  $@PpP  40 ,0$P:pP $P (0Pp ,P P PP*UP( LЍۍ`P@V= P@P8 /΋ PQ# P* P#PQ ;㼋P P P P P  O4P ^y `PQ  @`P P `P`U P kPTP k`P`` `cs@@P W@w-8 +y P8@<( @D\Cp8 pP P,0 _!P X `X8H 0"S K8.`U. [,B尲8p `P /oP`` P P +x@ڌ 0 P]TP2 HP.<x p00P `` pEIP|xt4$q p1$P!~00p! P P4 唨`_ 000G~`pIpQ_` Qa Qb Q F@[@Ѝۍ <  @0p@P>Pd"|x$t4q px0$P!~0p0̐,y,s,,@, ,,D,ؐ,6 ,4,U@0boBsPwLЍ#/0,4,O-CM-`/@P,M\<|LЬ0 P  @qo" 4Q P0P&| PP3h   PP4 1PP@" \P @WPY-P !E[  > $  Y 㨥ph PG PB8pP< |P7/Q|p sP s PkW @W {/*PppSڈzP r PㄤpP r P LzP < Q  ) 0 p0 P, Q P  PJ LIPd d P P Rp 8  p H `p  A dIPJϣHXPP 1/P /P`CߍP [P lw T0sP@ lP0 P Y㰗 \P (oP |P  B P? 'pdt&XP\P@p H  P gP Q @VP Q P Q@P P  R @@Q(*P  Lv `P! R &0p \UP Pq P $UP @pEPT#p PI P pHRY"  @T @P  P p`   0-,  0  P`P  ,p @ V v V  ,p #tSYi @ TT @P  PI #E0 pP000hqK,t\ 0 P!JPp`Pd P pP p`U  0~pIKM#d @P   VQ@ @p@p P 0( @ Ap"@c P 1/-P $A l0 S R P` P QP ?0 !0  <8 @`p,`(p0P+pLAP80 c, Ԑ,,-F ܐ,-ؐ,4,q5 9 d,h,x,`,-- -5 ;B!P!5 0'-,'--5 ZZ!'  0z" 'y,\,y,-5 - , ,5 )6 S6 ,G-/P/phyP @T㜢`pU㓢`v+ܠ+ g . V%@1dp1PpW u`9P PP0PtPJu0QT.Q@DP 8I 客;B!P!,4,9 5 0H-hM@\t LPd f 8PРo밐,; 4,x,A-MLQ@PC `lP    0P  ^ %PP uʴP5T P+PPyP`Ps qۍ@P0P(ۍA@E-: 7: @0@_^~n.Q ^n~^@^pp@[>Pn~ @@n.@@d>@8d@@tΟPx>~P|.`n@@@@@@_P @(+d PF*0.0_(.P  _P& @0P +P &P !P pD jP l jP< \_8P R Q P ; I_P jP@@lP\P^,X P^P T Pll0 0`0,P 4p@DW/ @ 0 H H H H  H H H H  H  H H H H H H , H H H H H D H p H H X H H H H H H H H H H H H  H | H H H H  $ d H D{( YPB( 0P :z( +c 0 P:8   0  @  0 o, X)0 eTH|@ iz$tp wpjp gc댉php$$P\ Qc pWS @,y( XP ( 0P 7<,(i 0P& tx( |P( 0P <xp 0 Cp $  04Ѝۍpq`@ 0Y?'7w0UA0,@@,  kxd7 -yPZ@W@w@@@]PQ (뤕P 1@PYu@P P PQ PQ +b@ Ttx+T P:?P Xb@Q@v P , @ib  T`]&PP uU]P  uL]P  uC]P  u:]P  t2]p%pP \)]X%XP D ]@%P  (]$P  DD0Po[,:XRP ,VPd |Pld ,@pX@P `p00 ?Q  0`+a,tp帓r帣 DV@@03 V P R P 04@ \P [0,p.V7 4    ?@0 -? 0 - Pnj0, q@LP Pbfwp0 -3I J; ,,,!,!`; Ȑ,Đ,,X; ,̐,А,,Ԑ,ؐ,ܐ,,,,,,,,!, , ,,,,,,f; $,(,v; + O!= !~; ; ; ; ,,; @!; '0,4,8,; .< > < .X,\,< T,\ o!< P,u< L,b<  H,@,D,l<'M< <,!< ܡ'`,d,h,l,p,< x,t,a = "= ;B!= 0= u+ ~+ + + + <= " ЉB= "x L= R= + ]= + - S S |,xC C ,,l= < O- M((B44R4bP  ቜP  X )0 p  Q PSP pp W| P lPdUT! x`$  2/PP P  @P  P   ЍP  @P   ~0,4,,,',= ,$,$ $ ,% ,,T xC C p@-xPPlP `@`P PH,F(@( P fp舖,<'"x ,L= = p@-@P 0`PP P @p<'p@-xPPlP `@`sP PHk,F(@( P ,p茚,<'+ ,3I = p@-d`dl0`` 0HP\@ @T p,$,,-,,-H-P* PU& 0`p@S`P`V p`V V`Ap Vp `PUW|5'O-Mp@`eV, PPV( V)ItQ@\p1pdd!W WX!P  `Q R K 7`PF ЍOЍO!V,ⴰp`P p| 0U 0\ HX ` _ `2/Ѝ4,<> > ;( d,= > |5'0H- $R!R!0S S1!Q0t100 R R R@!084!0S S0100@ P@\U "UPU "U P@PU& P@P!UU U UT 00 0S S 4 0( 0,---r<'p<'0H-P T@P P P PP  +0 *<'}> V> @-D@p0P@ot<'4,O-M-Mp$  $p P+(<8@ Θ(PfN/Ud(P(fN/Jd<@8 㮘P  jP u 0S l%(P@T3 / A/  A%( (  _dUdPj0`Q-@AP b@D T$tdPp?DA( j j X`@ pP:j)0$  uK!uPP:S0:UP$j( P(10A,qS @D]/ -T=IBJ P@   APЀX0 . A  QI@ *P : 8s0( %k!%P@ :S0: ` (Ăr1p|&pd`"g "'ue 0- PR,@@X!@R : P\" R.`p. AkG   H 0 JT!eP$P!ePx ,(P זލЍ P*p!e Y@LL!@Q5?e,AQ%.v w,BD@b"(r02r 7"cA qdP| (@0` `Pᒖ%3,O .APE--HE-`E-,L,r@ 4,|,ܐ,D( -' -@ -Q@ x4"3I `5"@ @ ų@ ,!@ @ @  @- M @ @ $ Ѝ0H-0MP@e bPC0Ѝ0@-De@@e@O-M-JMPP- F`㕗F?pPQ @C. -T=IBJ   Ah@T0@`p . A  Q.`pX p $ # 0 F=P9[ڼ#!HP1 e0 PK xP?@K P*8#ePvw @#` pp7cDepV0&+U'@`Up*S0`p:P ?|r#;p Bdplb#5'{AeL"G5B h0`Z pX@"f ZPaJߍЍ.A Y ! P@PPPPD-@P?- AKE4 H 0  Q%ᡏ,!p@PfB@ U: d08@vw @ ` pp7cGdp'qQ`  W 0Pp Q0pSh f`ܐ,ؐ,PE-,A -3I 6E.A ų@ %A `5"0A --DA LA `E-VA  4,@-c\@ RHP < 8,P єc@,0,4, O-kMPpPN `@xP/ pӫ.aQ뀥p4P| ZP  P PQ P p  HP P  @PX/ / 0 p0 :P p P| `P  HP `P PPJ?P p P(EPPJ?P p P.Qs AQ  w  Q  Q Q q R sP PQ X p @ U Ph | hrP PP P H @ Zq AQ    Q q[ܡ Q  pK q Q  x1 0Z 0ZS P\ Q7JpP|8 P  P bP  p p4pkߍXhLdd<`T8\68!, pE-3I '-d,4,B ,/-t'5B <1-eB & A A tE-= A B zA A-PR@`  P,P AQ  zP @Q:p '"P%a@ AQ  b\P p"P HQ Qp; F@Ddt08A`p AQ  8[P \PQ  Q P ,P p D`Fdvx塻@DFX@@P HH8@P(_P PP @q@opE-tE-B |5"H-`tP'P .WO@P pP 4`pG cPoB@tE-p@-MP) QQ  hPʌ! yQpap@l1 R0P0R LP R 8$/Ѝp3P PP  2 ``'X 0` `X ` X ` X ` X P  Ѝp@^ꀖ,'-4,B - ,,,,,B ؐ,C '-Z\!,'-0'-X'-/C x'-|'-9C '-4'-!T'-'-c!Ȑ,'-K-MpP`a\뼐@? T*  ` ?,` B0pdd Q`Ѝ@ᆓJ $ 0D됞,4,/D '$,,C 5D D O-dMPp@`QP PPP `W P 4P V NU G~  0ppW ̳̃ԓP `0S  f b P 0jpPVpP \P [P[P pVP*` @P  P `V: )Q* XP  00S 0Ѝ-4,@-MZP@ ,<P ( QPpPyZ@Ѝ4,ht@-H-P P#Q  P p\Q H QA@P ,P@,,,,$F @-M @!   R Q Rd fQgQ mQ kQ Q bQO OЍt'l'0H-M@PP *0OpdO\P LP *0<p Ѝ0Ѝ0H8X,NF \,kF O-pW% Q" S AP\ ` @GT ^ *p\W ^p2P`pW ^U1:O- MCPpA`A%[ [ V* `Pb[.KP :%[ M[c n[ m[^ c[P QDP8c[.[0 Qp 0p/Q W0^1PA UP0PA2!USp@S/T Sp0pG@Q0QSp/Z0^0BQ- 4 BV*.0.[NV|* R07 2R10v*`.a!QPP V  m[.P| R_ `PtꀡlAEVS*% iLPHPb V  RA `PVV8*% RL:2V-*/   R)*<00 QR937 2R1*+0R*00 R*`>Q V  R `Q   Ѝ耖,/-'-/-+-3I /O-\MMp`@ 0  ;7  bP HS +7vO qOP P R PUP p8  㟉p* P 㘉pG <8HP   ᅉp0  yq(((7 0w8Xp0@   ; aP  +O#X!@s[TX$P+8pP! uH0 m=iS00@,a@ SBCc / 㲀pWP W#P #X!WAQ"P<`  P*T0#p ThV} `W`<7 \Ѝۍ p,F L,MbF - F ʛԈ0H-@P0Hp@-P@@P`p``@PWP W#P `Qp `T WH-`pv@@P`PP Tp`@P]WP YW#P `@P@U HW@p@-`XP@TP @TP P $@@pni!4G H-靭PG @-@Ჭp G MO-DM@h h l0 wQa 0f넱04|A `=p04P Q(80 0 S0 0@BSCS /$pVP V#P "P V ‡P$ pʿVP V#P  Q  A<@V@^V  DЍOЍ/ @L,Mb/(/H-M$Q 0 ׈Ѝ0H-@㥇P JP0P @Pᭇ0p@-MP0``P @$`P 㑇0+㨈@ЍpP @-@冇@/O-'x<'V-V-V-R-R- &!L(Q H XlH [H H-oOJ-@Q P ,//OP/ K-K->'H p@-M` 0BR`0p0R! P X 0X0P 1 P ܍p& ,㟄p@p d , P DX<(܍p@$< ꠧ'H DV-U-H >'H G-MMTAP4  PP Tp)4!SRp% PPM sA+S`kp?PP Pv V V!$@DHokN Ld  0@$Ѝۍ rR Q hLQ#@  i 8 8U 004xAJ LJ $ >'Uq LL-'sJ cJ TJ l O-$MM̢@# pP-N 9 嘒 @  ᮃ ǃ  % \#P` ṃ#P P "`@$ WBN@ @#@P `Q< ᓃ# Q#QP-  P'X X  X LOP <` $`@V EP rP#  P@P # 4P rOP  ` P0x @$h<  ML$ЍۍR-,S-U-O'4I J 8I R-4S-A-MP P ۍ@*@Q:ۍArP ,p H 0 `P0  ۍA2I DV-$K-&I 2I H J @- R R0R0C PR R RS@@R `S RH-  U-LK-K-MpP@a? L E! @DPt| Ph`h@pQWYXF0Q s0W pЍKr<'' <'1J K 0H-M , PBcP rލ0,4p@P# , P~U z h L| < j LP>PP*\' qOI J H v >'J K 0H-M@8/LQ:Z( 0P00&3Ѝ0>'ULU-@-` 0BR`0p0R P X 0X0XYppP P\XP L@ L[P 0@0@ꠧ'H U- >'R-_I O-M`P 㷁#kL#" ŁU P PpP``[/ R  㰁jB ``psO@P Pjzh ZPPzZ Z Z PP  Pz Z" P  P P PPK PP p  p OP [QqAP ] 6<  QPIP p@ Y sP > QP Pp6PJ` P KOP s? p0t V0lW8`8 πP ЍO!,S-OU-dy S-'R-4I U-TU-J 8I qI 4S-R-O-M`@ @1 [P) P 㿀P ||p  [    㣀PЍR->'U-I K-A-MP  P ۍ@@P:ۍApQt`cP P`[0 @PP P ^< ,ۍAI DV-$K- >'I I I _I J H-J | U-H-BM` 0BR`0p0R2 P0 X 0X0,PGxx JJT!@!DD !1p`P. [@PpPPXcoPOP Dp P0C   JJBߍdπJ|J@, %렧'OI ,S-OS-'I 4S-R-H-BM` 0BR`0p0R2 P0 X 0X0,BPG GJDJ`!@ PP Z1p`P. @PpPPXoPOP p P0 W S  JJBߍp@LIHII@$,렧'OI ,S-OS-'I 4S-R-0H-MnII0p @P P#TCnIIЍ0 0;tIIX/LA WP 0   0;mK 'I >'I K p@-M ~`GP @P tP:I ~TT ~H ~nP,Ѝp@Ѝp,S-F!>'4S- 'J K @-@8~T .n DS-,J #K 0H-D|ATP(PH d~q?>'R-p@-M< ,PH A !00 J~e GQY c? 0S$ {/x    ?0 0,S/܍p:J >',S-+l V-0H-0MP@u>piJP \D0@  0Ѝ0R-R-p@-0MH`@PM>4AJ P  0ЍpR-0H-,P,@ \> 0HUR-zt @-@YTa}@0H-@PP EPP 00O-$MP]P@ԥp%5p ppTp %~`tQ; pOP0@ Q,* 0@$%$5`2 pa@Q4@  0  H X  `    p  @    EPw FP- IPz   IPx  IP PP`PIPe @IPe 0I죟`P PPFlP`/9P. `:P} B  `` X=0 0P \p9GP*V  alIT`D~U QiQxA` IP @!00$BFGCG@G=GA0! pA PA @XPd P p`oB@h! <A@PlP GPqPP=P $ЍI=| Xx|dP|L ='V-V-Q-LP-V-R-R-4M V-.M L /!R-r!/L JL L PP-ܡ'SM ! TP-xM M }M '5">'M M H- 0@8]렧'M H- 0 8R렧'M O-4MPF`oP7 pppqt`@``P- P  4 P{p Q |Q {:@P`@TFpP@4Ѝ<X P 4@ }9Fꌓ `P-R-dP-R-R- t ' H- Q`P-dP-K-M܅@P @GTF<@PV A<P /Q% qP,JppUp` P'PQDP4U0 p  U p UP(J: P"dPP /P@||P 4td@0$S \TQ DdP RP (P : ܮtP RQ P BGo#@: 㿮P: 差P: l|寮Ph: `姮PH: D埮P(: (嗮P: , 叮P: <凮P: <P: wP: oPh: @gPH: `_PX: HWP 4Q,(Q Q  Q Q  Q A pA pA ߱p @@T ,6P |@Ѝ<0 4 u u u ΢ɢ\hQ-dQ-}P P >'P 5" 6"o!Q-;v V-V- Q V-V-R-mR-V-V-!>'Ŷ! LW!k!Mj :O!! YR-^V->'V->'V- V-V-!V-!=Q V-I V-q!V-$Q Q P P P P G-MP@Pzz HzX{ FPED0P>,:$$ @ @ ß pyzwzuz!Dl#0S9+pQ PRU(C yPJ xyp<9P dbhr`嬒 vP 0@ Q :p   0@EQQ@U+  C P : , =@a,>P  @RXX!0@` DQCCCCp PU X9 P  i@P PPP P@P  | , h ( pQ-tQ-xQ-|Q-]Q Q-Q-ܡ't'Q-R-Q |Q M }M 'Q R->'/R->'Q Q iQ IQ Q-R-R-Q R-S-R-,S-4S-'U-/TU-g r!'.R 8>'XU-p@-0M`@Pp8 0P  R l/ R R   ,B  c/r P0ЍpR-R->' R-O-MQGP 8lallp@w l Z  &0p/oS"0 0Q Q Q P  P Ag oRQp\P R R P  L P >'Q-R-3I t'h' UR-O-M@0$!Bp A ` =P@PPqp p PUh  AA(P  @oЍl LS-R-' PS-'R-@-@A@f LS- PS-H-Mlpp=0 R `p@r R VQ  `RpPwP  Nw P:P \ pPP@ ? ^  4,PP1/Ѝ>'<'xQ-PU-' R-H-PQ (p  Q *렧'TU- P:P 4(@ P? ^  /PU-@-d00S R P0@^@@@lvphEP @跸 TU-XU->! R Q0S S /H-PU( 0\^?@` pW p`WU@PPPPU `BlV U@`P  PT-Q O-M}P9 @` p^P WP)l P:P @P?P Z W P:P @P? W0* P C QЍR <'xQ->'PU- R R @-((@ u @u'U-p 'O-MMP(@%@`B!@@HH"LBX `pP  ruP#  euPBP SP WPQ 7u Puo hJ +BuPP='`HP   Q: uGP0S* P* U%P @q_Q:|P  0BR00R P 00P U:Xu CP z' 1 '@ ,S-R-V->''U-G-MMP @PT 5P @P \1@P" @ uP p刐`PlP  LP \PuuЍۍ>'R  Q-R G-p@PU 唁 `=1P @?P4 P@@P@?0P %P @ :j!QP &@ tP pVp@PdcH@P   @ tP ! R >'V- A-apG!PQp @p`pP @P` XX@X Qp#PpPG> @PI P | P Ȳ P P P % P6 g$P-` p0RBR` X X !  P p@> TX!0#QA0cV-'' R 0H-0SS@6@sP\U  ^U%0S! @0C@#0 0RP00C 0R1P00C 0R!00B@ n@t@S @ T^0@0@00SS S@ 0R p@-@`P P @?Ppi@p p@-P`P@P z?P P s?P @p>'H-@P # p@P5 4 p H p p p \ `V P?P& PᒳP    qsP \H~b!P P P Q R R p@-0M@PN OP  X0aP3   Ul rdQP r, =R RP< vr@ qr@P- 1P %@P @P0EP $ , @ H P X | x XL@D,0Ѝp>'S 'R-S S S T T T T B!*T V-O-Mట@Pp ` r*3  s R (R( -r0.PO.P K.P   s spW$W`Ѝxt R-T f@W-T O- M@<p `PP, q   :<P  XPP s<n<p Ѝ V-V->'R-0H-MP@ @s2 :sZmP 2R q0P3P tp2` sT {q26 sqЍ0R-xt IT OT RT iT f@T H- `qHR- H- 6S V-V-O-{MMP4`=P $=P =Pfv䆟䦟薟@  1@ Q*0@cP @dP lP nP @@@p VP hPPap U@p-PP2 @lrP" pYP ?PU;P PY  X7 Or p Pt   P  PhP,,P)ppPZJUIrPi pQHQE  P@ P P@ppGPV Hpp7 `PPTL$0 P %%P -pPpZ U.P#PppP%' P P ygwrs}pppYqeX`+P,#6  PPP:PP@<PS PP  :pP p5k2P#@/ 05P(P -pPwpP)pqP P 0p@Y ፰`VT 0`PoPtV oPD % " P`P op p@qP PqA 0 !P  q 5o>H 7ɉĉÉ(X-$X-T ,X-A'ܡ'.gz]W 4X-D$!W X 'W W W W W DX iX X X sU lW ~W W 0X-H- EU'Z6"@-0(, @9 4U'Z6"X A-MPppڐ`pV`  PpVP6 P  0O&0"vpq#@ 1op P pW@p0Fs SP H4 ᬯЍ,X-T T T  ) MH-M  eQЍH Ѝ/0X- MH-M  S;K-MAP`Px^ 0@4  @p  nP p H   0LL@p 00P`T 0 RJT`f0d `@Vp@p:H0  }.C:@\ `0zH 0P<.pp@0@X O(Ѝ8X-X U 4U CU JU '^! MH-M  xQЍH Ѝ/0X-O-dM$@paP h[P P(0<8`4f (p p,@PLH,/o[ "QP X ( !$(h(PnP pA,@,X* Z @ 4 h 4 @  XXY (Q'H(,  |(QQ.H,(q(QH,(g(H (,  P (H,( @ P u (H ,( C( ($H , P _(H,( @ +  P (H ,R    C (H  ,R ( P 2(H,( @ '( 80|aP  (bp48P@ Y 9( 0 Q(X,  Y ^( 0 Qm(H,P ZeP4 < D L 8p `   y P^a  X(j84YZ lf c Z:(j[YPdЍTCtptthhx.`'\4L^U V V V V PV :V (V V hV V U V U U U 0X-U sU PU H-rpq#@W P` Plp P pWP6O-lM $heYPL[0p88P:  CHH0 @ <0 0@ P pP @PpD ,B,0`P@p(@P $ (P#P@<4P ,( lppP' ( 4p@ pp(0ouP:P@p, ၬ XPlЍ0h @NuP*@<  p@$ Up P PT@`<0UpP pP @ @(`$$4$,t@&x @p&Ds& w t v0P$   p,P @P @Z A'P6"U W >!"W 1W CW TW PU G-@cS $$P7P`+l?G#1R# k:Q[.07P0`vX$$ R$P N`DTp P-P+PPQPr p 7`FP N@DT`P P QP7"x$tBPP`w$$PPLp$HB$P<4P (1V@11@DTP S7)P)V)P|P P\P3U%gectAPhh 7P1PhU`DAdfPe $0q  (P @P f1P6P0PuTT SESN&Y \X-XX-ЉLX-`X--s 1Y E!6Y dX-=Y hX-FY lX-UY -X-lY (-g'--X-pX-ܔ--Y Y @-pʈ@@x@t%,P nRTPDP <5R%#IfX-X-X-T-V'@-@4㢨P @落H-雨PH- T  Q Q/@-0S R PaQ:{Q:A@AT 2[S@ @2@S@P@Q0SK-0M│ P Y! t PH*p!\ŸQP ỼKPP'P8PM KPM P\X i!00_ P P!5 P5 P>:JPP5 2P51PKP$ P+ 'P P%! P K PKP nP K P       @ @ " t0tp`P  ,Bx`P (@mi < 0ЍX-X-(-X-X-.X-X-X-@-M4 jP @"P _@PDP"P ^P0 0@PT x"P ^@|!@Pl@hj"P ^PP @8P,PЍht@Y 0!X-Y $A'Y X-Y @-@P @^P @Ee-@-M A @R@   ( T (Q  |p"ЍXP<(PX-Z Z Z Y Y Y Y Y Y Y 0H-@POP0 Q 00HEe-G-M$!!o" ! & F P00DPPT%%봕먅%%HuEPt%t5xU|exutEtTT  HP P<4,%,E,P%P{$u$P  m$4tPp pR P P\dV Rl0$ Pd \ CTPP@$4 6, R PP@ 'P P#̣P  PD 3cs  0@00||#|3 pS dh#h30P0L#L3<4#4PP PP PUP`Q  `E៺ `1 "" |"P `R PQPR L ` ADy `q1 r " P!PzP@tP Q@@PЍ Z (A'@!Y-e-!Z =C e- Z $e-#Z (e-/!,e-S!0e-&Z 4e- Te-Pe-8e-He-"pPX  B\ЍZ # X-he-0H-N4P$P.PAP P PP |P x s P H@P0P NPU0H0H[X---X-le-pe-4e-e-X--\e- -de--e-e-Ge-Be-@-@PPP|P pp ,dPLT #HP(8 e--X- -X-he--`e--pe-P/`X-e-e- X-e-/H- BHe-,P/ Q /ጔ-e-X-P|Mꈔ- X-|e-te-@- P p@T ``` P @9000 P @ -e-e-e-,e-xe-te-@-|@ p X @ (| e-e-e-e-e-0H-P P!`@ l \ LP < P;@0C'e-e-e-8-e-e-H-MPP+ pP' +P@p%`.-Q%vpm`v   .Qb  P VU`TЍXPqP(b@ Q6 h  < < < < < < @ < ( /QPB@ Q* \ < < < D < < < L < T /yP/wP/rP/RP /WP/ YP////-P// // / /0H-P@-P0 @MPJQ00 `/C'0H- P:P @+PP+P00H00H|@-M@P /P!  +P PPJpP JX Q8U[QJ(~ЍЍ@w Z Z Z Z @-@@@   p P@C'e-< 0  !1``@o/C' P L(A'nZ e-H-@M@P `PU y/P P Pp-Xp 囦P 8 P@0dp@Ѝ(A'e-.!sZ   /e-p@- M<` P @P0@ Ѝp,A'P/p6"K-`Rp@N r P TPq Pp PpEUT T|KM t8/p pPw p PWpG8/p,PTP K-Z Z t $ [ Z Z 0H-$Pp@p L@00A'[ 0H-@P!J R| 809 0  r \ MLPp  b,P0 A'e-e-+[ -TX-0H-lP@P Dp 0 )0 (<R   0 @ 0e-O-MP3JԠ 0p`/)0S0"&᐀IP`pQ !0# "  WcLp aP`U Ѝ A'e-=[ O-M<@pW% `PKVJ r P@ ɀ Р +0*  ( EPЍ , "0 S !  0 U Z4pZp  Qe--` R L00S/ 8 //e-e-q"0H-|P@P   $ 809 r 0Ht$Pp  @0e--@-\  0 S @ 0FI&0@P@@@T0 ^@E@e-C-@=P \( ) R 0aЁ@`V p 0T!@@Ѓe-4P/( &)/e-O-M4Z% ( PЀ P !) ( Q*) b@pF T  ! 5 @@ T  ! 0 hP  HPJ Q (P @ 0  @@@ @Q*@ Ѐ   p@ @Pv)fp0!p 0S V PY)&   0<& !   `q    *b0GPp H8`DPpUpwpJE P PJW  `   0W )u 8 `Q XPOl!J02CH@P 8P)#P6$P5P  00  @ B  @ @0 PP:( Ѐ7 ?4JDЍe--Ȕ-4A'm[ 0A'6"x[ \X- A'e-' -p--@-Q# (  R B@ PRPPY RP0<020Q @p@$p'p 㰀$e-PJ Q/4A'0H-M@P) P 8 PP R 0PP So" 09@@0@(@ @@ @%!  Ѝ0Ѝ0HIe-][ H-M 0$PЍ0H-48 0s 0@@Q@0e-K-M @PD&`P3@ p p(p,p P  0 P00  0$!     & q@ЍKaDX-e-A-P@T5 p "  `VP   N   P  @py ^@V 3A%e-DX-P//e-H-PPp`@PUPP*P5jPuP# sP# kP)(Q  A^QQQ *PP Q P dP nPPPPe-O-M㉦Z댣 ZZsZXPT hch@P uP+P G-Q   uQ+P  GP TH :P KHbPP .P bP wP pP cP P@ Z Z,PP"ŸBp`Pp`aq0!001qQPp0P  A1 PP1 PЍd@PD 3P8@P (@P@P ՀPЀP ˀPƀP yP 0p`P 0p` V3I ` Hg-Tg-`g-lg-j` ` @g-8g-0g-(g-=` I` U` \` e` ^ [ ^ ^ t'e- ` e-C'` !` e-/` Q p/e-e-0H-p@PP\PPHP 8PP(PPP0(g-8g-N'-S' p/e-H-p0S :Q   h \  S@D4S@#   0e-e-f-9` ESCe-@-MP&@PP tTQ @0$44    0ᑽ Ѝe-e-g-9` e-ESCH-! RQ 00 R0 ! P!R 0 !Ƃ 0? ! @ R 0 !ɂ 0?!  )q 0 !̂ 0?!  0 ! 0?!  ! 0000 ! 0000 ! 0000 00?e- R R R R P/p@-P@P `PpP PU:` q U Q P@ RP@- \ *0 B @R/o"@SJ0H-P@@P:   8 l ,?% ? ? ? 0 ?? ?0 P? ???P0H-@P`P QSpW`QU4 U1U uP Uu```e-0H-p@PP\PPHP 8PP ( PPP0(g-0g-N'-S'H-^Q R RA 10S* Q1S@-,@QP@g-R'4 1S10S/ R/s"H-@P/ `P+ PQ p2'P pQ`tQ p#'P  pQU <@EV@P@4B'8A'` O-MWP D T: DP.P bP cP$T*@z (Ѝe-` ` 0H-LL444 40<@PPPPPP0S'o-o-o-xg-xo-|o-(( (0/S'|o-o-o-O-M@$PP- 帠帰p  `@pT*BP P PPPЍe-|o-o-p@-ML@@N$PP ` iPPЍpxg-K-M@P@=pQ0 P`  d 0Q B QQ P `HQrBQQPЍxo-|o-X-G-MⰀpQڠ@堐 ` P 0 E=PA@P  AP( Ѝo-|o-xo-xg-o-p@-M`P@#   @0 ЍpO-Mℑ|A pW=P `p 0P G pPWa 0QqAQPI̐@8` p ARp@PЍP` ~0 I B ZYxg-xo-o-|o-o-X- 0P/o-o-K-P3 `P p PU @"%P@b` PpUp W %P ps pp-0H-8@P(P0 PP0S'o-xg-O- MPP xP Qx(x8PQdXoP\ ` @`P p$`P`AxPqP VG0o"0PP@Pb# # # $ $ l$ $ $ $ $ % % x! x! ! L" ! ! % % 4wPO[M P P  ЍPU pwʬ&pAp@嘆 [@@Ts ` A$PvVp@PH0FP e[ ^eP r)"Ep  Q  p PY  P PY PXeU `E`HuPP GIr Aᄪ  @ QpP ``'pPd:X ЍO&T[Z@U8T(4dP P Q P PD P?CP1 PZ 4/*|tT dCTP 4S$0cP P PPP P |PP PR  P P P X} P P2,,"0G0bP@PW P* #P T @P@@P PP@` V:`XaQE [,qH q \[ [ @P` RQQ 7PXPi PPP P\PS iIe-o-o-o-o-o-S'o-o-o-xo-xg-S'S'o-o-o- )a ;B!S'o-3I p@-`P@  ,Q:Epd P:00@T0Q: Fpxg-xo-S'O-$M$q p0@ P1 0@` ` @SP @b@*PpW 00@C @RP p0@ P  0 ` @RpP  p.P  ;@$Ѝxg-`  Q/o-o-xg-P /o-  0- O-MM@PzP(8Po p WPjJ  PfᎷ`:V^  `~PV p PO S~PI PpQ Q Q   P  P  P mP "PX Z P@⨠℀ ⤠|   4/ ~P1 4/Ѝۍ\X- a 7a S'?a S'#a Q  FR/2G-MPcQaPP2 fPX ih a Q PQQ<Z  @ P? @ T@ uVPJ  PPUJP JPdP% dpPp Q@`@ Pxx ᤶp  0 T 22  T XVЍ\X-@-S'S'a Ua / #a p@-Px @(P U p@lP `P < P p@T\`P pFa q!p@-P@Q `P Pz`V V FU  p@?Up\P XD 58Y4P ,$ *p@Mp7a S'S'?a Ua H-M@pRGP`pP`P T`P`ЍP 0 !P `P`xg-p@-M`Q.  P@0 PAPP <P @ PQʬ<PЍpxo-|o-X-G-Mࠟp BQ` @PQ [ 0` CVQ @PIP Q , @@Ѝo-o-X-xg-xo-p@-xPx@`V ?F RH 8 @o/o"ppxo-xg-S'o-@-PP D@@88 @ xg-o-xo-S'o-H-P ;Hxo-p@-MP@PP ` @PPPЍpA-@  `pP t P  PpᲓW<r  pP Aa Sa ba ka xa H-` R V`:zLpT" PHao@DTB X-o-H-P`P p@p*TPP P P7P @WN@T @g@o-o-@-@9  o-@-@.( @ R  o-@-P @P@-u@ o-O-LM/_e00OoP}P KP PPQw>t/A8P P vPo P P dP~뜿PPF: CA`xHP :V P 2:K:':8nP@neT PeePapP6P=mP /PPP  P> W W=WOP ,KP P P.W 0G P:$ ,MeP. ԌmdPN RPp 7P iPP bP P \ QP `P miYiP iVPIcQ G 4G HG dA xA A |G A A G G H 4H B H H I I 8J TJ |G J J G 8F > 4K hK K K L $L @L T@ T@ LB \L F L L L M (M M M C |G |G N DN hN N N TC hO xO O O |G |G O 8F |G |G P P |G > F |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G |G 9 P[oY`py艟j#P; W W PE #@Q+:IPP\PX p pPS `@<9P  `BP @P(34IP0 WMGQ  @A XD > > > (F H@ > (F C > > > hD C > > > J7apm P>;7 $ P ! &>~>&7pˡs>7<Q& P"T p84l PX>s7 P v 7I>d6 p X-X-o-o-o-- lpp0>K6Do-o--X-o-? 9P@ Pe $ Pe  Pe  Pe  Pe >6*DX-p-p-pe=6:{k ˟ 0` 0`<;p-et=A6=),pˡ=26QM PEHpˡw=66o-p=6$$ ( P 7 P44 P@@ pˡ Pe$ D,!p0?=Z5lP] P ' P   rˡ@-=+51g plg p rˡc<5 p|P 4<5qac\X-Ie`pPk ^Pj  YS'~! pˡiHP I4-S' pˡ{HP= `<N5/DPexG0 ! #ep x -rh><45 p ! $A' "$b X->0=xPe= \Pe7 @Pe1  Pe-  Pe) (X-X-I<d4 (p-@<[4t +o-0#@1e`lLX-u/%<@4P 0C X-b/<-4 N8 (h6؂ S'a u pˡk Pe 32P zP h"p| pB;4tb pˡP Pe `"p P ^p-:eA,P` P 6`jw;K48P&3S'``/P4!`0V(0F`˱0/P p0pb  5eT>e;.(T(bX-o--o-DX--p-o-p-X-X-X-p-b 3I b o-S's-p-X--\X-a S'~!b ub jb ]b ܔ-Mb Ab b b .b a b a hX-a UY o-o-h--o-o-g'a ' -$-ؔ--G-p8;13`W@̠̐̀@q WP`RU  i PU 8W2e Qes--e-K-`Pq@  A  P.@  <`堐V VJ  .  P  |<`@,4T KKo-o-\c H-@PPPw7P 0s  xPQ`@`PP`p p` H$A'-X-pX-p--e-p@-/ ` k@P@U@ p@`PV P U U@44p@Io-o-!p-nc u~!p-0H-":=2OPY @"P.P=#PV $PZ %PPI:%0Hf4 P8 P P< P9!P QP  \P0\\PT@+Q Q LQP Q2 0/P% 7P. EPP (70H~$P PP$ 00H 0  0 0HxptP 0.0X!0HV@^0HBo-\X-p- c c p-c 3I o-o-p-o-@X-o-A-M   7  ?  I  D  ? :  5  0`@xP1  0S"@TP P0P <Ѝo-o-c c *c 6c @c Kc Qc ;B!Yc  p-Q/e-0H-P@U 0O-$M@`S   sP `nH@@P @ pT W QlAQ >P : 0AS R 2@P ^P  P *Pp Q:Y@ P ႐P p /@P  JI Z P Y:HUq P@TA$Ѝe-H-, $ Hp-p-p-p-O-MP9 `pJP,@ PP PPPP@P PPW@ppP@ W:PЍ?d @-~2FP @؈lll 0OP \\\ 0H<PP 0CP ,<< 0@;S'U'rc he c c 0c c c c c c c 0H-Q P@ wP $  00 0HZ2p-c 0H-Q P@ `P $  00 0HC2p-d A-@`PQ ?PT pP 5/@l*PQp$PQ  pP4  pHW'd a 7d K-MP@QAGP=J` pp4@P.  0V p"  GG$ 'WPMP+P PQ P@P M@|G@ЍGP`@VEPVnPVdPUppPuP cP ePPU*6vP#PU*PU* @xP@\X-p-p-p@-``P@PC C  0C 04 Up p-p-p- p-K-PG @`pAQ"* P0SSU5  S Q gR)  B R r R  Q:`VP gP DP @PdP fPddi p-@-M@d P_PQ( QЍp-p-Po//p@-R @P `لP pp@0Ad H-M 0Ѝ' G-Mp|`PhPЍT`P D@`PQ hp p>iPU:P PVUTe`ЍG[ @R d 3  BP`d`3`dV P V)dppU PAEPQ`X-X-X-p-p@-`Pe@V p#U `U aU`B@PC@HC@PB@( @Q!@#%" X-p- -p@-M`6e@P-JP;P)-P%;P"&PV@U AU hB@PC@PC@PB@ mQ 0Q@#!Ѝp -X-p-O-MPPp/w YXpP YP ! 0@@ wBPP Ѝ`wp 0G?@ BPp/w P ?wp@ UBP O-M@`pPPUP)GPWP* qP Z P@T: <P PP @ЍS'S'0H-@Q P[ R0(B R P#0Q 0 S*A qR Q 0rS Q /0H-@ P PE00H 0@-MP3 p Q, @T T pQ#  :, /EPPH  Tp <, .Ѝd-e e e e ' @-0P(@P P @d-DX-P H-5 HDX-O-M★P@P P  Z `z P 4U Z z @U Z @{ P  P``pPPJuP @~.  0p@Z` @ L D  PN G 6 8. 0 p PPQ;t 3 0. r, `@ :gP 4ZZ P P T :@T( PU ` PQ@P  EP0,P (@ @P D0:,P / 4, P P @D ,P @ЍP `P  HP``P TpPp`4P P P "P -҃ppp/CpڈpPJ P*P X@- YP +C* DX-HX-UY ~d ' Ԕ-d `p-d pX-X-`-x--6"3f `X-TX-hp-pp-@X-s-S'<-@- @P  DX-0H-MPP" n/p   P @ @ $$   Ѝ0DX-pp-hp-P/ H-@P`Q p ; 7T,Hp@-M@BBOPP JBP@k-P``UAU DU+ OUaU dU$ oU W-P pBtP 0. qxBiw(p@,ЍpPX-e A'e Oe O-M∱@PP j @`@U  P-*P@P U'*  pW k  P*p@P W *@PV `ᚂ ᗂ@V P ЍOz@@P  ЍDX-p@-`P  P@_P U  EP T  =P p@NpH-tP  H+HDX-H-8P (+3\H)`p-d DX- DX- DX- DX-A-h@P`T%+pUP W PE` -0H-@P P PyP0H0@-,@P |@@g@fDX-H-p )H)O-MP P7  R  P \P P:P A` @n Zp W P `@V J2/ PP PЍ8f 6"A-@K QPP( P0PQ@Pt4p`P`' pPP PW P@PS'Ef S'H- PEf O-MPP pWD ! P`P@W WV `P`p`\`@  pRP@PWU P [: @/ P0 O(@`@V 唐唰Pp @W pP ppP ᕓ@U`PV ЍEf S'xp-S'f g Tf K-M@P& `P" Pn pk px~P XP 0! X @@p@ @ ᓀЍ&!;B!@-@N @a G-00P@`p#Q%QWWP P #Q %QP $ `Q `p`@#Q%QTTP P #Q %QP  `Q @HX-DX-p@-`PP PWX 0@}P` PPp\X-[f G-MP ЍP RP `P|qPp  `PPPHQ `@P!0C&QP`V p@u  ᤂ`Vl  ᛂl`V P5P \X-Ef _f hf xp-f g S'S'qf f NG-MP@P>  0@p6 `,>P/ĐĠ@P `P DP  @`P 7P  p=PPP `V:@U@ލe-Д-H-M`@P ЍH聻P P``PpLD 0!s e@Ѝq 0g!UG-@dd3P EHP & `ᴑ ~Pp@Ppvpw W 0H-@@ PP , P  oR0UY ~d p@-M@P  P ۍpO-M`,pP PscPw @PT|PPE-PDF PI De  %R R   0%S sS4P-+@ ,`)` 0pᾞa~!`\~pV3 U @ T@ =P`p(p4@лP pɻp[ :P <@@Np%~Ѝ\X--a f ~d A-MP8P Ѝ`P @ %R R   0%S sSPЍA'Pp`p 0`P3}}@}T ЍA^\X-f f H-M >p   @o Ѝ0H-MP@P q>p&PP%  P! ]*P\t Z>PJ  PJPI$ᗐp$PЍ0Ԕ-V'V'@-M@Z>PJx| 0ЍpC-M@P `">P h  #D Ѐ # "q p RЍpDX-hp-pp-/U@-@Pp/Q@0H-$4 @0!P 00 00S 0Hs0Hp--p@-l@P pp `t(@P!$ %$oB@e-@-@P ](P@3Q/~p-O-MЁpWP@P`'P`iD$@TtP WSXPN@PH0PC,@P`T(P`%&) p 8  p W  08P`l :$@ b$@P`$@TfЍD-H-X-X-s- e-@-@ ,Q' @D-O- M08p4P@P U P ڐQJQ@P P`p TP 22D 88`1Q`!0 `0 o,P` P`Z9BP @P &% '|'f6]'&%A(P 'k'P R"4P1PP #@XSWpW`P ,P` ! %P"' ! 9(P(P$ P`('ZP< % &P P O#P@X @'P`P @P 'P ЍOHX Z 5{4 ЍOp-X--t--p-e--V'$A'&g ,-LX-(-p-D-G-M,@(P`Q Q p tP h@q  P T < P0Pp P 1 0  V0S0/Yp@m+_`P!&X &Z)-"@YT Z xЍGtp-p---X-D-t--p-HQ/8p/(Pq /@/p---X-G-MK P P uP ЍG& p 0=ЍpZ @&P P & Pl`@P% 0P@(% !0" ЍG8 X-e--A-MP`%p@p  0@ЍV %ЍAp@-TP@` R ` r `V V@pX-P/@-@ R P R0 S   XQ 0 0C0R,  B zz@yDX-V'p-, P0SQP/V'P R/V'P R/V'/p-G-P8ap@T P2 @y8@ UP  @0 0$00PP0000040@    QdO RNY*y yT V'p-P/P //H- P PH- P P// ////0/0/0H-P4@PP Ty4@04/O-$M 0 H%UeE(+5 P D/ P ?  . ) P p P Y   uY ) ` p 0P `pP@P U U`p P P @`Vp@@DTʀCV ' p ` F FoopP V Vv p  P0 P)P V VU PPB` @`PTP; lP< L@P 4BP`} Pp`PP`3P) V V{ P P A PsP P`xXP (+ PP`AWP  P0 &  P /( P`PP  0  #PW   P P p $ЍOS  $Ѝt--e-p---s----O-M D@<`8p@PP  Pp   0m(PpP  0`(@TU<=U>   0F(*ЍQ O 0H-M@P>4P  0Q  JЍ0s-O-,MDDHp`wP - 0W R V,WPSP {z@$# T T  P P p ip PPP P(` KP` $ `P`Bp P X r P0PP X XY `Z(I[ @TE(P@@PUPQP X X +&XZ`Z`A刱P P P P P  P P PZ('y P@$p `  &P$P@尰$p `P9 7  ,ЍDP B 0 Pt--p----s--H-@p PP~p P P @P@PD@0`kp@P@TPA'A'p@-/P p@ `@P@!! p@Q! 0s B @!! pp@p@6g X-O- M`@"N"PJ@@T{! 000qP P ЍOtPb! !d0Pw  ЍO%PQ!M!  pq V  Pᴑ@XI% !0  @ *&`P T@XP)+ Y `@!& PXPp  0  @ 00 0 @ 0H9`@P `pp! 0@, Ѝ 0xg X--p-p--H-M ^!! r   3ЍH-VP 8H  P  P  BHQg X-p@-@P`Pp P@{`P(P  p@-H-M@P;`p pP u9P x P@ЍTP < ЍHB ЍH-ܔ-g og A-P@p|`p!&  0E0V< P`P@p@T AAg ܔ-g O-$MM@PP(P``P0(`{0<0,`v0w堇``P nIP tݕPP` \P 8W8w8,   P  P  P   P    `P0 S S  q\P&0g"0<S !S <SFP=Q P=S >S<P=Q P P=QP=Q P P B  d V Q`U`u`Q/ Q2 Q$Q:ڱL U u Q) Q, QQ* C^P4tД`$`5t娔1tQ`Q LQ{8QwVt` Q Q q"Q#Q P Q\Q Q Q Q PT PP[ =dP pP+P/PTpsp0Q Pqe/QTPP P=P PR/r蒟PU P PP=PTKB/P P P TP Q Pq,/QpdQ Pq/QdP P P /`P U U U rQq唑kEPU U UP pP pP<QdP U UPU" p.p̐P \Q Pq.QP.\P| p. $$Ѝۍc p- W'0Y'p-p-p-g'' j j #envj j kk 3I k k *k dk k A-MM@Phhh `0 Q ` 0(Ѝۍp-p-Vk p-H-Pp^P$ \P30 aR>0BPz*0s01 00C `@0TP:Q s P0 P0r0 SQ 0P0" SQpp0kB P0`稻 h h | h h h h Q- `0TS8bCPE x  4 4   < D   L      T  \ d   l NbR eRPR000thlCSDS LS RS *1S BS $US! XS   C^P$0#   h         ,0 (P``p-Y'dk k 3I !  m!0H-L@iPD@aP KpP d\ @@-P>-LP@:- @$T40k r-Ck r-k r-p-Ds-Ps-\s-s-P3//s-p@-  | 0 0  0 R @ `P``@@ @@P@ pppp0@@P@ @@@@@@,h,dP, @$TPpr-Ds-s-s-s-s-s-s-s-s-s-s-s-s-s-s-Ps-\s-s-K-M p`PP/ PA5 g P 0s  W  R !Q |q!P|0p a@0|@(p |P 0pa@|@0(p|PP7    @ 0YAQ 0p|`QQ@`|@0(pP 0<|pPPa@p|@P(0P|0!|0 ((0|ЍĔ-@--A'A's-r-0-,-s-000 00 SR/-,-0-Ĕ-p@-\P` VH@!R', `V`| `pr-Ds-s-H-pP0O H`XPPVv@)@PFyPAeaP@@ P P 4@P' P Pxx |pt0 @@ @@ ,P *@P@@e-r-De-Le-8e-Te-H-f@@0/88 0 @e-He-Pe- PoSk 5ܑPp P^@ )`  0PPAJt!A@ Dp\aP@  PPEU6@4 _pPPPwyP  0ЍOPP  =P   0C@P@pp@ЍPEs-s-Д-r-s-e-l--Y'p-s-Y',!h-s-s-s-Ds-Ps-s-\s-VUUUs-A-\PPL`@p/2 0PpW@s-s-@-(@Ps-s-G-`B`PH8PY( VP(BRr R! } @R a   @R |`aQdqQ88!   A Q 0 0S  v  QPP YPQ PX  S   KxX@ PPPs-s-s-s--X-s-s-s-s-r--s-@- e-$e-Д-p-0H-PmP lP@ p@TDP08P@ p @T0Д-r-Z s-l A-`xpp@ PP ʟP`88 0QT$0 ppr-p-s-s-s-@-< 0RA ^01 0 Rr- (/r-H- R  R P @ P X |0S1(00 P  B! ~ s-r-- /s-s-G- p`r) P%\p" `p堠@P@UP@PF@t T}`pYXPo`Pp-p-r-G-餐pPh@h`TV V  kPT kH !jjPPPp-r-O-M Pp` >PQP8@P@ P" ذ`v+ UpP 0@Q: QBQ* PBPE`s` P`pZYЍ`pp-r--G-M`VQ &p@  lPP  㵿  @P@@@ {j 0C`F@ VR:BA ЍH-P@`pP 0DpP @8@ pP+P`s-r-p-G-鄀`l R@ 0!  Lp`P| 0R`UP 0!  VX-X-s-p@-@PPJ` PP  P |PpY'P, '/ 2S/Q/2S Pl"R PH"R P$"R P/8-Y'H-PCY'A-M@P`peP P p P@"PPЍp@-L 0 S < <0<@ P` F P pД-s-s-X-O-MPD@` p U  0 #0SPQ0P) | R6 @ @``Q@D P p PCpW@T "P@0 p$ # * p) T @U r@ P  P@ 0@aP V  -`q`豟Qp # "qP @ @T$ @xx!0QTH1`q 008pX@ @T`Q0U q$ Q%PR 0ppp0pqq0 R A Q x@` @PЍs-@-s-s-s-s-s-VUUU\s-r-s-s-s-Ds-s-s-s--0H-MP P@QP@p2 0QЍ0Д-H-l cR:TH0P Dc 0>:0   t- ---K-`V @@TP@@ PЀ)P( PU `V@<P`V pp q`` VP P` 0 p  pPpT P P U V RtP0A `pVp0 `0 R A 0-- -O-MP|P@%$UDrP 4r `R`P|`p !Ѐop!p1VU0R`0^0.PXЀРXdap  0 D(!@ [X  0+U ZP  & P&ЀРp U `  0B*! X* U   00  ЍĔ--0-8--4p/(P    8-Ĕ-p-l @-X@PJdP 0  0P8-0-/l O-MPPpp@Q ` 0pRp!# " p.P4 pS"p# pKp R0UPpFPЀpU 1`  0p + ! XU ЀpXx`  0"p + ! X  0B Ѝ--O-M@P`Dpot[J Q@`p!&o T@P` p| P`& p'0pЍX-K-@P뀀倐`PpP 0 0@p`g t--0 R/$ P  R/L-D-O- M`-P`]  Uٿ =%pR%o!p%HP% PP! P uP t@ q @q  0 eȺ@TP@yye%`%%@Y H 3 k 0@ ЍO[~! q0g!"Hl p-G-MP`p p ! @p@.U T  ! @ 0 0ЍK-pP`P @mၡP8 @$ 墿Q O M "( ㆺ p p  Y `Pp pPwP w P  pp᳆pw W p pPwPw P  pᔆpg @P0^ PYl ~! p-@K-逐Pp@4T 5T'#T'a3  `pppP d@ P6TH-H-o0H--P$P 'P!jN>.P ^P@PPPP [P @PoP ldPIP @pt@TPD@ HP 00P Nd@0H--DX-6g X-l 0H-MPP @ 4p D0P0P&0 *d ꈾЍ0DX-@-H-Ma@QdA@QLN@<'P #P j  ЍH-l H-P  q  HP@-@-M  r @@@0 k΄0P6 cЍH-DX-@-p@-3P5 P@jTp `f fP& cfP P`c`<P`@P Pp p@kpH-DX-ܔ-0H-@P 0 R < PA0DX-wl 0H-l0d 4 0 S@0%@$0 :p05Qa#3Q'H-DX-H-(0N A R qH-G-\P@rJP z`P4c1c@D6tH-O-$MP&   [@唐唀` P r 0I pWp P  0 p; ` V$Ѝ(-UH-l p@-MPmPH PP``P= @ P Q `@ P-JPUP UP R Q @ ` QJ 0 S  0 S  B0`S`# b `ηЍpX-0H-M@Q Ѝ0HW P P PᶷcPJp ڄ 9 Ѝ0pd᯷LP@P mb\@fb3Ѝ0H莿\X-l A'TX- m m l l  00PX-@- MP P P=.P(1  R& "0s" @ ㌂P DP0@0S |  @t Q \<8 Ѝ 00['zm m ܔ-Xm !Dm .m H-M< R J0 ==90 Ѝ['X-ܔ-@- MP P P=.P(1 3 R& "0s" @ ~P DP0@0S |  @t Q \<8^ Ѝ 00['zm m -m m m H-M< R J0 ==90Ѝ['X--@-MP @/P  @* Ѝn @-MP @P  @ Ѝ2n p@-P Pvp|P pp@ ံ)@P p@Pp ` p@ \X-Vn ܔ-(-0H-MP P PDpV\P@PTP a@{Ѝ0H a  Ѝ0g'tn g'@-PH@P 0,$ @ꄔ-@X-,-;B!0H-M@P P P,PlP=P MP hPP|  mP wP sP@ XP@@P0@P(P@`ӵЍ0蘔--' g'g'g'P/̔-P/@Q*P/@-@| pl?PxPPLHD@<8@gn g'/ n n n o 'o [o o o p @-MP` cRA0BSA@ DD *mRnR sR uR+dR kR%       1BPhd R, PЍ@ @p,@  Ѝ 1p 8-Np up O-MP!@pP`T* P@W@ T*`0@ P ? : 0Ao?B `W@` XP`T* P@WT ,PVV 0 `@Ѝp-Y'Y'K-MM@P P P9GߍۍKȐ@ 0 S `Pp,W:,ఀ(!WbpWP &< < Fb0 @ ߍۍY'!p-5I !Y'p ' H-MP P P*P  R Q ЍHxx l0 0  00 D< (( 0 Ѝp S'S'p 0H-MP P P(0@ PPݿ@|P lX0R>  <P S$P Ѝ0-p -@Q*P/lX-p P/P Q -@-P@Pp$-@-MP ,@P  eЍ,-p @-MP ,@P  QЍ0-#q H-P0P(PBpHN<-DX-H-MP P P D^R Q  Ѝ ['Rq 0H-0MP, P P+@P,P0,, AQ  @0~d@X, *Q @0Ѝ0,,P D-H-8 q Glq q @-MP Pb P0QSSEC ^:   ` ` ` `  ` `  dSeC ^/   ` ` ` `  ` `  C ^&   ` ` ` `  ` `   #RS WS ^S   S -S rS wS S SD 1 CR C 07 E  F   K    N    R    W   0 >0@@ 0RQ-,0ЍX-q q <<< 0 PQR0/H--D-$ 0AP/D-X-ؔ-@-鱿@ 0`0--s O-MP H@P Q Q 2/P d@@P EQ XHHHXHHHHHHlHHH@@@@@@@@@@zP@ T  pPaGQ3Q Q =QU QQ D _aEP3P@U @PAL`,,,, o  PP[P~   Q Qp U nUzPPnP Q @0 PO  @R 2/T x\QS?@+پ4 Y_ 0P. @+PP Y\|-Q @ @@SXD+Q@ @ +QR !\ 6Ѝ @PD< P @T-X--,-0--s @X-q Lr r H-M0S8< 0*ЍHh| *a|ЍX-1s ,s H-M`P@6p-W0A Q:UT h pU-W` U T  @ЍWs ps A-M`P) @pPQ$ pP \Q`P \$Q T `P `Q,  [``Ѝ-oQ4W) W W. Q QV$WV W W  &QAP,  o  P PV R X2/@PX U@Q *p|P X ,Ѝ XX-r r r r s p-{r P/So/Q  / H-oPl P/T-H-M  cЍT-X-S:S Q\S 0SS/.SQ?S/g'p@-@@@P@`@oPBa p蘔---g'X-g'H-@@pP<` Q P  Hc--p@-@`0P C/o"sT J@`@T @O !0  /o"Rpp@螮X-/Ȣ-H-@P dPT`VxP lpP@" r &n@@T렪@`p-ܢ-e-X-O- M@q B ((!P8 P P'@P`p ! &@  [  0!   R᭪ժ@Ts Ѝ ЍO ЍODA'A'e-p-X-@-@PLT !P 0o@a@Ȣ--ܢ-/ @-@P 'P@-p@-P@U `PPPV,,     p---p@-@`ҰP , 0 P PVPp-H- P BR Q9 bR4Q& ^ R N Q P@pR @pR Q Q PPPP P0H-P@u < 0P !T @0-0H-P@]P 0P  0T00 @R P@P0-K-$P Y@pP0`#( P%`$ % `U0"0^Q  %0$  ! R (QYD 00 R 0 PRA'A'--t-ܢ-H-$  PH-t-ܢ-0H-M @ Pp q 0+Ѝ0@-,@ P @Ȣ---0H-Pd@^|P D 0@APJ0P P @0S'Ȣ-ܢ-t-O-,MQP@P@@P:   3 TP Q SPP ) 1 PJcs lljQ Po HP P8bP `p[0`p!&TFP'P PP P@'  P"P@`ppP`p&')`p!& PU`p 0`p ! ȑPU`p!&P & ' `$ps[! P 00  0P" AoPPZ/  P P  ,Ѝ0  !   $ 0  !  T 0P P Ȣ--t-ܢ--N -X-ܔ-m / H-, loPȢ-G-M`Q `KP@pP fTPQ:PP  P PQ00P00 0PJP ]MpVp ㄢ`pЍ--O-M`4P84@p`yP  0 P Po? 0 0pD I4@Р08ؐ`@+(oP LH$` &@P p D, (0HL !y  W` HTLY  ` HPLY YIV  0@@ [ ` ,@ J<048pA 0( Z p V*W(P*PPP%  /", @AP< `@p X` Vpp`,BK@KP @< rX-X-ܔ-P-D--Ĕ-H--h--p-Д-----Ȣ-t--s-p-O- 0 7 0|E W ) @(pWQ p< 000  00B P4PЍȢ-O-Mp 0 \@@T5 P @\ @Р @\ @ (@`VZ 0&@T @Z@(@T  @TР(p@ `\ `T9 " p.*0~ ЍT@p% `$p Q p` "p. 0bp Pp p Q p` '0&@Kp P   pp}} P `X00SP  p XWX W @ @;p@XDp ЍW O$O4p@-P@U Q``㽝P0㹝 RP`P p0 R P000\ 0/@-0@ T P000R@0 O-$MP`CLpH_p ppp@ ppLP^    QY ?L Z   Y I$Ѝ-H-0,$ Q  Hc-|-H-P  PlXHHd\X-ecdeH-@<4P Hd-|-H-0,$ Q  He-|-㬜A-@T<  P뤡 (@P xxpP`uQP P00PAj-ep-X-X-X--0H-TP@T   ^G\GZG 00000g' --$-0H-P@P" P P tP dP P J@@@@@0g' O-MM@P `pP T |VN|||  )/P  HP P @ Qc Pp R} 0 p @ 0pRm Ri Pp`@0p@p W P0@`P@  pW 0`0@ 00RC `@` R< @ 0 0S/ 0p0@0S' 0 0@ BQ QQ P 0<40   .PkX P  `gPJFU l` h.Pv p!P  P  W.Pd P P^Q `Q Q Q@LP   P,  ^R  R R 0 \R0Q  $ 404 RR0 s$P$@o0 0?+10 PA ppp!7p;0yPᗾP5`FpV1cpd_Wp`Zɚ 0`pHW EށEXP  p00pGPd2Ѝۍ0pX $-݆ s"  g'g''-t'g' --s"O-M`PY   ЍOmP@pHH  0 p @P@P'*1 P  0PG`LI ` 0M 0 E`E 0X , Ѝ--Ĕ-Д-φ @-P\\\ 0S @T 0@0000 BR-g' -@-P\\\ 0S @T 0@0C000 BR-g' -/$-/ -P/卿-H-P p`˙@TřSWPaU F㷙EWG-t`P@2p QQ  QQ  -H-t{P pPCH-(-//H-MXp@G p P`p-VUPPЍ(-/@-@P D/p@-P@P`Q/ ! R:3+`Q  C`@pH-M 0*PЍp@-R@P`@TpQ/ A/p@-@PU`PUp/@-@ R Q Q! R * Q QS@SJ@0K-M,`(S@Žx0V"@^QpP` 0000040 00P0ЍO-OMM D봿P  p{P  @ @;PP#P    P   ZL pR 0``@D  Rpp`V /`P {0S 0 S@W R  R 0 @  " `V R`0x,`yyd,z| G,R @Q @ pP Q @ QQ @ p{P- h!P 40PK pp@;P p{}PJ \PPA $  # pP P#@P$ #PU[^ X@Jpp @`@`Pp$I p\P T P  P"3T 0 @ R*$\  $00 @Sr  0S:P 5\P&P$\  $$ @ $PPPPA@K$5@P$ p @pA PM ``\P PB1 \PP  $ p{P @K P Q @Q$PM 0&Hp @K 0Hp P P= P`P (08PP7  00@v P+p {@@QoPm Z FP@cX(T@PGP@ TQ   Gp/*P ( Gp%*@UT `H !q !Q  $@(p{`(;P }P+Jи ȸ$ A L $@ `T R \` @ R``P1E Q*PK '@"P tڄ@`@@@hU HUIU gUPiU pU,U U;U# p{P #G P=  00@ P3;P1P(-wU  R 0 @ JA PR R Q J `@ yl Q  ,p} +P p $0S PPp @\S p{R @   R q`  @P P@Z  \R R  0S S  @P E PPT`  Pvp{Q @ QY p{Q1 @  p{Q @X N@Q @PtP P @0"@S.@`qW PSP pl#@ p{<  ,p3)&4-0-t'Pr``뼂xxCQU pP 0x'V?PW`VP Oߍۍ 0 0 PthPTH0@ `s"U ԐT0 ͐LÐ|pdXLd ᪐0$H<$ 㟐4-0-t'--E 8-p Ȋ H-' e 8 8- y T o S Ȭ' %  f + ̽-н---O-MPC HP@qP{P tP rP 2aP bP.`V P p0"pS pX PP  Z>@TЍ(0 $p0 p`8--- ̽-A-MM@0 A R * %PЍۍ.Q$Q +Q(/Q \Q  `NP P IQPR IAo`AP,,0 $0 Ǐ댵--J s p@-@0PP@ R RQ <4 0%P& `ڰpt'-- O-M[a [h \[l p[] `\0[S \S SN[[ SDF@P[U-<0@^X^000@]XX5 ]X! [Q.PAU PP0pW" P]UPW0C0 U \U nU 00p]Q pRp00ЍDD0 D)((0 0 ꌵ-- Љ 8 O-M`Pp @\ Z \Q Q: . AR [Y. P[R[) \0S$ Y" IP ]Q [QY[[Y][Y   P R  P R[   pR`  \FPX R5Ѝ,, @PQ 0ᤎ<---Z -H-M@`PpmPn@ P2X aP dP fP       P pЍO-M@Pp`$ V ?P [P PE@ Z *?P  pP P@Ѝ00@?6SC ԓԓԓԓԓԓԓԓ̓̓ؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓؓ?Q7@?QW@Q?0|/O- M`P[tLC@@sXL4X UHPa@Q%純ԖԖԖtԖԖԖԖЕԖԖԖԖԖܕEP GPX IPvHP\!X@Nz  "@ P 0RP 9= 0EP \,= @\!@~p%<0APU  @PPU p00 0p.`@p pP PUl囆PTYD3I @- ' P-Ҍ .D-<-g'L-H-ܡ'g'0-rT-H-t 0[\Y렧' O-M袟rಟ`P P P5 6#Pg[&Pr PQ QxF\P X H P" 0?#n>P:.AoRy\`nX>PsPQn\,0n(>PV;P ?0  L=mP PPQKQPPEPPAP l>0  LH=Hm<PP, PfP( Pg >P0PP P L ~{㲙P坢 ᜢ sl@@)XP L  B<*r000蠿-t.----ht'O-,M@PQT(J< P$0 AT ! PP !rQ 0p 0R l帼㰠$]P , R P 2/0 R  2/Pp pR  P0( 0p0P 0$ PPP `P  æP` @`Y 㸦pPnP Y pPP auPe P P0S 0 0 @sR Q1D@_ @r  1 `Vʰa@ r R @P\pdjxPSP PUP XPU PPN(0 ,sQ  Q0@@0R A (0UP7 hrռP z㙘 (0 = 墪 Q 卧$ @p|P2PP,vQ/P!AQ2SP RPF@Q `XX=P P. <Pg>P) ?Pt ; QXXa 2pPF R1Q U 0!0CQpaC_ `SVpP|fQ.P !?0S`X"P0A@0 B0!ARP !@ B/!s꺍$pW e呠P咠 0oP Pҩ(P忦ё4epPU$,pP X PQ XsH5 ㄙ 0 _6> PPpP<P! >P& dP$ &QPAQ:P wPuP qP#RP SP U PQ  bxP EPPAqP(PU Ss cpp|r0S! B  6 2Dcp| xPQ zPaPxP@a@(P(@P   t bmQ s P ȦU4Rpf  R  2/p[ P!PU   M r `P 忥 匕 `嘦凕`aA7 r P 娥儦P !(Q P`P ( P`qV4 R  2/T PPP N P,Ѝ^ 0 T (0  ID 1`P p IFU묿-->--p.t''t.+ l'ʓ 4 O-M@QYrpR'P- `᳣P@Ug 0UP` p` 㜣P@U 0ޗUQ ɞ 1`p@VpG s\ 0RA0PUp`FU``vPUڶav0|Pv00C?s`P10YsPUY `  0`Ps !VPrU V!   P ( 0q[ `PqUP T0 ႗ q!A XЍO- /᰿-Q/A R /ᬿ--O-MPp*@0 T` %P3 `  ش늠`P   @<$P 0H 000R0,0(80(00@0404<<1D0 Pp 岑$0, 8@Ѝ謿--V @-PJ@Q 4A P <㍴謿--Q/Q//0H-@LLP@U U,㌱U0L'../@-@d哦P XoQ  0S0000 Q]= nbv H-+0 cHy=꜑ @- Q/@ 4hP` / ,* C( #  +x P `,L L0SP   @. ..ftp ...H-M  f=Ѝ.tgzQ/  $H  8 ( C   ... .*!.g Q/ p|L 8 $ Q  . . .V.H-M  h=Ѝ.tgzQ/ D(48 $   C} ...8.H-M  o<Ѝ.tgzQ/ X  H  8 ( CV  O ... . !..H-M  pz<Ѝ.tgzQ/ t8 $  * C' ... ./ O @-Q$@ 4DXdhQa ) ,$ M"+| h L, 8 <0SP  @. ftp.O  @-Q@,xL`Qa ,+ | 0SP  P @4 P y ,".. .ftp,.>5Q Q Q/,  jz v(. .*!.0H-Q@Qa 0s ,P\ PP,+  9 0H<!(.g Q Q Q/,  s+ '(. !..aL@!L/aL!L/aL!L/aL!L/aL!L/aL!L/aL !L/aL!L/H-H-H-H-7d H-YH-7t H-v7H--H-(.H-$H-7肑 H-<:H-6:H-0:H-*:////H-,!WL'.H-,!WL'.H-,!@WL'.H-, {WL'.//@-@0@-@@-@@-@@-@@-@/@-@m1@-@1///H-.H-.H-}.H-v.1H-MH P`0 0   0 Ѝ.H-M@     0 Ѝ.H-M4 C 0 Ѝ.H-M8    0m Ѝ.H-M8    0Z Ѝ .0H-MD@   0PPE SЍ0.H-Mll"R \, 06   d 0$ Ѝ.ftp3I 0H-M|P  K  0@ P < 0 55Ѝ0.~+ + H-M8    0 Ѝ .H-Q5.H--/p@-P@`0  p@-hꐑ H-M8    0 Ѝ*!.H-M8    0 Ѝ .H-M4 C 0 Ѝ.H-M8    0z Ѝ.H-M8    0g Ѝ .H-i-/////// / .B / .!H-M4 e 0" ЍV.H-M8    0 Ѝ .H-w4./H-M4 e 0Ѝ8.H-M4 C 0Ѝ.H-M8    0Ѝ.H-M8    0Ѝ .//H-M4 e 0Ѝ.H-M4 q 0Ѝ !.H-M8    0zЍ .H-M4 C 0hЍ.H-M8    0UЍ.H-M8    0BЍ ./H-M8<    0+Ѝ .H-M4< C 0Ѝ.H-M8<    0Ѝ.H-M8<    0Ѝ .///////q /9 /B /ᇒ /ፒ /ᜒ H-ML 00 Qa  0Ѝ.H-M@     0Ѝ.H-M4 M 0~Ѝ.0H-MD@   0PPiSЍ0.H-Mll"R \, 0Z   d 0HЍ.ftp3I 0H-M|P  K  0@2P < !0 22Ѝ0.~+ + H-M0 00  0Ѝ蟒 H-Z-$$ " A/./H-ML 00 Qa  0Ѝ,".H-M4  0Ѝ,.0H-MD@   0PPSЍ0,".H-Mll"R \, 0   d 0Ѝ,".ftp3I 0H-M|P  K  0@}P < l0 h7252Ѝ0,".~+ + H-M8    0XЍ .H-1.$$ " A/,"./ /!.q /!.9 /!.B ///////H-᪈@-M~ @jP  {N^ЍH-ވ0H-P׈p @} B~00H-@Ȉp P}~{0H- |zL'.@-$@ P zL'.H-~H-~0H-,P@ |!a~ z0L'.p@-X`P)Q O,@  @|Az 0~pL'.p@-h`P)Q O+@  @|Az 0~ }pL'.p@-``P)Q O+@  @|Aez 0}b|pL'.H-f~L'.0H-HP@ |! Jz)Q }~ 0}0L'./////᳒ /Ồ /Ò /̒ /ْ / / / / / / /! ///U /:v/y/!/+ ////////H-M8    0Ѝ*!.H-M8    0}Ѝ .H-M4  0kЍ(./H-M 00 Qa   0OЍH-M8 s   0=Ѝ(.0H-M@   0PP(SЍ0@-M@d ,P H 0  d 0 Ѝ!3I 0H-MP  K  0@P 8 |, |//Ѝ0~+ + /H-M4 e 0Ѝ.H-M4 q 0Ѝ !.H-M8 s   0Ѝ(./K-@`!PpR "  "r  Q00Q Pax Q Ua rwQb ( dr aY `់80S  3/PK,!V & ,!A-PU@" Pᶒ`ᯒxpPUPWP:@p`P WP`$$ 贿---Ŀ--A-M`Pp @U@,  pp& P 0_눀 0p pPPu LѦP @@C@ЍT'ȿ-!̿-0H-@v T\PuTPA04P:#P P*@̿-T'ȿ-|~'H- xe 贿--Ŀ-?괿-W괿-@-@4ae,, @괿--Ŀ-' MH-M    $ЍH Ѝ/M0H-MP`@ 08eLL # Ѝ0HЍ/ᴿ--Ŀ-O-M@S0 :T @P ܢbRܒܲ 0@ @@ 0@0S 0p0@ @ P P0PlP 刑P yP yWPoP y y   BQ<QY `DN pYW THPZ ya Y`p ypGW T Ȱ!@pP32PnP|@P pyXT@ 88 ЍO긿--t'Կ--Ŀ--п-VUUU @H-H' M@-M@ 0" Ѝ@Ѝ/H-M Ѝ3I H-Mpd`@P%dPP , |("  0`Ѝ贿--Ŀ-O-4MXop"oP`뼤@a\ U`W,@p P  d`]LZ, u4 `Q,@Pi(j`w$` D@@ 0`0Ps1I P@I [@I[PP P tP@QP@@sKQ,$`(@0 EFU 3 W @6 @ `tP~PZZ@ Z`=}hkAZ1Z7 AZYYIb`Z ZP\Y  AR0 B00@PPPAP @ @ P, `K  ો` Z  Z#`w Y&, K A╋PIK`l[Y [P ,P ᳝8P`Y Z [  ` P G,P K g P`=0P $( 0 @|x  P QP ,    m,4ЍO4괿-<!"!ut''-Ŀ-p@-M(0@,4PP `pЍp3I O-MH@p`[TH<8PW @ WPQ!&L@ !0 E8<p QPDp W  p  ꝡDP3Kyu ГPP  ʓPPUPH/V` R` 0@Δ@P7 BCP *bh#h DbᾕE G0⪔P`Hh h`b  0@]PL iH D 0 < T aX ݔ᪄ᷕ륄ᣄЍD P^p X괿-p.-Ŀ- !H-M Ѝ3I p@-M`$@P , V   0@ЍpH-M Ѝ3I H-Mpd`@PaPP , (0   0`Ѝ贿--Ŀ-3I M@-M@ 0  cЍ@Ѝ/0H-P@0贿-O-MMƟ6F|V`p&b00 >\b¤PPFPP P  GPP&6 ƟPUU  זPZ Eu腟4P(A  p0ePoP pPP rP ECPN DP_fPU@t7P&  P@ @8 8P E%p  P @T`V p=Q @Tpp᠜ wX8$L0w a0,`D tmP(pHV v/PT_@` D@ 0<CP P l,5C~t<@@@@_P4@[U8K p`PH 8O(P 4A@@T 4;@@T45@@~T+P& `4"1P2T    0p P8l`4`8TpP@T~P @8 Dvo"kxPkP v1XutU4Mߍ4@P4 %@ 6K3: 0,m3p 0d. .B.!... u"8.@!..,"..l!..w! L! !'U$.]= nt.,.4001p1 .P!!d3\` .(.ؿ-}!?!H- 0E03렧' !0H-M -LF1#ZyP@T + &6B@`tP@T +` 620`<P00 0Ѝ0a .` !0.r !ؿ-' !H-(PP H3li34..H-d3H-XޔP P @FDq!P Ha ;B!O-MM @PO `QPI 4P/ p  ~P; P 5'.ᰰ'"P)apP!  [P  P ppM  M / PvЍۍ !H-A-M(DX*P Q! upK Pj Y] 0%Pc GP^'J% @Jl'G^PPRJu^8SP,"p#"P7 FP. @`Fp $a~FP! ""PE^| X)P )P P  P FP! p,Ѝ phP @W P!R U 0aV 0U!PQPX !a"4 R U 0qW 0U!PQU p`FP9 p`V`p1/P. `pW P `p 0  hQ0S 048l !0pp`W:U `pPFP pPU%p"}.L'.$.' ]= @- MC(P: @;  P1JA$*!P RQ 1/P $1/$+R @NFP JPDP@P + Ѝ)Pb  Ѝ@ !vFP @ R]ܐ P Z_ 0$PKFP4?&IG#&.L'. ! !p.t.]= A-(MM@(P++(`+㷗+DPP (DP l 0 @@@@ @@@@@ P((5C(Ѝۍ !.! 0H-MK+ㅗP+㸉 P+|0+㯉DP Cۍ0 !.!@- M.*D^(P  @V PJ*Q $Q *'P * Ѝ P ` 0#P#m%.L'.O-MQ   0P  P P 嚛X @Padqᑛ P: zP Rp pQ %R R!"  @G  hR%R; dR `W p!01p+Qp(iR* sRH" 0 ``@`Q \Q`V Q 0p1p%Q^p  R P P Q Qx@QcP aP<0  3/P3 BP$PPHp ` PX Q Q   1 SPP$PPP`V: @T2  Q:Ѝt'0H-M P@T ' *2FD\72P @ '| 22 d@n0T HH [#Ѝ044 1x/ .` ! !p !,.D$!m ' !0H-M _@P ~' P%[Ptt1P d% h'T %ڞ)00 0[Ѝ00.r !y ! ! !D$! !@-(M 0  00 0@ @tp@4(Ѝ@@@ 0ㅌ00S  }/X' C' ! .p@- QD0 @8``;P Q 50 p@tV .0. MO-jMp1s? 0w0W, tL`P6 Z PD @p,p4 pEZ :[2U0*P@@P,  p,ppP‱@1P `[ PP  01 pW cM$[X4P 0( 00jߍOЍ/ .+ !B !J !#MO-M H"/0PL2< 冾0Y 唌P@'P P  '㘋pP Np Pw ,PQ@ G  0p >P P * %R@RA* h`'P`V*PGP/ަP p˖/ŖpX1 (P$@ PP+ (E,PG .P  P P$(@TPk P  $0ꄊ,P ,P$@(hP SPX`Pku4p $@PQP @ 04tPIP 2  $IyYpw0x 㔎 0p=p 踈  6(P HP  pp P p pt~Op 㛜0 H   "" ( ,p~v\P\\\ 0hh `l`p`P @p p p@WP4pv  0N  P P[` ,@P @ ||` pr/,@ (o @HVQ ,xW4p P #~1@ [ pp張@" 0KP  P P& ,QP!Ti6@P | ` P@[ )xT /p p$PN'P t  pP P! ,QPT* W@`Y V04%pW" τЄCW }Y @WZ q}&c+ׂC\tEWZ ͂n`a}뻄돋V { W ង@㇤Z dJ}SG}w@P$Xj[ g㞍&tW zX  Wu9S01 $PP @+ P& Y  ߍOЍ/ +` dP ^(@ @P @>.@^  ^|z a?Sqp B+mH$P  .A-XP  .$X$~P $xP$@%= @$@   =  <P <|P$@ }\@<$ 88ht@t. !pt4. .0.q!# !U !2 ! .5 !G ! !.r!Q !!' Q ! ! !,!] !H-MLaP@ Wvu뎊f p|뽁^R|Z |벁]RցD|Rq傃P 0Ap_P @=RP \\{z }TЍ$$ 0+Q*t.'  ' !O-oM M Q8 /p⊯|P`D<PB @ẕU<*OO lFTPPD᠕@ ዗PpW<⊯< iY3⊯Y iD   Y 8P | P `.`@ 0lPp0Y u   u 0,@Խԍ4p80@t8@J@ps `D\ @ @ ᢐPa  P P@0 8-@ @0+ ( +0㟒pP0- P  @  (0ℒp )!@sP }]lP 4 A|\8 +}P$<@P T/ 4H40`뀜 O ,3x 0w 0 ᨖP L V<` 0PP VUt`wv (Pј K!͘ p   PP J0 |P J0 P ,P :    | tL* P{ \  yy0 JV z 4c 嶿|*QpP:?Q` \P 㥏4*{0(}  0# | 0x9yɟ Pp9 QR @V iY 0pt)S0` 0Wp pV tL99p@ip 0 S0 0W   8&p㠘aP p Ah >` ; hUP6H RP  P~  0 sP5   sP/  sP)   sP#   zsP   tsP P P  0P p' 0P < 4 ,4P HP<P) 005*P $@ [ $0P #P t# TdPV W `"@3xxß  F0uyP  050P2rP) !2p' @  MIP B_ (`P`;P (xlL!2P ASD0P P !0Qo㔅oߍ ۍ0S " [t 0U&P@T *,%-]!0t'!w"!!-w"^!D$!p!;B!nfsi!?-?-!p !!!!!!*!5!E!S!.!V!k!?-!!!/!!-!!e !- !n'.` !- !->--!-d!o!z!- !!!!!!! .'3!!@-!,!S!x!!!!.{!!H-MHA0 PDP / 0 PDP / ٌ Yp. P@(㔕 ʌ xPUCx 㺌CP `X@\pP` ~ ~CPPЍ!i-!--8i(?- o!0H-BM@PP .PQVP @0 P䂌  {Bߍ0--H-@pP` ,iP EPQ.P@P 4@P0\ ~ H~-->-P!P/3I w"K-!MP<|ἒPPC 1@ ``C: 0`;@`0p /P P/Q/pI/P |0@ P\1L0P`@ '!ލ!!!3I w"!G-PB@U% 堀嘠`pW Y /W P EQ 0&@  ᏂP p`T:t'u!H-MJQ DD6<8 4 0/S 0&Ѝ .j .0.b.! 0w,".p@-M@P0  @ Q ||| E ]6pPt@0h` /Q&O60</Q PP&Ѝp-. .k ..b.!$.@-@ 0@2.p@-M"xP Q : 6 @P dd d0;PXX@L40  B&<<0 =&@ލp.nfs!*!. ..!.:!$..H-BMP P RxP~hh dP X6TrP H6D"D2 @&46@P$ 5 0 bP !5 0P !1`  l?!1hxx6P, P5d XaL8aP ,$!}  yP  q mPhrPP H}T PもBߍ--P!C!>-n'.!?-!P!-a!W?-!.!s!-!-!!!!p !!!-!!U-!!-!!H-pP@ p `8 p# @j-G-M@P`ᐐPP. ĐU 5P\P 5P\Op hhh X   0@@Z ,4jT@ލ!|!3I ! .!. PP  P/ ,P  ,P\/PQ !PHH/ Q Q s nꐉ!w"H-M, 0 0 QЍsH-MP@ 0 ppp; p% P! ` 0 ppp, p dmP Pp4/P bP0p,Ѝdx",!p@-@D `QPPP {UPpZ!p 0H-@PP Q P P QoP P0\x"Px"H- x'O-M`V! @P៍p ኏P xP PP `VЍH- 脈'K-Mpp$am0< PFP H@L! 0 p4/P pP 1/$qp 8 @1/pЍf!O-lMP P< 8p@ L03/P' H$  0` 6/P  0 3/o Q 8 <01/P   pW:lЍO-QMMz@L@.+hXh/ @P@H`pk>,@V@]z@P#^4@4@LTN/ Wg0^ N/*P  ᬎP P0 }PTX\  "4   @0!pK`048q00[,aH!L1`"B [@[R$()!( H!L!,!0!4!8!(`` V< dVaTfPYb$b卐4@$ $(!0P,qP,q048!HLQP0 5P`V'#EG pP@pP@de$;$BPw@<P H!L1  #@$Dp$>B :0z<8<<P P4h8 kP  _ PP $1/$@Q() Z}P $}PK? gA$؃LPLPX @$48!LHATY0H Y \#0?n?! 100T(=0_pX bPp  zoB 4@` N_T0PL@ Z0z<2p0`1 0 0 4@|@wpLp0P``z~ V?201   z0@p,P @L , L@ !x"!!!m۶!U!a! .L'./!'!0/' 0u0s0H-P0 @\P0P/ 0H"-! 3I @-@  p8@@-0H-M Q 8 P Qp  0@xP@ 0 0;5/P @ P^PPЍ0@-0H-$@P  POP0@-O-MP CPV@PI  6PDJ@ TA q`BI P R  dP  dP   P @DPPP  pH  @T Ѝt',@-M@ Q Q P 0 tЍ0H-*JTR0G-MM@08T<4,[ QvP0 `$P P0A`T4`0 P{ ,Ph ,T8Tr 00<Ÿ`A@T   0pL8z R^ P4Ql @0R 0pW PpRaPVW:( R1/4@TP* \O@pp@P@TBP0< `Y P K? 9P 0P4PP 0`4``N@TV  } P4Q @0( R1/4@T:0 ߍڍ`_.'0H-  !//O-tM@R,0 0 @, q P$ `P 0QUQPU Q003P  L03/P P `V:0Z u`Pp oPk (0$`P4 ($`,q P( P 0QUQPU Q003P@ L03/P P  X:0`V( < 0`H   0```[p <`8`$`4P4`8P  zP 8 <0p!0$` 1/PtЍаO-MpPPE `  Q7 pp @p  L0 3/P! ppt`0 ᆂP 0! #dP P Pp `KppY: `Ѝ.H!0H-@P P 0H0p@-Po@`Q0  p@> A-@ P" Q ` 熁(0S `V:0S P0QqPWS:1/AK-0MPP @ `p L0 3/ p 0P@`W:@`0Ѝ8/G-MMPx` ;p@p p6/P  ;x` @p p6/P ( 0~oBЍۍ!G-M`L@HpP EP PN L}# Q Qm P! a'Pbp$`Q a$qU(1,!04# H` P P%`0@)PC %P?Q; HP7 P 2 3p^ `p$P^ Z $H0P)U?H\. ;P5 .P2H4P- (P) . P$ K?t # Fop5q6 G0PPA@# 0`HYt\ XnTH  Q圑P P1 JJP?Hp T;S`q L0 P H  hPd`UP P K?tb # `65\"pru{AP1 p/67NPEQ* FPXQ&o !0.p A0y 0sK?a # F_`5! p; ,70H` pP(Q0030SP'Q 0W'pQp0p 0WP07@&P: Q@ RQK? #p F_p4 ` 0PPPNލPx"Z!x''ffs!x     }D  !2!3I t'!@-QQ`!!H-S P`V VVPU  0B `SV VV U E0\0@P`pw` V :w\VQ Q `&c``a0````0``Q `0RO-dMMpQ:P P dЍۍ ց`P ЁP  _{V7 +um|/+mmz(P \R R 0S   @PU2 $P  R 2/phQUc+;m+/2mP`@PaUj:4aPf+!m$$P  R 2/p pP0 _R7rP[FP K? 4P ` R 2/p1/4rN_[p$aV| /x;@@ P`t@tP  0Ad\ 0:ᠲ!oBЍp8. !.b.!!., !.$../@- @P !.!@-@P @o,.p@-M t @P || |0Px| h@hP\h`00  0`PH 0`@Ѝp/! !...P!, !!. ..$..0H-M=Q H@HPH8 04, 0Ѝ0.R! ..$..( r/0A B0 /D-$ P/ @/D-( 0Q00A B r  /D-   /D-H-MR(@/x 0` \\0 060I0P``` @UߍH'-LK-@؀ؐ` 0U Pp`1VW pG0VpPPE P P P/U1US 0p``0 p$D-LA-q 0R"@0 `pP0U 1US 0CP 0pT@T @ @pGD0Hp <0p@P 40A6 @D-x-|---!-!p@-MP@Q PP<` 00`2P` 0ЍpY!;B!c!O-kM4@`P  PpEP1!000PYPQ 1/pPdбP  P [ p@_H[8w Y PNX  0G B`HV [  ?npP|P p `[p  (kߍ . . .!.x(.h!!!' ,..!D-@-4@n{P 2 QR 0.$..H- P ..O-,M@Ryp$@kP @`$(P (``@ `%$VQQ P*5y( p@@A$rk@P@PE pp$ekP@* `$PA( (```$VPP Z*`H u p@ ` x(p@$:kPPpP x@D@P,Ѝ 0G }r!!!P 0/S/<S0S 00S/0 /S/H'D-@-M4  0@@Dv POЍ!O-MM,00 01vQQQ 00 0vPPP b夢 p0@%  PPl4a TRb @c rX beQP  0d7GxP Y~Q`FYQ  Džv8l PJ Pᷭ Pa4 P  00uQ8Q5Q3 nPUz P P m P Pd |  00|uPPPc@TkЍۍ!!! ! !,.x"!!P!!O-WM$@ Ӯ0S  ,j무 {/ZXꈄ 0S   R /R/Z@Xk 4D@DtDTQ` Q]` PE `hc`V`kP  `0 0a V`XP P P+ P `00S 1S /S$Q AP` `$PX @D`   @/Z$ P p pWmP0T` `(s,ykX$ AP PKxP |P + s)d  mn|nPhh(߭P( ,0"# 4\0sP $Q/P@P E(( 0@@AtX  Qo P T) #Wߍ@, !0.!x(.H'D-p.t.!.!&! .-!,.:!s!!!!;B! !!/!9!z!!!H-M Ѝ M0H-MtP@dP PD  7 Ѝ0H Ѝ/!p q!.!p@-PU |@ `P P  PUQppp踌'' 0H-MhP qP@ ὫPJ< /Ph܍0!-!!(.H-MA oquh`%XqXQX!0 @ LS0%v<A   H0 0   0 ` @ P`0P!JP@XAu0 *@O =)P !q᫬oAuߍ!--(.--D$! 3!8'Z!!A-M`uBO P @ p gP`00U0($ @ލ-(. H-<H*AO-M☒@Tb@tP`TP Hr@TP@@T r` 1uPU e!00 Va ){PX @epeTK .PH  p p@ PPP U}P: " 5yrP/ 0 ! )y  P  Pp   bpPj$lpzP?q4pL0  dЍ-h'---- ;B!@-M@P    P  Ѝ0.MH-M  0 ЍHЍ/O-MM@   ⩙PJ ⡙PzJtd ♙prGpv)@ Pp Gp| P25Pz p P`P ט`Bt -vP `=P  ` P 55V%  P @P!)P  PP 3 2,PP = ;9P 4 P 0`3  CTIhPЍڍ u5 r5ᛩ!' !! L,.H-M ؾЍ M0H-MtP@d'P PD  C5 Ѝ0H Ѝ/!p !.!;!!@-8@P ( P @P@!!(!O- MMiP/ #P/ P! PĠ p`@+n P* +a T  + a TPP `P  Bo᠂ Ѝۍ 8;B!@-@8s R@ So蜃 @-4@#uP  QR ,...0H-PPP#@Q@U |P ut h}\@9PP9WW$@QPQZg0HWgt.,.0H-M@kIP @qw$  0Y  Ѝ02!'Y!@-M@  Խ Ѝp@-PX@/Q `Q tP `/Q@T@pH'K- M@$dP pP` pp puVQQP:$dP ЍMH-M$ 00 0ЍHЍ/A-pP`vP @V !gn P P8/AMH-M$ 00 0ЍHЍ/\H-P| p pd dX XL L@ @4-!p(.!,.!t(.O,.y(.1,.0H-@8PCv@ 00H-@8P7v@ 0HO-DM @`P pP L03/` PU:pP K ` PVF pK L03/P2 剁i(PQ "0P  &m PPP$P 04@P@8p,PU000, U X040T \ [2Y1:PDЍO-M8@up@W[ Ѝ4 0pS RP puP P`4Pi p `m U*p`pP/A-HM@Q9 0<S8D@ @8 3/P P P`p L03/P `V:  <0@D8 8<P@ D01/HЍ0H-@P=u R 0H@-@ 5(3@0A-@PA pag0 hPUpmpW * 0 SpPW:P pag4PU Q 1/pW * 0 SpPpW:AK-MD Kp8 P`p@  @   0@6T q @ PrPЍP P D P P@Tx     }D   !3I  !K-M`P- P开@p  Xp QP@Pd 㩥T BP  9Ѝ<''btl!f@@-ML@q @ 0&q Ѝ@ЍD'@'O-MPB ! c0 PU p`Kk qPa@PP! @PU! @ip t p@ۦPP P Ѧ@jT d ߍ0P r@ Q R@T: Q2`!~Pa0 0 p*0p  eslQ+`p  ?OPP k Y 0T a0N$(^O  N q Qp @X0 [ P0V 0tQ z !/!d@edA(!- !P0@ S 0  0Q00A B r   " /D-H-M(@P`/.s 03 hh0 0000000` PP `!@jߍ-LH- D00S 1SQ/A  D-A-lP@`p0P 1PW pGT P p`D-G-Mpo@q W``P``廥< r W'#W  c Wi&u@Q(:Pa P)hPP P PP ŸP lT2 k\H"H2kPQR@Lbo n  `(/ PPg !PFPQP[ !PP0`oRIdPm  4u'PP3 P, PP& P 0  0RPP 0I` DPUPލP !1!! !!!!Y!!(.$!! !..!b.!!!- .*!.}!!$!O$!H'|!ftp3I d!!H-MP" @pbPoP P `xP| 0B`h |D LP@T 9LaЍ--- !- 8'@-,000$0 @@!1----@-H0 @<0 ch((!10 ----"oH-MM`p ;@@'p  P@p آ@q`Ңq`ЍۍA-錀@P@@@ @ `P p P nP  P'@|d zd@H-MM@ ;`P`Y'p p 0V@ቢ`tKq`@Ѝۍ edAO-AM@ PPAߍ`P L03/P  P@U: АԠ,( X*$  L03/P  X: аp  [ ,[( YY @ 0 +l`,( 0$l@P $ ‐0 P`0@  lp  0l@PT `@ p0@Pp 0n.(."!O-SMPP@(Mpp1hXP@T嘰fJ `Vc:T 40@ YVp@$pPi 0Ɵ0p8`(P<@@YP @ RRpP8  ,NARX=ş 0<@H1/ pP0dp0@ ppp3/ P@0p, 80 3/|PPP@%!$Q t$ Q X<4  8L0 d3/P@P] P p cg 0 7  ßP0 00F 0㍺PPO }Ժ@p8 <`PU 8Qn4cP@ PP0 3/q8r L0 3/, p@D0@ 0| x@T0 XpH, \ @\<@T!a8 RK B!a"p6T(PT!B"-TA@z8pQ9 p7d 0@ 3/P2 T `Q4P- 0 pW2  0S$ d@0p 7/P ,PA P p f@!(pSߍ@ ! `P <  `Q APppW,@  e a ] eZ0 0h 0M 0VPJ`᝹B(Ѝz",=;>H-P0 @ `0  pV0p0PpSp`K-@MP L0 3/P 0@P p`@ Q J !pRpR@Ѝ( (/HP!P/HP!P/H-(MH`@ P e  0pp`` PP P 0@0p0P`PWU`V HHPP(ЍX\kP H/V /H dHPt'p@- M` D0P@  `!  0P `N+HDd Ѝp!b*8kH-<0@SH`4PyjV9rj9VV0;:!HDp@- y@y@y@y@HPp ep//K-MP1@Cp (0AS*d`0 6/ 0( 0 pp 7/Qh0 3/ލO-M@P[4`崁崑帱Pp P RF V P P> d!PQ9 P PP-  ,P  J0`03/P ,P Pa0  Q Q Q HPPpZpQJpQ  q" 0  QЍ|LG-`MFPpW g&hP _hPŁ VhhPł MH hPkE,hPG=gPH5gPI-gPJ%gPŃ gPagPŅ `gP$ R p`(g p`P$ V:pp0  Y4Qq$ Q $Q$QzY  l48PQ Ql$ Q\ `$Qj X$Q P$Q H$Q @$Q P 0 #HL #HL #HL #HL #HL #HL  #HL@ |#HLR d`ЍG#PB 0 0f2)( @P 3"Q 2 `ЍG#H\"@PP!t@0 f2P@0 f14b 0P(b# H!@PP% 0d#`ЍH \ CH ` 0 Hd0S? ! f  h0P 0DP<#HQ,  P`pdp``I 7/(0  Pp 0\@P 8H 0\ ........ .... .L"!3I .(."!"!|t"!"!#! #!#!#!%#!-#!2#!!"!O-4MPp aPA P6 `  L03/PPP` V:#0P,p!0# "   % ^ ( ^ 0S PppfR,Gp b8`T 4Ѝ 4ЍOx.A-@P> P\1/0 ` 1`0F?o2SP) p adP+ 1 `ZP! pbH"POq h P 1  C0"O@A߯tO-$M@\1/Pp`Q `V` YP( pW D3 0P  $0Y0 01q0<0  08 1V0 010<0  B 0u ŸPCP\P Epl`rPC" ppJ0`LŸL\(P0pp匴p,f< 0 @H0Pc (`pPV pPP Yp`Vp 8I gPpuY  PW`PW:iou<p80 w pP 9P pP R 2/pW,00Pp(p(p p(,(dWp,$Ѝ(( (0a-tP !!"!,"!P-` #;B!K-@Pap $`P6 pp Q h`"pMhph  P bI"pM`  p(p崁៮Ue`A-M@P `03/P !  0P `h 2/ލO-EM@($BPP B@@L`pCPr WT.E @ P2P @ P*0 簀GCp0@P\ @ pPT00@D00 $0 PX 00Pp PñWUȀUuuuuA ⸴  u  0 'p P J 8PP {P Lp,TH1/PD `'@@LL X4P0PPl hp@PHD<8a L0 3/ 0`6/PN H  `R L X6/P; X\ 0l h0 3/p-  L03/DPh k Hh 4pl0 0p0<80`  0T@4PcVD@hpL<8 PU:@PD`Pd Tp!@ a@(@!PU  AL " TLiPB U Efa"HL 8p@ P@,  (  @P` 㘠D PL#HtVP0 D F0" ֺP ^P P! PaP:<qPh L0a@ 3/XT P@P5 h l@㜀@ (p ` 1/ 0y@ 嘠圀T X*@ @㜀嘠@ yXT P@Q  QcO 1/`*@P!!0!P  \U FPO 0$\@UP4`0 V0p0T000Q,p(0P@WT^@8pPV9 F`@P&F A T RЍ. ---y"!t"!(."!"!O-,M@%PS (@\  4`P, VV V`%U:V   `P  P $U   00 M% 0pp(PJ`ᦦ-,Ѝ 0,d> z"!!"!"!?@-@,PQ 0 4  a808  qAQ l0 0 80480 3/P,41/,H048 TX ,z"4 R80Q0Q(1R Q//z"@-@|0S4 c$S 40,8 0P0803/P,41/,H048 TX ,pQ:0QQ QS: S  Q R 004 H-4!\ \ 8 Q Q80$SrQ80SS S0Q:\ S\ O-UM`pR, W (1 3R$1A2R"1A2R!1/A2A@ (^PW P0@ 0+ @尠V@Pp*,  (0@ @PJ(Pၥ@UߍHA 0 0R RH <\H @`/O-LMMHQ h!0Q *1S$QLU )P ILЍۍpW P!T17/@P@@ P& PHLp L03/P ,P0PP  ;x`  6/P pW:HLL'.<.@.p@-8M@`040 0PPPPJ[PTJJ4 0 0P UP@PoQRQP8Ѝp0H-P H@[PP 4[P $[oRP0;B!!$!H-H P3I .@-M0P /P P@/P@ 4,@0 P /P ЍD.D$!b.!p@-@`PPPp@ .3I @-@ ( (P @3I .$!K-M@qPPڏ@p]@ؐP  L`P  LT]ЍPppZ @LL P 0 O3I . .$!0.$!'U0H-@P, ,Pa0 0H}3I .$!@-@P@H-M@Pt`tpPCP KT}P`7@ @T 0O܍3I .$!G-MP`cp@P` #TUPp T㗏pX  0܍3I .&$!0H-@P5 P0H3I .A-M`pvXP*P @ xT` P`0X0 0P P P$P@Ѝ3I 2$! .8.0H-T@P P 0800P0  PȾP0{P08.I$!3I .K-鰀@T& p`!ZP P@T `ZPPP0PPL  0᛾PTPH 8.3I Y$! .H-P`@P 4Dp` dS `S`H8.4.A-MM@ ;_PJ`P \ BS ኍЍۍ{dЀG-騀Pp@T 删P`YP   03@THP@T D.8.3I Y$! .4.p@-@P`3, ,P0 p@苽3I .' 0H-@P@ @P@ P o03I .k$!   H- oH- oH- o P/8.H-MP ` 0pppY @ 0ppOD"P0PXЍz"$!$!H.H-H!H-Ma@(P<)P9$p UP6 P1 $1/$P  0@;P P@H!L1 @ 01/P !PRP$HQ@PRP @ RQЍ@L'.=@-Q @T R Q p0S@@P@3 @@P@3 㯡/H-M(P@U ̱`ȱ  01/P @㊡Ѝ/H-hMP; a!1P@pPLPP  P P P 0PP2p 0) 0@dpP d 㽼pPhЍ 㞱9P .;B!$!$!$!H.$!%!)%! .7%!%!/H-v H^%!!///p@-`Q  0@RPU @T00Q0SR p ]p@P Q 3/H.0H-0M@l    ,($R3P P3#W  Pl 0Ѝ0H.//H-R p`@PTPQ WP `Vp@8$ PR3 P3VXP$!H.0H-PR00@VU@Q" % %!$#㲰0.(.H-@@P`eWP $( pP HL.H- yP -0H-@PK'0(.0H-P@N0 P V0%!0H-P@ᛰP (㫻V ,PN/ 0~%!O-GM  KY.P vP P`p耟@P#  ! uP lP | eM ^;@LZ ,]ҋOO @Gߍ!-...%!&!'&!6&!S&!G-MR@pLOo2 lP PP *PiPU ;`l` ЍR t&!G-!M`P@90:pa!P<|ᨁpQpP/ p ۲P d xPbT` MVP=P%  IJP  PP2  0G+@X0[ Я0T @0 X@P L G4 !ލ !c L&! .&!' &!&!D$!H-P@Apph P9:0X`̌<` 0P0 < jG,, T&! .&!&!&!'!0H-M @Xc  0uP YQTP@Pמ@ T8 @0G$ C܍0!.B %!%!%!H-H-P.t H- H(~%!O-aMp@PWU OP b,PY Y Y_$G)P d"ሹP P0 H"|1P0 P:9 )`!0hX ,`PS0 ,`HSpWN#=3 3La!0I8Y```!cp`P P iP pppp @`~G@ P`tGK F0 0 & 0'p 0ppPPG,@ ᐢaߍ45 )PJ@PS.l'q'!'! .'!t.3'!)'!(.-...p.t.__J Dp@-@P`@ 0p@A'!H-M8Q@pC(GP `W1`V 3 -} ( 0E +:P 0 0P㓸\넉dPP 0` F@L `TPoЍ'!s(!A(!(! .#(!(!'!(!c "/..0H-PP@PI !T0,"D Q0(4  (0|.....@-@$P/ DQ @|.\|"Z0H-@P@o0@-M@ ?Q T ]OЍЍ@8@-@P x|.!/K-P`P P 0Ap QPP R 0 RR8p@DQ0V  0PIW# (  Q$0X, @!$ % Q |.(K-0M`@ PrPЀ P0X0$ 0S!*    PPP P QP P  R 2S  PP0Ѝ..K-M⺛Y80,(P`BpW@T V `VPY P\apHPW :X X L^PqH^0,q 0 Ѝ ! !(!(!@-0M@   @ @00( P, 0ЍO-MpP P ! voP0APP S @0SSP`RЍȰU  P0p 0  I((Q $&R,PQQX  1L  PP Q 0eC|.(!0)!H)!O-TM@p$<0 4 `e8 @ `Pg $p@pD` 0 R ,@XXiH L08 @R @@@pT \  0@RP WPWtrQ` P P(P8  @,Ġ⺛Y# <0` Q BTPPQQS S S p 8S:pQpp2T2 0`Y8P P  *WY  LT$@`TP { CKr/ @(O(HTL W0 H  @DL 8P @ R<_( (Q $N0 P P3N   00\0GXdP P$EtHP(H  DЍz"H|"/h/p@-MPXP \P `P dP hP" @ Q &0Ѝp\\ l0g#HH T0h44 <0i $0j 0k(!e+!v*![*!C*!**!*!H-R0H #GH-H H-P`/Z@P# p@H 4NPaP:a@P*Q P @ R @ R@P@@-P @a@^ 0㻧(!{+!=L!@- @㘲@L+!0H-@P㨽T Tp{{{{{{{{{{TT T  T T@ P"T0|.G-MQ@`P "T*Q7萟耟Q (P (0S,  R4PPV& 0P" `4p %0O l 0@;s ` `զD @ @0/(@`EЍ|.....!(!0H-tP@PtD  Q "PDQ , (0D S Q4 p0|.....O-$M H L rX0`0P\pS YQPpST@0Q^ 0  0K Pp  0JYp [Pp   ^ T  Y P `  PRT r 2H`VPU BZG`@d0P`@@& @ @S@@Y@@Y@ 0VP`Y```@S@@@` PZp^TT@ p 0 `JPTp ^P  pY8 P  P   p  p^TT` @0 PpcJPTp ^Pp Y\q:p $Ѝp@-d`@PP`0rRv+Piv@ 00  S@ p..O-M0Q> q` P + DP@UP U yZ 娰 @ 0`;/PyJoKo @P  @0` p1/Ѝ..z"G-@P# Q 80 Q3/P41/P D0/P@41/@K-㍺묀@p Q` 0/P``pWV X`sLP  TR!HA  qKt|"....p@-P@Q DP`! R 2/`V: p@ӿ....H- MȤpŤ0 @P UUT 0@U@@P` VVU@V 0PPDR0 @0$`P0 z Ѝ+!D$!O-|M1/H1/4l0P1T!sP 0Y[, (0H4p0`0 (8 , `3/pPoHP RM80pHL4T0P!0 0P X01/\ 0p3/pR H L03/PJ QE H L0pp1/>H@$ $p4 80 ( ,7/P\ 8<RHLdh 803/\  p0 @3/p 0[zpp|ЍL'.O-M@P )`Qc(P`TP%52PUR Qn &ᜅP RPF0Pn|ş|R0 ``pp``幗p &0PHpTPPP@H@Q>@ LPgLPJ=P `P TPQ `" R pQ 2 !0PpW:T`V:P Q TP :@PPT@PT:PQ(M$JGc&3pP"0 @]@.`!0U$(0 f`l$t$!$H`@PPL0S @8 3/P PTH`H , lŸp2R0 :HP ,u `AH  0` `````p^ PӖ,᠒'PR P`NŽKP 彽Lob@P P  P+ pPH` L03/P PU:X\P P`=V 㽢`xP eP R 2/@`Ѝ `T0S H2 9L'..3I  ..  . .dh .,!+!+!,!O-LM@ PpPD@ <DP `R@ p@# X @6/P( X\0lh h 3/8Pq  h L0 3/< h4pl 0p`D @0^AVp@PL[:`@ķB ",  PH`Cߍ谢h ./O-MPQ `$@@`(bP `"pV=U $Q 8 Q "G=@p@Ѝ|"0H-@8pq X R 2/P Q8q5 1S ` R   `0SP P $0S ``0 3/< 0 2 PQ`$PPVP*8G-M,PPVC @P@P @P @PŁ @Pł ߛh@PkכL@P$ R p`(ƛ@ p`P$ V:< 0 RZf t,P!|qQ0 pq|R8`pdp``J 7/ $@P(猛0  9@0 @ @0  @ ` 0 P0? xpP0` pPL `p 0Q $0ppލ . . . . .$ .( ., ."!.(."!K-MP1< @Cp(0AS*d`80 6/ 0( 80 pp 7/Qh08 3/ލp@-(M@,0/`ѳPV    Rx 0  0`p ᳊A8ݵ(Ѝp,TK-0M8q L0 3/P  @ p|1/ P@ p` U0 P ɱ0ЍK-@M8q L0 3/P  0` P` P@Ѝ /G-FMP @@01/`P `FߍP  : 0P``PP -P p@ 2/Py 0``PP P`@-@Q 0 A2/@P 0 @  @^' @-M@8q 0 3/P<  Ѝ@/O-MMJ Pg[P uP] OP up ʘ*@+:uPd`0 D@ u$@+9uP 0 @+9 P"0ޤP tBP`+9L r0 Ĥ,+90 ᵤ 㮤Pf 㤤P\@+9uT0 ᒤPJ( @+t90Pa P,Y PvP.t묰 +Y9Gܠ@唐`p  0nCP  0SPE u P + FЍۍ&-!-!-!-!-!-!-!-!-!$!.!-!.!;.!.!-.!(!:.!K.!J.!'b.!O- Mp`K;@T: PY Y4PCP, pQ:  q?P  0bp|XCPP Y Y 40夳9 ЍU.!b.!Y.!߯O-MM@p/PP PrpX`P` P "0@+8 PS*A@/JPP `P FQ Q/R sP8JP "tP) P Xh  rP&J/P[!0@+h8`+c8 P{sP J P+W8 P:hA?eA`@sr^A@PЍۍP /PP) @P`P <P< PT x+]* P*+W* P*fspfrP)A>&A@@PP!b.!D$!;B!H-* p@-M Ps@PJ  @,rPJ P r`8r V P: 1,qQ0OЍpO-M080 ` 00z @(8pD DD [DP 8P 0T 3/P[ P. 8phAg"80s" 80` 0S ФP L03/P hl ! PU:P8(P"8PpW: p0@p` `%0000 ,`;p5d%XupX@&T  R q p5@`TP7 M50 `0-` R4@$ X,`e0P4$@,p0@Tw  00`Xh`PΙD00L`,!<HHAC ` =P4<xP@=P;8Z Cs=P p Z 8,p0@ [*!k8q  0 .0, 4 0@p0^0 0 0 ,pk0CVJ9#X 0 0h@@PV ~ `P H 00@ PXv@VSJr%PoBd{J:$(8<H1/@HpL 00 /o" +6 0  PQ`:U`C0   S 0 (0Z( 080S 8 0 0Sp 0 p @  @p `P0`0@ pt P @ R0 0 x R8ЍC(83I h.!.u(.D$!L'.c!;B!t'0H-0MP   !0F"d @P6U7C @嵕 @$P 5ᱰ0Ѝ0. (.0 .H-(MP@>.(Pj(p,p10 (0R0< 0F0P0 000```Pp匉p, 0J,щ(v0bP`(n(`(Ѝt.X0 .1 .G-0M@(@ X>P(p U d1`0 p  0`Qp@810 5! 1,0 " R Q P ` L03/P  P U:PU  0`Xp PU@P2,p(EA(E@0Ѝ訹}"|p@-M)@%P7 P 0`000S0P`pP %+Ҕ@,ϔ P0)  ,+ P 4|*㵔 'd-㮔0TT Z@F.㣔44 40 0Ѝp@!  (.1 .o.!}"G-pMQJ@PPe : 0 ` V " 2p 09": r`T Pv#cx"p` X0 8H":0 w8"J& ,Pg Ep0 "(H0  R P5 ` p=TX嘪p!0 Q 4 t R8qS TX兪`  P  .,.@-PM$!@ * n088 8088L @PЍ,(,>.G-(MPp`W1 PYI 0`0S[ 0,"C; ( 00  09{@v{' (ЍG/X RTpLHP0@T  @PpQ(Ѝ p.A-MpP@(p&3/|U,tt t0lDp `0 x p .A-M@P.dP P ,P% DP 8 ,P+ ,PP|  ,Pvp00 @`CPU PUJ pW@d 00A<p8`V 4`V HWQTta/N0A+04QU 0QU }WB< G !0000@1NC0$ xP 0 P05/ PN@ `0`0 ``PPPpW XpW,`! VC` $0`P"` PЍt(.JD?.g/!,.<>.!p(.# ?.t/!@-!R*Q0VW <̌ @T T T8@T@@ 8@T@$A8@T @|AT @@@@@ R 0m {0!z0!'H-8Q 0m m0!z0!'0H-hhPX@Q Q Q  Qa/PU 0.L'..0H-@$P xQ R1/0Hן՟$ Q:Px͟$P U:H-0M@$P L0 3/P' U  0S0A`0  BRh( pWpA`p'`&p  BR @! 0! 0Ѝ..H-0Mp$@`P L03/P $ 803/P $ 0 `Pp7/0Ѝ/H-xM@P@8`-xp$ `<W-A$ZP a 㓭|xЍL'.p@-0M`@8PP P c0㎿P 1/$ 0 x`   06/U U 4 ( ,0Z 0Ѝp !/!!H-0MPUJ@$0p x`   06/@ 7P xx P@!0Ѝ/!0H-LP@ *P 0 ~*P  x*P)  r*P*  P0}  PP @  PP 4!00Bl P 0P @ 0ڎP0J<#o!/!/!/!/!/!O-UMM,pZt,PP{@SP ;(PrSP -PRP H!PrbP  Pr`bd|rt2`"hB`PHΠ  `,B@ ````P P p Q p000  n jp x0` Jp 嘁0Popp<+, H`Y KR 0 $0 vp( @Tr#wPQ $P P |QP PPUߍۍ .p(. ?.,.>.t(.D?.,.>.?.>.>. .$?.>.` .L'..O-aMwQ`|@ T P$P |Q1/$Q}P}QAT+ `Pv |fN Jp!Qe  j + RW > :0 0S O +&0㚽PU  (P QU}QU/e  +PPQTQXQ\Q})<, E" "@" P a/Qbob*dZ [ `tP }AQ  Q  Qa/@T[V  0@X p j  qP)1  P#S  8儁`Xw$Po pP`〰 8 U6*L0 3/P, 'P$ _Z& 0    j Q$80   V P 0$1/``$PPV. pP P L03/P P _Z j   Q  8 @  PU: p| @ TP xtlhp| h0 xXT\| T0 @d@`@$P  D ,@  0 ,, , P H4| @0 L@<@8@P ($ | 0 | }oPb` P`` (0dP P``QARQaߍ ..0!,.>.b.!.D4t(.>.>.$?.>.p(.?.(8!Q/Ѵ!/ .O-Maa8@P,4P   PxpW   R/07/P- L03/xP PPG g`48͖00PS H%`_㺻 $ 0R 7Rt;$ _`pd" P!  PIP)DP`,Iph!P RP,1U A  0UP @P 40#<IPk@D$ L0/3/PT"0 P  I `$P @P  PIPHRHQP #I 0@7@pRoP  > :P8p@T*0x 0SU C"T3_"IR/P,"I`0;$r _@p 34 @Y| Q~0" ߍOU Ro   $ @q;$ _@p| R/0:$ RoC `H 㮪"` I  @ ' @5 v/@ *I   I ߍ@+!3I 1!:1!,!B1!,1!' &1!W2!!1!/ # 0!/ .O-MM/`p@T! P|P $P 1/P $ R  0P1/P 1/P|QATTp `P @O~<`8P P / 0  P  ޮ 0ծҮ pPQ( XQ%0 ^PPTq 0@xp P` `7/, PT0 0xp0H0@M `7/ ᤮,! Yᝮp@PQXQ% 0 (PPTq 0x@ `` `4/T  PT0 0x@0H0 `4/0 o ,p! W~  0$_\YL<  0lP#  0bP|  ZP `  RP `^Z38 PZ ,|,D`D@P <P @ 0 P+P P$PH`YV' <@xP 0  5/ 8 B$0xP0 05/40<  P!@Y PP   P JĪ@P < ,8 7 Pr  0x BQ8!# Rd(@@;8$PQ , P㹈 㳈PLp;`|  8P@T8!(0S ) 㨸 8 ,8(@$P!,0S d) 㖸 8 ,88p!00S ) ㄸ  ,8  0;bP,p@0`L8P  R8(,40y0Pn0 0`W  dT(y0\Pn0 I  V((8(P 0 :  G'y0lPn0 ,  9` P  !P '  0  &0@q! PP P' 0  ,@P0LS'   T0S&   X0S& ܷ  `0S& Ϸ  d0SP& ·  h0S & 㵷  % 㩷  8   0㉇400`0`Vxp)(@$PS8   08Sqpq R  R   Qx(@$P,8P,Q@|P 䄟8p;P84AP 0P`VF $ Q?  L0 3/P HPXP$ Z:) ᙩ  P/P / P   o"P{8P 48` s P4p UaV{V 8h<P4PP 8`x Q[ 4# 0Pc 9P KP 0 Ɇ0P市P(80448!0| 㱆\b% P  ᣆP 0P0PPUOPQ 9 9Q Io0F0F PQ @P PPPP x < UP@P < NPP t GߍۍP. . .L1!p(. ?.1!*!1!1!U1!2!2!.!42!I2!^2!q2!'1!b1!t(.D?.2!2!1!,.>.2!3!+3!33!:3!A3!H3!^3!e3! $!l3!!%!s3!3!3!3!3!3!3!3!pP,.>.b.! 3I -.!3!4!#4!@-@D P P @,.0!p@-MP& @$PP" 0PP `HP L  05/PP 8!$QH`R UPPЍpL'.H-8MP8P= 8@y#T5 P1 $q$Q P ޭ`P``V Q  ᖭP   ` P   24|8Ѝ 0m z0!z0!' .G-Mp8Q 8+#`Y rP $A1/Q  01/P P1/P$QPH1/`@0"W* 803/P <0S  3/0X `````3/PppX000  3/pb h L03/N @წ  p˸ᄭ PA @` L03/P |Qzp `V:W$:P" `p㘀 L03/P  |Q h l0"#v` pW:v ` ``  ZT|Ѝ$$ $0m 0 y0!z0!'l0!" .p@-@`PQ  D@ Tpp@G<㸎P PUpp .O-$M\)@`p\  0 PU PPU 0P 0`pPU P Q` V$ЍOH`$Ѝ]!.H-M!bAP8 @Q`V P m ypҩP_ q`P x @PPQ$55545d5556hAxhh!h1lq`Pa Pp paWP@ 0 P`I& 0p`Pa PppP`a 0 Pp \`XPp@88 80 `P#PЍ . .L'.0!HJL,M$?.C\EFG>.,(,>.=@CC>.08:`<=?.O-M@P 0`a q08 0000 pQ7` RQ`V, P&" R Q "t  p 0P g&"Q!! S 8  `ЍD4 sK-MQO@|899999:0:L: w`  O ́pPPP XP B 0 > ,p! W w` T . HpPPPXP  " 0  ,p! W ܍ Pw$0 ,Pw  0%  Pw 0  Pw l0  Pw L0 Pyw 00  Pqw  0܍K0!"!,!' K-HMA`PDPpu   0  0ppZk QM !n@D;\;x;;;;;;;;PPg9 gP2D fDPP$U*Pi$`l@ `l@`l@PPo @0X &pe 0Pp y3GPWHЍX'8'5I .O-4M@Q< `PpPP TL0 3/P Xo R r P,`! VU $@Q:P P+E⚠+,, PJ4Ѝ#?.0H-P@PL $P P0G-(M⠂`p-W BpPvJPPpG wppVP>l>>>?\??? @@qv0 y @iv`QP !0 ! 㶱pI @Nv`QHvl g0QP  Q:v.@-@C"P < $1(!,048<G-M^ P`u =VH @s8P`P^ sPh 0SX0SL!  @?4B @s`d: @s \0 +`0S @Ah0S @Cl0S @ p0St ֮@E qsP 0 F @hst`Qbs0 Bߍ0!;t 5I 0!0!0!K-MP Pj@ J`lXp4KXKKKK@LKLL$L4LLLLP GP0,!< 0A0Po0;4Po458P PI  0u'dPod!K`l\p o`pM`lhpN`llp0 R 0P  u CPWލpP PptPotPP P5I L'.@-@ QQH-@ P`ppp p@`gᷤ$Q"d  @H蘐Q0!p@-@MP@PJDP R ,@! p``P T X0P @Ѝp . .O-MM?xhX0(P pW pW rebq(@@BP   ,0RuU  0    0``Dfp pbfhPJP`,吁!(Q !C A ,R㐁 `  `ߍۍ .O-5!0H-@ PU  Po0H- 0pS7 0P@Q U `PQ V*`UU U P Rl0ῆ40pP "c  0p@ "5!O-GMM@8 ;P4PPP!J4 `Gp F0P# P 0ypp PpW pW` uWPPPDP 4` V s#vPX`U04X 8008,D$( 0`8p P#v؀Xk8P$ P PZ 0 #",  #"M(Ԙ8P h RvP>$D P 4 EvP1x@pW W   P"  P &vP 8 R |8ˆ8d08 vP PJD[0`V: <@P1 DP 8 ᡈ880p W P p8 Pp8 pu@  C `q`V0   ္PGߍۍd@6!6!6!16!6!6!_ 6!S6![6!6!O-_MM`P@2THQ DDY ,` P uP\ (Z0uPUHPP @h l phdP@@ PTX($< 8Pp40DHPLp@`p`e@\ kPW PP W W' W/XP;X p@0v`oP  Z\T\Q T O``\TeeP  5  1赟pd!0 2@ X` eP CP  =P t 7P \P# ×Pdyh0<` 4<T( $@@,`LpHPDF`P@@,`Lp?ep P:P@ U p0D` X0 X0`P<0@48`P X0@@,`LDP@@,`LD HPR8p080uP ZPd @@,`LpHPD8<40($PT8h0p 08<<4@ uT  A@P P @tP @_ߍۍC(@$P @_/ $; P  W- 00 R 4P ` PP帬PQ088PĠ8p@T0W@0PᆬP0a[/plDP<t ~Ppql0 [/`tD`P(x\% @p0Y !`Ъ040 0#8@ 0#  R `xp W:_B@@i(( (0 L0h .94!^7!q7!(.7!7! L/~,!d~r~U~"|d7!|7!G-8M@( `P HP P``\P|8`X&&qy8Z`0  $08Ѝ 0mh94!7!i!@"/ /H-0`@V PpDP P `pV@p@-P 0P@U  ⚴ڂ`ׂPV҂p@ς 0,h94!7!7!@- @ s@7!A-PP`@pW P岂専,0LQHA04q8aW X   ?V   T0`  R Q  0 p?`\p`  ЍO/ ЍL'.UO-\M RW  CdLA p0P O P0f!3`@>PQ @0P = P0f3p@P@P?HL P PU@P T 0Q/%$X P@10`d5/p`\Ѝ5I L'.@-@P/  .0H-|P@Q% Q0XT D 0"!Q@ PRUR0 0 .X?.H-@P*p- 02 H@  0Eb$"8!8!'0H-P@P |T T TEU P *P0T T 00 0 0 .X?.<"0H-MP@P  dPPT  bP @"QQ Ѝ0QЍ0H .X?.Q /^ X?./0  S :H-M 0  ЍH /$H-M @0 Ѝx 0 0H-0MB"0T00    000&P0Ѝ0H-M0 0 ЍX@-M, $@0 0 @ ЍH-M0 0 ЍH-M 0 ЍO-WMM"XP0`p @P t"$0 P$`VWߍۍ刵P AP*[P ,"@Q[ " " 0ᶜG0P QD∠ 娰X\`@dPpA  !0@0蘜 ;@@@{PJP P=p;w  Y$`刵P!1 ya  G@(`@(P L03/P X( \,0"# #" 0@ T:$`0 0xp 7/@j4!yd!"3!/!8!9!#9!p@-M4  ?0PBT T TT bRPU 0 Q T TT @  0D PCЍpO-R R@> ( pTЍX?.8!9!':!\9!59!O-tM8^P[ 40@ SD0AQ0R^C0` p@S[ PPTTT  rp 0`:T X0W0-0Q0*0@`@VD`CS0`T 0@`@VD`CS0`T @0`SD0@P0V^ Q @ P`P ` `P`  T1^[ :^ q0p<|pp2 `PS0p pl 40lpp0 PJlPU4 R8<`[,P  Q [  0Q0pf 8@< 0RD AQ 0pS @0 SD0AQ0R @ RD @P QmB`0Dp  DW T `V`@<`8@@D40  P8PP!@ "L8 PQ o PQ xP  85 `p0p LQ Q= `V@  @0D (  T, @% @0DP$00(PP0Q01Q U, $0"[  PP(PP^  P $040vP 00U pldD`dh嫮 VQ? " `>,0`Ģ4`@,8 ;qPJ4dD(pPp@,P P PP P! )PPP P  `p$0 !R RR.R@0K# " ? 400O@˝-@ᯝB R R R (0"r" " 09 0YR0pW ,@$`PBnrP T `p W,4,ppnP" @0g 4_ pP,| 5kt `0 W UPD (p4P OPWtPU RtXJ3z%  P-"P(8 L03/PLP  @RD @P Q1/  @U tp<Ѝۍ$`(p4 0lY8!;!q7!X?.K-8M8qP/ @X`\PV ppIW? " `p>,0Ral V0  "᷐P 0τh@8Ѝ 09%Y8!;!q7! "O-TM $H0$P L0iPHJ0H 4LP`P0 4<($D @0RP.J(< ?P@ˇs#,W'(t(@p;)_,! 0!Dp_G%"@T'"p\    0P'"X$! `VQZu  吵" ?@Lp?`HL Q pWp   0%L1!#*P 'P\ H0$ 0PJPPL4p 1!H0  0 "`V  Q @TЍL'./p@-8MP HQ2"d@A`~ p 8 P2  L03/P*  ,# +"+p  @0 0@# A0" 0 t`#2 d""0   #<",R*" P&08ЍpL'.UUUU3333O-M4@pPo? FFPP Z QPکPW   pP p(P JzPP PBPTW Ѝ;B!G- 4pq>pW(PT \ (0 ?@`RU U UU R, @"0R Y PW ^P  GP:Y ?W P?6"R 22  G讥L'.4O-MMPP TQ4pAn 县 @P w  ;"pp   2@XpZw D10P 1/ BT _`q`VqOPqPUq qЍۍ 0k V{dЀ8!;!7!H-MM@0P 1/ ;˵p `PLoP p 0uq0zЍۍO-M@吰px| Q94`0ẑ`H pG0w@0P@PЍ蘅"X?.! . .Q QR 0+ /Q/ AR/1Q/Q//@-@<P T$Q @ .X?.K-M─ Q @4` 0cs Uh p0(@YDD0  p"!@@@@ЍX?.!(! . .K-M⾀4 pRAT W* TpTY `P@T U T TT W pP`UT ^ D0 08Q 4PU" pRUUO`m`Vm4W  4 ]@@PXRU PPO`m`Vm:!O-M⾀@p_`EfPP V QPکP"0@XKQ RY ( "  `FpvPP P[Ѝ @- P0r0222R0+09 R  @ " >,Q " 0R8!;!;!p@-ρ BP  P`QP?@0P`QP?@ `@ 0$b #b0P 0pO-KM`PS㤕Eu  ˆpPePfP lP zP6bP eP  0$ 0ׂppW @T  $,p ჾ/ Z8 X6T4 <F ,Pl |-P$   P #`@p TPI $$ x# p]pqlZ' I,pʔPp|KP(, ,$+(+#0ṽP 5$ ,$+(+ bŸ2 pRp@ Xpf@ p PF/-pt!P  fPt pIs,pT>p<$[ A[,$+(+j ս+  _+p@P P( 7+p3Q P 0@T &P 8$(S+@^Y !`   R0q0 P0R0v 1P V V A Y kP@QX.`.;!.;!%ܡ'P`@*p! 0 @pll0< p D0 @upЍp=!C!O-lM K @oP `2p- @ p ( 'p 'p hP :(h" 'p 'p  [ 1 4 & ' lЍ - R0 |0 x0H-@P q ]&PpPPq Mw&1 p000H-P0@@'p)@P@0p@-pM`0 @p P I&p @F&pЍpO- M@ `p jp tl0Tlp0pPZX0TPZPT@ @Ph0P ЍJ< =!=!3I P!=!_ G-MMQ7QPp@3 ` V8PZp` %ЍۍH-MR @PpP `V  R: `QP 5d`P.`P  QQ*jdP  P  pp `pH0   P`@ffЍ A-MM@ P|| [ P1`    +%p* P ` `P  0 @pl ,'%P pp P 9P H<V bЍۍ=!=! =! >!!>!>!p@-xMP`@S  j  %p/  `$p$  $p  $p  $p  P ! P0 fp 8, $ xЍp=!=! =!p@- % P ( DZj$$  TPV  QpP$%%pH-8q!f>!E!p@-@p80% p@xPU 4` P-PUp@н!"E!A-HM@tPP Q0@$M2p` 0P pxU @ z| bl ?Up  HD1HЍw>!>!>!A-@`5p$   11 1  6  rH Q 0>P :&{P P P U e0A-(MpP@`6LP$pP8 Vs P !U PP tPQ` x5tP @P P bhC PK DH!h H3,(ЍAd P9 P6PXP5P K_'(ЍA,  ,CP $P  dpP 4U(ЍA (ЍAP>!>!F!>!*E!EE!>!?!T @-M@tQ0$&1p   N xЍiE!WE!H-MP@pPP= + 0 + );P  0 `"xQ Q RQ 0 0 R\ C PSP HЍ ЍH?!4?!E!@-M@pP Q , pP t 0_ЍE!@-M@ P Ѝ HD  } P Ѝ@#@-@:d9+PP POLP P@!+E!>!T p@-@`LPp P$  Pp: !$P p,A Pp p@E!K-M@q & ` 0 pP2 PP0 px P3 @ P  > $> >$QE **AxP @ P | t\PK JHGK@p7;pA@ Q   x@ Rpx DH!@@ 0@pV Y PHQ   Pa ox!zpЍw?!?!`?!@?!W?!H-@P `pxt , A`UP2* 0P P:H E!>"E!O-MM` *0"p $$@P+ ` !p@Zv7P  PP@ `Z u\!`1 pPO PxP `@P T`V* @Px  0Px` xQ@ DH! 0 ` `V`xrxP vx*Ѝۍ?!?!?!Mb@!(@-@ xP $ L@@-@"@CA-@Mp@PR `{P V :07  @ЍAP"R P 0r>pWU# * (P P `* <0% \ p <0 8X>P * 7@Ѝ @!/@!_@!|@!H-M@`8!QQQ)Q7 Qp P[ЍH QT , pN||ЍHQ" Q/ QQXtt!Q0 Q< QF,,,!F@p0ЍHk  !: 0P 2AD!\H1Bq # P0pP  ^ Ѝ@LL x@T v@HЍH;>!@!@!@!A!A!@!@!@!|c!@!@!@!@!@!.A!p@-M@ 0hP* `HD1 S8!@ 08P0@00ȌP 080  P 090 00 Ѝp@~ЍpO- MxpWH 0@ P [ ` P:P PY P [ U/ PP' `(  :  0? U    %PpW ЍE!K-P 00`PdPp88PxPU!  P X `@P @W@X %&p4  PU $P&xPU P X `@P @W@X %p P88`88`ЍP Xx`@T +@  0P`   0`x8 PXOA!`A!pA!A!A!ܡ'A!">YA!@-@ P   P@:O-M`PP4`0` @P  P 8p*=㐲/8h0,d4bp[pTp &kfJ&kNO쿟쏟0 @  0t?PMPp[ 4P+ 6PN@Qf@ Q$,h@XhtxP`kx\pxP8`f(@E,P , x8 8‑E|Q 0pP; 8 0 P:pWG| h P8@ K 0pP 8 0#PsH G  8 Z4 ,= p   ) $Pd * l l|h $ @   0 W *   @Qa ;+8+00[| 0 @ppRp@pD ?p 6 P[ tp; grspN P 8NjpP :(  `8P P8} 0 !/q ,8  p@*@T [`P`@:@ @v`,*8zVpVp8+0p{ @ `` p@,@ 8_pp  84' P Q R000 * Z[8<P O[$M[8PH[: _P >[ P@1 X @dp x,[h X'[ ߍ, gp Tf ,p!/1,p /(p,3 @ 8p kP G 7  p p ,7 ppTpRVV, T88wP @  @ Q P>  P: @ %zxpP &jpP P&8P p$h$8 \  @8ϊP @$0S p P p6@8 +`Gp 8p `<$(ddh58  LpPFp dP p @,@($ Ad!d48  )ptnPxp d$ 4 0V8ppX 1+n&pXIL4 pp>!1R84 P9 @Pcs P P)!@Tp,@W  0S" QP= @X :8@@$", ,* @!pW @ P  @@bpW! @8P4`  : p4p@8`V p P Pp`V)0   Q `VA!OA! ( W!1 R  1Pgꄔ'A!8E8 @T LQ P  0@L@Tp,@ p넔'"A!A!OG!@!@!@!@!.ܡ'G!#G!B!3I P!_ J< ;B!0B!ݸ x"bB!~B!B!B!B!&4&B!B!C!C!-C!=C!xC!!=!C!$ C!C!,!C!C!&!C!C!D!#4D!LD!wD!D!PD!D!$D!D!C!RC!B!LB!=B!D!D!>!'A!"4G!0H-@H5p Pp$0H=0Hq! F!z@-M@ᦈp tdPt :DЍ@ 0d @Ѝl!F!0H-M@ , P p<,,,Ѝ0R |l0`XЍ0H<PЍ0HUY=!qF!F!F!F!@-@Q  ppU-p 7P  P@~VPzP @y=!F!O-M@`PP Р,(p R ` `0 P    !  H6@B8 P P  @ P@ЍF!F!0H-@LP PPWLPLPWPTP PXWTPTXWXdP PhWdPdhWhRU P # ,PPRWlRU pP  p,PPplRWl0@-@@'F!@-M@Q  b p PQ `0 @kpЍH<Ѝ@ Ѝ@=!>F!&=!p@-M@Q  ] p `PPJ|7WQP| h0 ! @.pЍp@4Ѝp@p7`i`kЍp@=!OF!'=!p@-M@Q  44h_? BmPP p LЍp@b!Q| A0S|f`XP<P `@P` XX  P x80 @p Ѝp Ѝp@ =!`F!'&=!p@-@>P PR TX<`0p`> *e>@p耼H-M@pP tq^$"P'P pPpPP PP@!U8 >pQ: `l!R pP 0P 00.'p$$lP >P p *P> >'3VptqЍ jx`V >P`lP x[>P p *`> >p@ FK!'K!' JK!mK!K!AK!K!/K-PE S `X!1RQ;q@p .,PU Q P P Q   P=PP U Pp@ `崑U 0G;K!=!,L!L!H-P q R 0S  U B  0:K!IL!L!H-`?@_?PSP*@S0p0Gs p $pP00R0ʚ;H-M\J8 ^ 0Ѝʚ;G-PM PUO @`SO*$(p`W P P p0pW P 4 OpPP# OP( `P Q   Q,p,ppp,<< D0(( ,0 0E:ʚ;K!L!L!L!L!H-M0Ѝ0H-M8 M=IP̎.à( B 0Ѝ0Mbp@-P" (^ @PQ`V`V ^R`V`^`,``4`PP4P p 09K!\L!L!H-P T P 0)9K!sL!L!H-PT 09K!~L!L!//H-P8 09K!L!L!G-(M$@T < <`$`Q ``` pP8@?P:<! 0`V: p <Q  ` P8 p <`V:(Ѝ 0Yy9Ȉ"K!PB!L!  R/ 00/ᴃ..0H-XQ@P Pp P@0@4@(@, @@S0 Mp@- MPO @`V P`q QPpQ   p B@SHSU HLP Q   S Q ,  S(PQ 4  S0PV Ѝp@ Ѝ/@-@@SO-MP @TPȲȢPP @@ R D2/(`V P P J `P  Qp   `UVPP/ pLP*H _P% HLpH R 0s qpp 0P   0Q0000P0   QUPH 0cP*y7XP3 8pW/ `VPTPP P     `FQ 2/V pWP,1/4P`4`TP\ PЍ` 0+8봃..K!D!L!A-M P[0` O0pQp*0 Q  0`0@s Q0  0(PU @F`pPp*` ` p@ pP*W pGp@ PUЍʚ;MH-M  0 ЍHЍ/G-AMp`@Pp `] 0rp#  VV@ V L ᰀ@ D;t :   ZAލ舔''MH-M  0 ЍHЍ/G-M@P`g p 0grZ0 Xpۍ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    fЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    HЍH Ѝ/ MH-M    ЍH Ѝ/ MH-M    *ЍH Ѝ//ሔ' p/=Zꈔ'A-MM P+`p @ PPP ,`,$ `Ѝۍ舔'' /ሔ'@-(@@ Z@Zꈔ'p@-@_``` ;P  ` `Ɋ YT PVp蠧''YP/@-@6DV @#Q0H-@"Pp ! p ! PpP0@-@q [p @"A-M P`@p  t Pp !wv PP 0pPЍi$  L r /Q/ !/p@-XM>PU U7V)@T @`Q T TPUA @>@P@ <0) 8 > U"P> *@BXЍpL!@-@T B@A-M`V @P P  nP Q  0R p B`VЍ SQ/@-@T fB@@-Q 0s0\?o B/o 0 Q 0Oo0C?oB2 0^0R030O-aM0@p`F @wJPp P!Xpl XZj  NRpR P$ PP dP ZP@T P @X @P @X@Tx  T@PY( PX hP TP UT\X @` WP \@T\X,LP P BP L[LDo,  U( Q P[PPP!P P$R$RPLPH (%MP @` ,P PU$, 0 @x  pp 0  @DpA@ 0@S/,PCP !5SO S1 >,PTP5TdP @h ĜP d@T!P( P,PSʇCP#:SS S (UP|P U P(@X TYT@,PP 帒*> @RU ) p @ d!H pHP}H P P 00L ` a PD@NPaߍ P.M!i_M!M!(D!M!%A- MP `P @ P P P:` Ѝ:\P `  p8W p8 r P  !00:P PPA`p ``0`P iQ.Q  ` ``Q4t'0H-M P@  0  0pЍ0~iH-@MP @P`R gp `V pT P P `V`@Ѝ xQ/$ /H- M@0 P:`V 0 PpP P R: R #e0`P`VxP Q  Ѝ p@-@ M PP ` `,PV:PpM($P`P` ` (`,PV:$P_M$(pO- ( 6@0  00  @W8    p  4[ _X+ 4P[,@Js PPA  @l2h<@(P0:d@680 P`8@P4E 8`0p434@ Q P A P PP 4 ,(   0kP4P4P\P  P P 0 s\P 4P S  ` P`Ap` @R `,@V:@kL @ pP ``,@V:@YLA `0 l2p0<@  8p0 @` R ,P00 woP (,8@p80aP4 L424`Q P @A P P2@P@4@@[ U  *BP P0 P; PA $PN WL|P [G 4P  P P  @r\P 4@ R @PT Q2  qPPT cP $PT $XPPw Ps[o, (0@Jc` dh❬P @4hAՄdhP dI$P W LpP0! R *B <Ѝ؍"Ѓ.KP!H"LM!N! WP!sP!G- P@p`P `mV?@ QZ 0  GGx"P!Q/K-PBxP Q @K@QKP Q @J@QJxP@TF " JJJ,(VP X,,PP,(VJ40VP J4,PP40VJ<8VP <<,PP<8VJD@VP .D,PPD@VJ J KJ` P T PT@PH- D0\ CϠ%AˌDq   0+":+ 9!Q 0\ RH@r0 O-MS pPQ`  @+N@0 Wap 0 P @@0pU   `p` Ѝܡ'"A!A!.O-4M1C@P* `   x `0\PX`^l^x^^^^,___8`D`P`````Hv`HvpaaHvHvHvTbb@clcxc(d4dHvHvTddddeleHveLfHvXfffg@ggHvhhiiiPj\jhjHvtjjjkkk(k4k\klkkkk<^P^P^kl ll(l8lDlPlxlllllllmxmnnnnno$o0oA \n , paP @@,ZP PCPe /0@iC DIQ \  @P Po P P p_GP pt\y  @P P Pi P& li\^  0pWZW TQ\ ?`X\rR 0@@ q P0  0d P P  0Y P7 \ ?0X\VrB0 0 A P 07 PP\ =@ P0 PQ   p Q Q5Q2,0 Ps @P/oP<0@ ォP <, @!0 <,0 PV @Pl/RP408 eP 4, 8!0 4 \F XU X\8 P @$H 0P `p @P BP  0ApPH@\  C  |\d 8@ 0P p8\X  0pQ\ @PY @,@}R;\ X P~Pp 0@  ]]0Q8 \ 0!   @j0 R$  \ ?X\VBr 0 - PP 0" Pp  Pq@PP \P  \h 0@   P\0 R S4 0A !P pT\F , @8P PpP W  04$   0@00@,0P9 \ 4R R 04S 6R 6R R{ 0 R R RsC\ 0@   P\0 R_ '\ VPS PP\N ,P@``VP" P PF PDH ϧP2 D, V!DHP*  P PP"`\ L @FPLp a\ ?X&\6p`@p @$P P3 P  ^  Y TS  \T  \I :} z PU $z\, P ($\! g$pxx"  |\ @>P hs\  Xheb\ ?^X\VBrp 0 o P 0d P 0 0Z P8 2f$\ X@```VP6 P P0F@  P/[0P VQ!T!R!`VP P PF : PvP p0!p  pp p [0Q 2Q!\\  0 p 4@NN!Q!E\A 0@   PZ0 R ,/\, 0@   PZ0 R Ū!Q!Q!R! \ 0@   PZ0 R| S O8N! oQ  Q QjQ=PQH Q Q@@@QA  Q QhQ9=P p P!0    @VZ0 R+  0jPEP% " P  18 444 0A; 4 T /@ pwPP /qPP fU @/Px Z@Ppz4#@h@Pa O[.P Pꄔ'P!P! M!"P!Q! p PKP@ KP @`KP |KP lKP+ \KPa HKP 8KP (KP KPP KP KP KP KP KP KP} KPz KPx KPu tKPt dKPs TK\UP{ <~KPk ,yKPh tKPe oKPb jKP_ eKP\ Vb P_ P PVX PU P PE1@@@ p,TPd =L Q 6@@ m0 jTP (9Q!L  0p 4M!Q!P@ PB  PM  Ph  PE x P? d P9 P P3 < Pw (  pPY  PS  P oB" U< Q@ @P[U  U @*`hTP Q!3[, p4PwY:7U  @P@S W@TPI P PDQ  Q QQPj@@ P PP*Pf P P^@, PEP @P ;P !cS!!cT` -P (Pq`lB  Pp4H )A0p P @45]@ P PPY@/S!P P PDP@ P PhP=\4L, 0 @ 8'87p4`DcP P PDR@,0 p$ ( Pp D P ,@, 0) 8(&  pP B  PU DpP@U@W@`DPc P PD`D=U6 0D 0@   `IW0,Q$ dS!U3 , @p QP P0@08, P B  |P P PD_S2S!B cP$T gPP P@P X U U [ \WW\\V  Q PP Hm3U!LU!P P    [  WST `Q  Q Q Q@! `@fU!~U!Q Q Q@dHP Gz@P@6@4ЍS!@P $$ Q` 0S0S  ,`QRV, ,`ޡP $ & $(h@) W  @ a@P gdyQ!`0\pHP  ` P` P!R!O!U!U!!$U!)U!T!S!fS!S!R- \!S! T!Փ2\!=\!*n\!I\!\!\!\!\!#\!+\!a\!Z\!۸ S\!f\!\!S!s\!|\! [T!lT!T!?T!yP!T!ET!/T!T!VS!4R!@R!MR!tR!mR!cR!`R!R!R!R!R!R!R!|R!  P!q!O- MP`p@"Py"PP p U [VQ UP X` ~*`VU\P @mPsPnP9 rPWUY UUPTPR 0P. bPHUJ FtP> xP@ p 0pp  0@  P5 U 3  A.U!   0RP P  yAU P U U P X: PpPPU [7 Ѝt'O-MP`xP6 =@lP5  U ``V p=Z@W P! `VI? xP @ \P5  A ЍЍO 'P xP p$? qp T=P      TЍO?U!U!H-M@PR `P /P p   㩾Q &UT `` pU P W /G`T ,PT`U -`ЍU!U!G-M`PxP n%P wP p ᲟP @ q W%PPP< 0 |>z>Ѝk U!K-@M @P h `d  p  'P t t@ЍG-p` V1`@P.P X FGZ : J 0pQ00@T*H  Q3/K-T`V0 TpW1 @LL Q Pbqp ||PPPP HHPQPQP3P4PPP.Y $0F# 0A#U!W!3W!W!@-@cK g@G""@-@P @H-Q# P" gPP# @ P ` TpPH`W9P $$ (0O" 0>"U!6V!DV!V!H-P TP gHSH= 0o"U!V!X!0H-P @ PP T 0H0@-P @c g@ 0Y"U!YV!V!0H- @P PI= PP00H-P g_ P @7@P %0 t@ 0u"dV!U!V!H-P QT$$ $0cs" 0m"U!lV!'W!X!@-P @PT@ 0Z"U!uV!'W!@-@ἿP Y0@H-T R H 08"U!|V!V!H-P @ c_P ` pTPZ)`Wp@- MQ @T R R" PcoP P>p ` 0\  Ѝp<< D0z!(( ,0 0!V!U!V!V!V!X!O-MQJ pRL P@ < z8P< qPPTt`P ` FP BP U U t U  pp  `  0ЍHH L044 40![W!zW!bW!W!3I W!W!W!W!U!GW!X!OW!O-4M@P$₾d~pz P TTI$8`a+P $ |b:P ̠$`  p/T Q a P P T8pPPN9PPJ6PETc.|X P)|TTQ88mP4  P& 7P P P TT R LP <[8 87YP XX0PxxQRpVP c_ 㞿P< Ȱ` pᒿ`PP+9PP'׾ ᯽PT P    p fP bP bV [P p@`᣾нP F`Hi CpP$ur4ЍЏ""V!V!V!V!ZX!cX!h0Q03Q/A-Q TPp Q 8P @Pd4`PC TTQtt PuPttkP88fPC XXW t  t i @p'P ] p P W @I pP @V T$xxQ8 @(( (0;$X!!-X!!0H-P@p 0H0H-@Q pPWP @QH` PPe"PU:Xⷴ0Z!'A-M@`PPPT  up' p P$ !R* | 0 <p PP ` ^p1rP ,q $n#ЍA cQU p` !qNPUЍ P PP!p0S < ,Q ?0$ >FZ!KZ! [![![![!ɝ`Z!5Z!O-M`Q @U zyz~QP P;@,(('P p   p Y  |p p WP% RP MP HP CP >P p9P `4PY 4 Dp !<p x;@ . PP 0S  p @ |p DP Rᔳ᪘ps @Yu   Pok,%,5   p` L0  e%S S pS H pM P pG $ pA  p9 PP tQ0$p ` p'  xP <p ;@ !Nx`V# P P   P`@Ѝ`Cp D `RphVp  P `  V  #Vp T Vp  ڹ`P p d5P/ 40P& $+P! &P !P Pn !P PP_ P[  !p}  pw %P  pm %P x`V %P`V 8pU @ pM PP 0S  Gp9 @ /p2LH Z!Z!Z!Z!Z!E!T >!EE!!W?!"E!Z!0"Z!Z![!'Z!! !?! [![!$[!/[!8[!B[!Џ"M[!' ,!^[!g[!r[![![!.!;![!A-R 0S P`@8p p 0S[!H-@PpP$  չ`P.P! PP KP x 9P HE .ㅰP` n`P @! , [!H-@'Qʄb(PA p`pP @P` XXpX VP:4R`pP @P` XX X V T T T  T!!!! !@!! !!! !!!! ! !! h   T  T  T T T`@P`XX X UXH!ꠧ'[!S!ԓ\! \!\!\!"\!*\!1\!<\!H\!ڸ R\!Y\!`\!e\!)m\!r\!{\!Q- \!? A;0S /A+ R 0S,0pQ l2 R Q,0 /H-QM`@Pip 0| S` *Q pPE E *Q:ǖ`G$$ 0SQލ\!C!YA!\!O-4M$\(P Pl< 00Px `B0`,p@PPd   P  PU@ P PY@T,P ۾P.   H,P P(@$PT= ¾P   H,P P @T,P%Y" `P#PX  0X  0\@PP 2 24Ѝ 2 k \!\!0H- R@T0QPP0.T T Q@ @T Q @@@ PP@Q \ \0O-MSXP` @ Z8*@p` `V3 P@PH V :QG TE?YP>@Z8@VD*p^ [A @@@ .Z:p WA @'*^^@NY `Z:`^ ^ N nVk"`Q V`FЍ]Z7WO-Mp@QPh2 @`X2y[ PkJQp a Q @YQ& \Y PJ \Y!V< WW\pG`5V/ WLH! pG)" `( P /Y YV W50 )\0!00 0000pG` V W! pG``0@ U:@`ʿV W  P P@궿7@Ѝn t'A-P9 pPW5  e0`.Wp@`.W&,W W* W Up\ 0 -W_W  >Q0p P ppjXp H"pt'H-M`P @P pRW PP t-Q0# .<8 W 0FQ2Ѝ\!\!O-,MP0 @ \pP(P  0p P P( `p P   g0 p0P"L  pG ,`Y:(PW} $`    08/P(,`Y:( $0p8/PX (P $`  R 6 Q $S 0p(,`Y:$( $0pG(p8/P'$!p 0!pth 0,ЍOpL@W 0( q0,Ѝ\![!1]!]!\![]!\!O-GMMPD@`p, pALpZ  ,QpQ T  $QpI =upD W  @   * Q+V42 0<p' P Qp!  ] OP      @  0ppAK GߍۍmoW R@ p W p )+15 =@@C e  .0"P  Pp P PdH%Pp p.   Pp p"p  p {Pp p  2/ 2/WW gPp pW:bpx@P`TP0PPEuS 2 ppWl' n!5I ,@- @  QCT  ᱺD03Q Qp@-@ ``P P `,PV:(P $P`(`,PV:p 0 rA-M `P+p@ Pۍ@@gP ` )P ^@///p@-MP (`P: @"3 kp1 0)``p0@ `ptl 0" p@ `<p Ѝpؙ"l]!z]!]!]!0H-QU @p 0.x0H+.0G-FM@>P+ pF`   M" P `ֳhp F?`> *ȳ F?@`Fߍi0H-@M@nQ@8 @PᗹoQ Q@Ѝ0L"H-Q  RRP` 0"]!]!^!$ /Lo/0H-@QP  P t 0H-(M `Pp!@ᖻ\ 0cPP pT !W:ֻ7 NP(ЍiH-M `P@(t 㪲 Xp  Q(`!^PpZ 㐲( ``=PЍ8i(iH-M P@B` p= s$ (P PqЍ:iA-M P`p@# Y @ЍO-OMMQ PT@P Z @@Btp8T CPLHp`P+PL  P TLXP3LU ,V|0 px Hp{HpPpt`(xPLT`忺p `冲GW@pxP X " `ᦺ P p l` @peFV`PL ` UFVL`P  ( `@L P  X 8@PPEq pOߍۍ88 @0$$ (0 0]!^!V!V!X!G-MP"᠀@`P P 0PP4p Q f*P p 0PP4p f` P ,4,0@`P'@xPԑP   "P\P  Pự P ]@T:/+TЍ*V!A-(M P @`Q Pp(Ѝ0'x Bp 㷹pWtN {  QD r   RQ|@|  8]  Q& XT0Qx x pPTPP8x%PT 0]!;^!E^!!A-@Mp @`P@ O ㅰ !U4 P$! U @0B@Ѝi@iA-p@0G0|x"PWP`R*_)P |bx `EpްV  ||p@-M|`Q H 99p |x2" ЍpH"G-vMM@ p+LPp U U``U`QQR ARj*Py(Q`Zv $` r xPm   Em? pc SP$  RR}RppuQ  RQ  RRn@㉸ P 㾯!.  4uiph Q s AR:Q*wP$0`P$R p7 P " ( RQ QP P) P  &P`vߍۍx}P @:@,PPP` _{V`P` `RP RN% &5 Y_P [1P ZP*,E/F?0  0GpHR^  $0 p : $L  4ii@Q^!b^!H-M 01Ѝp@- @0 Q*P`E``U`@ Tppp@-MQ @P P R xЍp@4P5PIP' @)Է/$PU ` Ix5@PU x@T `>P* P @T@ЍpQ/@-P@@@嘷V@-P@@@剷VP/  ̒"O-Mp(@@#$@P&P] @xPPpTpp`  0gIwpNpP :pP  p- Q'P$ (`   p ) p  7/P$ p $B#P 8&p H(@Ѝ^!^!fB@lB^!O-M`P    Q4:  0Qp@T W pPP 'P   M 00 R :   q Ѝ"H-M0 JЍgB@- M^ *@ @  0 Ѝ@-@ <(@9(@-@p  p p~B G-ZMP  x ڭY   L D   d`!.Zߍ" "gB""K-Pp@`HQ™\ r崀`T 0R ,0TQ qHO™`,p V:T 4` bH@,P@T踚"b!^!^!O-MRpЍ@PU.* U !p `p!W*P%W Q  EPPO  0Hpp O  Hppppꨵ"W!#!G-MMRp @`0GP P Pp  pPꆵPЍۍ |PSOt cHPp XpG`W p @O PHpGp' @-MA/( R r@Ѝ @R S 000P Qp@DTD@O-,M`P$  h  @  _@  y0XP 4ou 0HPk PP*P`JP=`p  Z8PP6@P4 Z( Q( Y j0$p t$ ( $8  P`X@: ` P"P ` @v hXp TT`Y@ !0PP pLPJP `Q( # &Pm ( Q   Q  Q$ t (`$]8 Z *P`pW:0p QQ 0p$t@P- 0pP$ p P$($ P P(  8  P`W:`,Ѝ3I b!b!O-M P帀P"@40$5P $Q``pW pWJ M0l  hp P" 0P` $Q:` `M0  Np 0  Ep P" 0P$P M0  1p }M0x  '`p 0lP p$`,3$ 0 `p 0,P ,@$`%  0p @Q b@<,`@T:A{s R @`),`@T:pQ lbp,`ppW: Q F B`0 P1 ,@`V:6Q pW Q, P" ZP X!(p   0@}P(P:0P (" B0("   0P! @`p㊿0P0P"  P ("h0 0  0@`,@V: ߍ^!^!^!^!_!&_!5_!O-$MQR @cPPSP Vp$ЍcP,H Pl  0 p YU*`V VB Z  X4VQS0V   `W 0 QS"P  BR    pP  ȩ H  0 0\P ᭩rW)~0H-@T P PPPPPP@P*"02S @"PU 0S, 0 00H-PU @L0@-@\Q \X\@-@`q ``H-M`# w@p4 P0 ppp% 0 pp 0)p   V  p @Ѝp@-M`@P5 0xhh \P  R h0@J P L0DH   @K 7$ Ѝp@G_!s_!_!f!p@-@`hP >P:&TTx R RQ TQ  p >P:  p@;c!@-@Am@諿 p@-`V @@PpPX 0$J 8L p@\p1c!)K-MP@p `$PH` " 0 `` 0  0  *@0`PHvH V  `0`8PG PK:j @   *@$J`(0p  {d$|J T sLH0:HP[P hI 00RNHЍK$48TJ  Kj@   4P 8P  @  *R @  PdQ Phq $$J 00 P<PPfH0p 4 1@8 1@0 1@4 80 48@P\i`  0.p(h`HR巼 P hdEP ЍKNЍWI 00D 8@??_!_!_!_!_!`! `!_`!`!_!Z!d!`!`!`!t`!`!a!O>!A-MR @`  0Q 8p0 0S  R-  . 0P Q :  PN | 0P Q:3 P 0 P:P 0{ P;P 0p P  60P Q:Ѝ1  0@a!Jc!Tc!H-@ P`08 l A\ 0080L<c u`Hebc!c!)d*0H-@P P Hi$ hhL0HIc!c!F!H-MP@`p:P PP dp` D0 @lp Ѝ,ЍH ЍHh+=!c!K-P`p O @Q$   P":A  P  @  P  0  xP d &P  0$ ` KL ":4 HK KQca!a!a!a!(a!Za!p@-P`K@P D 0Q 0 pKpcSc {Q0S/080 dQ Q/ F!A-`@VP 0Ap ,1 P i P P<P $G v - 0P Ps PPoHPP hPdP[  $Aa!O-YM`Ȑp@R L@P@QP1P}PLP~ @oPn  W/$aPg  W.!.. R 0S  R 0S xT0@   XT0P`p (P @  R?6, 28`h4P KKPP  8dP GQ* W8 (R8Q cR R SRcQ8h (> BP* l0`  Pi WWU8,PT0S @$0(S D`VW W8d R 8h``S 2 8$(00CS*0 8`0050p0$0 S. D0S+Go <0Q$ (AQ:8`6< 0n8 F ((!Q= ;WW 0W(@P*8  00zDW  0`DP}W0 (@P:20 0 0`YW 8`W4Q (AQx:300(@Pl: 7` 0QK 00$ + ` 4`  ` " `"4` `P` 0 `W :R $ (` V3 ` $ 00 `,0P:(AP+0 J0o$0l `P I h6$P$ Pp`U R: ,P+ 4P `PP0`P& ",P,P `"4`PW:P ($ P 0` l$ 0` ,0\$:,P$04W(@P:9? 0`p0DP 4Y (APM ` Ţ08`(P (AP8`=( ᯢ(0W0`   4WDP (APd< Ꮲ 00`P :4 Z (@PF:0`P0WR  M 4 <CP Q ` 0Q7 (8P@D`P,P 8`  C0!`( AR 0QV 0` C  0 ` 00`PW  DPC+JPEK9KhP[ `ph p8`P^ ,`  C 8p PSE zw@ C\P 0pw-` D>,P2@P' !: 3 0dP $` 0 PPU`P ,PX  0@Yߍ<`P:!.C$P!+C$H! Nr / @,\X@<R8HNDTPL@<< TaDp R{K(APp C0.4^!(@P:0`t0_!d!К":d!d!cSc@!kd!d!T!|d!e!d!d!K-M`pP@P P 0ЍKpG GW:@Q Q ЍqW:<Q:Pp R:pP P p pWP =C pP   `    a9 ov4P0q!A @b!!b!-b!H-` P@R :Tp `C0 H1pPdȨ@ 0He!H- pPP @T `dPB0 HHHQ \Q0 H0 HWb!Jb!O-M@p xPU% `;U PQPUT P> R* P( v 0Ѝsg!0H-@PU `^ \(ZX@xP P QQq p 900H-M@H PX P  Rk (>P: ' P 0+' P P0    }xPZL @  +S00 @Ѝ0Ѝ0HzDzb!O-M MḐ @(P8p< pH PUP P`i`H 0ȀpPp@ ((q. `DQ& P(  Q1p 6 @p3 fpЍ ۍO  N>@tP([ @(((> * (P >Q 0*< 0< ߯  =pF @L@2 @@ S! ` iP'   "0 ; X(taP( (((1pt!O4 Ѝ ۍOI +PWPp U$ C-PP   *;@  50]AP   ᐞ$P PP    cQ0S0SS 0 PcQP 0$P 6@Qi cQQSQcQ0p i P Py cQQtSQcPo l@TP LP P * `EP PP cQQ}SQcPx$r@ L i ; 0<|@Qf k2c \( P `PP  h dPh{0cSceSPcPhe    .Pd@ r 0 `0 P0R  $@ @@480 BAC0 48\ $@  ~Ѝ ۍl0 X w;=!g!E!g!g!g!h!g!' 0i@P-  #PP w 0UP HY<8(! H0 @Ѝ hhFh!F! ?)0H-M@0P Q  RU 1Ѝ0 "d*p@-M`P@\P Ѝp @.P\ 0 P[phhꙤP TT@  @Tx+=!c! 'c! 4G-AMM`@Q\P   p _p 0 `V\PU  P $ QOAލڍ=!d! G-hM M TX pPP0`0@P  XV@p XX 6U `0p ThЍ ۍ=!d!RQ:0AQQp,| Rp/O-MḀPPT@1P> R *,P  0ЍO P (L Q Pf0 q W 0S: @= nDQ  0Hv a V^ 0S:  50P Q  Q @P  yP P  =p@h$ @ @pLP`p0  0PPK`VP6`@K   60PP@\5 @)= ЍO<P`00  0P|PP6V`VP l 0LPI  P PA P 8@  0Ѝ@ T  0  2P P   P : iP 5PP < <Q 1P P@P  0%`#JPK? 04 0 J@PP 0 =  P `  \T t i 0匿 @4RP} PPL P ` Q Q@ QVPM`@`$QDN   60PE QB:<@d 0 P hh  082 ) "P)   P0oP QZ Q <`:   P0SP   : 0 6 0  Q*P A  Pk:>! 0ؾPL ( R h1嫾X! 4 RP*y P   P8 0@㦾 ^ `l m H弾\PPJe!re!e!e!e!f!e!f!Af!kf!1f!~f!F!f!f!f!f!f!vf!Z!;;f!!f!,f!(f!O-IM \pP ٞHLaP p` X! <;oLP IߍO\ P @œat Pj ,0 60$@@{$ oR003p 40@m'P $ R ", R QP ,@$`%0 P:Z   `W @@ ` P:Z x@dX A P@0  IߍIߍO,f!g! g!,g!g!H-M0080PP@UЍ`P  P  p5@0H-0M@: 0᛽P P ,,P    ,n: l e 0P 0M;0Ѝ0Yg!0H-@, Pb !L 0H9g! ; H-p@`PQ ^P P P(  P H HH(a!Za!0H-@0 PvhLh0H}h!0@Pop/A-`@ P:P qP@P 㳟fP/1q/P /Q/H-0S ^ Q 0 SR 0 S QQ/ ,03?#R/Q/@-x^ 0S\ 0Q @T 0S @-x\ R0S @ " 0S@-x\ R0S@ @$ 0SQ h R/dP/0S Q/SQ /   R \/\hh0QQ R\/cQQ cPPSPcP/SQcQ SPcPcQQSQcQO-\MxPUp @  P ȐY PhP dPa  +d P PS `d|Hp |Hd H 9 P$  ٔP" p8tP?P%  `C\ |  པpP ~p  $  UP Hp`Hd8dX d7p  ㏔P ` ړ|xp |dX{P W  r`P$ PUOH≒ ^P P. P* 8 P% Ip @oW W  P P < 0  # P  PȀX  #P$p <`5$Sh0`O Pc pttXX 8 `X`dxQ XSh06 Y` P `/H VH ғP `Hp ē`P5  < y t妽5  < n D国\Ѝ 0*Џ"h!i!i!j!-j!p@-PE P$ D@p1P P {P wP  t`V  R 0S `Vp0QP    U dPdh 0^7i! *i!h!Y!@-Q @b P  4Ri!G-M`@pP# PPPU4< P P p  PQnU`@MT  R PP 600@ Po @.$  `p㠠p6  0ჼp  PP@ 긜P 88巼@ cЍW!mi!xi!`i!K-M`pVo @P d$P R3( ,0 aP  h d JwPFPPU ‼=hP dPH0Q RQ PU( Q,Qh  XQhdPPHpЍi!i!PP    Q/G-MPPU @ `xq 00  0 PTЍO- M0@< Rx!R XP PP p`PP"Y Y V' P PA 1Λ˛ ЍV P PP1T= 0S; Q4P5 ` P` ` w500@ Po -[P: `Y ЍO. `` ЍOtW!i!@-P@TQ    P@ p@-P= `Ȗ${\< 1 Q(  P:Q0`Q 0@PP@\Q @ @CQ:Q`VQ`C`Qp8@P p p..t'.p@-0S# P:S`@T V P 0`@TVET@V :RV :VV@PppH-M0  0ЍO- P 0D@4,`V xw4pZ@(pPP `l` SP ,(p04 P  = 0 P~ @d(P :PH8< 0-`<8V vev :h= @P`VD L@0S@:S0A0`Q4:V:0(0 AR (`40 Ak  Pc 0(04 A` H A F  `f~ b~8[ L= K4@Pꗙ@K 듙@! ,P  = (0,P $ HA[ i P ) q ` Z `<Ѝۍ , @P   ,P 8..'!/ᘘ'H-0 R ^  R:R |R S 0C R:R 0|R p@-H`P@P /V((( 0000p@....@-8@P V  0000....O-MM``CP P R4+ Pq sP 0SA  "0S7P   AQ 2 000@:R#RP\@o"t `P @OU  Pq +Pq P Q ` QjPPpQ\Q PQA:Q @U T\ `@: P90 jU+  R :R|R   0v`P P JU` d`PЍۍ00S\S000..#!..t'.K-= P{ pd7Px Pd]Q\Q R:Rd 0Q0@0AT&  @ `0V  p^Q Q:QK pQ:QE ppaRMRB0BS `,^l^^^^pqP%mRb0BS`,^l^^^^:NR RR TR nR rR tR     @Ed P P EP P ꑗ  ~P  < PA-= wP- `dP* Pcpd R:R pd :@@ZP d`dP@` wd  eGP  K dp@-`# 8P  0Q  xR p 0/@0PC U:aPCV@U:APC6@U0S2 pH-<P P  P..@-<@< P _)P..Qj! O-M8P R`$$r UZ  PK oA쑟` 〄P( pD[ ,P:6P  HP J Q   P Q  @PS PplPZЍp0 p+P ,P S 00P P P S0RS0...x ..H-pS 8@ P ll@p@-@8P  PG@DP8`8PP 6STpp ....0H- @ PPP !SP0..p@-@ P  P@DP8`8PP STpp ....H-P .@-@P@ .O- M`p[ pPP[@ @P! X P 'P P[ X Q UP0@0``P R`P Ѝ ...//////@-MPPP <4@ 0PЍ8.@.p.@-<@< P e(P8.t.\j! O-M`Q<@8p P&[ V``P 8bo P8 0pܔZ ᑒP(P  PJ Q@oP P  PJ Q  @P5R PpP) \P VP QP LP FP @P$ :pPPЍt.8.x 8H-MP`@`pP0P  0p`=PPoPЍ8.H-M(( 00;PЍ@.p.K-M`p@PP  0p(`pPPooP@@pP iQU@@Ѝp.8.t.0H- @ PPP SQP08.t.H-M(( 00;PЍ@.p.K-M`p@PP  0p(`pPPooP@@pP QU@@Ѝp.8.t.H-Pp.@-@P@p.H-@P`p_ Y S M H0H-M@6PT PP P Ѝ0 P@T@P @@P P (@>$ 04/)x.y.z.'oj!3I O-,MM@P ,Ѝۍ荓lE0,((  pv  %$5@ 8E,e$U/oP b(  P P P+tp X( 5P P (((H@2Q6 3 7/B\?P;88AP2AP+(&!P@P@x P@XH`q(PI(  Qj 2pR R0Pb0P@@`ņ`1 0`apAp 1`p`q1@qP RNT C , FЍď..؏.///O-M4P Ѝ $Cp 07/   #p07/ # 3c@ P2Rr"T` 2U06/"2b@ 0bPS2Rr"T` 2U06/rRbR PB1/! @6 1 A葟ءL 0#>#"R RRK<0 VQ<`J 0V QP0 @` >3S0 @R   <Q:8@TP<`X P, X >3S P: <` X  PUP P P,H Aq PV pP8X @X @Q, 0 BP *PH0`V a1V`!aS:0CRA 1S0!1 ARP *QQ:Q: 0aaPVP1`Q A` <0 8 `p _ pU  R0 >#R R0S0CRS0 00 pE0He<0@0  LP   R WW``ЍTUUľh̸.A-M@``>Q$A QA X,,,4  ,,е * (  (b]Q?Q! [Q \Q V:fP`>Q( <Q+&%^Q {Q |QP;8P6 3V:Pl @` V@`$ P*)P )  V LP*`)P P`Q$**0@SpPv{P0S*dt 000,R Q ,VQ >P *PU +P0@ $]?P^ {P=`0P*0,Q < (0VP 0 DQ* }R X g. `A $  $ zPh 0 @-0  @&0@  @P!A>#" P>  BQ_`%p] ^#  x 'Q`QP  8 P  }RP P P* *0BS p`v P D {R P*$Ѝ.t'K-M @\Y  P:PH```JY0JIPAp DP/y`qPLP  O$  F*YU .Yv [Y[$yP( Dn{ YIP2 / @` V@`$ P *Q*\P)P \) ' V LP2Q1* \R)Q P$0&+ (P bP ``QFV x'Q`Qy y  P#*0*SPh 0Q @0 F @Q*\S{Q $YЍR`0Q* 0,R<Q*X :0VP  V RQ1*0\S0}S/ R *Q * Q\R }R P P] ^%`PxP (n .t'@-@P*^Q  $  $ @-@P  @ (  (p@-`PpP@P:P    !pO-M@o R  2/Q**t0uS P P*0\S|PP P *Q  P|P P |  2/0 R  2/ P QPtPn u0QPP3S Qp2W1*`P\V`p|V Q*`pP|VPP/o, P  0@   AO  R0@0 @1>3 " <^P P\PP  1 B>3 ! A Ѝ.O-4MP@Q * |P2  {P/ @  cQP  S00@7~ <P* ^R 8 P*]Q -Q- P &  ] d0  $ 4 Q }*x0]Sy  R*-S]P$i-S! [S'R%* =R9 :R Q:P ]R-RPP KjpPA*0-S=Q;* ]R8 -Q/-`.Q:P]P-PP=p PJ*Q* =R]Q P'`W Qw:\P_:WP WW w  ppQ PW oPP 0!p`PxuQ*x50 `@V:P  tp p zP> p WP PIF!  p`uPP !  puP !  `uPy ?yQ:fP`6/P  u ,PuQQ`P OP 0  P\*P* :R]P  PP s P g r0p00B^NP  - Q|*]PwP{8 P 8< Q  P  0`0`&$PxiU `P P ] PS `P`` P PV`pP x P`{P'wP' w? (p P@ |@@P  APt4Ѝ,PP  E@#4ЍOPP(pAm!Hm!.t'"Ȭ'l'h'p@-(M@     pdrP(Ѝp@r`] N`(Ѝpt'l'h'p@-PPp@`Xa!EA(0S0"(0%P0S0"P0% q 0 !`app@- S* @`PPP Q PP@ 0A U R  Q R    pt'.K-P@ S@SpP@ WW`P   PpGP P@xxxxxHxxxxxxPF 0v @ P!A># " P>   oPp  hPpG0H S@@X@P =F 08  0 @ P!A># " P>  PF 0  @ Kf .H-q`@PPQ  ,( MP) ,( ,P<P 0Q< Sr1`` Q  Pr0P  Ȭ'.l'h'@-@ P*Q* [R .R. Q 2R1:QPP00.S ]R.A-@X 2R1 :P`q0pSWp]W `00S:llpP wPuP pPWVP.X"Om!A-@TPPQ 801 ,P !(0# RR: -'R:0p >Q>"P P P Q`qQ` O-lM`e ,@Q 0EP  lЍ,0PQ : `  t,0  X:  ` > t,0 = @Z:,pQ$[ 4Q8Pp R0*$P PJ@p P< [:$GT,0P pKZ-p`P0 Xt,0 . @Z:, pP$  4Q8Pp X*$pJp@P< X:$T,0P pHZ @P$i:,PP 4Q8P$PR*p(` `@@pPP< [:S,0P $PKP#RR>p&A Q dR p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#SpLl\2 Q@  0p@ @P> @ X:} P7D x  x>S 0ph `Rd\cA^^ p @ ;M0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00t'Ȭ'l'h'o!O-,MP`TQX PX p00'$@  D | @(@p-+R0H(@P`t    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B#RR>p&A Q        @ `  R p>#p!>3 S 0@@M`8 0 E FPP @  0 @p6PZZp  0u 0  `8 0@ FP@ @  0p P  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp p p  \dp p p p p p p p p (Hp p p p p 82 Q@  0p@ @P> @ X:} P7 ThT>S 0ph `Rd\cA^^ p @ DG0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@T3 P,P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00t'Ȭ'l'h'o!O-,MPp`T@ QV,ЍX0 0($P  " ~(p -+Rr0 X000000000  DM> AHF !0 > Q  > 1> Q@5>  @> PA+^$ %p"P$P P( Q qP p  zQ ^J @ሀ`Va^J !>  (R P 8 0 >03@88Q ` <@Y PPp( 3PPL( )PPPP @ Ȭ'l'h'O-DM,(`0 4$h   Dh  0lP\P  ` 8P P X8l@Q$ ! ̌X <<(l@P  p 3DP@8,@p0 S S@  @$@@<qp W W  (@pPS4p@Whp00@T {B  0@T0<{p Q40\! 0^ hp,4*48p _^ \ <_\p ^hp,8 r  hp ,_^ @qQ0<@0p s0RtB  0,@@P p4, pP^\ ^ @< r _\1\ 8 r _ ^ o"pP&<@8p^t w0  wp ot0 Qr?o24hp QqB  0o@poP  pP5$@ ,CP@Q) (@[%P M_ H_<@h 0tB D@P8@ @@@\\_ < r Y_\eVlP h@P DЍt'O-M8@S*P`  >#RR>p&A Q \"\"\"\"\"p \"!4!T!R p>#p!>3 S 0@@'`8 0  FPP @  0 @pPZZp  0u 0 `8 0@ FP@ @  0pP  0puO > J?"0I > J? A p 0p`  0 FP  >P@p 0P p0!>#@ >"P@  PP@  0@% P8@`Y*: ЍO-MP@`S*HD@`P 0!=#Sp$D#D#$0%8%X%x%&D#D#D#D#D#D#D#D#D#&'X'''D#D#D#D#D# )2 Q@  0p@ @P> @ X:} P7#)()<))))(**>S 0ph `Rd\cA^^ p @ A0PR@[ >># R0^=* _Q3^ ^*^%_Q",0^ 0^ ^*%0  pp_S0^0 0^0^ _S^   0^* Q(_Q 0^^_P ^r ^  ^0_ B/o_0C?oP"2P 0^ rQ| ^u 0^^*^ ^ f 0^* Q]^ X0^ ># `S R P 8010 @p <@3T3 P,)P!  @+_P" Q@P`X}:> ^z_RwP  @0P+ @`PX`:!P@P^  @p>0Jp@ `:Pn@D @D`@pZ<:^0Ѝ>S0 N/@`   00P`>Sp  B N?@`   00P` 0>P@  0P 0P0 @!># R p!>#`q@>s"W` 0`0PP 00t'Ȭ'l'h'o!O-,MP`TQX PX p00'$@  D | @(@p-+R0,H-,------t/t/t/t/t/t/t/t/t/-..$.0.,,,.,,,,,    000>Q !0 >s W  >3 01>s W >000 0!># R~  y\o sppg$Pf jPbf( Q `q PX \pT X ~QO S\LZP\NJP!>  s(R P 8 5  000>0HpW0qQ@* B<Y PBP(vPPp(kPPBPP  @T$ ,ЍȬ'l'h'///H- // //0H-HQT SJD NJ , GJ BJ  ;J 6J  /J *J  #J J  J| J d  JT J Ѝ _7 2 /7 6 6 6 o6 b ?6 $6 O-MPQ`@T AP p 3P P nPoPoPa@PThhhhhhhhhhhhhhLh  ]P  ]PZ U ]PZ T ]PZ Uhp ]PZj UZ< ]PE ( ]P?  ]P  ]P  ]PhZV U4 ]P'  ]P!  ]P | z]P h t]PBZ6 UZ UZ UT13TTTT TTU  Ѝ5 }5 Ҵ 4 F 3 v3 f3  !3 2 2 p@-`M`@048<@D F?P@@@@:_2 0P 㐐p$ 0H \p [p  【@p@@@n_PH \h_Pf_P  k`_P`ЍpO-DMMp@|"0BZ @ @!yoPB  " 0! <R5:0V/ `Ut`TV}FM xI$g'T# Q "2q`pG`Vp4 @MPJ"2"2pqapRp ZTZ@P3/H%P  BP  SPCq@a?0!Ba.PHrT2LbWp 0!  @4PꟆ)\P ף(\*vɻOXtO-MT2PXPPV@P" p PP. T@ $  ( 0 8 8 @ @ H H L P D X < ` 4  0pCp  ,@Z aV$zXP `P P& P Q QaVQ 4V e F3P9l|h 4$ 0 8 P ( d x 4 p  `` ddp  hpx"0 "K p  02p;0s0{ 0p3@ P9P P 0P @PPP`PpPPP P# dstdayminsec  Њ  zA | ; X}r t L  , [  q        }0H-P>X @p |yU:ᩃ00at T0T0 P <  Q/0P  Q/ /%j %0H-|0|0 @ R@ P  0P @PU UPP@T0 0% H-H  P 0S !  P$p@-t0h0Q L F P0Q P`VP  p+H-PP @p PP `QeP`H-d`@`P p `P PQIPP<#H-d`@`P p `P PQ,PPX#O-M`P6 PyP5 @p`P  P QP{  `WpPY W L !6`P Y```Ѝ )k H-P@Q p`P `Q,Q  F,NK-MP@Q p`P `QQ4 Ѝ FQU& Q pPp```QYp!"PpW |Ql 07/Ѝ4Q$ dL  @-@ @O- M`pPP PPQPX @PP 6P F H `PC `nPoPo@o`=N>P PPQ  P Q0  HQP S hS`P@P @ Ѝ C J[ O-MMpP@OP` {RP:=Pq  oRP /P P Tp fKPPk '<0 ppppe =P| p0 pT `P{ `尒  `Pn  NMP 0p  zpv  DMP$Z FE 0]p#  82O` F!O`p FOP/Xs FO`O` yFp@@ >O`Ѝۍ 0wp `P    0w`bOX  0m `ᒀzd@L H~ A I 0 I f H-M   0pЍH-M>   0pЍH-M?   0 p ЍH-M8  0G pЍi P  / d`H-L0H-@EPP :N? $  0(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(408 0@S4 0@P4*# 44P*``404 R*>(4 8 0BpS4  @P4*# 4 4 R*p4 @ P@p(4 8 0BpS4  @P4*# 4 4 R*p4 ` P@p(04p8`@Q4 @P4*# 44P*4 Q@<84pA 4  4  P0R:X @4 Pj R*>0 tJ04 R*#004  4 (P4 80pBW  @P4* #004 4 R*004  0R@0<08 4 *04  R4 $P: #  @P:  R*004  R4 P: #  @P   @4 QBLЍ%#jo%juH-M00^ЍH-MPЍsO-MR @ `pPJP/<7aP D  0Mp4 ЍIIЍܠ P8 PPP   0P p-pIP  0pIP IP8  0 Ѝq |   ܑ p@-MP @0`0 5/ЍpK-MMp `@,zp P/P /RP @ Q$  P ` . @`W {Pp   PP00 PPP;IP6IOЍۍo O-dMMp FP /MR R: rRP;Kd`+?X nRP7 OpT(Ѝ` HpN W pPl K   W P 0PpW O](Ѝc0H-P 8 Q xP(@P8 :X@<@  =S880@800bc(bP:/@-P t7P h  X1 \@P@ H5/4( Tc \bcbabT  Q/\aR/S Mla Jp@-@ HP`Np Up p@2 >>>V \K V 帻P VVK ajY 塻P BB`qV 勻P >>>>||||AW vP nnnnT aT `P  AV JP T B T 3P hh p?@ hȠHČ pp`p P@ P @0( 0 000h 0 00P00

Pp\0` f`V2 Q1 p P @T,@\0  V 封LP:4P0psP   pW   Pp\0 H`P!!rAD |  ]@p , @QPJD$A,pP @pCPA!X!F P ADX   P P峲U`,   X Aq P:P`P  `V    H`  HY `P R 0'ACH``PAD | !  ?p ,H PE U @D⼀d$[@\$D忹pWpC幹PCL岹PpUPC嬹@`H ᧹PCT@C H UT4``0`W`@ PP\ph4`pV,APF`D |  ?p3 ,H PU@a @L`8PA PP VP`p Vd,PFA`D |  g?p  d,H P U@a Q  `Q`800P \0P `䰝p,`KY \`B AXZA`@,pd @ T5   P P嘱U`,p  T డXP: PP  X    T0 `VEg\pW QD<   P @ST`,` W\[:P @㱫P^  @T  48qL` TAX@0ZG`,@di Y: d q PP @T`,@d YdడXP:TP@bP d [    8P0P `V4H`,ZI \`开 q, @HXJ@T6 Q  P `尰V`H`, Z X:\PX P  [   ,LPJ `唰p,`K UTUdgLpW5 dQ$   P @_T`,`d WdL[:P @㻪Ph d @T   0HYZh `l q, @K\X TTLTSdH`I@TA dQ(   P ` V`,d YdH`[: P\cP d Z     X@kߍ`@S@SLKp@-M ,,`(p@0p 0SЍphC`Q/p RD D  <0($0 0S ?@H/|>p@-`T@PUPpPUf@pl>p@-PP`@PpյP=N@pH-Q$ H ?30000S 00840 SX0  | D0R 0R0 0S =<p<H-P$ H ?30000S |00840 SX0  | D0R  0R0 0S$<; /(O-M$P`@T4 " !  !  !  10! qp 0qp p$pqpX\0`pl mTpn`PPD\ 8pЂT X0 0p`lmn Q }(   MЍ<:;;8<<p;;;:;H<;;:D:::0;:;:;|:9:$;(9$:|:A-MpPPs-PP J`P @ T  ``> /`*p㉧`zPY } pU ipP pQhPG  0PPPPP(P:  0PPP(P/ p+ $p'  0(P  'QGPP =P  P A_PpW Wp壬ᡬ@Ѝq 7p@-@ PP $_(`V (V`!@僬\偬Qp@x6A-MDQP+P- #v*' !: !^ <0 | >@00_`oaf`!pS@qa R 0@T rpWxSqW 0RQ  00 0Fp!!QЍ 4 p 11Q/G-M`pP+``(P Up㻳7Pಳ3㺳࿳뀕P ^ >B<?^<v98#6:30'0#- #(H##p--_|o pbrvy/z{M|}9  H  %!,+&.0p*&!?@ABCFDHG/ + I%I/ + JM/ + K*K/ + L %, M  Sb #, Ev/* G//* Ne ", OM- P&.* Q9 R   R 0S  0 S pW" sPUJ1P1p80Q  d0 0E'0'>C 0( Pp Ѝ t - .H-0' 0 ( Qp(      /8.O-HZ p`Q "P !?>`APQ0H P P p @`v @@ KQ t p  `!>0@!Q QJ q" R R !0`Qq  0׮Q`Q 0 ɮpxAT `Ta  0 ᶮ`pdQa @ K. A7Z Q "P  P P p9 @D`vX @V@ KQ p(  `` ?>0 B!0 dp;@!0`Q I`BPp( @,!A`l ?>0 BR!! 8`p P@`PЍ`/. @PLDD 0!#dQ)$,('%p%#($ #$h#O-M@0f  P`R`P Zp|0 R L Z 0 R LPm E( $ x!R  Dlh<p$(|'P  KTp'P  PC XR$0Tp |$ t@0h0pPQ\pPPP QoPHP QLQdSTq倱,VP `p PS Wm LATj 0HPd P``p$V <P>"PVs0(P P`@`p$V <P>"@PV V@ ᖦ ᔦT [  @2PEQ 72P E W .2P~? @ pA `pP _P \[ P TP#  ZЍ\[  2PP@Y1PPPV 1PQ 1PP @Y 1PP P PV 1P( . U ۖ L!qP( PU hpD tp P wd U Xp8 @ !>0qBH" @" Q5! !@10q! PQ p RJr0"1pW UpB0S 10Sp02\Xa ?#>0 BD1`R0 q0 p@ 0PPojPP xp"|`Ѝ|| 0 UQH  ,бXtسԳ. ܰ,p@-P὾@p p@@ E0PLPojPP 0(Lp  ` H-PPQ oj@ S pP 00A  B @` H-PPQ oj@ S p֟P 00A  B @ H-M@ R  0 Ѝ (Q/  T/|  A-`q@P qpp借PB 㱛PG      papUqP U㑛P , Aq@ll0L 440 !㩿㤿}  } P~ ~ , O-MXK ,  1!q1saqQ P `ƠV EP j W*  0sp Ws: W`D0H |.p ap W 0@ .ЍЍ@- (@7p @t@-@7p @0H-(M$ P@ b(Ѝ0 0H-(M P@ U(Ѝ0p@-(MP D@7p `~ @(Ѝp(Ѝpp@-(MP@7p `j ,(Ѝp(ЍpH-M   ЍH-MT P ,00  ЍЍH-M P ,0 1 00 0 ЍЍ0H-MP h@27p T  ,0 P Ѝ0Ѝ00H-MP@7p T  ,0 P Ѝ0Ѝ0(Q/6 @-D@@p lm$  pO-M   @LP <P  P2P Ѝ6*0lm0hF p 0  P, }PЍ4,T@-@= @P l 0 \  /*4 ` 01SPRP@-@= @ P  l?:X01S6 ` P(PT@-@= @ P o t Q 0OS*` PP4tA-,A=~z@ P D _ZQ8 ``: P - P  08 PQ 6 0po8PQ*P8` P@-@= @P  R  "+ 8 PPDp@-@@PP%`= ` P   P  0oS*` PXP p(P8<@8ppA-P=njPQ z@Q$  "+ 8 P&P Q v@Q  ,-  @-`@=@Q [Q  ,-  A-P=njPQ ?z@Q$ @BK@8 PP Q !@Q  ,-  t@-L@=@Q Q 0 .G-`=P`Q @ Q+  @0p,@-PP@P@8 0pPyP Q  @Q  ,-  0H-4=P 0lH-4=P $H-@= @P  R):d@ `H  P t PpLpp ppp PA-@= @P U R dP0@ȀplPdp<L 0pLl 4p0pP0P@-P' @=@Q Q,@0A,@A1@0L 4P@h0H-P5 P=@ PP  R0 T,  0P!, ! !0P!, ! ! @P0PL P0jP00 0@-P' @=@Q Q,@0A,@A1@0L 4P@5$\H-M@ P8mQ DQZ QP1DQ?PP@DQ 0pt  tP P0/6 0 '6:  < 0 06PqЍH=P/@H-H-L R ,P5PH-P  Q PP( Rs3 /@( Ru3 / 8 0S s3/,/* Ru3//*/Tp@- M  P@ ` ```ZZ `` `PZnZ HZ ЍpA- MRPQ =nj R Ѝ Ѝ PA@P$P g&p! Q` \&LDA@P p% 0  Bp) qp|P  46P: 8  (6@@ 6 X6 0@+ @*PP ЍxA-Mb=`Pg A@PO$P!   %p`| P[p QP5PH@@PQQ  vQQ  k P  P=0TЍp00 R/* P@@H0S 0PPht@HԐܐdP@-4@@P$#踎@-(@@P#lX0H-MP@ P,P |Zp PQ \  TLPP  Ѝ01/Ѝ0ht@\t̍H-M\P ЍHH    $Ѝ脍D4H-M\P $<  Q, $ЍȌH-L= R ,PPH-8  PYPHH-4 , PP@-P xQ |@Px@P @  {44/*@3@ d/0H-P PQ @ Q Q00tQt0QL0Q 00  ;40 @-@ @P P P tPl P L  4@$ P8lH-P" p8 8P, (@0`P0``` 0CV@`V0PpW0H-P ^, 0( P@PPP 0UPAU^0P/0 S/,/p@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pp@-P= Q;J@T8R6J`DV R0``` Q(S,@( A`P```V P  B`V , (!@PU``U`( @PU``U pp@-P! 0QJPURJ0ES R,!(@0`P0``` 0CV@@T0 Q0pQ  R/, B0BR P/0H-^, 0( P@PPP 0UPAU^000H-^, 0( P@PPP 0UPAU^000H-\,  \ 0(@TPPTP( @TPPT00p@-QQ,0 (@0`P ``` V@`PF`VPQpH-(, 0P Q00H-P+ Q\$ Q, 0A@CS0^, 0( P@PPP 0UPAU^0P/  CwP/0H-PX@tQT X0,P /*P /  ,P ?:P A/,P /*P / ,P ?:P 0/P,P /*P / 0P ?:P 0+/@-tP MpP @pQ ]7@1tP "t@40P /*P ,/ @ R Q/*0S/ 0/,P P </P P 1/H-<P P #p HPH-@T& mpP @tQ 6H1tP |Q pPpp|PUw tH0 O- MPE ZCz P=S;p0R@P @pQ  K`p 0᎛PJTP  `FPGP  J0  Ѝ `,P P /O-MPpW!  K`  0᫛* ႏP  0`埛p   0zPP Ѝhp@- ]P >|P @`|`0@Vߔpx& @P@|0㝒P Q @XPPpD X|$pp@pApdpHpdp@-@ P P P`皔`0PVp@蒔G-P @?zPP  X `0@ P R R' A0ɠ ,   BL\0!저|X/0, 0 F`00`R`` B0SXP PUPP`npP `VO-M  Bp T P  [`p 0KPBJ} [`Fp P bP P P(@ PJ JP Q P@U  !J@W   J@Z   ! @ЍO-TM +p R TЍ]p!R @ 0 t04TЍO/tATW |! BR8   P,`Y 0TЍ € 1,` `VS@4p  wpʀY`t 0@ 00 0Sp pٚ t1 Q 0 0+p ǚ YpG-` PPp ᾚ@AAP@Y ZXT  P@P ᩚQPK-P pP2@_P+`P:yP$JupP $ `V( V QX !`pNpPV GpPV @pPdH-?Lp0 S @ 1  0  XPL 0H-@h P  R"4坒P PUX P R 0P R 0 0R00|0z,x`Q Q QP ca0H/D  R/P@0?30Q/@ 0<( /P/0Q@?R/@0</Q/ R/Q/ >R/9R/p@-@@P?`-pS/p@-P?`@pH-h  0S QX @4  @8 R ($@ H-P RX0-@ 40 @ 80S 84@ Q(O 0H-@PU XTP@? @!<8P@@'040H-@PP XTP@? @88P@@0p@-Px @XP`TQG  Q@@ Q@@ Q@@  Q@@ Q@@ Q@@Q@@4Q@@ Q@ @@Q@@@Q@@@Q@@  (QP   8QP f  X0m@ 0$`0 @ 80S@pp0H-PP @XPTP/  @ @ @ @ @ @ @ @ @ @ @ @@@@@ @ @@@@@@@@@  +   08Q@ @00@P@/H-TP 0 R S !\ R! ^ R (!R !R 8!R !R  R LQH-TP& 0 S0 R !^1 R! S0 R4! S0R!S R@!@\R(!R !R 8!R !R  R LQ(0H-@ P 0H"0H-@PR J 0 P  S  0H0H-P@ 0H0H-@PQP J P  Q  0H0H-@ 8P 'p v 0H0X0H-@P&p P J Q  P0X 0H0H-@P&p K 0H0p@-@ l`P&p V J P  V p( p@XO-MP`V7 p@PT( `㔀C 0 ᜠ堀+ @D PT ` 0jpڔX ЍO-MP 0: @p`PU) 㔀 0 ᠀ PE `U  0'pڔX ЍO-MP9 p`P@T( `㔀 0 ᜠ堀 @D PT ` 0pڔX ЍH-M 0 0Ѝ輾O-M@P%p4 U2 p`|V)  㔀q 0 ᠀X `F @V 0ᗔpڔX ЍO-MP09 p@`P<U(@ 㜐/ 0 ᤀ娐 PE `U @ 0VpڜY ЍO-4MY P,X0\`AqQ  @QF `(XH4ЍWPK `{x`X@X @Xp  T@U8pG  W P p pWTU8   A P  @T P8  *p qX@T PP| 0 @T (0 pQ 0 Q  0zs4Ѝ @VQ, D0|@0縀pG H L`FPE @V(0@ `X@Q Q壔[CA[MTQ8  (0  `0S0 RPD|p HLPpP ( 0A@p Q0@ TP,X@p (0`Q Q P ~ @ hdH0PSL#P0ᰱ`P:X`@@ PP @`V@ X@[P`F `F?PV P 5 0Q#Q pWm,@`QpbD|`pV HL p!PWPT@ R 8 V P 0( 0CP  pP0@ CTP,0( A * r 4ЍQpW@4Ѝ@(0G  Q   4Ѝ,, qO-MP @pP H`Pk\8 Q A ЍVrXTXP EP8  P  ,PBp@㤰 0ⰰt pG @W ڤ 0 `᳑pڤ[xj @Q _ T P 8 O Ѝ, X? @`嵒xt0  pl(Php`0S0 p `S00Dp X1P  W H`! 0Q!!` 0p00 GQЍЍ Q HTKLP/88!R!RQ@@/ P/48!R!RQ@@/H<Q/(!R@ ,@ /xP/$!R@ ,@ /ᬯLP/X-(!R!RQ@@/P/X-(!R!RQ@@/P@/LP@/A-PP8@ `@Q Pp !fp !4P #!P@@xD40S \/A R QPT/,\ Q/A0SRPT /$  RP00T/ḬPP00T/0Q Q//0Q Q//ἬO-M@T Q lP\PHX P\T \ ARA `PhVTV[Z IQpI W @ Z+ Y  0@IYʔ ` 0!![G W`Fp,0!PPPPPPP,!PJ ZQ`p,D |    pM p`WQI P pIV 0!!`V,0 !PSPPPPP!,Z!p WPP`,D | 尡  p `PVЍP U 0@PYP ЍH-^ a^ 0S,@ Q( ,APapP0SQPQ RA/Q R  A/P/P/P/P /P/P/O-MPF @P H?A,0DP   p@Y*  Xaq | Pp pW:0@  wЍЍ@-T0 0SQR,,r@  @ A`PTPHP@ U P` V `UPV`%P `P R  0S`AV` V`Q R @R RP p h $P Pp pp $Ġ,t O- M@ZX'PQV Z0A(0N01 ,PP`,PaE`a ZpP`Q` pP4, PPl j,0Pe ,Q4PY 0 H0p4,PP P4Pp 0ZPJTPP*`pPpY, PPDp`Ȍ| `p 就PZPPQ P ЍPU  `pR G 0p PGQ QpPG p$ p0S GR R /PU  RQ/$0$\/ P/tp@-`@/P`*P0T0p$ R Q P8UePp4<G-P@Q謡 $ Q P P0  @$ ` V`V QIR H@p 8  0$`p WpWPQIUPH p PkI p$  `0S0 SPR HU P@p |@hT @T :@p@耜؛  0H-P0S 0@@T@PU8P @^Vtx 8P,0 00@ PU @P@U@S 0A-PP QJ@Xp0$`SRJ p`V` p`ApBX 0S0P P aPU   VPUP0 P EP/8 Q@ @ 8 /0H-M @0P@0Ѝ0K-MP Pp@Q G0 U `E `V PЍ`Y` ^`4@@P `$P0PD H0P pD H0` 0 R  PB(p,0 Q@, ! 00  0ppW(P0H-M @0P@0Ѝ0p@-MP @lP```Foo0 b` P `PЍpPdO-MS8UPYSZЍ@<@`PP p @p< V p(@  0A[ 0cP eDQ HHP `P$p(PPX`@p pW ,[D 0`@P"0S  PH̔ؓhH-M  @ 0Ѝ P Q/H-M$000kЍ̓O- MQ@R ЍP~P @ ~P, ``P0w 4PP# 4<LP0 `0H 8|@Q`  $H* \`dhlp8/P4D p}P= 0@0(Q@ 0Q8 ^ X9 0p@8p pW$0Rp@S8pV @08  R  R} !Ry$Rv RdQ8p @f8(^ 00   `4 X` x P4p` , G04 !P# 0` XaH-MPЍA- @@(Q0`p,0 Pa B,0 !00  0pW(`p@-X ]80P\E @` P8`Q p$0 TR80Q08Q Q !Rp$R RdQ8pP:/p@-M 0 @ P0C B 0 L0N````ЍpO-DMP@PQDЍl`hS`F@RN@^A@VL@`t0 L`SC 0 0RPPppP oRPB 0Ap0 pSPVPP x b 1p 0 V` ,  [PP [Z x@ A $P  0!P 0  Q:ꤌȋP/H-Mp@pQo :P`t`xP 0  %PG9 D 0` FA/   Ѝ0H-M 0  ЍO-TMP X0pW8  Q$0 N 0|  S S pJ0J$pp`S0p0Q Qx00CJ$00pQ@  $80@0808@8$DpH`80DpH`<808P080:0 {0r R p$@z W pPPtPPPp A R :X,@PPu@Xp p`,0p`G1```0pp 0`,p00C1@@@000 |0Q(PpPz WO,,p(P1uP8800 ,p`(0!pQ.dP <(/ Q8 #008` ' ` 0T0D,0 QU PPPT  aV,XXPPw dPt J  0  0hpe 0J , l_XPePb / ԏп ,  X ?:  o` @ 04@00toP` @ / 0  PPxUp, AX   p AT PU0@,  , 嬿P  /!/ 댏#o`  0@ `vP dȏ`QF / h_PPP($ @T @TP 00ꌂĀ00P PdP H/ 000P h/ 00W `PA@BVZ 00,     00 A B b,QB @aW V , 0    ꌁQ @,0Q   @t Q0 R:,pP0`Q`PP0vPR.`글9@i`pT W p, 0   P @p@pO`Q@`#00`$ppWpp'/B!SPK,l`0Y0B !0 `,` Q`@V7`V @PP& `VP@, !0,V@@@`p`<Ѝh R5, 00BR|p 0 `Ppp,`a@U PU @`P PU`@ ,0~!<|}T| p 0R,p-0NY, 0!1 0P00% 0  P,@ 0 0D@C0T qa0 `p`' ,&<  0 ,`  @F@\@!0\ |p $@p| 0PP,`0P p?#/0LB\ FPT0@P0@(z`T$@0 0@ { P0 \F Z  \t, ,1 a QPU  P0{@{0 P P[ ,,@`P [`@P U ꔽ 0@( U 0zlzxl \/"$@@! \0 T @S,00@,0D0 P m|`0pt Pp P UHL0p1 D0|0pa P U x0x U :hl ` PE UD 4,4 (<0 0$@ @ ,P$ P) \P 0 pJW0Pp R5P $P, 1@LLxxwxvuw$@ 0C(,,P`q0($0 @ 1qT,PT  .Q,JT*0, PQpTTQP% Q PApP PUP @ ( ,T7 p:v PU :q ,HPE |GU!?   0A {| ,P u\vtd 0AlH 0T@`,qY? ,Pplt0t\txPp R,(@  0P ) ,0  R P g_( $@0 {P gK밸 0shstLsP -@L$  0a3' `,0@@$ MP klt{$ R  ,0 0 Sm< 8up4@P9$e`  l @pPUG/@TPP PCA| 8tpD@,ZdddT P `@XdpppK$WG,$ 0!S!`q 30S0@?3S P  P MPCA *W\ D@# * @ P    Ѝ@PT~P D" 4P ( PCA  @T(QapP` qpWMGxPP PCApp1FE  Dl pl\CDCHP<0  xt\H80<,(lL`P0`??hT4(ttHH8=pd<|P4,$`H-LP @W88 PC B0 x8 RDQ/lP h%R!R/!Rt%RQ/: P/9G- 80SDpWlUUhUUQU  xğx@ S `< P\lT`1ppp0v4DP@\0``` $  P # ' 0 p@0@lP h0P0P0P   0 00'ΠTʌ Pʝp ,T,(PHJr |\ R```ǡP?R``o`ǡP8Ro``aǡP1Ro&`bǡP+Rg2``cǡP$Rg>`ocǡPRogJ``dPR/'V /% P   pppp` R R /*P`p`P0p W1/+P0#'1qa0( x1p`Z0 0 PP! TqH $ Z% PP H 1\0 H @,PP U !T``` `  R00QUtUUUU 5S t0Q%l99(8,8`7<76((454O-0P J,rppWPC rppWW1z00pW%pAW`q4 (40pBW`q4 (40    q?:`'P 0@q0Sr"r0 S <X  ($ X 0S @SZ,pp W [1 P00@`$@@0PU3l3421@-^:J00`0S4'>:00?:0S0C^@1,0 0(0AS@1,0 0(1p@-M@P)J\ R ڌP v`P!lP0ok Pr`l R -P 0 0 @ sЍp00/@-\JP\@ T،r@L@@v 0H-O-!z 0 pW%p@W`q4 (40pAW`q4 (40,a,q`pPppU QokP%g0'njpP<X84  X P @PZ,pp W [ P@`$@@PU/<.pD8.,/-O-M" R " @  " pR@P P  hP= P'r"QJpP  p!  @0@@p@q Pᴖ ql! l  QEZ8'QJr0"<p,P p ! K @1@qPᴆ q  4 r"Q ]=  q p  !d$ f@0@Ѝ +<-, +P+,,*+ *`*<+*)X)0H-P@PP P&P  @ | @ hP P  D@ @0*`*()|( *(p)/)0H-h@ Q pP QpP U  ˊPb0p)0H-@ Q pP QpP U  ᰊPG00H-$@oP;0(0H-@oP20@-  0 S QPSZ\^@, T@@@!\@@@@ '@-0P RQSZ\^@,0T@@@1\ @@@@0p@-P0SpP ^0@@@@0S `0 0@0SUPPQPJ^@ T`,VA```%O-Mxx#p X  Y oPCZ @P@P0DUEp ЍO$` F@P pppfTT8  ,!!g1Rv`@ @Z}0 @00(@P0S0jP@`p' U!` P @gT D|OpN HPEU KPE[*Pp?P P尡 : @`@!bP+ P `VP Z 0p`!pp 0p B Q( 0A pQ 0@pЍpp T%0H-@ ,Pp 0H 0"0H-@Pp 0H0 !  !O-TMP" `Qo pnPC[ aP @P G PPR0@["gTЍP$0 A pR? 0` L  znp ڼWpCI 吇(+$P @ P TU8  P PP P P PXppH$pNnPCK $CnPC P  Q$`$P@$V`F&nPCYIKP3 @Q! ||h n@H$pPmT@CEt!)+ $$`mPC  APQ J $ ,(pQ1@P0W1Pu p@W1pP.  b@QpQq[@D| pl H !K[ PEKU*Y$ p(`P@ $P ,@ 0,0P0(  0`Yp  0@` P$ P@DT @PP{ P( A Q PQ pelTЍ  0H-@ 0P p  0Hn0\0H-@Pp  0H`0p@-P 4@`p  p@Mp0H-@Pp  0H?0Q 0H-M@ P UQ U PQ, 0 Ѝ0H/ P@$PUPp@T@O-MS `p  "p01Pp0.P 0P000pE`/P *P@`p|qUh HD 2/`P$U<P,.Z@>P [ ! D.Z  0  0C AHDp/Z *Z@`` `Q PQ`Q'qr ~P P@7/@DT PH`DpP PPЍP qp[P@7/@DT 00`B/P[^  Q H-M0 R!R Q L ЍH/ $ R p\H-M<<000 0Ѝ"$H-M0@@ (Ѝ0H-MP@PQ PQ  * P Ѝ0dQ\QD  <x 400 Ѝ0dH A-M@Q,@PA P0 @= 2"!1K`p@pA% a!a @ pa}P `V $Pp`Vp fPjP@ @Ѝ赁NT A-M @ R  $ P? PL0  2" 0C`p@pA ?> @pa&P `V $Pp`Vp nPPOЍkLD? | A-MPQA@PPX `0 H!2" @ pA0p$4|q@Ap " a@qP* aV$ @T $P pp@T WsP P`V X PU u`PЍ-?L*S 0 O-DM4lPB]Pw $4:p3pP@ @4:P8 P Q9 21=QA #Qz Q/1 a 8084U<%%!1KP@%A % a!a@pQ 8`P =vP P4pq`o1# 8084T<%% @ 0A0P$\4@$A #" a@QP8  P01   808PS<%% 0CP@<#A ?>@pQ `P g ` P2   PP.  P*  P& | P" h P T P @ P , ~P P   ! iY dP P P_P=T ,@ Nt @Y  Ht@V a@ ,=pG w P`Q6@,t%P@$t@DЍV UaDЍ-?L*SkLNx< y 0  r y N : ( O- M` [P @0p    00.R A*R0Se p%+\P p  00S@   RW%S ,S  RP p00P000+0AGS`1  << 4  R P    p   0  dQ00  00p  d [  Q`P`p0\Ph        c p@0iQpp0ppp!p3 QPp0p0000c00h PnHH"0  ` + %~!\P  p PA` 0\Pp P.H% -,Hp@0 W:P\Q P^P  P \[$ `@ P_ @ $<p q/> Ѝ%p0%p0%?%>%t%+%;p0%{2}%*h  0H-0 ^^ \^& 00NS* 000 0 ^\00@ P Q 0E  C ~0 % ,  P P,S 'S\S/{ dS :)Pa0 !  S :@b%aB 0   b0%! NP0 P 00}0:S ' 0000 0@O-Mp@`PDpQ$ %QpPp1@ Q: PsPplP T TX  @0@@T`ЍMH-M 00 0ЍHЍ/O-sMpQ `PP T [ Y<[ 00@4@PpYP, 0pp$P PJ PQ$ %QpPP1@ Q:sPPlP Z Zڭ 0@Z @8PHN T p@T` Q R8c ,Pd  4 @ `@%T TP`%V `40 P:,PY\PI 4,0P% P0 T-`@ `0P`@@Q* 0F@XSe qP0d.Z00 0 AqR Pl00P`0Z \ !F]P?xxTxxxxxxxxxXxX4`xXxXxx P @ qP @  K pPD&FVQ \888,48<8D888888888888\l|888888888888888888888888888888888888888888888888888888888p4 P @ A P @ ~V !Vo@ Z4 0 pP*,P W,`ZP 4,0` 0|pp 4P4( PP*   P 'PP'PI P @  P @ A  ;R ?R%Q Q P- @a@Q OQFI/P88P@@ P @@ APP PT*1@P OQ!80!0! !P  P @ P`V  P4 10 P*,P P @ P 0 0p 0@  PQ*   P +@p>p@<W9 Pp6Ppp2@or.Ppp*PWpp$pp!p W WppP}P}PA~V OQ  p OPq  P %A@Q" OQ}a ARI/A AR @40 P*,P _,`iYPY 4,0`T @4 @j APT:c\%Q Q    ;R ?R eRP P @Z ,p)YP 4,0p  0>{p444,  ,ppsߍ< MH-M  0  0 ЍH Ѝ/ MH-M  0  0ЍH Ѝ//᠇K-Mp`PQ``P# P Wp<PpVXP  @TpT Q# X+kX)4X!, T tXX P XE X9 X6 Ѝ "pP Q  (P [P  [p(OP  [pXЍ<4ӫ, Ϋht@& d d d c c we c ąE> > @-M0S H@P - ЍA-P`P p N@YT  DpW|P vP pP jP dP |^P 0Ab $ b b b b O- MM pP /P  0 ЍۍOP= Q/Q9 P6 @`\YV.᱒`P& @NYT  Pp  0`:YM V Wg@? YP$ @P`t@:PUppGTP:PW g U g  0PF]P P9 /P 0 PyP 0FP% @P@`t@:PppGTP:PW g U g  0PF"P P Ѝۍ輘a a ` ` ` =A _ _ O-MR `@P pP %%qVP P  !dVP  P  SVP  GP VP  : rPp R p P pP 0<@p  p `[ `Q'pQ Q , p`[PAq 0Xp`pQ pQ [ ̌`P 0VvpA  !P 岐$ Q$P  $P`P PR W$POW$ UP$E `YC [ PP0 0Ss0   r0P, psP nP fP2Ppp1[p p2Xpp[ `ЍG-MtPp!` 0w P4M @PpP+ Q8 @P 1 0A p pR Ѝ P 0 P  0pP  Pp p<Z Ȑ؏H-@`P! V PP`P |(P p@U oQWU oO-$MP@  PP,PjQP  ``VPF p|P  刣P  Pt @@P,P `7QP  P`  Pnp@TPg  mV p[V P pPPWP PX P `(, (, PpW< 岰P`VZ`VJ $ X @TP TP $PPP ( $@X㰰( ( `PW@I@VC$WP7V@L@@PDPTHPLP3 Pp`sV nV fV    P] &  0qP @T pU $Ѝ,v3fU W ; BU A-@P P|``P,PPMPP  pP S  A-@p P`UP SPP PP !Vpఀ  O-M`?8P. LpW @@fP@pW P/Pr @sP nP P@@ PZ  0|pW: 0Po4sY nY fY  P H DPUP @iSP'@P#OP H @DP pH@HH@sY H  nY fY,H (@0H0%P' ,Q0@H <P00@H 0ఀH @ H  HH @HHLPLЍF Q Q 0H-@ PUP S04OP!0@- \ s\ 0@T sR nR fR 0S00A- pW `@`pW PA`P sP nP fP` P``M0H-M@P 0 <Ѝ0HЍ/K-Pp@P @P `( `8 H0NP*  `pQ`   p@Q  p岐Q   pP @p @,@P ,(` @ `<@P <8`0@ `L@P L@HP@ PA@-0@@@@ @@0 @DS  @ ES0x0t@\T0:Q0@ 0S S ^S@@\S@ B A-@p `PVP QP!PMP A pP2  H-@`PpWP QPPMP `  P  O-DMp @ P  ,P ^P00\P00 PII|P|@P@P\P:  DЍZ P:  0 T P: 0cPPPP `< P`P,P7MPH  P<`TP#Z4 @ P@ ` ,P= ^P00\P00 P`F2``P,PLP  PJ<`P ՋP uR<@rRpRnR@lRjR hR0fRdRq `FYP XRP, p @0p0 S <8<P <0 R PPi0<(0,P U>8Zd KPc #0 P< P @ppp Z <8,P < R  0 S P4@ SP@PP <  0f4P8080 PS*W$P  @P@U@ p R@Ua pPU;< f0@@ @L80P. 8PP  Q @Q p\Q P UP @PU p\Q<0QV0PE 0R  , 0 0 0 p0PA0Q , 0 0 00P@UPP%^T ^URPu , 0 0 p 0pu?QQ Qd PEE/QD (4@LXF  , 0 0 k 0 5P2 /, ) & #  @Lp W :<P 0 $C84Px4PP <p 0 38i( Qt<p s08PVuu,p Up pP< Qupp~<,80Q <  0S Q p<0PP Yz0R < N Pp\pP@ ppW <4P80<Q < 0 0S 0Q  p<0PP84 PUR <0fN @pPe%PPЍ0kL ķ 0!S/W 0H-M@0  2" @ PA0P$4\lP@APH " aP@0PPЍ0-?L*S@ 0H-0M@PRP 0Ѝ0[`P PJP&KP> nP> PPM P P 7 K P7 PPBKP2 P2 KP P9 P- P+ PP.P, 2PP(P! K P P"P PP P PPPP P P P PPP PPPR0Ѝ0H-qPpU@@P1 Q|``,P | p` `Q  W|`pQ  P|37`2`F``mtmp(H? 9`0P  Pp8"TpH0?? 4Pg:\P `9N? /`PXVU[ PE`  A? ԏGpP8X?|pp 0PTX \0 0 P`@ ```L9 `C Q? 婑`FGQ?XTp``0D  0 B R{ X0 PpASk  jP`yPv ? sP 0 % |SH`Q`dph` :L Q? `E?l`/ 0p࣑p`F0Ql7*VU 0PE6`$P)  ;6? `U  EV*R  EVR  EVR PEP$P ~7? `Ud  EV*R PEP$P)y     ` $`P`P  Uy V00E *S_  PEP$`DQ  `P9?  `P`PPP `U $ RQ `@A`P`P:? $P$`0S PP`PVS $`QP R25`7 V0C`0LP`p;? $P$"`0S PP`PVS $`Q$P (R25`7 MV0C`0LP` \ X P$XV`PU 0EV *S  `PE`PP`  HY`P P`$Q ,0  H0Tp?? `PHp  \kT\`0pV aHp  \[T\`0Vd V)dHPed `pHTp P00C\ Q  L{Tp HP)ed d `p'Tp`ν H` TpL` :( ))()4dHPgf d e0 `pTp Pjpdh T0\0Bt0BP <\Q?TpP`P` Y( P(`P `XHPedd 5? Tp`D$XQ 0  )$`pXP:P E Tp0P  P 0PH`DO? Q P V+`0Sc 0CV*S  `0V 0CS  `0V 0C S  ``@`u% ``0 YU \4 Q?`PXb Q?\DG? <8\P`P  `Q!P#*XP Pe@p00 \Q(*`0% pS 0C` Q:XD <@`n??PP <@`@ \  p`0 aV# ! ,2 Q `V ,``P \  `PLP ` 2 Q PU P P@ f# P`1@ 9F`T0 X9 ALVc \ 0`e@ITp?  LP` P@ J? \T P 1pV*`0ZS J 0pS:\\`0P @P:0  2'a`PP`V%P` PP  `P@P ` 2'QP^M? Tp`^?? 1 A! `@9岀0F9`C@ \K? HL R V*0  PQ A0S:,L Q P?XTp#`  P 0@``HpH9`CLTp ^ DHAP0 `PX@P@Q \PN X `PH4P, 80@B8 A PP B 0 R0N\QH Q? P( )R ( PQ`P<4L Q?0 )`FTpQ?R  `PE)dHPed `p|Tp PL0PQ?Py=P? ?\ ?P  LTp `0PSLQ ?,P PPXTp`Q R !`a``a$` `a a ?,Q>? Q  % " Q 2P R?  R 0S/$0S\ 0S/$ 0 R 0$/A-MP R $ R\ PЍz R,2 0S0S@@T:S@?LRl/@ <@010<  0bP !d0P @l@PE0``,@pV003WfST*@`Q: l,0@ S Q `Qpp3VPPaWP R*U:PlP0@0U D Pr OPQ 00?K? M@,P0P4P PY PP`<@$`P pPTh`Q R/$ R R 0S/,00SA0?<Q@o/K-pQ 0`S @$PPUP8PT (.*3/pP 8P ( 0( 3/P$ (2/8 .*MP  R@ :o=RTp B0pG 0P T0p YBp ( 8 y8Q R/$ R R 0S$0Q/ / R 0S/$0S\ 0S8 0 R/ Q P /Q R/$ R R 0SX00S/;Ƞ Q C? 0QD0D0A /Q R/$ R R 0S$0Q/p@@/O-|M000RX0\0`0d0h0l0p0t04, XP0p`pW@```Z 0=0P5 P1 P- P) P% P!PPPPP P PP 0e X V XV6P/P+P'P#PPP P P P  P PP X 1UpPJugPLJnPHJFdPDJaP@J$aP(:JaP 5JaP0JaP+JaP&JaP!JaP JaPJjPJP ,op$(,@ 0Rc3  4p80pR `V P`P``0T T Xp@L`@,$To@ X0pP0 $@, 0(`Q :T``@ `,@0K: S( q!0`B @K  X @@ PD  P $@$@ [B 4ర[ R UPpK [*X0pI `@P`0 V:pFQ0#%S0, 010Cq! xZ @ 00  |Ѝ0p- 00 f  T O-  0@  ᬺ ,QP @0Y 0  pWpW  ᏺ 0  LQP. IpY  n, QP @0 0 IPH  P- , R P0 @0  0pWpW  ; 0  LQQ0 p 0 00Q ,P P [$PF  P- , R P0 @0  0vpWpW   0  LQQ0 p $0 00Q ,P Pg,P7   R!4pWpW  ᪹ 0  LQPI0 00 0  00 > 0q pWpW  u 0  LQPPtPg P^ Qg QDP tPtP? l80 ` 00 1pp t l Bt lQ\ 0R8UP @Cl\ pWpW   0  LQ7$Vi PcP! t P*tPV P P`l3`lX. 80 pSW* W W% WgWfWeWdWc Wb Wc  W^ Z_ 800 00 1pp t l Bt lQ\ 0R8UP @Ch l\ pWpW~  b 0  LQh      B B , R R` :u Br0p0pppp1pq  `lb t ` Bt T 2/4VA V \l 0P8U BP l\n pWpW   0  LQQQ P<V Vd  0p V LD  ptP\l$ pWpW  ᚷ 0  QLP: VQ:0Q: 000  00#00 3 00  00   00 00  00 (ЍZЍ  <pp0  000  4pp0 00` pWpW   0  LQP`oЍ  @0 07 @0 0P+ \PJ8l 0 B l\^ pWpW  Զ 0  LQPQ(ЍMN9@-\ @T$@T^ @ T9@L8T;A@L\*\0| p@-!!$2T3P%0 PU $PU^S p@T9@@8TGAP, P P%l@ T#*P @LP@T PPU `V$PU `V,@T0@PPTU T0!&!'pQ0pO- M , AQkZPPY  @*R:1\lp` BpGQ``1V` V *0I?oV 2  RgYe Vc&)o ᠒  0 &$`@ @@ !@P @T@T  T 0  LQW 8\ W p 8\`F P,\  C0V   0  B0s@ `R' , V&*<l@P 80Al0 lPP8 0 C, l@V`l l 08C,l\`P5T   P\`Q <@@< @BP,0\pW8 AG\l l P,R@ T@T 8  %, l@T@l  0* !CP,p5R\1XApQ*0I?oQ 2  `R?Y=  R9Q7Q@@`Y Q00 o`8 0 p\P\@T@T  \ 0  LQV` ЍA-PQ ` P $P@TP9 @8R;! ,P*PV 8  0(/+3/PP p/+pس 0(, `3/( 0,8 3/( 0L@ 3/( 0D 3/8P@ R D RQ, 8 ᪳, @@ ᥳL DD ᠳ !ᛳ 0 b $ 0 BP`kp@-P@P@T `@ xP P 0 0 "0pO-MKP tP tQQ P P:8 lX@H` TP Dp$"4 p@00H Q , @ Ps`Pu:lp t@Ap0p` A0p@@p!Tr  Rl# ``PpXd1` `` `Pt b 0U` @Bt*P(:0E`080` E@DH`lTX4P @@0l0 pk'`p`  BrH`0  KPl r6l 8p `pl pX0THpV Ha%`P*l80 pp 00p 1pp t l B t l P:\0P8U BPCzl`\pWpW!  t 0 PAU PЍlP#Q.\ 0R8UP @CDplP\`V`V  > 0 @ATPPPQ/ \ 0PR8UP @C`l@\pWpW   0  LQPPP|9:O- M lt lBPt; tP tQQ. P0 P08l`X@pTP!p4p0 P` d`Qx Hp` 0R#*l0, p|G 0CSP`Q `` px `dR *ePlp@ Qx RZ:PXd0lt B0rpP0pp0`C#0v`ppX5 VLc 0 Q0``  bOKx`Pt0Fxl 0C@pF0t0xppGw_ `@ Vl`8XH0T!D@4P 0@ P PHP`hP~ 8l0 pPp 00p 1pp   P%\l 0P8U BPC`l\ pWpW   0 PAU`@l h Q\ 0R8U@P @Cl`\LpWpW  ° 0 PAUPlt lAh tP ЍhP 8l0 P0 pp0 q`` h lP#Q.\ 0R8UP @CiplP\`V`V  c 0 @ATPPPQ/ \ 0PR8UP @C6`l@\pWpW  0 0  LQPPvPt33O- M,@`x @D|0RlDl@4@#1!PTt`8pP3`P` P P P\ P PX@TT@TP@T%@T#@T!@T@T@T @T @ P`U@T:  ` P@H P p P  U*0SR  Ѝ /dD Q/O- MR: p~P`4`%0a.&`RP ~p`R'p.  ~p`R'p.  $4`3'21'R@cUg 1C@೟ 0PP#%3 u`a0%G %[`#;@P@$`% P P%%C u q@ p$%G @%[p$P@%p&'S w`aP`%'W '{Pp`%@'@@p 'S w`aP@`%'W '{Pp`%P' PU c ppq`p& k  ` &00p!`P DB'@ppq 'ppq 'ppq 'ppqp'p' '`ppq 'ppq 'ppq 'ppqp'p' 'ppq 'ppq 'ppq 'ppq p' 0' #pp01 #p01 #p01 #p010#0# #p01 #p01 #p01 #p01 #R-:10p~` P@.  Bppp'Rq 'ppp'q 'ppp'q 'pp`p&q 'pp`p&q 'pp`p&q 'pp`p&q 'R \00~p R'.  Ѝ~p' B. D \G A @ ? G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" DS G-QR Q0Y   0 aq0P@.@`0 @FP% 0.0 0L "" lR H-P! 0  @^   @`AQp#pP` pE  Q H-P! 0  @^   @`AQp#pP` pE  P @-<0@.@ @L0## O- pR .*@P A xQ8xQ R*R p R ~zP , @ BK[>:RL:LL p`@vpGP0@P 00@P@ P@P@ @ P@ @0 P `@ @```0 W997w  [njK0<@RRG R5:0`P0` 0@p`Pp`@p`Pp`@p`Pp` @p` Pp` @p` P 0p`p`0pp0  BRR 0 R 0!0'<K@ Pq5RC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`SpqRC/Ap@-p` <7!q B@<7XP DN 0JS,BP0U``AV`Spq/k U/ Q `2/  w&XX X080b$0 ;0,+   h ` H-ˁb ;, R $ (  H-P @  Rp"` ` p`  ` s0pb3Ǡ 0B S S0 ppp‡0 S0 pp0 p``pp0  @ $4pp0 T0000 #4pp0   ძH- R0  0  R0   B@-/+ 0S# 0@@ 0@  @0 c 0C<" 0 S0@00 0@  @0 0C0S0@00 0@  @S@00  BO- M@/+P ,0 ̌S8p`0`V  PPU p p0;S;S<S p,p @  +嶉̌R<JXPP0`pp0`V/  ᰀ@TR TR R  WʶpX RPPP( 1 P=J`RPP`0@@0S/  pWP WaPppP P q```sps Tʶspssps@R P`P`P`P NQ;Q7Q3Q/Q+ Q' Q# Q Q QQQQ QQQ",0 0q@ W0<0S100/+ RQ  0 WR+p0   0pp0p a0 AR0Pp"0 0 0 pPPp q0b pB1 " 0p+( W<pPp@@pP@@Pps0g pG3p8 Wpp0PP0pPPpyp0a73 pA7p WpP7p@0@0p0P@@P0qpc PC1Pp1~0 ̌PP0PP @UA@pP``p`PP`pg PG4p b[    r Z  P  00  P 00  ЍE?`ppW`p VTD H $I O-DMTp=0{< 0E>:pp? @;X Ϡ0+ˌT 0@ p0 ``0T PSU YP!Y\k `差y 00W @X 姠  W\ 6P 0P\{y0W'Up!@`XV @* ` Q   `\{V:P`V  Z\+yJ 0  \;Q !pAy\;`+0`;0Q 9X0;!`A\{ @`yW(Qp1A @PU*0 X@K@0 @T000@\{T:X@K@T0 @P`;!AQqA1@ papX +p0PUP100 @`9Sp!\;9 pSQ0QaA!@ R @* P`V  \;R`:X + RW``;p APPP10)pppp pppp!P0!pITp@pT- 0 ` P ! Y`P[`? ;000 [ 0 K `0>#0 R  ` 10 0." =̌W7 >0 \?;0 `R BV @`F`B`` pW`B`Y /+ pv0S apGVPA`PY @PI啬%P尐0CY 0{` @^  0p0p``PP "! 0p21`r0qcpaP` 0p`S#3tdJ$ Q !0S p0`PPp@`Pp0C`SʰPDЍ  差 @ @yW `R00pyqQ\;XP[pl{R pGYl{ 1p00G0O-Mj>:kp?;W`  @$@p^*p`PĆ\# P`kA$p嶐b@`dWᰂ3p` p!``$` pf@9専@D q@$PbpE`gUB`PP@P!`@@`$@PdpV `ガP`ЍpH-`P p@@PU ),PP@)`yaraH-`P p@@PU ),PP)>tcidA-`P @PP@ypW p%PA-pP P@@@``V )0P`@(yaraA-pP P@@@=`kV u)0P`@(tcidH-M@ sp P pPP@`DV `P꾫PPЍp@-M@ Rp P `@P#U -)DPPЍp虫Ѝps(듫Ѝpyarap@-M@ &p P `@PU )DPPЍpmЍpG(gЍptcidH-MЍH-M@`p,P P¦ p P# `@PU `V U0 `-`V (P`P'``ЍH-M Ѝtcid0H-@6P(PPo0tcidp@-@'`(P$U"oploobp@-`P!P @ P'ppR/0H-@P'0@-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@; @-@@[ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@"@-@@1@-@@L@-@@i@-@@@-@@p@-@` P P @''ppp@-@` P P @'ppp@-@` P P @&ppp@-@` P P @&ppp@-@` P P @&ppp@-@` P P @&ppp@-@` P P @&ppp@-@`{ P P @&ppp@-@`g P P q@&ppp@-@`S P P ]@s&ppp@-@` P P I@_&ppp@-@` P P 5@K&ppp@-@` P P !@7&ppp@-@`r P P @#&ppp@-@`^ P P @&ppp@-@`J P P @%ppp@-@`6 P P @%ppp@-@`" P P @%ppp@-@` P P @%ppp@-@` P P @%ppp@-@`O&$PP0PPpgntsp@-`PP @ qP%ppp@-`P P @ ^Pt%ppH-@`p&<PP P PT atadp@-@`[P P 2@H%ppp@-@`,P P @4%ppA-w`%\@PPmP p P pgntsp@-@X`%$PPPPpgntsp@-`PP @ P$ppp@-`PtP @ P$ppp@-@ `%P$U oploobp@-`PP @ P$ppR/0H-@ P$00H-PP @_!P$00Q/0H-@R!P$0@-@ @c @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@y @ @-@s @9 @-@m @] @-@g @~ @-@a @ @-@[ @ @-@U @ @-@O @ @-@I @ @-@C @ @-@= @* @-@7 @G @-@1 @g @-@+ @ p@-@`P P D @$pp0H- @P P @#00p@-@`P P  @#pp0H- @P P @#00p@-@`P P @#pp0H- @P Pg @#00p@-@`pP P @#pp0H- @\P P@ @}#00p@-@`IP P @i#pp0H-P6P @ PW#00p@-@`#P P @C#pp0H- @P P@0#00p@-@`P P [@#pp0H- @P P@ #00p@-@`P P 4@"pp0H- @P P@"00p@-@`P P @"pp0H- @P P~@"00p@-@`P P @"pp0H-PtP @XP"00p@-@`P P @"pp0H-@P P2@o"00p@-@`P P @["pp0H-@P P @I"00p@-@`P P t@5"pp0H-@qP P@#"00p@-@`^P P N@"pp0H-@KP P@!00p@-@`8P P (@!pp0H-P%P @P!00p@-@`P P @!pp0H-@P Pt@!00p@-@`P P @!pp0H-@P PN@!00p@-@`P P @w!pp0H-@P P(@e!00p@-@`P P @Q!pp0H-@P P@?!00p@-@`zP P j@+!pp0H-PgP @P!00p@-@%`!$PPPPpgntsp@-`PP @ 4P pp0H-PP @P 00p@-`PgP @ P pp0H-PUP @P 00H-@`pc!<PP "P PT atadp@-@`P P @ ppp@-@`xP P @ pp0H-PP @1Pn 000H-PSP @P\ 00A-h`!\@PPP p P pgntsp@-@I` $PPPPpgntsp@-`P7P @ XP pp0H-P%P @P 00p@-`PP @ 4Ppp0H-PyP @P00p@-` @PF"P V!P p@"p@- @P $ dA-P! @ P P`` `<pP 9' p 0/ 0[Q Q Q @-P @ @U 0} 0P Q RQ @-P @ @? 0} 0P BQ P MK-M$P @$ 0pu4PJ` P  0Pg4 pЍK Ѝ/ 0U 0gO EP WP H-P`p% iP @`P$ൖT `h$@$$l\ ht<p@-P @Q pp PP `pP`&\\G% P @@` Pppп |k@H-@P PQ  p P `pP+&\\% P @@q`V@ jlQ/ 0 S /Q/8 0 S //Q/ H-^ L0 SQ 00S P %舽[ Q  0 S//p@-@P PTQ p g P ` P%@p Q $ 0 S/Q/lW K-M@P, P`Q%V# Q  - P ` p0TP S03@ Pp Ѝ  K-M@P' P`Q V!   pD P x0x p0 P0`2@ Pp oЍ(( (0; 0< SI J J P 0(  SQ 0S /(TH- R 00 S Ro H- R 00 S Ro费 P 0L  SQ 0S  @/  PQÝl7 P ,00R  @/ R A-M(@P b PP  P:`P6 0 P- pD P( P0 P  RQ"QD 0P Ѝ蘸H-$" 4~@~tH-P Q HA88 80 0f$$ $0 0gE F F E F F H-P H$ 0 0tWE F F @-@l\"P XV"H<M"P CA(}}}|0H-@ P ` P  P P 00H00HDH-P 0 S 4  PQo"+ H-M  Ѝp@-P$$"!eP `!p!(O P @NN!GP `!pppP\!pLL L0M 0` {{|{h{0{<{{zz D KD VD H-M  ЍH-M   ЍH-M  Ѝ@-@T  R /Q 0 S / !@ ! Q/ q3/@S"# Qr3/IJP ,0 S0! 0/P ,0 S0! 0/ȱP ,0 S0! 0/ሱP ,0 S0! 0/H0H- R x0P0U0A  t 30t00 0 T    t :@0p@- R! 0P0UpA 0t'P0``R  0T0   '('R@ph0H- R |0P0U0A ! R 30t000!T   ! R :@00H- R |0P0U0A ! R 30t000!T   ! R :@0$0H- R 40P0U 0A  U0H@0舮0H- R |0P0U0A ! R 30t000!T   ! R :@040H- R x0P0U0A  t 30t00 0 T    t :@0蘭p@- R! 0P0UpA 0t'P0``R  0T0   '('R@p0H- R |0P0U0A ! R 30t000!T   ! R :@0X0H- R 40P0U 0A  U0H@0輫0H- R l0P0U0A   t  30t000UJ   t :@0h0H- R x0P0U0A $0t%(000R U J  $((%(R@0ܪ0H- R d0P0U0A  U  0t000UJ  U@0D0H- R d0P0U0A  U  0t000UJ  U@00H- R 40P0U 0A U0H@0<0H- R d0P0U0A  U  0t000UJ  U@00H- R l0P0U0A   t  30t000UJ   t :@0d0H- R x0P0U0A $0t%(000R U J  $((%(R@0ا0H- R d0P0U0A  U  0t000UJ  U@0@0H- R 40P0U 0A U0H@0輦P 0(  SQ 0S / t0H-Q DP@PT0A  USSZ0$%o0(0H-Q DP@PT0A  USSZ0$%o0ĥ0H-Q DP@PT0A USSZ0$%o0`0H-Q DP@PT0A USSZ0$%o0p@-M@`P``` ` `Qe(PQa +R 0R -R  p9:"P5FxQ PA     p:"Pݚ  !pК"P P , P uЍpoH-$\ՎiiԢ0H- @0  Q@ PRP0 TQ @ R*0T300H- @0Q@ 0PTP0 R Q @$0T*0R30@-@ᩏ 4h0H-(M@P&* P0 P    P0G,x PzP yP HP(Ѝ0,, ,0 02*1 d Ԡ0 0 1 PH-P 0 0@TP0T`Q URSZPP!&oPH-QHKtfXf /0 0CS/\/H- uoH/K-`@Q 3p0 PCU pP<S p0!S0-S0-SV000S ppS   0-R-S >RppS /SFPPQ PpP`p,`>PX` P\ utP/Q PY (>Q (>Q $Qx PQq  Q&  Q@=R(  P R0!$PP"Q qR  PR "R $PP>Q  0 0+ X+ n+ O- MpQo*0`QP@ QT "QM  \Q_" @SRH 0!Php|ePWeh_  \  Y  V @P ?+6 R 7 R P ?+7 R P#P P.0  4 T1?.! T 1 ?.!00 (R ) Ơ?1? .1  PW [* P$ W Qy*  P W Qp*  P W Qg*  &R @R[ <R\ W Q]*  @a BRL0!D(((((x(((((((( pR% mR3 pR ;R.& @ tR ;R&> @ tR ;R< @ uR oR tR ;R"  oR  sR ;R' @X\@P ЍX\@ 0 0$% {% % O-IMp@ T'pP90PP4 <T<Tp T" TP! P`Ge P AQ @PZQ+[0A S2 1\@60@"Q3 6+Q0: 6-Q06 |60A P01:PaQlQsQeQ( PrQuQeQ(50@50 @P5"Q0(50 3/Pu E/F?PO 1A 4/Pa  E@ @Q p<Pl` bP"  [P  TP\PR PM -R-P >Rpp<pP> >P pPP4  0 0CS!  E/F?PP3P! `~EFP1A P4/ 0PP Q ~PPLIߍ< pPP (PP Q pP[ PP P@GEF@PxT4"Q6 $"Q6 Pd\010 pP'   pPO pPDH ypP9< $0 A3/P  0@P 1a 6/P  aPVa  +P PXU E/F?``^P P~EF`1A `4/ 0`JPtruedatadict " ! ! ĥ<0  +dԌz<Č'|_ O-MP{t`,@p? P;p F0f pW*0  0P8yz  [  0 : yp l@   Ѝ G-p0\WG@0uSČA0IS*V0 a0I S:00I S3'P `A0ES:a0E S:00E S%'pA0GS:a0G S:00G S'@A0DS:a0DS* `00D S'` 0000H-@3@P 4P,P0P4P8P(P;"P5 0 ]P, P3*P "Q :Q  P  P x  0ppPe pЍ,, ,0 0 - - $ q I c @w 4(wp@-M@004 R;P,S Q R& `V7 P)  0Q 4,A4P- D `ЍpQ 0j 0p dЍp`Ѝphh h0 0Z[TT T0y 0R<< <0 0cJU     A  ]  =  H-4Q , 0A40Q H @@ @0 0((( (0 05 M e  )  O-M@T*P `4P  p7P pP P Ѝ ЍOTP HD `P <  *@P<Pe4P,Q\ @ pPX pP\ P H¨PpWpWv  @ PW-  rP% P  P  P  2/P 4!T  R! P U ph Q @ d pP^ ( pXTT!T1 0I!1 0)A!1 08 0 0/ 0 0& 0 0DD D0 0t4tHsrrG q 3 DtQ   - w    > u  e       K-P: P`VA@V U1U144P pP' 5 , !$ ,,P  Q,Q 0S p+ pQDD D0! 0,, ,07 0po , <  = @-@@H-H,4t4H-$\4h4dn⻊Ḋp@-@P ``QPNP Q < `R4 Q ,a8p`` `0 06LL L0 0).88 80 0%mm  M )  0H-@P P H  Q< 0H 0 0l  * @-@D0P* 0 0x2% F X H- Q 8H 0  0 D Z k@o/K-S, `pP@V  cP x P,Q 0Ke>;a _  01 0 H-Pp@P `/ W  P  `ԃ`/ jH-P@r`P oop, WP@P @jH-P@W`P oop,WP@P @iH-PP@pQ8PP T@ p`(P  @wp@iA-@P PQ P`@V pPW P  PQPP (`@P h,hQ/ 0 S /gQ/ 0 S/gH-0S L RQ R0SR gH-@P  R  `PV U P  p@U DD D0 0{,, ,0 0r$g    Q/ 0 S/HfP 0(  SQ 0S /$fH-^ 40 S 0SQ ufoeH-MPm (PPi@P* !0 8P$P\   `p "PL $ PF"P 00!01 0 0 BP1 `pP+ `0 2P Q P Pw` pPP \` peЍV ^P cO-Mp(` P@pW=Q@1, A yQg U P V T/* A U UP V P* A3! P V P* A2!0 V T7* AP z-* pGZ@X$ pЍ R U:05p `BV  =R p0`5 p AR<Q ЍX @-@P G-MPt*Po PPb  Pd  PU%:p@`* PR $  PJ & PB ? P< PEUU+  00U@p` `$P$ ' P =U ( |P =wP d ЍG ЍG8 `@Ѝ(( (0 0teD`ܩ  ^q / H-0S RR doP P88 80 0>$$ $0 06 0H-@44s ((PTPP0L#T#@-@T  R4]Q  0 S/P/\Q  0 S/P/\P 0(  SQ 0S /X\0H-P 0(PP @ 0 P xPP h 0 P TPPPP nP000 00 0! ! !X  ! p@-@@@P@PN,``Gp PQ 1/`@/LPP>  2/P T 4/ LPpPp# T 4/U. 1/Gߍ 0 0 0 0xx x0 0|| |0 0hh h0 0TT T0 0 z ' W g 7 K Z z : T Z  l P/ O-KMP( @p$TQ QFGE 0`6/P( P  JI/ 0P $q(QP6 1$!( tP Qq $q(QQ T JI/0P @J_Io($  2/ 0PKߍ 0# 02 //@-@@0H- R PP @QP  ,  @00XX X0 09DD D0 0:00 00 0;X 8 x  X 0H- R @PrP  R00G-MPP*@PlЂp/W5`x (08<<bp\W W  0bP `p[PX Ptpnpfprp\KPH FPC @QC >P; @;Q <Q >Q&1`P. g&Q&&`P# a P mP p &`P l P tP ;P`Ѝ` 0 0 f - 0H-@ P P P PU:000H-Q@P 0HPpP P0H-@P@*pPPQP5 `pPP. P*<`PP# P ppP PV  P P `pP P>H 0 0I E p@-@P1*`PPQP& `pcPP P<YPP /SP P `pIP P>p@@p 0E 0= 5 H-@PP*`P%PQG P ppP> P QP,PQP0 `p PP) P%<PP P `pP P/P >HppP P 0 0Y< L A-`PY P @TT pQQPM  lPC W` p 4/P5  P0 P" P( `)@<pP P  P  P @L P  zP` 7 x7K-MPP @zpUPQ. pz  Q:B?` =`9P5Pۍ!1 X 0RMp  !`P Ip `Űð  Ꮀp pdpp`P`P :W t~PjzP @Q/Q /Q @P*U @U P/Q A`lP`1 p NvistX/.plXXXX kj/A-`@PpP P P @*QrP@ LL L0 0B 0 0AG o @-AT \ T'@QARS ^ $DQ B@R S ^   0 0ZgG G-(M@RPU tP0  ` p  8P ͞PT(ЍL| [     /     / 2/ / /     / 2/ / /     /K-(M@PP `P T"y$P-P (Ѝ(ЍK* 0  B0  ppP P QPT T (Ѝ@ Q   /@-@㰮T p00 ꠯@-@P @-@PH-P Ny?H-P Cy|?H-P 8yP?H-P -y$?H-P "y>H-P y>H-P  y>H-P yt>H-P xH>H-P x>@-?^ ʎ ! 0@T 0 @S^ 0@T 0 ^# O$-A(? b  @0   / //@-@P 1/p@-`H@PP x ክP }|pp</H-P sx-<<H- H-P ex<@o//H-M0 ЍvtH-M$ qpЍwt@H-MQ Q Q $ ˮЍ*|Ѝt 㿮^t $(/(/$/H-4 @   ,B,0,0 (/$/R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@H{ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pv800 @  0  /UUUU3333  {**B"6 S 1d8@HHPHXHtH|Hpc? b Aa-lswr0 -00w !=-  S -SxsSr -   w0-0+00 S-SxsSr -   ,w0 -0 R0-RxtT /G-lP) pJnP6  p mP.*@l`qPqP`@pW   wP =Pl{zUp@qPTn050H-M4"424R 0PPHD@P< 80*  w@po  wp ttd PP|PxPCp \PXPPTPPP P\oBK ww sw?@QP'P(d (0'm8 0  㜫Pm'U yP L@ fpyP L ;w 7wd L@Ѝ0u>] 2 002O-MP@R D "P ypXsЍ`YtP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0\@I" 0zy 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qm00x0O-MP@R D "P (ypXsЍ`sP+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0#\@I" 0x 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qmp@-M($`P4@`P 08PpЍp .O- M@p@PpQ@`PR` E#P:`P@D{xyx`  0yqpxP lx4P0`gxP Q Y:8`

Q U> Q  @@)>Y \ P p0 R @@f 0SQQ$pG@য় z J P@ ">Q > Q @@=Y \ P 0a R@@k 0Sqa`q8`@e@@ @Xq qp-V@@P I =cPp@r `@s:V +@ocP WV;Q :Qd& Q \P P :P `?`t@```Ѝܵ {t U pDPK =Q {= QD PP=ZW \R P 0a R@@i 0SQa`Q ?q`@Tu Ppp@T  sP&qP? u  0S 0S QPZ+ dPR :PN D dH ``}P*ppWL#PoPu BP)[' PP:PMQ p-P+Pe`pP :P P  ?`; @Rd[O X:P)\TP :P 4W(WppWD P :P `-P+P:`:Q :P?`P!10 PP  `P`@`PPP`P:P 4 Q  ! A-P+P'(&h\&Wf$|sg.%ؿĿ@'н"4\ l#$g`X $_W $` e`LL!t Y <  W  tV X K-p`P+ 00P!-Q@⤂@PUP% -U -PR)p"p2 0 <<PU (("@ P@::U 1A -P@@-aP P aP! :Q1Q @:P P>A! 1 @0P00 ?`P:P P  0:`:P ?`P  0h\\s\HLH0 X`[xtZxC  H-MP`QsP3@P P p 0PP 0PP PPP `PP_s`PYs` PRs`Ѝ\A-@ ` 0Q pS P1Q*+P pEr Pp pAWp  j Q! H-Q Q Q+s$ 0 0 sAQrT 0 0 Ϡq  0 R1 R010 r讣 V H- X{0 X0/o" #F 0F/o" ;F@-M@ 0@PЍ0 H-`@p`c0VQV UPqcA-@`pQ PTPPT vP  0 U ] r К H-MYЍ@-M@@PЍO-MMⴄP`@p$qp0  2$(,04 д 0n}P @T} @WQ C,@f@̔D0P; P8a@l8 ;isTppP8lP5 x0 ㊡p6Y p0 ちp-p@Rp*pP. |Y t \x@ 0@|PЍۍb u@x@xʠ|㓡PJ㎡p|徠Yㅡptpp娠t妠GRpP$lP!lP" lPl$QQPP/yxh!0P0 @43l  0/`axP`Y  A[ [    0 0   0*2 Y㦡  Hr6 ! + < 0  3 ٙ ),I :^f;3 Ԙ O-tMM$̵`@p p匡PDHL @@0 ؟p  p@`,\\p,{ $@8 @pT? ` pPJ ֟ ؟pXןn0P ,@,n#Pdn=PQ3 n ph    h 0`xP 0 [enn@ h 0     wP  Ce  C@Z TZ`@@p,圤@Z,: , CPU(Jz,<#``  0=i &@iTYXP崅PpnP 6PMnPp ]op ,刲d @ki Pdi ^i ` P`PU `P P  Ԟ` PY< 9)h( x%iPP(h 0`7wP`⑔ P v YnϞذ , Þp0 ㎞pPtЍۍ:$@ymH0  b p hՖ   7 I f CD O D $! l@-M@@PЍG-PM`P,p@!Lqp0  Lx $(  0zP @nz @tpQ `p,pcp 0%@XzLPPЍ z )  K-M␑@P p lU U&W```W` 0 PEP:JUpU tp ڲp)l/$l@l@ Pp pʩl0P @ Pٝl#ѝPЍNK-(M`pP ppp p$p  0p pyP@T  0P @Tppy(Ѝ! O-MMPP`P R  QP  0@PpM)WR PI D ;@PWDPT NN+c+DU՞ cD D DDP pNH␞pP  PU.:W$ P p?0.P V*pW:V'B71@4P1*p@@V *p`Qpp:,?V35虬q@ }p@-<`P@`u(00 ?@lp@H-M0@P`(p( rp Ѝ!@-(Mt 0@0@@ ;Q 8@$  0@(Ѝ O-dMB@`0p`P" F `Pqxxa[  0@@+P} `,Pp  Bh  0@`Pf eP#  P, 0v;P,0p@P<@XYZ X  \@]PP[0@ p^CP4$P( $0F P P(, 0B;P 00,@<YXZ [0\]g(  P $\@@ $g@@@ `RdЍ~~ ~ +y} # 4$ H-0Mp@00 0  P``P :P `o 0P`0Ѝg0Ѝ" O-UMB@Pbtt[  0``SP} @4 pP$  ig  0`<@Pe dP" O$4 0:P40H`PDp ppP 0`dP4,P0(, 0P 04 $ 0Oj:P 804HD 0g0((P $X@@ $f<@@ PRUߍ${ y'z _! /(A-M✀PpQ!pP `Յ\ @"2  0P  PЍppH"G-GM<@ l ,ėP7J\+`ᷗpP P\@ +㪗pPʇf@ᾗfW@JY!P \@၅` p"2  0P  lPGލA-pM⼀`@pPlᐂ ᛂW!opP \PK\ @"2  0P  lPpЍp@V8U8@-M8@8@ ] 0%Ѝ) v 0,Q p$/A-M✀PpQ)"pP `\ V@"2  0d@p (PЍpO-EMMR@P@PjJ<8u` WpZ xp|X 0\qG W+  RUP⠰ W+  RLẖ@P  WpW ePÖePPT@P(JY)P @ T p"2  0g@p  @( ᝖LP@Pᗖ0PP@PEߍۍA4dxH-M  0kЍA-xM⼀`@pPt *W)WpP `PL\ U@"2  0d@p (tPxЍpO-M` 0L! D1H0 0g&9  @@` `gb g 8_ cb b 8 >/p g!f!c!"@ pmvmzA-MhP@? @p !R/ᬣ0H-MP @SP*JDU ?P :&V?P: Vp  P0 D  P0  ZSЍ0< / Mp@-M@5`0T` P P P J 0` 0PP  @@`Q Ѝp@ Ѝ/ddb|:Q7`P@`@T,zP ,P [P]QQQ{P }PV `FVQ* Q :  R  c ЍۍO-TMM` @pP~P\ `Y  *P0S/S 0QpIpQF P HN ;P1HP. q?P 0S  0 R! R  b P 0@0 BSpP` `p HN ;/P `p `W PPTЍڍ *p`V*Q W P   RS PUP pP0E EQQ ?Q [Q ᰐ!Y Q 0 ]\ \!Y[`Fp   pqp1!Y H  0]R `r P-Rp- ]W PPw  p3``, p`P N+0pPpPP   p Pe  mp_ p [ ` 0@0 ^8QEp@-@P PU aPU` P KHpH-\50? CR,0!|Q 0SS *SO-M@` 0  YDP + _P< PP KppPPǠFP W   `UŽ  0  0   QPKЍ]DO-MM™`܄ ؔPQ$ /0`Q @W'*qp@Ӳ Qp/Q TF/Q`0V*/Q Q    P20 @+~$ 2/Q!    Q :K/V/Q   4   1$QЍۍ0  Q Q 0pp 0 Q@}( 2/P   PV*/zO-MM@0< lQP@ @H@7KX8@ **@IPP X:8L`P0    Q 00 @P}$ P2/QUX QQP    Q 004+A @D 1/@P @pxp7/P $`<`*F(P 4@0p<`u(I pP4@0p7/P   U 0R0*  .R   .R R .R R H Y RYP H8P $P HL@@QT I@P/31!@(  0PH@H5尰@P:[ orHP@ @`v` V ` V P#@@  z?PYV# [ )V$(P J`r  V  P3 `r` pR,`+D @oD R P{ RP HQ \ P QP ᰰPor:[1D s5r RD PD,pR 0`{Vs`rPD V D 5 @ .R(( p00 p  WorH@ P0 0uP U P U L@ P# -?@IU! [ )U"D%P Jpr  W  P3 ⰰ,ppr [*, @ B/o"P { R HQ S  Q  @?orL0P:T@ D {P<`r UPp[ ` r VD r`{ R V <`嶰@P{P~$ P2/PwX Ps H<`m}괐YL@QFP$ LH< @0` Pf$@T   $ P PVP?P/ MH< P0F0P@IHob8H4/Q/ *HH /P㸠 PP㘠 ꌠP 4@ @@U 1/UHP $QЍۍewxwnn4nH0H-PT@P FP(P 0m 477 O- MHP /8P,P; nH% 0@DP@" 䴟` TP#Q$ TH 0)P Q 0 pp@ Q:HP  P@ -PP %PP P P c嬃嬓C`p @  PP  UEP@P  GEP@{Py   9EP@{Py  +EP@pPn  EP@dPb T  EP@XPV  DP@LPJ  DP@@P>  DP =P=-5Psl DP =P =5Pb ^ 10P! *T P M J @G D A#PP P P P P4P Ѝ6666t6l`606505]=F9KKHJh28!QH-4P $0P (110H-.0"S S, ^\S P  @"T P @^P CP: S #S 00 0CS   \0#0H-RM@a` %P PRލ` P  0 1ppp x PP 0\PD%PQRލ/e/8/ __O-MH`@pQ V]FPX ,@prw8@p@<8 @<8,x P7p4` H ǟT T@ P"p`,ps Px, EY }A  wT 4 'Pf P$G`Ap0 @   `G(P> U 0 HHLpvpK P?  vPC GRRQ RRQ RRQ RRQ RRQ RRQ RRQ_ RRQX RRQ RRQ RRQ RRQ RRQ R P(RG`QP PG`(Q RRQ RRQG4Y :T [_GP[YY I4$pPYuc4$ pP PGGP G GPG Gd LG GP& QQ G`"   u4$pPP  u  uPG`4$p(ApGY IP ( urp uYPz  us`,pW1: ,p$`p"$ ` D<DY `p,p$ |Dx GwPG@sD@@V .W jDGuPG@cD@@4PV @ P@`@[@  V@OD CPV PЍP :uW0ds$c_d`_ _)8_@6P\d\P\H-M;0Ѝp@-MP@Q@ ``+  0P@ЍpF#`<v` $ Q`%P%L%%$O-MPP  `up. Q  up 夰@K   RQ wpp`P  up``Ѝ$$|$`$D$8$,$,$@-hX`@@PPzuPJ4@T@@A8#q#U#p@-@P4``PpVupT>"`P<`_C` p"""",H-u   P"G-MP -5LP. `P*  㾶PJ00P Q- q@pqApSڀ0  TdL<pU DD! pZ@$ЍG@&Ppp@T T PD @>P\ P Q [h\ P Q : H! DD1P >P  뤐P @@\PPPЍۍh@pT Dߍ ֍ 84TO]#ci aSQvtR\?@@\PH((.X(uI8u0H-@P * ||pP NP \PP>P00((0XtH(,htH- P @0O-$MS) C`@|50```0`  @qQV  q ZR*R ?R>p/Pd P4 .PbP_ X, TZ X/PW&[R! \R R %V  q *R$q *RV  p/^1 ^1 R  V 00 0  @.P  R pX T  X/R q/QT /-P T TV     @p^0A!A?oo2@|Y]Y8Qp@0V PP P\PpP_oR=p\Q /Q IQ 0V  pQ9 P-UV @@ @P\YP@U |0S$ SQp@V 00 00W V   rQ'pp @P@@ [^<p8p6Q pP//-pPp(pV  p@T 0  P/TP  p/P Pp$ЍMN@-@P PT T$P T 0P ?0H-@lPf<P X`<P >0T 0T 0a,O-MBp`@ 0 pPP u>`-Pc``PP `  0ppQ  تPM PPG p p  `  <    0@pp) X|PP1   0p~pp @  0cpP  `Z:p@@ `L@@` P ߍLFDDO-MBp`@ 0 3pPP u9>`-Pc``XPP `  0ppQ  JPM PPG p p  `  <    0@pp) XPP1   0pop @  0oP  `Z:p@@ `L@@`ᅯჯ P ߍDHBdBO-MBp`@ 0 oPP u=`-Pc``ʩPP `  0opQ  㼩PM PPG p p  `  <}    0@pop) X`PP1   0p\op @  0AoP  `Z:p@@ `L@@` P ߍA@,@p@-X`@P`R JP` RnP py p@-X`@P`R P` RnP py p@-X`@P`R 2P` RnP px   n\>MH-MPP@ 00 @ 0 @@@ @ T  @MР 0  00S QKHЍ/q\>MH-MPP@ 0 0@  @@@ @0T 00@MР0    R   QKHЍ/B=MH-M 0 00>)MH-M  0 MH-M  0 Q R /lO-,MJ @ (}P8Jif`< R :R|R  P :   $ p PJ\ @9P D9P p9X Xȭ: PX@ X p ,(  p 0p ,p 4hPJT P.DHP@ 4%(xPp dP PP <P ( P P P| Px Pt Pp Pl Ph Pd tP` `P\ LPX 8PT $PP PL PH PD P@ $: /b7 G P2(& $"  $(,048< @ DHLPTX@@%  Ἤ , 00pp 8p4 80pp 9` O`P* pPP$@Q,9"P$T *Ѝb@ Pd88880888h8p 9Ѝ !Ѝ00 'jp@-@P% `PV! ]4P @Q/Q /VtP1 R0r/S@@ T@L(P ;Pp`wKhH-@M04$ (8  zjp Q@Ѝ@Ѝp@-P`}@p T&Vjp Vj@U ppd @ip P@jjjUipk/g56-M Ѝp@-@ P` !LN5 !@ApA-  /o 0Q?o?#'S @c\" \ 0- (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#   A-  /o 0Q?o?#'S @c\# \ 0/  (CHSS!& c pb0BPcGp00SgwsQ`SU1EQ1"U S !0#    S&!B3 A 0 0/0S&!B3 A 0 0 Q/0K-   P/!?/o @SOoϠ?d'T @dQ Q  @/2 (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !   K-   P/!?/o @SOoϠ?d'T @dQ Q @/4  (DHTS@ & d pb0R`dp0@TWwtQPSV3Q3"V S@$0 #B! ` !     3 A   0 0/A0 3 A   0 0 Q/A0@ ZH-@ Cp? A@ ZH-@ 8p4@ ZH-@ p @ ZH-@ pPPH-6`g g?0/R//R/?0S/R/P/R/H-(2@-MP @T   .Ѝpp :@@ *<@P@@T0$ ogi|(tTP^ Q  hH-(6PHdhЛh00$O-M0ϟpW   帟  SpWx PUs @l%Uq@ P%EUPb0aX ( <dPl (   ,  T t   D @@pG@@TUy `D8h@ 1P 7P @1P 7P @0P 7P @0P 7P @0P 7P @0P 7P @0P 7P @0P ~7P @0P t7P~ $@0P j7Pv (@0P `7Pn ,@0P V7Pg Z pd `@0P ?7P  @{0P 57P @q0P +7P @g0P !7P @]0P 7P @S0P 7P @I0P 7P Y `p  0@ Q0! /S``6^  3:S3  0Lϟ p 5Qp UUr zUpG @  0@ Q!0`/SPP V``3 :S003`00L0Ap S   @pG@7T 0@ P<pM  `  ` 0@ Q!0`/SPP<V``3 :S003`00Lp ;Q n t `P` 0@ Q!0`/SPP>V``3 :S003`00Lp =Q H  `P:0@ QC 0/RPP6S003`:R  30 0FpA4Q-. `P0 @ R{ `P 0@ Q 0/RPPdS003`:R  30 p0FcQ 00@ SQ@n` lR0T: :T*0 A1P@T0U:9U0 A 0@ Q!0`/SPPV``3 :S003`00Lp Q   9 0@ P 0/RPP S003`:R`3  0Ap@ Qp0 0@ Q!0` /S  V``3P:SP3  0L Ap Rp0 C0I `@.P B5P @~.P 85  H P G  `P80`@ V/p` 00Fs Q1 FR0 %pr0c#tBwpp#4#11C 0r  0 @ RR p ` P?0 np 0@ P 0/RPPdS003`:R`3  0ApcPp P# @0Prdp@+0A/S=@!`0t#D$`0@ V:T@`  @V0A`@ T T. 0/RPPdS003`:R`3  0ApcPp-d! R P-0Rb/CaP 0'̌ S0U::U*0 AaP0 S0U:9U 0 AaP0 S0U:9U0 A R{p,0  p @$ `00C P d\\ pPU \!0C0@0S0 $ 0`0pC W @A P<P@pb P V  ᜛   0 Sʁ0@@EQd 7P / MR`0 TR RK @@@@CR0 R@ ` @; R2 0``@-Q 00@R @  R @ R @ `Q ` 00@ P*QA0A S *@0A  p $(L`AVN*MQM0a a0p$( ,($  p ̘      pȟ p  |R0 0``@i JQ- f 0B0S 0 B  pc'R2?d A;Q:.a'Q30\ a $( pIQ JQ*l ax  `   ⴰP pP@ P崯$(Pp zUl0g l2PQ  e2PL  @]2PF  V2P@ `h L2PB $ E2P= 0 @=2P7  62P1 @p+ *2P7 @f+ 2P/ x @@@DA.a p$(@@@A>a 0 $(p DԔ 0 p 0!aQg  Q, Q3> B)0GK/;!`lqp'qqpWQq ""q R3#40` # pA5q4 @@08#k0<_Rsb/%o^`dP`CpCa Cp! 2 P#WGaqg G  #SCq?1cqe B0GAQfkt"R3/>0pA )`G?Kk;6#@LsP%Q7sP0UQ>sp'r6sp0W034b4Pp`eA W B R:4 b0 G B0 % t0k ,_Qsb%o^`dP`BpBaBp,!WGaqgARB1/!bA "Qߍt Q3> B)0GK/;!`lqp'qqpWQq ""q R3 40p #`F QQ ̓$IB DlԨt [^ H  $ LA ? d0  O-M@<PTHPP% (( P p1 R 0Q1W䀟 Sp |* W 1  %Ph`at  G `HP:@TP1.PЍ|0? ? idD@-0M@ ޮP0Ѝ@-0M@ⸯP0ЍH-閯P H-K-0Mⴀ ,  @ @@BB000Q Q Q L` @{`0w`-, Q0Ѝt,0 RB/R/K-@T$ `+)PpPEV QG gPEQ G 0S  SQpp@-R 0@T@ 0R@B@Q2-O-M@`PTs-p=Pp!P8  p1 ( [ Z P P lpp P }  $= $ p ЍP @-MQRЍ@2&TP @PЍ- -@ЍO-uMMXp  W-@AP` (^@p7 @P:,/~@$E E堥启O㹯W dE`E\E0 0 K px  E匥pEE@PJWP@Puߍۍr T 0 P MH-M  0 ЍHЍ/MH-M 0 00iЍHЍ/G-MP@R `UYYWJL0P @ P 20p` aa`` % pUC, Y  p`X |P" `p Y{UiPLrЍ` Y R`P @-M@(P k "( 01/`p) p 0`VP <`V8+`p eP @`$ЍЀ`p@-M@(P # ( 01/`p, p 0`VP <`V+eP @` +T`ЍЀ0H-e ,Q' @T$ E ,Q0 Q  0 P Q P0& ("  PU* 0 ,P 4P 8P 0H0H-(P@PpM0H@- @@@M@ؑP0H-,@@ _MP0褑O-M  `P0V ` xQ9`p@ V `W%6p@ V P`pV 00 !.`0@0P080C?o2k#0PC` Y*U .VPp@ VЍV @ P  BPR P P  P  4  R  *4 8/ 0X\S 040:8 R РS /^ &xBH-P`@D @pcV  ᰄӺ p@-@P``* 0H-  |`V{Pa@<lD` `\Q`S S %QQ|Pr:|P Pm U 0AnSz`1 (08@HPX`0A%0-Qi ^Qe00 0`?Q`00S 0 00 00R  4q0000 3q0000 _3q`0`00 0  # WAq0 S S} d3q`0000 `z `P`P q` V0 Vp =V Pq0#SP)0q`;V_ 20000U 10A@,\, ^ |2010S0+D200WA%@00q`;`V`cT@SPQ^"PvpU# Pt@dT@dT 0A \Z ( &Q& Tpa``00 `"0Dq@ @>0A 10  =Q )`` " 00000        0 t P 4* ) ( T O- MP`U 7 p @  0 PV. `FPp(p(V `FPU P&. V `F<(@V D3(@ Ѝ0  00  Y8A-qPpW2 !=@EaV P $QPXLP+ V(!`41/P. V<  $P@`@`P= ^pWpQ 1/|tV@V X   0$PȹX@/>3<8Ԅ>A-qPpW1 @EaV P $QPXHP* V(㩓`01/P- V;  $P\@`@`PpWpQ 1/|tV@V X   0$PQX@迿(d$dbG-@Pa `"P\ qPpW  U` "= ,@ QU Zv$PC HP U' $ P1= zpWpQ 1/U(PP   1/P $@Z $81/P />38x4(XG-@P_ `"PZ qPpW  U` x @ QU Z#PB DP U& P0pWpQ 1/U(ㅒPP   ?1/P $@Z $81/P 꿿4|~<0~\~G-R`SPP 0/`p{G`V @@ P ×``@@T p P l``` `0`p`@ 0p@``P}Ļ̻Th||||K-R@SPP 0/``V ppGw P m``ppW `Fv P Xl`` `0`p```0p`  P@<|t|d,d{t{h{\{O-MMP `Q 㚑P P/P P c%_% zWpv P PPj ``p/P PZ @@/QQ.P`T T.P  PX P/  WpC  P /Q P J P [ { P/P PB  e ,VP$J @Po   P2 p np'p/P  P [ /. ᑖ Ѝۍ$? [/ $e$>b$?_p@-P Q @Vp@p ߐ@TC Vpp$9$"P/㒔PP- VppȔ$"P ご`P Vppȃ$"Pp@P Vp#@pp@-PE `\≐H\E 88 Q,  Q' P:Q0`Q 0@@CQ PP@\Q@:Q`VQ`C`Qp@P ҕ00  p$ pD,$X8, p@-V" 0S P:S`@T V P 0`@TVET@V :RV :Vp@PppH-M0  0ЍO-LMM(tt` W0H4W XPU p@ R 0S Q:Q |Q T @DQ:Q @|Qp ÏP4 0S 4@ ,VJ 0q'HP  0FPr T`VJ$4HPp(0`KpU:H+{T@P`HP P1W Y4 ppQ 4#Q 4p$ 0S @ T  R:RU |RS QA R :R |Rp$0`0`0`W9P P P :P \PpY p p,[:4`,@KPK ,K40`(PU -TtY $`@0SW4圔`% %$0`, P @L 4@,( @P 씟t4@ P p@:PtPP  0PSR@S@Rn =R @R @Rf @:R  RD@H 0$H@Z zz$:dZ  G B 0S:S 0APpQ:W:,$P AR $p0`4`P PApEP ,D@E$P4A0`p G0 @  @0@@ @(4P,pP cS WJh"P  @Г"  W," XN "@4当"@D`4巓p@p@8P pD 07/p P 8p@T <@p@1/H! #PPP  1/p#Doᠢ  1/!   HP LЍۍqh( @P 0R!@(P R4VX  Q(P 0R@J <rx Hptl 8 p /0kH-0 R ^  R:R |R S 0C R:R 0|R 0H-PX@P eD888  00000H<$ H-LP H<000 0 000ȨO-$MMܳ CP@ # 笓嬃s pR P |P 0SL l# [ P   AQ 830 000@:R#R'P\@o" R`PU P"  P ɳP P Q R  R\R    ` Qv pAQ\Q  PQPU :Q ѳP 嘱 J`D:~\  P6Da B `00S :S|SB0PP P V`L` P$Ѝۍl 8,ħ($ 4 إ dK-@PP `@:P 0S R p  0SR@GS@R =Rp@W dd`P P]W\W P:P| 0Q-0@ 00Sd 0@00S_0@@pp ^W P:Pb p@W:W\ @p`V PEd ᩏPe Pd`p]WB@@2QE p:p@ppp p p p pp EV Z  FP  K-@PPE `@:P 0S R p  0SR@GS@R. =Rp@W) dd`MP P@ p`V PEd P Pd`pW:W EV   P  ᯐp@-0S> P:S0`V S P @0`VSEV@S' #S0@S! 0S xP0P/`0@E T:a@EV`T:A@E6`T`V`#0pO-MMp$ P @P( /S P,D 0t  b4 `IwbKP``$pN4 ($@VQ:QL@`P@F` P$ nO jO eO=K$N ;ZK$N/0 K,D$N `Y W wOBP @PFLdL:P `  P ̀ `AР Bp >O($:P4 ~ 4P  P<$PK v ^o^e H-  .T MH-MPP@ 0 0@  @@@ @0T 00@MР0    R0 N QKHЍ/jL O-$M`xxrp ` TP"  0 `币CPP U: @ P  E p  p AP\ qp X#p &Q!&H@v00 mP"3q"  Q$ЍE8 P9$ P2 @P QX" 0# " !  P PHP  P** H "[ ,pp P $Ѝ[| H0 Z ̲ x H-8kA, ,  X@-M$@;0@03P@Ѝh@ /  + A! 0  /= @ /  + A! 0  /=@ /  + A! 0  /= A@ /  + A! 0  /=@-0M@Q 0  !   0 T PT ,0 0#0ЍH- M ^MP ЍH- M NMP ЍH-M >MЍ cN jN0bNG-MⰀp@`PA$Q Q̞OdQ`Q\Qqpq@t 0Pa!Qލ똻 8/K-rMⰀ` pP@qAA噞Ož\AXATAxahaPD|l@0Z 0-!QrߍȺ l p@-P@` ( 0@ p茺 H-`@Ppu  0@ O-MP p0Q@( 4<T<`VU  %@P Q AQP Pp%Vp`0 p`WzP)!l $4x,8DP00@py`pv`ps lkpkkphjpejpbpPPvVA$Q AQP =P%`    <    <<尀 < 00@,0 R P0ެP l00g`00 `@m00`@i@-^[ 00@ `[ p)$8$8- , p-Q*-$][ ,oO `@PJpp W  pwp poP8-Q ]Q$ 00@0000i@ 00i@00@00i@ 4P6P I u nP; @PP~0 R 2  {WE ~ O-Mp- P@P0`PX  IPR0`puW  P:A  RQ8@<BP+@W  ᷄P( `  ; 0@ pR ـP   JPJЍ4 0H-@PX O}@0@-M0$ @ 4/P @w@Ѝ@-M <$ 0@04/P @b@ЍL @-M $ 0$@00 04/P @K@Ѝ@-M D0$ @$@0 04/P @3@Ѝ蔜 @-M $ 0(@00 04/P @@Ѝ@-M D0$ @(@0 04/P @@Ѝ؛ @-M $ 04@00 04/P @@Ѝ@-M D0$ @4@0 04/P @@Ѝ K-M<&`;@RDP P P P "P@\d$P` ` `X @ P! 6/P X@ P `["0tp @tp`Z:sp @sp @`㊲(t`Z PW p$0Q+* @l KpRp( ⩉@P W Pg*   PptN QZ* 0Q:  PN*!p p QC* p5 4P0*00 Q2* (P *   Q%* P# `?Pz  ` `U !   >P g `$`  `Ѝp P/  P/  P/Р@` 0`\P8H`.U ]P`U .U^PU P`L\ZPLp؃ #"@+*P` ```A-`$P@P*( *p p P $T @@T(0 U@ U 0Q0p@-@P  (=LQJPUP}LpP}P P}UP }~},=P`p `<o}V P`pf}pA-`PVA ,@ = %P P P R P, P%R+PAP&@ @ 0Dp"0'5P  0 P f P$U RPU4 }LPH P`U #3 0Wb (r<P p|WP P, P|Lp] , LP\ c20 U,4=P`0\`, /!P P]Q p[ 0 P ,P|UPPG-` ;p(& m| PP@,B<P=P%,6(<P2 `(; `, , $ ;p(" cP0 , @/Q/0 \ -P(;$PPc $>꠾ȽH-M,`0@pPro;Pp$ <`p 8  "! @  "!f<`- t( @_;$ @`ЍO-DMp, P@MP `T@ ,QH  Do᠂Z @@P <,,Ty $sDo᠂@ 0P P $  ,<, <,   @,0@/Q/  @ Lp0 P4$@  K@p 0 `@P@ P ,  .Q) P@` (puP p\  TX  8@4`0@0 @ P$ @!Q .QQ     HyP @T  ,$$@I0@P `8L ,P,Q <P  $/<Q QP, ,   0 $ r<QP& <@<[Y (@pWp @ )pP" Q  \0R 0  B   RLQJ  \0R 0  B   R Lq , $0 4`CT0V0R TP5WT LP2 00 DP!(PT"   DЍOk ?z8 `P p8zWp{@P, , DЍ,:P`}H-R:c%A-@  Vp`OPP-2P P-P PyU W, ,LP/P ,t PJ9p pR:`S9VPPP8p@-d`@`P (弊PP (岊(尊(yyp@)9j   Hk K-(M q`pP @P p; ;$A 0  ኳ P"% (ЍAQ 8@LP$ 0K $ (Ѝ ,j ` R/R  /00i O-MP@R D "P |pXsЍ`P+V -V `0V  p0VpTp xP0@ Qa@"Q#O*p`? P0w@I" 08 0`0PF/ U:aPFVU:APF6UPSJ0Z0: 0!`"0 PP7e!`"/0P`S`q p`pX SЍA@Qmp@-@M@ P`   0{P @ЍpP  0`|@Ѝp0H-P7@t  !P0P8P0p@-P`7@t  PpP7PpG-MMd`p 0r@P# 8  P rP(( >P 8PJ  P  pyPp Q p$p>P PiPgPP ((x xxZ@PPЍۍnfse d 0H-M P8@p   P  m7p  @3Ѝ0O-Mp`$;@ KP W  PP@@rP V PP p p`P`&Y P uP: `E 0  $8p `FPPP w 0ePPpP 76` p  P\`   pL@ p` Z*` pp W * IQ  Tq`Tq@P`(0 07`V `V P P  QQw` GPP$PCЍ` 0H-@ w P PwU 0 O-LMRD0>LЍ Q 0UqP X@<&i$ @XO  @TJ $p PXp D0`3/P  Y$ PpVH  `aQ $`pHH@Pp D0 3/P<0  S$`H P@Z<@HTPp D0 3/P<0  S$`H PpZ<pHWPp D0 3/P<0  S$`H P@Z<XH PU*P p D04 3/T$`HPpP@@Ég@8"  Y$PpHV$p D0`3/P I @$X*Y*P@p D0`3/PQ H`PV:8U"$`HP  X* A < Q0X H0A@VA Y$*$p D0P 3/P$ I < 0Q R0A< PQ:HP $< 0`Q R0A`< Q:$`Yx:p D0  3/P4np  < P_ pi8 (p PR PU  @0"  PR  P @`X0A3RX4`*RpP, @D`F V3X3 V1*D0 3/P4 H8ppP Y@s*Pp D0 3/HPN pዐ Yd* p W8*D0 3/HP} p Wz*D0  3/HPr p Wo*D0  3/HPg p Wd*D0  3/HP\ p WY*D0  3/HPQ p WN*D0  3/H P4 E<D[[8 P@p :/H P<pѫP: p0H^b0 *bH-P@b`P  >NbP paP P `P  H/`P H`0H-P@aP P P`P 0H`00Hap@-MP@`P `aP P ,00 bЍpЍp H-p@`P P`P aP `P `P H}` R R R#0!/ R R / /   /00 //   / / / / @-?/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/0H-PP! 0@T 0\\ 0@PU @U S000O-MM(Z`pPQ00PߍڍKP*\*X t`P`[Z\Q:XZ^pY iYi# XZu(q0  %@TJ P T*0S; (I PRJ P Z0: Q:XZPQQ Qj QQ~: 0S ( p[q'p BPh X`2I Z' p/0P8q||`2 0LP p! P0"'00p @ᲇp P P20 t&w00p 㜇 PVpP Q:`&6 0 ဇ P`J P^*P&P6@pI 0p PPOJWM & 6@pG 0_ PP>JW<%5@pG 0N PP-JW+%5@pG 0= PPJWl%l5@pG 0, PP JW 0%05@pG 0 PPJW$4 0@G PPJpTpp[ `@` H4Z@$00  pPJYI`p [f0pSa #? Ip s0φP|J P PO:x0 o 0(S`2PP P%0"R0p0P01P PP P p PP0 Q0P0^pY 0*000 0  @+PP' @pP P =PpS@[A0  0PPp PpX YpPW W WEp[9   0]pPPp!0  0  @"PJp P:p0 <`YP 0oP Qp pP0 P  0XPP p|$ z` J}! | ٶea\ k_T ջ  M  L ź  G-1MX@P C/< XP C$`Z=pC 0S 0@P P P  `&`$ P P @P Z0p  @P P  %` ` P1ލ& O-GMȡp` @P  W pQ P PV P@V @P5wp  0" p0 P 0S:pp PY Y `W0P  TPGߍt H-M`PPJp@P Q R 0S R p@@=pЍ0H-@P UP0P#/ 0H-@ad@U PP Yd0O-Mo@p8`PHE. U<@Dp@8PF 8PPPP! Hp@T @Po`d@W pP d@Po` Rߍ/80S  8 QP" =p PP   R 0Sp 0 `cs 0S1fcQpSP 4P  ` PD@H0 P4ሏ qڀ0 a< Q;Q  Q P   P0 S p SRP`U p UVPHpSR UV`<@Q1 D 0rPD.Q QP PE  uiPJP [P `0@P8> `ip @P H 7谝pp@W2 H`V/P[pPP' Q @@TaQ@Ia# R R RUQPQOP K 3a,  < 8X' @<0偲 @Du8@P P?  ( ",  +!A$䐝Y& S Y p<`,P @00Pp@U*P  RP pqʀ0PD P4 UkU #Nq 0A H0! Z!PvJ# ` PnJ4@ p5!pd\(P$` p \C4<< ( " 4 +!A$䰝['  P [ p<`,P @\ Pp@U*Q 0 0SQ q rʁQD4`\ \ p 0p 0 BP@P4 0pR  | @ P PP($` PPN# >N$ P 4 10@P0 , PU _PP Q @@_Q _P0@@_Q UM _JPHIi    ƩH H >ml @-@ w]Pt  @ H-P P R  R' R R.Q*/0S  PPQ R#p R QR RQQ Rp@-@0T S p S0P `V \ \ TS^ R8 R0SBP0U S @0@PU S P0= S SVJ V \J\000S ```SP pD D0S0 S@T D@D0SD0D R^0 S D0DPU S K-MQL @`PpPD PP9*P   E P P PYJY'yP 0SS 0rP X QQ P PPЍ&yZO-\MM0X0p 0 p 0000 0$0(0,0@`Tll@Pp X*0oFPj X*0eFP` #P P P [ pp P P P YP  |P8 840P4PU ppW  VP]PW pP ]@Z  `ZzZT 4 ,Q@X Q\ЍڍӖR oh O-Mp W  PP @@@ D`PP PVZP: 8tplhd`\XX@P3 XH 0WX@P' 00 f PJ !  0fP t@P@T^X@ Y]P$ H 0#P 0l 3 PJ !  03P 1]d1St@*Xx@d1#^*t R qZ?[X` P @P R P P `t@mTLTPF 0000000p0l0h0d0`0\0X000X  S S S&0pd00 `0\Xp00p0pX  0@Px@|@@@@@@< dQU*@7$HY@T3 @Ѝxp,dQ%Y*P Z[O 0p00P `V`0P`0S ,@@TY@Q507Ѝ螜%U–\. K-XM,P_P @p8pP H`W@$" 0{ PW  PJʅPW=U Q Q Q $$ 1Q  0`$R $X4* +Q:W)P 0@.P!pWp S{  YPPa`(@ 0  PP LPpP`v lW`$0p,Q 0  PLP ZZ$P SW x`P`(@ JWD``(@ ZZPXPWߍۍ fӎ d O-4MM,@Q0s @P$ ( z , 00 `PN 0 8p`P=  0  8 `P.0 0p(  !$PU!0 #"(p0|?  /r `VL0P4Ѝ؍ `V$P`2d l O-wM MLp @ Q@@@@@@@@i`Q Q RQ !QNi`PupP&  0 H{UPJL 6/P 4`&!  f , PU U  D`@PU%HY"*PE P U!U !UY U,@ (0wPA &% 0a(D`EP ) @p;`8`T%$0% aD`0 (UQ D`p@UEQC  DU(AU>U <HP! 0PTPJ`L !aTP !N P RP  !@+(D` V P ` `RUPi W" %^ P0 Sc T U^0U^U $RR RQ TUN  , U` ``t``VP U  `p0` P !`Z P(Zo pPpH   @1D`VA PQg ر@P PL `PdPhPT0PPP帠PP\XP pP P P WY `찟W $,  @Q R1T@ <@@$T@@Pwߍ ۍWT@ M  Մ|&  H-_@- @o0 /o0@ QA0C3S 0 3 .0\0 0.P P .Q R0O-LMp(p,p0p4p8p?p㠑@piW   )P* @pP: D O-M B T0$p`P@pdh|p @R T  (X080 0 0 8\p`` b*Dp0p0p0xPL07ppPphXd,pguPPDX@h P P Xl4 b*0P0P0Wp(07pPpPpWtpgppw<xἎ  '|Pa*0 0OA)A7ppHw`0au`P `` W匀`\`  ` f0 bj@0@0F 0Gp00p0v 08pc5PpPpPv`4P]p`p`pv@L`kp@p@Pv0@@dIp0p00vPP0c6pPpPv` P]p`p`u@< `kp@p@u0H@dIp0p0uP0c6pPpPu`DP]p`p`pu@`kp@p@Pu0@dIp0p00uP0c6pPpPu`HP]p`p`t@`kp@p@t0@dIp0p0tP0c6p#' PaP'`Pd@8PZ`!`&@ld0 @dH`%`&0PdLp04`$`&4dPa`#`&Pd@PZ`!`&@c0H@dH`%`&0c04`$`&cPDa`#`&Pc@PPZ`!`&@c0@dH`%`&0tc 04`$`&XcPa`#`&P@c@PZ`!`&@(c0@dH`%`&0cs04```&bP a```&Pb BPe[```&  4`(@@0@$0B`05@@@$appp'p`b w P"PJ`V PPU pW PZPPZUUPPЍid 0H-@  "0P(P0P~P(P,PzPp P P/P  88qP  00dc@-@     塛  0H-M@ PP08P P0P 8   0MFPP0Ѝ0K-@0`P\ PPU p P Pp`PH `4q `Pq  MP4 P% ``Ԑ pp P P P @X   NP q cP ``PPl0H- @     O0PPPO(0PO(P,P00H-P@ U 0A-M@ P( -`F PCp`0mO 0 8   0pEP0, 6P& P "p  $ $ 0`P $ 0$```ЍO-MP p`@ ,(Q*XMP (,p (`W:qqW  Q:0 0 0S G@LC@@Ѝ `Q V:pP, pV `9 ` `pW* W:@V  P   P !O-,M@l(0 VPHJ(IPD P,(0 nVPkJ( @$PPh  0Q^*0S0S S0  0p `C``S`p0∰R 0S 0 p` `@F@@V@`@   `PFPPVPp  0pCppSp `@F@@V@ `PFPPV@P p  Q $}HP BP(PP$` @(@T*PP, P   ἐp P ᝰ @PPG  P刀 PY Pt    P   A  Q p  @pPp  @P  S p   @pPp  ? P   @pPp  * b$ $`UM KP* LM ,Ѝ xAMH-M@ p/ `p PU u  0@@ @`p w <00 @P @ЍO-M(Q:px P`ᔶP A@Ѝ<(bG @$Z  $ (*PR,"P(P-Q(  KQXᐋ ` pP:P P!*LPY& Y P1 3P1A2P1A2P1A2PP` US @ 0U08`PEU8PPE9P R R P1 3P1A2P1A2P1A2PP` US@0U4:`PEU:PPE;PkT$  /@- @T ,@T  T  Q*! @ Q*  Q:@Q A G-MP$PU (@0 y 4@: dI`J0;p62A@A4"0$372'- A@J0IR@ 0 R 0 "00008 090`@61@R ,0S SQ*#Q*Q: QЍ0 0AЍ@-0@S 3/@KH-Lß) QN: @p`P p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T( QO: @ p`P`Ef&PpGt'P B&"P`F"f&PpGx'P B""P`F&`pG' P B'" @D T,@  T: T T     MT/: DR@!(  ̌ Ȍ Č 6@  T :@! !0$  'T:! !@   DR@!(    T  ! N  L$"pA!p@! p B("pA!p@ p B%"pA!y7\ LO-lM0@< R!pIXTP8@PdPH  0miH`_ /| ?0H-M@TT T TPP$T T PPPPPPdPPt   2H$P TPP4P40P0 @ Ѝ0U:.X8^>* ?0H-@F TLT`D?QrR P0T  TA  TB  TX0"T= T> T80T:  T 0 T6  T0 T2 T0T01\ G000000000p0P0H0H0K=jL=>=R==iT<<<<<]<_<<<~<'<B=0H-@Y\ p0 BG00Mp@-8M`HP`@I4@PH .07d00. @U PE tV04P8Ѝp@Ѝ/)}@ ;O-MP`PP@p0 RQS QS 0@-T@0+T@0@ P.T )P@pQ10p0PC00A.T@pp @ p!p5 p @ !.Bd0X#"0 p0@` Q *PP@00@`UP:A) Q 3V Q*``@V 0 30@ V`:AR 0P @0P1`0`00C@d`.UP`` Q ``e   @ Q  P*n P „ `V  30@PV:IU V * Y 0 30@ Y:@R  0@.T P+ @0@1``00Ad.TP`` P ``x ` !.B!.AP` Q  P* P P@T  30@`T:EV T *PU 0 30@ UP:@R  0p.W p% @60p1``00Ad.Wp`` p `` !.ApP@ Q  P*p P B )T)P)\` $ 8 |`+ ++d PP@  `  0pЍ h O- (40`00pppPq@p`0pG`rg``p@@@ @PAp@`0@D``R PP@ BEPF2U<`q prgqoq' 2U c prg|`qbFaq& G2UX`QpTTTTTTTTXTTTTXTTTTTTTTTTTTTTTTTTTTTTTTXTTTTXTTTp PR q`p0F` `.UPu``( `dPpp`e PPBpp@  @ iPaT`p pP0EP E`PP@ 4 `PP@.@` O-lMD Q@@R l   Ͱh   c!51 B(4r 0! c51Aq(Rd `Ad`\ X TP LHD  @<.p 0C a@\p) b%!AqbdP@Gz p 0C a@p* bd%!AqRd`@$zp 0Czp`W4Z Y ,<0@ D!HϠ0R0PQb$ 0C(01L001P T 0Xp1 0cEPW@#o  C @!bU`F(VFWobUaFaQA: \h0`0d0q!aN0PS00@7SR?2c1@P@SRR/"bQ@ RABj/P/CY <@Z 8@W 4@lЍQigMbsEYJN,0\y/.^']G+@-@P 0 .SP Q0* B/o"0 AP P.PK- MPP7P0 ?;@@04 P_ `?`P% Ѝ*H-M@Pt^PK n^xaP`F tf^PB ``^P> LZ^P: 8T^P6 $N^P2  %`pP,$ pp y&`PV3opP $0<H`pTpvЍ:?w 6$x (< "g!!H-M`@P]P( Q PpP pp #&PP U3opPpTpuЍw J* p@-P@2Pu`Pu` V P``㕾p 0R0p0Rp \ 0 /`0H-M@tP 0Q 9PaЍ00H-Q  Q  P@@PP P0@@)P0~ ~ x~ l~ ~ @-@@p $,X0@} X } 0H-P<@p ,00H0t} H} p@-`@@Pp  0p@p} | H-M`p@P|p 0@<8 40 p< 0Ѝ:Ѝ| P| h| H-M`lp@PRp p8 0Ѝ:Ѝ| { { /{ /{ t{ H-M`Tp@P p p( 0ЍЍL{ { 1z H-M`lp@Pp p8 0]ЍZ:Ѝz |z z H-M`tp@Pp ,(p< 0Ѝ5:Ѝ@z y z H-M0  0Ѝy H-<p H:y ly  0 ;u,y G- MPD`tP@@, P    H0 Pp@ ЍO-M MpPK⨻⤛ +P$ d PT  D p p|`P `Y  jP#P `\P P .PP`FP VP Vl*  p p@DKYP{P.P TT p pTP.@DK`{V4*T:f   @;P;k0C;0; );S*K {!T p p D T D   { {K  PJ吻`G  @ ?+ 0d @p P+ +  + A p਻Pkp3& V:`  @;P;{@KpG{ ;S*yk 㨻V    +A${o `@P@|%%%,hD ,hhH%p %)h%%$%hP%%%l*p  %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%D %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%("    / 0 PpJ  @k.P P P`V`FW\: 7d >0+ @TP PD+    +A@  / ?P,J|o`+ +R     +A Q P / ? PJ@W: $7@ p 7`  ?0+ d `@` P+  '  +A@3@{P: 6C?+ 0d `P P+L    +A` 60?0d P P+L  ӿ`  +A` 6d ?0jP PZ+  ᮿ 0  +A `   / `P?J> P:K SP  P-:  ␿ +A  W:` B6P + p+ ?0+ d @ P+  O> P +AP : K@pPJP+  P:  t +A  (y  d `?0+ @ P+\    +A` d @?0@ P+\  `  +A`  5d ?0wP Pg+  Ế  +A` @T _+lPd 0Np P>  @D⑾T  +A   @  P*Ln O  p_`    +A P* 0P J  P * P   `O _ / 0P@ P J P     +A P@/N@ QW: 4d P?0+ P@ P +    +AP p P4  Y t$?+ 0d P`|P Pl +  W  +A`( +\  d  0X` PH   ᜽pW  +A   P- :0Pn@ p`  |p P  7P JP P P  e  +A$ Q!* 럎 O _P :@ ` p ; P J$  Q:P :\ Wyl/ K1R/0 SP PJP P :   +A _W p  d `>0+ P P +    +A` `VvP J! P* pPpPb\XTP Ἴ+;H*{+V;B     / 0] P< J P5     +A  N3 G3 K ?3 9 K   / ? P J  W: 3d ?0+ @P P +  . `  0 +A @O _ /W:;+)K>+{B0 + d {P@ P +  $  +AP  P "*쭟 +\@pN=+ 0Pd w@ Pg +  ỻ  +APWW;+8)Kᕿ +A  i2@  b2P +?0(( @/@ P (  s  +AP t(K1R/0 S[U :K S E    / 0 P J$ Qp*倰+\   Q 7 Dp  p@W+ P   d 0` P     +AY    $Q: q `O _ / 0P@ P~ J Pw    0  +A /P@ P` J PY     +A KQt1+ Q+7 ✏+?A p`p`+0+ d .@ P +  rT  +A`k{)*W:d  @;P;KP[PD[ ";S*{ k P@ M     / 0 P J KQ[!d0R1@C〠+\` d 0p P     +AT- ` ꫪ m W: 0P  02 @?0PP`P Ps P  ǹ  +A` / ?  P\ J[ +R O :    +A / ?  P8 J7 +R + :    +A _ o  0 P J +R  :   0  +A /`VUUU      / 0 PJ P  `  +A` /P?+ 0d @ P+\    +A` /*?0d P P+L  p  +Ap /P  /`  /d ?0`i@ PY+  ᭸  +ApmWH: q/@  j/P  c/2 ?0P0@1P P!P  u 0  +A @   /'PZyW(*o`?+WKC0+ d ` P P+  7  +A` P*<$p4? d 0 `K[ [ 95XPP`X @  ,5@`U `F P   @  P +A[@C P) .V  +A@˞⬫*Zp:.f@PP+0; B+@Q*WZY    +A@? d 0P [X0@$0  SPP .``0S Pu`VZ.`@$ `@Q    t  +A  P ;:  @(  @ۿ嬫 K uP@ 4>@ PP  @  +AmWv*o p` d `?0+ @ P+\    +A` d $?0 @ P+  p  +Ap  P * @+\d 0 ` Px  ̶  +Ap P : p Q HTZy:@ pR ^pP g PJP P?:  d +A {$ P*d 0@& ` P  jpG  +A爀@  W Pt.@ p pZ|Կ Pp /@ P   10U ` +A 0`P  0p 0PE +AZ6aZMԿ Pp @ P   0U ` +A 0`P  ߵ0p 0PE +AZZ Pq:   +A?P+ 0P PV:)   +AZk:Zh:?0+ d `B P P2+L  ᅵ  +A` d >0 P P+L  b`  +A` d ?0 P P+  ?  +A` PP   |  P:.   +An p`H P-   +A$ 3P+  P ϟ ++ 0;A+`P[0D==p=Su*P[0So@!< !  ! @!  !$#       " s @!  !$#      @ "$"      V @!  !$#      @ "$"   @  #   "!    ! 0' u.f @!  !$#      @ "$"   @  #   "!   @ !"      *KT*Р+Z@D[KJS+K:*P[0CSKHo@`ZD, Pp @ P   0U ` +A 0`P  0p 0PE +AZZ  Pt:  A o p Q*Q]: +; +A /  / 0`P [psP 3 p@0H-P @PP :Q EP \0/0H-PQ& RR0H-P^ PA@?PYPP\P\\\P\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0P  TT P @0跱00H-P @PP  D`P @00   O-M-MP@`t@u) p@`P P P P p p p |@x@:&Bo` T`P@4  ! +W4 v< f@ / !  W@,T <  vo+,Rj@/` <  X`P   ! W4/5vGfb |p! P  +W/ `V/4V: x &" B@OPpL`N\^NlpW DP9 6 P4 4,DP. 4,DP),& #x|4jP:PP@gP gPTʛPP8P_ Y <4P |jP*RBk@x ( 1 x|#Y' Q8`k !:BjfQ`c1<0x S `R'620CPr x|4T 4DPk fp"x qx 4|<Q jP*7P9Q 1Y/xP|<Q jP4` x xYH <P\ |4 jPV@j @ N 4 dd d dd<P o 0 !  Q"04,DPLd K f`"|  @  |x8@pPxSP <P |4 jP@j @ @x|4 0 4 4@ 1@  |xY$4 ?xI2fP f$P4L P9|| F A-P@pW `P P ۨPA-Pi`fV)bP- ^P1  QQ 0`p@Wp@T p @TrBTr2S QXX X0 0CODD D0 0DG00 00 0E?ܠ#"ڠ%0 0 ɖ0H-P@P P Q080QQ R:0088 80 0e$$ $0 0fpP@-@! oO- Rc p@`0S00CSSP1DDDDDDDDDDDDDDDDDDDDDDDDDDW.p!W)0V S$`pWpW0T S@pWp p R[Z^\H-Qg 0P*r-w--xR  0vS-S rS  wS xS S //H-\:.  P/P/ Q Q/@-@P ქAQ @ R RP///o@o"/ /o@o"/H-/RR 0 0p녜ĜΜH-4 /RR 0 0p9xP/P PQ/Q /H- AR*Q *QQ 0 0py›H-PQ0H- P @ ㋢PwPuP qP%mP@0p@-MP@ AP l`X`VP ЍpQЍpP/0H-@P QQ P:PPU:0HH-`V p@PኦP p`VO-M[# Pp@arP @[X  P*K! !@PK Ѝ0H-MMdd@ddPRP  @P#  @@pT OG/()H-0 G-M pPdpKXBX`@`哚PA`` AB+Q8 `````R000!01U0P0 PP0  0 S 0 Pp$ > @ 40 0"TPލR룣   ,S-@ܖ1 <   0 KH-\$ (xLd(3Ơ* 3&!%  G-0MPR   `$0 0S P+ Q$ (xL`( 0 3vq:& 3&!%   0Ѝ\*H* Q A a Q1 A/3` Q3 A/0H-P 0 @PU @UR00000( O-Mp@PR D P"PTX]`P+V -V `0V p0VpTp xP0@ Qa@"Q#;*Pp`@PE"  `00F/ S:a0FVS:A0F6S P RJQ Pʑ! `0R`SX RЍЍA@Q004 O-M`PpR E"P צ XЍ@rP+T -T @0T `0T`U` xP0@ Qa@"Q#o*`@P?U  p 0ݡUK[ [ @pI" ꂦ!@0PD/0 U:aPDV0U:APD60U.0S+QJQ X P" S @T "/P  P" SO! @T "Q/@X QppЍA@Q{L rQJQ H-Q MH-M  OЍH Ѝ/G-Pܖ0@EQ`V jcP+`pPVPt  yP F  q@TP@F e  @Z p@-@P Q@ <`8U  r9 p@ֻ p@-P@yPu`Pu` V P9`ܖp@-@[ `@˖H-M?   ЍG-MpP0別P @   0P `፥  0 PქЍ`ЍO-KMC`Xp@V( V@@TT=C@y4/r.` @P P( P7 pW) @ 0 WPpp_oRWWUPU @ U@@ U@U @U UQpPPpW @ÒP @PPPЍㄈ@p@-P0`0GF p 0Ap@@@ (TP$pH-M  2/Ѝ/0H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ0 R/R R/  / / R/R R/  / /0H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ00H-M@PQ Q Q 2/P PP 2/P PЍ0Ѝ00H-M@PQ Q Q 2/P PP 2/P PЍ0Ѝ00H-MP@Q Q Q 0R  3/@  2/P P@Ѝ00H-MP@Q Q Q 0 3/@  2/P @Ѝ0p@-@R' P``fP P P03/P V 0P  03/P V  0  p@/@pK-M@p`PP P Pt 2/Pm  2/Pa `VpP['pP, P" PSpVP XP@   03/  bP* R: 03/p!pX/ *pV'  03/  bpP pR  0l3/ppXPW  }pppЍ93Id ;pH-MP`@pP P P) 2/P"  2/P  R Q  R 0S R 2/ЍЍO-MP`U @UYX ۏ@pU U UH @ 2/oP D  2/P6 @P9 T7PU U- U0- pPYPPH ppT kP P P+  03/P# [ p pЍ  03/P [ | 0 3/U P pZ pp p;p5El/*dH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`ЍH-M@`P+ PP P P 2/P  2/`` p 2/`P  2/P`Ѝ@-M@000P.QЍ@-M@pAЍ\/. 0A0CS00B" S#:0 .R .S .\\ 0A0CS:-R00B S/\//\I *\' RD .R"\/. \9 0 .R .S.\\0A0CS:00B S:'0A0CS:-R00B S. \ 0 .R .S.\\0A0CS:00B S:0A0CS:-R00B S/ R: !B]Q0S.R P \ " /o2! @^R : /\ . 0A0CS00A" S#:0 .Q .S .\\ 0A0CS:-Q00A S/ \ //Q/!A^Q#/!  /  / p/ 0(/ $ / $ 8 ̠ 0/O-MQ p\P Q*0 @ P P*.000@@P PAS01P!0P*@P0AQY YcY !P*@`pY: P $PJ`EUpPGPP` ! ~S p@"0D:SG`10S\*@PAQD!0D^S:0SO*)Pcf`51&VაDd0 ey0&fPD0uPd\PP`E0@P3*@ P|`  YP$J`p PPJ@p \P pQ PR .P* @Ѝ苐(Ѝ腐\[xҋz8;0O-M@ 0`pW  \W .W9  [* R Q.R @[W+  P sQp P PQ ` P Ed @ F!p W`` X*p@]}P LQxQp   QP2(@ U1*@0/R# ]R* PbS````  P0R| z ^x@ T" @` Vh* Uf* 0pS P[  `Q]QST(@ Q U1I*P Q@@0 @ ;A@.P- P2  [ *P X*P @ Q(Ѝ RЍQ X* H Q@(@n@k؋ t A-R8P0U9  0 PU. U'*PP`@V VAU`PQV!P`V*UPPE`Upw`VJ@@@@@`'(C t H-MPЍO-MRD:pR@* 0PU@ 8 G  @ i` P @PAU(0`aP!`0[0Z1*P d  Q*?0 0P `T@@XPUˎ(@ @ <00P0 B  T @A@ЍO-,M`S PY 0SPP  0S*p@WpAS@pqT!pp P SP@ P@(TYTpQX @QUAPT qP!pMpZ]*@0@D>Q Z:h0@D?P* C P $`pW?  RW4$R$p$ALPAK 2^ 2 [p R$ PR@PJAp P.*@ ᓅ(`W @(p pPP Q* H P(P}  ( u@p XY(,ЍH,Ѝ P*!H,ЍA-Ml`@P`0 100 0Pp (!P *pPP Pލn8 H-BMhp`@Pp 0&p  0!QBߍO8똁 Q*0S/S*Q://0H-0S* @T P0S:@U R*AT 0PS!0S:U0S](00S00H- Q 0S AQ:Q B@=(G-@pTWo᠂P` P0 P1*T`P KP@pTW (H-@QSP`p R +PpGP`W@A-PA@T  QQ*݌(Ap`PJPQ`@Ɍ?@-Q 0S  AQ:Q @(@㭌@ MH-M  $ЍH Ѝ/@-M@ p TЍЍH-R 0Sb 00S0 0s 00p} O-M`P@R E @"PfXЍpP+W -W p0W `0W`U` xP0@ Qa@"Q#M*@`pQZQSZPEUP@@D""p00G/ S:a0GV S:A0G6 S RQJZ PRʐ& PR@pX QЍA@QtG-M⤀pP`@Q$A AOT |x 0dA`A\Aqpqp@!Qލ{6z K-rM⤀` @PpAqqYOX\qXqtTqxaha|p8Z 0^hp!QrߍM6y y MG-sMⴀp@P{`1A$a a&OO\ |x 0da`a\aqpq,p`!QsߍGЍ/6y MK-M⸀`P@p!1Q$q q O`dq`q|\qapax@ 0pp!QލKЍ/5@) G?+;2#mps Q"!'p0#2n0pP<| r p1Rp P Y:D P@! P堰gQ VQ, Hp!0   Y *P p [PE5P Y: P Y: )@P"d 0Aspg@G'v Cr r 0\ Fp`灁 Q H ` P R 0SR( 0S%⚏ Qp aW``aPPePP UW R 0S  R``0 # Ѝ-00pȑdhT 0 $ ԏL0H-P @P  P PJ@P0A-@Q `P' P P:P  P|PP `嚏pPFWzpPTPt PPP PP PQPVp0@_@E nPp`VUTC10 O-MРP& @P aZ Q%  P R aZ_R  0Uz h %,a p P 8(}pP  PZP ``aP``Z```V RBa P  PQ /+m FX /+ ( C @1Q0!>,!a 8!0yP1@ %, 0 P P  P !!R~p 0PUP .0"@0pZp SpЍ 1p pY`܈D ̋0H-LP@P|<Pp0000 &@n0 0Fp0H-PX@bLP@2p4 0 @P0` PE  0H-PX@CLQ8: 04 P(0 ؊ X@-@ $ P  T  (  @-@XPQ< 400  P((  0H-Pl@`QLD00 P (( T  ( 0  < p@-`lP@\QH 0 P $$ T  ( p  xl0H-@o-  R 0phQTL 0v@4P0 BdTH <$ @-@P X Hp@Q,g$ 0@I t @-@Q  R THL@Q,C$ 0@%  LP 0H-PP H@*<Q(!  00H t\ O-MXPU8W Pp | 0 07 @7P `0P@ 0 @7`P 0P1 R0JY) QN@y| PXB㚯, $P(p>N/8Pp@0S0`Va`` `V 0pP@`|P8PߍT'\`,@$m F,7`  PU Tp pp  0oBC,m 7`8PF, @Q 倁T /+o, 0 B(P p  0`" @7P 7  0 @7P 4`0PTPTP@`-00> ; ; O- P-,3(,< 8H܇08}pW4uxty`h$to@~x0\vw0tzm0u{ nPĂ~ ($qp q0D ($r0Ap s0TQX1WRH YOJYM\KJ}\IQGJ1QEUCJUAT?JT=`06#D` 0:&00`,0R10J?o2 <X0@ 80H _ XJ Z:FTU U4@;4PP P6\ f,(pP @ !P @ p\= 0WZ s 0W(`W$@W ~ȿ0W(@W$`W 8W4@W0hD`WS($@0$~!P TP 00  @1@0`T `XP00\PWYpL  R ?; Pp WPY<GY$0 `@H$P p$p!W   WpPp CY0 pP0`0 0S /+ppP@W p`  PD @ `pRB   pZ P(@$0 pɏ0(@$P 84@0XDPS($@0$p 0P@X40r [ DV ^P  NP :@pTpP&H `4@P0pq0P U pWWpPp00pP T 0SS0H xPߍFۍi#댓 P T H QX PAX QQ0X01 T P  Y5HLT  [-Q p`Z p0uP pZ ps@1TT HT LpLLL Pu P>@P0p0p0W0@P 0[0ET0͠X p pȌTX@@ @!`00OKP0p W' T XA0P@"`S@U0C B @" P?/&@& RJPT !  R }PTL`T VXp@`V1pp@PP VL6 x- $* O-|MpPQ <Q ` R` >R `0 A R+A"Q#:Q`@PF@QxDPH AW !P Dh@ 0"0op  pPppD@PX@H㰡<@gNI0Q <Q0HH  R >R5 @ x a H{  n@Z HP n H0 A R+A"Q#:QH8pp4@8pp4HJ@Q00Q ,Q;Q{xAt, (8p WRPT ;P,Pn` pPh ,QeLP` P], xa0t@0d d@@L0p ~" Ao R % l% /O..pWpJD00S@00p0|S@@0cPm{ F0  @T  0St 700 P}|Ѝx@/ax@PD'@@p@$@pP 偱 000S @0DЀC0Ο$m F RaD00 @@00 ,pt    d` ( F͠Ɍ@p ```# `QT#`3PD /$0$PJjD00Q@00 aW p `8p8 L8 tt"t2!!a"Rh2a  3Q\"P F-) p  0pREWC 0p|Sh0 0$p$pW0JDp0S@0  08P0{8 0 p 01$0$0SJD0pP@00 ?  ; 00  00p4R< a $ $QJ@\l P 00,  (,p0LP (ȡ!Q)\P ף(\ Thf e@- +R -R 00B S; 1 0B\8 00B S:|/. :R2 00B S%01 00B<S! 0@B T:s"c P:R 00B S01 00B=S  0@B T:s  u uT@^ l @- MR JRR@@00 C Rln ̌! 0 B Rk00@C T:Rb@S 00 C RZ ! 0 B RW00@C T:RN @.RU00 C R@ ! 0 BRA00@C T:R8  P@.R?00 C R* ! 0 BR,00@C T:0 B@ R, 00 C Rn ̌! 0 B R00@C T:r  /R@/tttT.@* O- 1qaQs#@crc1Wpp3S@pW WWF=9\ Qa\@d@UVrls@_rᦿp@pF pPSP`?01G`pg`fl0@cAACi?SCA?1CB@X؀@B^ 1n`0pCPNPPU@@F}y\02PL`PU  pFmHi;W%Z)\P ף(\Qz*$I]O-$MR"X *0QЀ@A BpT pQ T  P0< 0 0@< Fmi 0oƟWDG8?WG(/ 0CpJ00=90<5ĥS 0CCx? (( BSw? `B 0np%P0 G`n."D㐲(97 @AP{p { oc 0n`.0n [/@! `@#4$t!$T! `p"2' >t0Sx4. Q`4!a  3SD3`H @PH @P@᠟m P2 ɏpZPzd 0SV'@Q.0KV@Pzp z Oc 0Nn@.0Hn@P[p{}d 0+V%`Q.0#V & (J/0 !# F[ BQA! A@ `p{ d 0U(PA.0UrT$Ѝ{p(_d 0UPE.0Up @"{Š. Jr0pAAjWGQ:@qG!BPBrpPW P0Prp PYp`"1A "#"0`#  !"q/&n`V>0003 P @pp30 0Tp p P1@DPT $p P$ЍE.=k9:Y`bu(\)\°Q(\\ףp= ףSc$Ių8ZDVO-M($0 0, 0$0 ppQ 0 PqR?"c@qGw@T0g003`Vg pp p3`ꌷ\ @g87&s'47v'P07 `%  p"1'?w&BnpVw^gppp30V6/  3 " X  0 Ypp H&   J  "!pP<W:*pATƟ 1/Q0X0eQYࠡ0eEuإ6T%@uV%$ `0 P#q%U&n`VeNU```3pUu?00030  FQ; ;0W FQ0 0 ph``/00b  P P地Wp,$ (@04/P | Px PtPpPlP hP 1 q೘ 0! @"0 + m   P 0! @"0 *^ W p 0W 0PpPњ PpP* uFUQ"hUEPʘ0@ ?" " RJ0,$ (p8@4007/P XQ\P pWJP   !!PxJ,$ 0(p7/P 0 0lIpTf,Pa ,@T],(pf UU,mP@DF R,`VeF ㆡ`FJP, R , PP 0 Q<,$ 88h07/ P | Px PtPpPlPhPP8<|o ЍL PjH PDPe@Pa<P]8PY04Pꉈ*(\)\°Q(\\ףp= ף-00`RT,SH-P   0 ^Sr~A @-@4P P 0/&`P  P `D @8  P `Q `倁Q `倁P `偁P `TP ` `0 Pp<`@0H\`XCP `H Xo {\` `[Bygp00`B/pQ:p P `'dϟx  P ` 00BB/pt `D<@ B `XP `PP ` IP `Sꔯ 8P `P `P `#P ` q-xBo؀f0 0_`pG (PB ؀Bf0 0Kp1 1P| `|P| `|꬚ P| ` `` php\`ZH [X J *V P X@ Z ꤙ b`L`D<@d  7@  P `_ Yd> F @Kꤘ Pg`  `  A 8% p-`% 55  R  `P ` 00>{:dL 0[ lQ R/ R@ R0("0.!r!0@W+  08R#8S l0P8 ` d38R80Q |Pp 8z d8X @eZ`L`D`<@ X QRT Td/J@Dp\`DTB T?0P0 +:Q, hSP g$ F V`/ P:gQ hiSP \2gP    Q :P hBSPggP     0 Q :PV hSPgW \pRW\pTL TP 1:Q: hRPzg0값  F V`P:gQ hRP U gW gfff g HR>RP F:Q hRP开+g % 9nn F V`P:gQ hRP  X  Q':TPv hhR0n  D Lp0W?\<X T0  S 0Y:\pgnQ hT0]PNH4X p@ W pWD`Qt:P) h%RP开gX TX(000 BS0:gnPW hR0P00O 꼀g | 0``C 0S 00:TpL0Q# hQ0P00gp!~ a0  @VS0R 0+qX\`8[8Tp0Lp 04X SA    :gnQ hQ P  "`s7 4GP9=P000R02:h\pgnQ* uQ0P00& `G W pR :gnQ h[Q<=0 P  00`\p,S:P@KO 0LF! H0 k%Pd 0 R [: 0`pI^! G00 0b\0S 0dS [  0W0X  j 0S꼀g KR:\RP /:QS hPP开j4gI F V`P:gQ hPP H\'%00g\ ( S :Q hP P hg꼀gX XPP @<QPQӬ \<dcsR:P haOP开)gX F V `R :gQ hFO P   꼀g KR'R(\pP  F V"`P:gQ hO(P \p#a꼂 \pP :Q hNP开`g Gg⼀BP > T<ڼhpTX# P0:Q: N$P开0 @F V"` P:gQ NP Oꀁ hpQ NPP开@gd꼀gP ` `尰`pQPThp*XQPhp8QPhp!hpP cNPlQPTXQP d0QPHhp7` PPHP @PpP P ߍۍ PPhpPP@@PPTt [P ( d x r t t hu z |z @x w v w ` u t Ps } \| { { dq q Pr (r P q  H-`@PpP 0@QO-4M`Pp000@0 $(, `VP$ %P@p Q * 0 @ R0A :$Pnp AZQn   l , , ,   ` H L , ,,,  d0  8L L @*P2 0@ ` Q0@ Q:p}p0A P3@!p0A P:$QDW+:i @@@ca [ YWUpp0A P?!p0A` P:$QOW6:f$Q@ W : `00p 0W` p)YJ* pY : p p00p 0Wp$Q W :  00p 0W`ppW* W : `00pg 0Wp `@W* W : p p00pI 0W@W* W : p p00p3 0W  /  s@W* W : pt p00p 0WoW* W : @_00p W0Y > P b  @W* W : p> p00p 0W  / A @Wj* W : p p00p 0WWU* W : @ 00p W0WA* W : @00p W0W-* W : @00p~ W0 W* W : @00ph 0WW* W : @00pT 0W h   @ W* W\:wW* W : @00p+ W0W* W : @x00p W0rW* W : @d00p W0^@PpW* W : @L00p W0 FW* W*@$W|* W : @000p W0 *Wh* W: @@00p 0Wp@'WP* W : @00p W0@@pW8* W*@W0* W : p p00p 0WJW* W*W* W*W * W*W* W*T*0@PTTX:PI X; 0 0P10 !R0!hhhh00P p0p000 P 0@P0@4Ѝ@H-R R RQ 0p bp Spa A`q0`Q`BS0V0 P0a0p  "!1@0a0$ @ PU:PR0^Ba/a`E0p`pf pSW U0a`V0bWgfffK-M@`V`PT Tp[p[Q Ѝ Tp[p[P [@d[@Ѝ #SFQ[`ЍG--@ VP@P(0 &,B0`L ' "( Q!UP UpplP `UG [ X Gn`GWP!"+G@Q '"00@0r pPu @Q P USPO P P# PH P1:ZP5E QH  APP *w4zPE Q%  APP W$JzP E Q  APP PP J PX@P}:  KV`YhZeGe"O-M-PMp@P@`P P? PA P`@;Qq  ;H VR R ' @ PD0 qV`@  PЍЍO@`@@V@H HLP (*( P,p  ,B @D LHD0APA  +3@@ +QA+A ; 0p 0+ " 0 1@ A  C0 PA0U0 @0EBL `q ap S4@08@Jp@ B@c0 VQQA`Q0( $Pp<@ 4X8\@ p`@Q@p `@p CPN 4 BoWR< P0PR P  Y h  !)H Y @> i0 "Q (# "2. ` Q 0   Q -0 +`!S  $Q:8A  ZW Q1 I    *+R 1 S 5C C*  U/ ;; A0B 300 0@GZ,p@`(?aCoc?yPD??$@@?@ 0B E,p;! ;C 000 0@ R #+ ;:;C 00`0`@  S0+;1C (,p3>+=;R  BAK2@KJR& !  BK:KD1000@Z@,pXBA Z,pH `A2A Z,p@T@D0P AHP6JY4 <` @pW= @,p A8@+0BNAB0@;  R +!;;;; C1@;0CNAB000@  R@UP# L36`aQk P (@ W,p{J @v @1`t8 (@TZ T  J@DK Q(@R -P 8P @88@8@P P Q P 8p<0pSD0`'4p  S4@0PWP o  pPQ `y `  `PP:@ (@@` @Pj VV b(@P  @Q+Pc8PP$MV4 RI R 1@@@> @p9Q\013D/@-8Y 4P! $(P*< 8P <p_ 8P ( P#P6 Tn(`Ph@8  T@0W@ PЍЍ[[ 0PJ X@8H ,pP` @P`@8p0PPDPPV   58(@`FP  )8 (P @P   ( P`W`iP @! N(P 8@PQ@P pD4$PQ D @ @ 8P @0Py< Y BoD [JR $P PPRm4P fh YXPD6  P: P  8PV Z.  PzaZ(! 8P@ w(pH@ `P?ad`40 (P ,pP@ 8P 8(UP4/0(,pi,p@T@D0P f`,p0(`4P: Y8 P 8(0P-@* 9U @1P%9U9D,p0 (t9QR1@@1@[1PPD4P 9U @1D ,p0(PDp $ < X  ̭ R ":S S/$/ /0H-@PP:P QP4PP@0H-P`@pR:pPpP p@Q   R@U0 12 OO- MP QepB`  @ qR T@-P 0@` `0V00@RP @ `PA ` P @PQ@JP@PNP J0 `P` 0`PU00PW Q @ PQ@J P ЍH-kLA-RM(P@TD@,  (  `-H  0 $` `````lRQ㳇ܾH-KH-p@-@PQ P PQP#`P  qLpp@-@^PP`P  `LpH-MЍP H-MD" -=)@/  ЍH/C/ H-M   0IpЍ0H-@ 00: P:P P P!  L& @0000 0S P/!C/H-P@Qb  @P `Q PQpAG SGV f1O-M-MP@`0`!pO` t p l d@Y JR:*Z Z Z +Z -Z  xZd0x!I x0Z\ 0 0xSM$` xl0 Pd\00x  0 XH 0 C RPP ! 0PB 0x000 C R *XX! 0BP `` TDS R p`@@T  `R0Lp@d x 00S S B0 x 0X p@@p@LJ0S @0pxp0@0S @1 Cp R@L:20 C R*0S  \` ph@1AV VPpGࠡ`Wh@ ` `@pVPVЁx0 @@L `pEQ[T  x0p+S -Spx00C Q0Sdp0x0 0R C d70Z d`xpx, 1BpQxh@@0pB@`0D Q `x`0 0C0pB@ Q:`F0 `0O@ F`NLRNlpQdph@Qpg@`T[ \0h0T PS 0P0aPTPX0Z @LP IC%Px2 P x@xx) Px@`xT`P-0ZhP@@X@ T B+ ! 0 PX Gp5Qd0L hhpQdR$ R4R;ʸ[ &p  L 5 [  (A6Pdp pT3`  p  0 `,Pp/`PXHpr(@ hp%`Rh|`!L !B pp  p0` 0P PX\0 `h@0S*   ! p#Wg ϟ#SG@0Ltp A ``t`'jP +W `@00psEc /    p!W8 lϟp0!|@P`0U% II0P R `APUG8TP@@l)|@P|IIsl Pls |@DP@|0, 0Pk| PPX4ph<@*,Q' J+( ? (BJ@@ 9@ZP ;D0w.P"lgp@0@"t@!* tpP?  0 !R1`\Ao` pl@H|`P ` @PilPX\0` `PA@[P4pBU@P!< U!0@PP4U28<Q0  P p_ P$P U @Q l0q0pS*`v 4pl8|PhUXPQ lUPlj| H eA|@|P@`P|L   T |Q2 `\XP0 0P. PQ- lT0"Q Rl U pM  `1\0 @`\0X광 0Q @0 !R8<Q=l! RH@PPH~ 4p  0p"4pr X0Q@Pm l @PdU Pl PeP!ad X |lPA|4pQ b.PPh X`Q pQAH 'MHV f1lP.l`X<  BQ| R`P XhPQ pQAH LHU e1l`P@P4p!8X@|00SP@P4pR lG p0pP* R BA= O-M P @8  @P 5Y`R pW`QR p9><Q Q` ` P~  !  `2`Z V @` `f( P Z  `-@PX @p QA [ P PP PPڣ L"  `'PK[Z)8`  `f6 @`R `s`ЍlZPH-mK-P RPPF @` 0pPw0%uP'%8p Q!8PpW:W*`qp'8!!8q`Q:S \EP P! lCP O-$MP@`0PP  (P0A S:@0Q0q 0xS P0  p0p@\7 PYP  ^` YN Q#\*[0 Q@ q @ T2' 0: 0[ "\ pA0q 0 0A1 !P:F0P xP Pp  P7 \ :)Y. P+ \*[ ` @ 1 P pW1 `P :\  p@0 0S PY )Y`$Ѝ pP ` 2QT 7Q $Ѝ$Ѝy y O-MD@ T `0P@  0R 0S@ 0 PR P RS Q S==0@S R 0pPU p0Q  P( R 0p@@T pR R  0Q0Q  /o0PC R C pQ+Q -Q p0 4    @0DQp $0p `DK\p0@aQ @0#`BDV:@pG0@ `Rd P@pI^p ЍS pR ] @Pd PO[Ma Q QlLP  P U0b`p\ uRP U V ` U  `PEcp`PP4@@ Po D `0g `Td `P`^Pf P( P([&_[  I"b@{`;pE 8@ Pq  Bp8P![9Pr`bV: Q@ U`:Wp 5IX h 2 @=@ ` v @ R iI"@)@Y!@IU4VD` `T `p P PE7X p@ `@V P P P @ P> PB PUAU9E P49aQ `jY"@@U !@0"@PP" j eP Z!@p@ @Q @Q zH"P@!@Lv ! /K-`p@ R  P0Q P(  YppA PI`V0 A P PUpGpH p Y @D` 0 @P `@Tp980H--M@P @ ACPR @R B@ Ѝ0H- ^  A0BS 2R H-A 0S10 R: P(PࠁNG0S " R10\  R/ R /0H-P9PP8PP7PP6PP5PP4PP3PP2PP0 @1PPfed0cb a@0PFED0CB A@0 H-0S $ B1 !R1*PQ n@`rp6@`V:0 pppW: 0 Q  RA@-MQ @ R @P:@ {@ЍH- a@`P ` TQU  tPU P F xxPtPEQLUPP $&$i i (,x L h |i 0H-P @!P:0HdPPQ T H0!S A ,0H ! A0g h в\h H-   "!rQ"(?or0S"$0""0"!0S    G-?Y ϠP q @a @@P0^U Y `I:P `! a>!P : ᔸ7!P: ᎸQ& 0!S  {PPQ r0`!S `ed! P$! le ,f le e f İPf <P13P1"0"1P1 3P1 3PA/A /0H-@PPP@0O-M` @R@` [¬P4 P[ PA@EZ   @P ^*`V p00p60 Q:p[ Q[ЍO-M@` P P@P &Pr r&apW" RPP qpWHPa pqpP 똡 猁PP$ fPG pT !P:ၷQ ~1 0RA s  A@[ p`WP apW3P pPP HPQP LDPЍ@Tb Pc lb b b b xxa K-` rW WPF  V:RUPE 1` fP@VPPR5Q:UPR:LY! !P: lPPQ \P0!S 4$! T_ ` X_ ( 0P/00 R @ PA/3/G-P @R !0p`VpAQ B:PI   @@3TAPA+P0 /A 0 Pp``pPpVpp PpW: @` V*p```PVP0Pp0 P:@ @R p@- P0`3P@H1P3TD1""1TB1 3TA1 3TJ  @b R@P SP b 0A5 S>0 R N+b S 1@2@@pK--@P kRT2"pQvV  GH&a@N# 0[C'q0Vv ?oRR0&8Bs R#4B #2@ #1@! R, `@T)w ?oR '(br@T"$2P2`""0`"!0`V" p0 `T @` `@pp0 @ d"7t `W`p`Q 3AA5d# 0` @`pQ2 D+B 0pQ103Q1""1Q1 3Q21 3QJ pppC R /  R/H-MP UC@A fP3 ` @tP3JpQ Q& $vp%   PGP @`  `\PT  P00@$ 0( ,@fCcCOЍY X Y X u0H-@4@PPP40Q A  /@- aR rR wR:<?0,0 e@BT APx%0R +R$0+0 Bp@-@P3 3 0P QQ 42P Q 1/pPӼ 剴0P @ P 0|0`aa4 ``pB p@-@0Q QA 0H-@P.GP HB @H0P @ P 50<PPP 80 1P%P%2 PPlEg!$P  5/PP0 @ P0tV T   Q/1H-M0 *BЍ0\ \ \P /Ѝ4 bЍ Ѝ6@  //O-OM`PA<PwpoP3 @VQ   WtP APAPAV 0 p x|Z zҰ pDp4,  0P8P0  WAV tP P X P  Q P4P PQ *Q Q4@J>P3 P0!! P$00`lP0 p|@P73(, 0<0 R5PX Q V0 XA/Q Qr12307p 3P7 25< $1$(1(,1,010414818<1<@1@ D03?D0 <@Q?<OPAP p0@P-@P3Q&@P"l ! 2/@P(?SP !D 0@0!Nuq@@P@l@P Oߍ4$$ԬP  p`0 P  p`0P @@P9@Pa8Q 4O 8T0DA-@PP UQ `pP U  &1!!U[@PW@PH-4!@P K@PPP @P  @!P U/@PQ NoppWP رp UqбU @PP/0H-@Pᾱ0@-@R * 0 0@???,H-Q p?@-@S ?,  0@@-@ ?,  S 0@?G-M@So`pi $PJW $( $ ($PQV !R WW(0Q(($Q U 0-P;  !Q(PU((U$QJ(q 0PU(00S0P  (0S Q$ $??,Ѝ(qPpP  0PPlQ !R 0U :pW $Ѝ p|Rp GP C (QЍ0H-Q ?0@P P4P  P 00ZP@0A0O-M@(0!P5R(P%p5Xaꇑ P.  pؑ ` # x> {paDP !( !' PD  , U , 0 ЍOdЍ@- 1@3/, (P0G-M4P @@ 1  3/ 0  `@   ``! 00'  (P0)` 0* `+#  ,"PP-!` `. 00/'0&  1%02$`P3+`4*P05)$ 6(E 7/"`#8.%0&P9-:,;3<2=1>0?7@6A5B4C;D:E9F8G?H>I=J<KCLBMAN@O`FpDPE@G`pp `G`@0`Pp@Q0` A/wp APP`P@U 8Q 0,`,hP ލ=O=,ލaO-MP@ ! `2/,( 0<V`Q0 0P P{  尀@X_:@ `YVZ :FW P,Z 0 piP!y@jP3   0P  `@㲀V `Y ) Q] QA0 j P;@ @P e R  Ѝ b P d P  b P(@Y TP ( B  ($ @$q8O-Mp`@ S [9p P`W  $80p` " (12/ Q, P  ` F P, ;O@T ]p lW@Ѝ$( 2"p[(;;P`; ` 'P ` 'P pP ; ( {b1x> > > H> L= l< < `< ; < t: : 0H-@Q P(P 0C;0A-M@`pQ P(PW .;PЍ /P ` P r 0QP!@ n(P h(O- Q + D Ƞ # @!D!Ƞ! %@%h%LP ` @ ` #X 0#4 0!4Q P0 Qp^ z^  D@`@P0p@P`0p@ P 0p`00p0` P0@`p0@P`p0P00P0P 0@P0 P 0 0 PP00P P0 @ 0Pp\3 00s\+ TPP@`PPp@`Pp  ` @ P  p @ P ` pO-M  Q_   Q Qp^ 00 s^ ` X |PP Dpp@@@ `P  @P@@@ `p@p`@0`00`0` 0P`0 ` 0 0 ``00` @`0 P @ 0`Ѝp\3 00 Ds\@'@@P@@`pPP`pP @ p ` @ @P ` p @P d X L# `!dP!X! @'D`'hP'\p#x 0#4  0 p@ ` PЍp@-P@Q `v&`'`p" t&p P  P P a奪ᣪ$j`P`pp@-MP@Q `?&`T 8Ѝp "    %P @ !pb1   `n &,&P Ѝp  Ѝpb1@-Rq0 @G8@-@ / ?!BCb5 @ @R*R/0Q:/H-Q   !0(|pdXL@4 0"0"0"0"0"0"0"^O-MPR pW! Pp!08@ p0 o2W  q pYpo0 Wa @0T 00 0  pW; pW:B|pP- `uP$ TD[` a o2`   aPpp[p}Ѝ pp @bP  @q 401 B S 0001Z+ @p@ | Q"0S0S 0p @a@P@ @  R H- 0A1Π\1>-1!!K-M`qWWЍ@P ppW R T T  0aP U P 6ЍЍ 00 !     /p@-`4h@p PV ip p7`8h6`pA-CMLaP@`,giQ$(!1,P00 P P:6?-$  g,Pp ,Aip  gp T Wip  g 6@ gg6@P,PCލa& 5 T9O-DMtp` @@Q P#P XXw P0S@PP%z6@ QDЍ/X(P j6 p ,00 ( 040 P(p0S p $0 8 8 <0 P `PX  #P 1 0p7 0cPE  #P0  1`  0CS&:PP  p P  PJ   T#u䱄帲 P\   E#  P` 0XP  3#TP    !  BR *0  0  رP 7S 0pP@ \0! A 0 q! P HD( PQP"!P P PR  pQ!  " X     P_odX% " <# ! O-M@`PQ p"p eUf Ug ,P P P  p0 P   r0S  P  r  A/oᢲ AQ   P 0 ]pv @P   <"[GPc P P PP4(4 Ѝ !P PP` " `P `QE ! m!PP 1 `%P  !Y     !Po"!, !XY qWC P 2! !P{ `W qQ  !qPW U㴠  Ez !01 P P m! PH `[ K [! P6 `QW|  P( `QpWG  ;!QU;  2! P `UP  &!QU @X㴠  z P! P `/+ࠠXP崠  q `PO-M(p `Q R QQ Pp  p   p   Gp  0P0CUP0P1 Q @?;0  P0CUP0PB Q(E Q R QAʁЍ ( CWR [ K  `PY OKp P  `Pe [I p PQ PP2 QPN  I W㰱 ` 갱 `   0P((R   0ᰱ `P Ѝ(('Q P    QP   (( ( (   O-M,pA To  2! ]P{ T`P@  p9 P P' aP\ SP V pX ,0@0CT@0@1P   - 1OK@  0pppH-M 0PЍO-MM`PR@U  P pSJ PJ P1? F @Y:@/PP 18P ЍۍF @XP>IY*F  @;oYFG    U -bp JT$ cpDR1P P p尀? P P0PpPcP! P)1 /P HXc/P   P 1{y 1@oᠲsG UT8 @-R@QPTPp(A-M`|-@(ptplhh \ U(@ HPU T P T |PЍ$ C u H-(MQ@PDfPU `P% t @p!0    PP. Q p T(Ѝ hfP' K`H#I-`B0 : p  `bpb`ᥳVeP  `$/` p HR8RO-M⤑$ Q"`Hp  '  '@ V8  V-Ѳ)]`Hp  ' <<<<@ V V `   p PЍ$$ f $$ a  $   O-TM`APEZ BpZP pppp @  : pp1'? @Y:)@`p   (Wp@p@P:X p   '  @  PPTЍC $ O-|M@xd,P(`h  tplh &@ Hp W:U d U ,Lx P|Ѝ $   @ p@-(M|` P`$} @T L T $P(Ѝp $ ֱ d $ O-AM  Q0p(P$0 Lp Pp 0H(H吨(Hⰰ s  e  ^& \\\\@ Y   0 hp,  P)H( Q H (PH`3 h 6  -& . Pp (PAߍY"*K, K| A-(M℀` pP$ @nT L T $P(Ѝ8 $ ,4 | O-M P@  `,`(`$` ````` ````T PQ0F?v`QLb4HHRL`(("0 0`2r  HDP,($ p@    ,($   %@   ,($ p@  , G P:ZPD   F ) P  @P@ePfd`PЍxA)  HGF  @-@@\ $ @! @ S C H-@_ P\ `Y p$  #U*H_O-dM(0@Ÿ, Pp0 HL "$@X@ @0,THbP\PP`` 0 pPp "`X %Ha`h!T fP"e< `z8e' PXD %a8 #i aX @`\e<P@,d(i#nʌ k a("i `a 4`dH,`i *d,n "|fl'f8T#afx.g R   &P@ @@@  PP  pR PU  @P! @ PQ  m嶰ᴀp@Ѝ@Q \@O-MPp,  @Pm  a 0t @1 @ `  3 PO  `x@ @b P HP㨀 `X` v@T@F  " ( vpQQ @pP  @2 Q(  ` @ЍQ QP   Q/      A Tg p 2! %P TqQ.  A0T-  `  q Wh @ 2! Pc WP4  rq`W3 p0[p 1 Kw ! @ ᴀ@T Pj [ K1p  C @d @@V@  pt @ . P /+@`Vp@ !@   @7R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/00/ P @-0 @(@$ $@/!O-0M$ `pP@  (,V0 pPD$@g#%"A4O`P,"q`pq (p,pi A p( p p'p p  (@0 p  @S,@@0A$((" ! $%)@@PsA`y''  cqAv'eCE$L$   $`c'@p@  (p  @' @$@ p 0Q ` pP@0 ` 0Ѝ!` A-RE ` P?@Q @pa(W0 8(LP@D @T:(p@ &>@P@@D ?T @T :0@P@@D ?TT ( H- K-@P6 `P? q<W (7W (7g)7#( ?W (?' #  8#@D((P ( 2/ Ph"P @-0 @(@" $@/H-\H- P @-8@ @P"@DHL@/O-Mh $X T pP<,`@8 H4\ 0LT0@D@(<@ P4P@0(0 P`L|0 0\Xl ` 8$pxp,PP t `p h圐堰 P p@` ᐰl` G)I +) i)g`&KD`&+G; ' I4 $@ "0 @ 00p` t`0d@匀` @ ` ` 0 to0! 0#2%>'aက0#lc@(0#`@'.`$O%A" "LC "t@ 0|0|x x0@t@`@Z@td dhl @ppp圐 0xP!p0S |@L̅"tP`bp/#D "ࣣ"0@0@P 1Qp'@ p'1FI>0$%CqY"3#M~&P@ "pP "Q 0tP堰吰0 Y0 w)y)Wp%[T+Gp'+Y W IP$K DP% @   P@p P pd@P t P@ p xP| 0OpP%P%R(^&Ap hP%LC p"% @p&^p'O(AR@%\S@$P@ p@@P@@PP0x@^P|PpPሠ[ @P z~8  0|x0 PAkP @-8@ @P! @DHL@/H-RO-M@P P`p (  $ Ѝ 12//0H-1M P@yQ d\(0@P`p|x 08HPX`hx $p|x(<4D<P<<\h1ލ0}PP@ P? P^: 1ލ0PB PP=1ލ0H 1ލ01ލ01ލ0-&QQ1ލ0    R FR@%;&(5)3*1+/,<)@P   ?㌘"q 1ލ0BCDEFG ?ip P1ލ0`LgDd@ 8^0[(1ލ0   /02QS1ލ0H Q 1ލ0i1 1ލ01ލ01ލ01ލ0   ?pC @P? 1ލ0  ?0!   /0Q 1ލ0 ?ٗq1ލ041ލ0v$rrsrrrsqq6sPA-8M`P $(,  ァ|ɠVppUpXpWY PPWDQ. Q- Q, Q+ $Q* ,Q) 4Q( <Q' DQ& LQ% TQ$ \Q# dQ" lQ! tQ |Q*       R*A%@# 0SQW 0: @@ @GP ! ! r W*AV T5 `U P. PX Q( V ! R! @@U p 0pX @ @@  㾠8Ѝ @hh 4 40@@@ۖP4P0Q qP th @4@@ e e e e e 0H-ٟ@@T 0/@T @P xPPU 0/PUXཟ0DPPU 0/PU$࢟0d d Xd Dd $d d H-MdP ЍL    0rpЍT H-M 0ЍA-M@(Rp) `PX!@   0Q/ RኌP?  M `V $PX!@   0Q Ѝ QZP   ЍЍp@-M@0PSP  0 Q  s ro 0;Q Ѝp!2/Ѝp@-0\ 01S  @T0SLD0H-  0 P01S @PUS P200G- PpP`P*@֋P% `P AP pD U @@1  . PU  p`PO- M@ AP- Dp@ X PP1  YW  X X  `pP  ЍA- @p XP  Pah`FW FP PpGYW 0H-M ,@P( @ @MЍ0P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*G-xMb儒@`R `tPb8PPbp4Q  )PP8V `04`P8 p 0P兓P PE U 8喋  8 P: P*8P6 H!T1"0` 04 u4PB  P80 0P`80ppW08800`XP40R:PtPxЍ[@8P@8 彅PP8 ` 0%P P@87@8P8ꫪX @ L@/O-M0 4Q 8Q  PP{ QPs 8P |X``4r(py(@X^`  0˒p* P(PW*يp7` !0 `U48:YY  0@pT(0( R`PYd@`UC:^= @ T4*Z2* 0Sp8p"pPU(p(PUS4p4p0P0P8P8W PPpP 0P`pU:@ T: T: T *I8 800S P`Z*B PN}`@PU048`J @X@AP.QBXc/y[P  -P `J V  0)  O!P*`@@ $ `WPP p$ pP ! R PP3P@@3P8`V( p 8`V 4@T U P @ P @T``nXPX@c/4 c/ p/X@X c/&U Pc/ `Z( XsbpX 0RPU@ pU XSP@Pߍ X@ pP T !(84b@V P p0BPTT y`˃P ` P@P@8@ yP0BPT$T& y!0BPT%T? y0BPT*T, y'0BPT)T+ & yKP X"~ y0BPTT y y1P@f 'P6?\ y@PUꫪ 8V U |U \U T R bO 8 0H-P @P08PU 4P 48`PU:Ἀ80@- 2A! "@ @X0H-P@Q P  " 00Hrp@-@P` VP p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/A-M Q$ 0S) @ 0A  Q `rPV*`V@@T Pr`U*PU"Pߍ 2RߍA&+딥 O-:TZ. T Z7 XB JMT  o `9{xK#T  [n o `  98cT    ^  b*QooA! ^ 0`)T  >7ooAP*`!a9>8.^ nrb9>8.@n pN18g9'0p0@?/P@ P PO ` o R 0^_(㆐Q  ЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /I@- 0@!Qd /H-M00 00O5Ѝ,U  RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00////Q/R Q/U/Q R Q/R S Q R   //H-Q0S QP Q0S 0Q@-Q0@S Q^ Q0S@@R SU/Q \  \/ R#%U#/!00Q /0H-@Q0S PUQ PP0CU U @SU@0@Q@0@-Q0S AT Q@0CT SUQ/RU / Q#/ Q#/0H-QSPQ00C@QPPPU QPPS P@p@-@Q@S T 0C`PUQ PP@DUU PS `TPUPPpPQPp   ///H-P Qs R US  R/ / R S Q00Q/ S#%U#/!R  Q0///-R/p@-Md`@ Px`3333PЍpL 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/P /hJ J H-@-D@@4@@p +n@萟|////// //G-(Mp`aP`:ݘP1PqL ,0pPP@T PAL @PPTPPPPQ R "0pWp 0pA pS:%$ $ T H< (9/(Ѝܠؠ,///O-M$j@q`x P PUPe %P T4 ` ppxZP8l@||H0P (0*X= 0H Q 0H Q: P Q 0A0@ Q: {`yyvi`s@`q`o `mlkligke lQ `P [/XpX 0 py  n wp p> G 0c  ppu  j 0`8p0x``0vPppRJJ`P @PpY  N 0`o[  O p`Y    0  @p0/ Q-Co" 0:m @z`' @z` @pz0p`p0r{p pRI P P) POp * &2&b @Sp 2. 10a@S p 0Q0 p Z p:p  0! J0  Gc z `: p0gL0R 0`\r ps `0   Y+ I` `Z T`4 BRS  T034 T40 Y  `S T 50 4 YZ T4 BR BR0 T40CSP T 4 4P0  Z T`4@Pʵ @ 0000p0 TKH``TPЍLH #xH9`> A-dP@X P`ppGX`WڼP 5/@= K-@Q" QL QI 0 Q0C pW pBqW s`V`PUpW`W, qW( `V%P P pP`V QPP R R R RQ O-MM pP( @t@ PIY!  0iQJ`PU|jyj XP  (IP $QЍۍ˦< H; O-MMTa@ PU`p Q RЍۍ ' 2 ' 2- qpqpQ'`0HX'  0:iPJ`PU!jj   0 `oP`` ``; 9 9 O-MM⤏`Pxt  F PP Pʑd `a || Xp0^  0e" U\ďh@Tu PhpPX` R 0RYR R!RQQ L!RG ̌P? p. J.-̌P2JP P  Q%Q Q QQ  QX ǎP  @PZdPh+ ď̏h 0S PQpb!pW 1pP@`sP@ ` 0d0`  PIQ `XU  Ddp0VpJ΍TpqPpuf【 K P AK.,!J!တ XGQp U A `FU  TJ~d@PP`T̏hX\QP\P,dJ(<$ x_P H L Qp @ Q Q l!1v/0< Q 2 QD 0 18p4qpl@x`W )Pt 07/PU qPE_PPc`  l00 ;P4 X0\D`<@PQ@pP8pPsxt`P\PPPPq `@\ 0P P``s 6t0 / i\ 0pP*PHX`a8P 5`J (V`J 0ЀTt$4 0J 0\X`T夤XPPdPpЀXP 0Tpd 0d/|@QA)@ (/"|*P PruJh&0|*P Ph`P\p% aL  _PX01  JP 0 \h ,0&P`aL  T_PLX0 aL x ^PX0 hX0Y Le! s+p`  0*PJ`  X0 P 0o+@P ~ P``儍h s0 dd- ോ`\T\`'LFP``8 r0 - .` X \L($!  X0L gP`` r0 PP, dr` w \hYJ \\PP _ P tX$UPS``刋h r0 hh+ 3A`\h x " XPh 0 0Y  * \LhP% hZPP4  `  XP 00ZY P `P \`L  L v\L X0 L\`P 4PY9 @P8PcxtX$HTPPP@9 p $|X66PPgP5J. |J| K*PJPP PPP P(@ P l PJ a  )PRu> (WpPQT@pteJ^ : X2d  '(PPp@DhP`q :(PmPA hde Y`@ 7 6  @X0hPq R:q (PPA  ,T hI q  R,#J'PڴA Xh1 `a   XP0h0Y $Pp` p0 xx$ UP5 5 $@\`p`!! QX0 a`a  p X0 R _` "\ R   k qW )P6t xl0p00 07/PU qPEP P Q $@SP4 C$@P>p` p0 # !/p 4 RP笂h`9$$!Pp` ip0 PP" +@Pd ` Pp` Pp0 ! p$$  0 d`QP Xˈ ($D@Y$@|htQP=H  RH Z \$@PLP <'P#p$ <@U @=P`` oXX 0  `< &QߍۍFCxm@! ) o$ # P* ' (t# & GX.8" ,# 4. ,, / 1, $. d$fh. W1 P0 c, `+ D+ 4, , \+ 0 H& - % G-8MMp`P4=@, X0  ;3 P 3+$y3 /goPH30 @4P8Ѝۍ Lh0 / /0H-@ P8 0 Q 0P 0 0ʚ;6eH-(p@ P$Q`` R 0PR@QP@FP@ʚ;P  QC/Rq/0H- M@  'P P'p  ? Ѝ0 Ѝ0PPP Ѝ0 /0H- M@ &P P&p  ? Ѝ0 Ѝ0PPP Ѝ0 \L/MbO-$MM@HPp    T 0ᲆ  0  X`PK L ;`P8   ; *`P(L  0f`p%  !P4 , Jb P$ЍۍPȐ А 0!(/<  | 0t#x s0/?r s0wpp+PPP`2`   a  O-4MMp0`` a R 0.R S@` QQ.AobP0;/ P@ X 0\ Pd(ppP# R($ X 0\ $PPp$ T @ @ p@ pVY (`U DPO $ @H P .PP@X 0\` P^(=Pe Q Q Q  X1 R 04S  R PH$P PI T @RT@(P X 0\ PU q [ "aP0P4ЍۍpPPP a  a<P0$ R      O- MMAp`@ %P P ЍۍM4uP $P `d+0GLPQ1 P@Q$ `Ep?P  @Q ER @ R``PK  Dv` `Q| 7X  K-AM(@0P `p  V  0剄V ` ` 0+ P P^`P 0@.Pl  ` p`84 0 $QAލ O-TM`刀xp A 'P  03@X YPPPPp W@/P WB WmYk `PP I0 P_P`JPxp_z`_W|PPL A QI A0^PBJ@ __p__ P @"` I Q'x p pp_z__v_@PLV | PpL   @ETЍ A-P`@p p@ Q)``~_ Xpw_``Pil_Ph_ qE #FA- Pp@` ` A0Rp RQ$;_8_` OPEGp._E9O-MMLP  _ cU  \  T `@@ lVA@lF5 p@@@\P P8pBA<̟<`8 … `,(@ ^d d  RPQ `` ^t\ H@0_D`S`@0`P)*p WPq0 0 pCWS `4@ @4 P `v+0IP , \8H` @0($$+0IP #P;P  *P&  #PO  Px  P  P P P,p)   P PX,p P0  P PX,p P (@@@@@@@@(@@@@@@@@@@@@@@@@@@@@@ P P(QPp P P Y Y{0 PO Y% ((;Y$ P  P ;Y yPJ@Y@_P( 0@ P h0 dP  Y;Y yQJ@ @8P @ ᠥ 08Px  1P,qH l0 P0hP P v @H54  0; @ <0PI X PA or_P& 4 y PA ]r _P `D Q 0 Q Q0S 0Q 8PP:4T Q Q QB4E< ,R >P (0< R(P2(P<cP(P%(0P x|8dd9  P+|@| p 0rapφA x |3x#%5v 0UUUP P`P v Pv.xP 3r4P1 `pHpPP a .PpRW :P@.\PPV*GWp HDQ PH@PQ:lP   &Qߍۍ/arpaip6.int U YRvhD   hW  V  l  cK-䁙PJ `Q vP@PU*p pAX xp CTxb|p ^^P ^0H-MA x4PTPPЍ0(Vp@-pM|``lQ ^`@@U@ P.  9  l QpЍpUG-`PJ  pQ v_@@T*p X" r3P@ 0@ PQP# R!R 0sP@ 0s 0@P O- M`@ܡ X ~P  ,t,Pp  P P  Pr   Pu  P  P  P  P  P x P ` P H P 0 P{  Pw  ~Ps  wP  pP P hP  aP0PdPj I~fdd` >~[ PQ 0~MId #~Hl :    Z& P ?P? ! oZ P ?P? ! o(PP P P  ЍwnUJʶxcJOh۷ʷDA-M\aP`@l3h##<10 "=p Q9xq, sW qx|0x#T0%0P00L0H\X`H 0xp 0 xP T T000Ѝ?T  pppЍ,OO=>4E>>>;>>E?@DDtDp@????hD,?`EECS 8C8C$C CBBBBhEpB BAAAAA;`>AHA@@t@x@H-MP,$a$`@ P@DQ vP% vP P pvP pW:P-\pЍ  !XX X 0`Ѝ44 4 H<ÐRߡ"@<0</r]O-M Q = R  LP @ P XQ , P  , 0||p0t|p0d, PPPP|P p 8\P0  (  :R 0`B6V  `0`P``R ` ;R`ۧ0r0vP@v0@PK@ `|; D0 h+Q ` H+ @@k` 8Q (Q + 0 S ;000Q @P) ˟ ;0[P,P *   ,j`VhVPhZP(P 0  0 R0,P  `P`FP  EPPP3 R@ 3UP) F` ` P  UZ#P$ `@ Ρp P ) @U@pH P t p @T@XT) `  890w@$ T@+ 5xPv P 80^w@T@ Zhx`PH@|8 T0pXP@V  @, H@@8 04XP,H@ `V@ T  P  D 0য়  R`P @P"PP @4P\@DDLT`hpxhR RT& @UP@y* @ R P` 0AS006P |PQ `;Q`ۧq@vPv0T @ 5  R00/䤟  R& 0`AS006V ``P``Q `;Q`ۧ0q0vP@v0@PP A6P 0Q p 0 P :RSEC@\$  L4P0<^ ( `V ``B6P @R P ;RPۧr0u@u`S PsPm,2 0$ >Z><AЍ753ZP) @P P p匁 p`V *PDЍЍ @BЍP] Ѝ\d;;h;P;4;$;;;;:::::::H;t=<=\>P:4:0 :9@>99L;|9`949 =99< /////08888h88T82|2x21h2,22h611P5/$1 1D87D47"D766666`75t5\6*p6d6(6H675555555\5P55555544|54d4333t3p3001004 33d7ҕ;0H-P @@ D R08PhRP  !      P0N@P000 0 00$`,+++t,H,$,0,A-0`lNPD @ `fNP= P`P5p`P,PQ!0` P0P``0P0P  P( `Pp( ++*******Ő/O-MP稱q娡娑威 p P AT `Mx@hdA`T  , PQ!0 00 @P(P P$ |x  `1P0PP0Ѝ)))))))8)0)))))((((H- Ttq@-@P !R' R  00 !0!000T \hA0`  00LL @  <@'`'''''P'\'D' ''HMP/@-@\P PQ@  P R@RQ&&&RH-P)   0  , 0xQp  !R`!X0 P 00<< 0 &&%%%%%%P/@-@=  R  1S 001l000dA0\00HH @ @@/`%T%T%4%%$%$%$$H-PPU+ ``AT& pqP 0R.RVq Fl  Q X 0Pp p00< [+ (P  P0)P . P$ $ 0PP   0PP@P P  G Ѝp@-M`@ PpPЍpO- M`pP  Q @0P0P C A@P. 0  0P% 0P᱙@P 0 0P P  ᢶ @@ ЍO-MP 0 @po  @<`(p P0qpP  RQ 0S R Q Q  0VPAp P  `0 v`r@@`@@80@` CP:@0p  ⸠0@P pḠ<@QpЍA-MP`pQ @㲾@!P VY,\\,\\\/H!R*APD 0"A(/ $p``pW`ppW! `WC `pW W4! !2/p W'!  ЍB=P " @@W 0"P ! }BG 0P Ѝ V Vp$p   0ЍO-$M8rPp@ wQ ݴp  @  U U  P 3 `PW p@U U@ `L P  YpJ   PA t`Q*  0p`駣p`Pp-`( pP@ 1 C 0q p "   ㍽`8pp P$Ѝz  ꈍHH-4QP83 |<H-<Q $P2 42 H-tQ\P PP  R 4  vH`HL2 H/O-MMll10 RIN``P^ 0 @0 ?Ip, `Z):ԐĀ`p @0pp*IT@``![*tP P XL P <00PЍۍ&z뫪b`a`A-0S  ppp2  P@`p@`p@ R *PU Ul`\````@-M @RQQЍ@-MlP ЍXX@  @ 0 p P Ѝ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/}*/z*/w*/ct*/2q*/n*/k*/9h*/e*/b*/8_*/\*/Y*/V*/S*/ P*/M*/J*/0G*/QD*/A*/)>*/{;*/|8*/#5*/)2*/=/*/,*/)*/"&*/#*/ */*/*/////^*/*/ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */~*/{*/x*/Ku*/+/jp*/Om*/hj*/ig*/vd*/a*/ ^*/[*/X*/U*/R*/O*/p/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/ 4T*///*/@-@B@*/*/*/*/ps_strings missing %s: %s not compiled in ramdiskbinUsage: %s ..., where is one of: chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxEScrypt unavailable ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoFLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s -> out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-c-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tableUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.LinkFile%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*///dev/ttyFatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... usage: %s [-pv] directory ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %s | %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if then else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d)Done (core dumped)you have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelseelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalshiftPPID20220122 BUILD:20260906181336Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeoleol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcolscookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8tandem-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupMACHINEAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipsi386ia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyccdvndATAPIjfscgdflashrumpdEdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/vimalloc# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zu line %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSEnter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' reallocarrLabel name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not written# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] unknown command: %saddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: QRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSdrvctl-commandget-propertiesdevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': unknown command `%c'Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device Select neither dict nor array with `%s' Unhandled type %dDRVLISTDEVDRVLISTDEV: number of children grewArray:0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalidMalloc failed%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsThe data for partition %s%d is: sysidExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry:dfl:nPpqT:t:vx:y/dev/rq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!pPqynfx:Cannot use -x without -ncan't take snapshot of %s%s? %s %s? [yn] Usage: %s [-fnpy] [-x snap_backup] filesystem ... FIXED** %sCan't open `%s'Update FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** ** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost Files** Phase 1 - Read and Compare FATsInvalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors No space for FAT clusters (%zu)%s (%02x%02x%02x%02x%02x%02x%02x%02x) FAT starts with odd byte sequence%s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Clear chain starting at %uNo space for FAT sectors (%zu)Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read FATCluster %u in FAT %u continues with %s cluster number %u TruncateCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo %s directory No space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRUnable to read directory%s has entries after end of directory Extend/home/source/ab/netbsd-11-llvm/src/sbin/fsck_msdos/dir.creadDosDirSectionq != NULLlong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain RemoveDirectory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label size of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clusters%.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d bufferscache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblockunknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRdestroy[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Bad number `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]o:/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u %s: getifnamein_status inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: multicastqueue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sbyteclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s%s%d%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%s%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: Offset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track -%c %s Cannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d %s: writing sector %u of %u (%u%%) %s: can't read sector %uNO NAME%s: can't write sector %u%s: unknown standard format180320360640720123214402880Can't get disk size for `%s'%s: no default %s%s: illegal %sbps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs="*+,./:;<=>?[\]|Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizepollrecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstpoweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] ./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NILExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent listcannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolichardwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |NEW|KEEP%s is not on the tape dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.shell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). atalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowCannot allocate memoryold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad valueprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s DestinationFlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspec%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY %s by %s: %s/sbin/reboot/sbin/halt-v-x-z-dCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx%07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)swaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260207%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. (none)GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdic%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldReading `%s'Writing to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. LPSVwrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumb:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:INET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longmachineAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcmdimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... 123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_nameLESSSECURELESSVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000ltiso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%sLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screenquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotestildeno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %s%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03o><@=!:illegal -m option format: %swrite to stderrterminal type %s is hardcopyterminal type %s is unknownTerminal type? [%s] Terminal type? standard error-a:d:e:EIi:k:m:np:QSrsarpanetdialupplugboardTerminal type is %s. EraseKillInterruptset noglob; setenv TERM ; unset noglob; TERM=; export TERM; %s %s set tobackspace. delete. control-%c (^%c). . %c. usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] G:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchNoAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up/sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlolo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donecd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesprogress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICdtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../util.cstr_arg_subst(size_t)(t-out) == lenraidctlvndconfigcgdconfigdevice-parentsdmmc/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %smount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES sshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %spkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi %s (%u)/dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts%s(%s) %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPED%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelink%s: config file changed, expiring leasesInterface options: DHCPv4 options:Compiled in features: INETusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimerebindpersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrclientidnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %sinvalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtopbuf != NULLlen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initaddr != NULL - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'new_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_routeepairfwefwipvetherxvifif_copysasrc != NULL%s: SIOCGIFALIASif_ifaBerkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile %s %03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646tolowertoupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutable/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pid/var/run/a.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitincorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist