'Vg:v0\GNetBSD/earmv5hf ramdisk 08<:g<  <:gIn]Ct t<:g@@<@T 08<:g<  <:gIn]Ct t<:g@@<@TU <:gt`A<:g<:g<:gA<:g<:g<:gmA.<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gC<:g<:g<:g A<:g<:g<:g A<:g<:g<:g$h <:g<:g<:gmD <:g<:g<:g (08@HPX`hpxh$|<:g<:g<:gL$I<:g<:g<:g M$<:g<:g<:g(08@HPX`hE$v<:g<:g<:gpx%K!<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g4!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g B!<:g<:g<:g B!<:g<:g<:g!<:g<:g<:g"!<:g<:g<:g"!<:g<:g<:g"a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g?\!<:g<:g<:g>\!<:g<:g<:g=\!<:g<:g<:g<\!<:g<:g<:g;\!<:g<:g<:g:\!<:g<:g<:g9\!<:g<:g<:g8\!<:g<:g<:g?\!<:g<:g<:g>\!<:g<:g<:g=\!<:g<:g<:g<\!<:g<:g<:g;\!<:g<:g<:g:\!<:g<:g<:g9\!<:g<:g<:g8\!<:g<:g<:g:\!<:g<:g<:g7\!<:g<:g<:g6\!<:g<:g<:g5\!<:g<:g<:g4\!<:g<:g<:g3\!<:g<:g<:g2\!<:g<:g<:g1\!<:g<:g<:g0\!<:g<:g<:g7\!<:g<:g<:g6\!<:g<:g<:g5\!<:g<:g<:g4\!<:g<:g<:g3\!<:g<:g<:g2\!<:g<:g<:g1\!<:g<:g<:g0\!<:g<:g<:g2\!<:g<:g<:g/\!<:g<:g<:g.\!<:g<:g<:g-\!<:g<:g<:g,\!<:g<:g<:g+\!<:g<:g<:g*\!<:g<:g<:g)\!<:g<:g<:g(\!<:g<:g<:g/\!<:g<:g<:g.\!<:g<:g<:g-\!<:g<:g<:g,\!<:g<:g<:g+\!<:g<:g<:g*\!<:g<:g<:g)\!<:g<:g<:g(\!<:g<:g<:g*\!<:g<:g<:g'\!<:g<:g<:g&\!<:g<:g<:g%\!<:g<:g<:g$\!<:g<:g<:g#\!<:g<:g<:g"\!<:g<:g<:g!\!<:g<:g<:g \!<:g<:g<:g'\!<:g<:g<:g&\!<:g<:g<:g%\!<:g<:g<:g$\!<:g<:g<:g#\!<:g<:g<:g"\!<:g<:g<:g!\!<:g<:g<:g \!<:g<:g<:g"\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g \!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g\!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g$!<:g<:g<:g4!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g !<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g?\a<:g<:g<:g>\a<:g<:g<:g=\a<:g<:g<:g<\a<:g<:g<:g;\a<:g<:g<:g:\a<:g<:g<:g9\a<:g<:g<:g8\a<:g<:g<:g?\a<:g<:g<:g>\a<:g<:g<:g=\a<:g<:g<:g<\a<:g<:g<:g;\a<:g<:g<:g:\a<:g<:g<:g9\a<:g<:g<:g8\a<:g<:g<:g:\a<:g<:g<:g7\a<:g<:g<:g6\a<:g<:g<:g5\a<:g<:g<:g4\a<:g<:g<:g3\a<:g<:g<:g2\a<:g<:g<:g1\a<:g<:g<:g0\a<:g<:g<:g7\a<:g<:g<:g6\a<:g<:g<:g5\a<:g<:g<:g4\a<:g<:g<:g3\a<:g<:g<:g2\a<:g<:g<:g1\a<:g<:g<:g0\a<:g<:g<:g2\a<:g<:g<:g/\a<:g<:g<:g.\a<:g<:g<:g-\a<:g<:g<:g,\a<:g<:g<:g+\a<:g<:g<:g*\a<:g<:g<:g)\a<:g<:g<:g(\a<:g<:g<:g/\a<:g<:g<:g.\a<:g<:g<:g-\a<:g<:g<:g,\a<:g<:g<:g+\a<:g<:g<:g*\a<:g<:g<:g)\a<:g<:g<:g(\a<:g<:g<:g*\a<:g<:g<:g'\a<:g<:g<:g&\a<:g<:g<:g%\a<:g<:g<:g$\a<:g<:g<:g#\a<:g<:g<:g"\a<:g<:g<:g!\a<:g<:g<:g \a<:g<:g<:g'\a<:g<:g<:g&\a<:g<:g<:g%\a<:g<:g<:g$\a<:g<:g<:g#\a<:g<:g<:g"\a<:g<:g<:g!\a<:g<:g<:g \a<:g<:g<:g"\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g \a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\a<:g<:g<:g\ !<:g<:g<:gi!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:g!<:g<:g<:g B!<:g<:g<:g B!<:g<:g<:g!<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:ga<:g<:g<:g!<:g<:g<:g!<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:g a<:g<:g<:ga<:g<:g<:ga<:g<:g<:g<:g<:g<:gbpf!<:g<:g<:g $<:g<:g<:gn$><:g<:g<:g$<:g<:g<:g$s<:g<:g<:g$<:g<:g<:g$<:g<:g<:gA<:g<:g<:gm<:g<:g<:g$<:g<:g<:g $<:g<:g<:gA<:g<:g<:g A<:g<:g<:g A<:g<:g<:g A<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:gA<:g<:g<:g_eo>9m1)f`P dj?|zHrSwea+7D'fpACfD (4!h~6<bI#Yd$!+:'t(YZzk4G3bRB E!IeQQ58 Rξ^{WV\[R.CmKYVpqEr!b"W+ԍM&)wmR:]杽jEݱrb2Eda&c]jKR,>6=׳D'_ B(cſ{#?2~u|^5Pϑa`@7'sP0 #RGv@~ؑJc$t\vO5.A"C\-G2o n#7/'j%Qm^Iaz7[,&V汌.OFHb9J[} d1yJѼ r%B <leI?0N: ye;:fGIQjKx8xڊ%}}DTt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4D 4 (ZZ$$uLL$$NetBSDʚ;PaX NetBSDearmv5hf3D0D 0p@-P0:  R R1S7'P P 0SWA吡S@ @@  ϻP<q*4T PL00CS0410& 0`00 Sl'PT 0@@00S - P- P  P 0@0CS0\00@  %,&&&%@&&p%*?p&Rilp@-Pd`d@000 PPPP<0P0CS0p(00 Ip&@&p&G-@0` V VHЍpPP 0崀 尐R`00`@0SoP 0S  0 h0 0 s?o2S @`sP&|&&x&P `00CS`0p S00 P0S X0X /X%G-pሒB刢`0SS CpP[ U\ XLDV00 0ѺPZ 00CS010a U0Pd 0@Z _)"  00CS0h10=0PUPP1 ` 00CS00 P0` R0V00vP)ۼ 巺p00CS0p00 VV0  000  @00S 0S XHh&\&&p&p%&*?O-`-M  R 0000100010S ر@q0`  0.0P0 0':T0J?o20SS SRO f0S  RZ@T  Z     00 10S@@  0 : 0P00CS000 Ѝ S "0P  BR l  @0S Z0 0$\&&&h&&&p%p&A-P0`!SP@C( 0KpP0!S P ((P 0HƹHd<00S0 ẹ$00C'p%D&&A-Php@`T0S P'庻$ 喹O!h&p% O-`@ ؀0SP ĐĠİp0 T T R R 0pfP Ѝ PP P   P Pp@h&&&\&A-p0`!S@oPP'Z 05 @'7C P0!S P z'=X 0PPD00S8$ T@G@Ѝ#p%3D&O-@bp00CS01pW PU>ءTpp0pp00唸P"6' ո 00CS0Hx10 t@p@P0 5 0p0CS0100 S00   X 0000  0 0@ &屺 t卸F 0 `00h0 P`0W0$0T P 00 %l&&&p%*?p&&d&&LWO-pLP0 SPEUP ЍE P C0 0X0b U000P&^ : 00C0S.20 & 0 0CS0T200 !Z( 0 PPE CP 000S S  `V%0 V00嫷P L&| xt 00C00 0CS0D100 0!X 0PFjP 0 0ZPF C V(崀VPP0PP00hP  &͹t p婷lb 00C0m0 P0CS0<00hj00`6&\&&p%*?p&&RO-P@`p P`T !. 0PSdP 0@^S00\P0S \ [ l P @P@+0P00i%nw%L6@-T @0H ҫP 0S( 0C00S 0C0 Ѝp&ht@%P0 R  QQP0R/@- p&\G-`PP@ X 0S@ @0S @T@@DT }pP 0S  0 0 PЍp&G-@P tp0SW`TPUP 0 @+PP @\p&X0000D@-] 40aA R    0/@%p&40000 0h@-> @%p&O-R蒟@ 刀p00 pWp#s) 0`?VJV$ V 000 0S0 =D $  1@s4$0"S00 @∀ FQuHSUUU UUUlUUUUHSUHS U0UTTTTTTTTTTUUUUU0U^V^V-Vk @ 0000@^V-V00@R _$ p˜1@s@U$0"SR 0.V@0 @R R /Fo@P0 R00R  G@PR 000;V 00 X@} T0Sxp&@%&\@-0@00 005P 000 000 ,R;R 0S  S   0;SRpp&p@- L0PQS@@R0p`VP0C p&p@-P㾳@P #吷, (l$% p 00p%*?Q 0Q\SA@-o/`@-0S* 0@ 0S! P;pP PP @P o0 S</R/    Ȳ0 p&#( Q 0@30/@-p&00@- R 0C30 p&A-ppA1S0PR a  R R 8S ` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  JU0圁0CS00 pPp&%G-PA 0pR0pG0WR``0 0`01S 0100CS0H89 tP00CS0' 0S  dP 0Sp`0 0`0R0 000C00p0  $`pp&G-p0A 0RSXPB0GBpPPp`U,000P 00CS0'0  W  pP 0圑0CS00`PU*Ps`p&G- A`0P00 P 00CS0-0 o& 0FSLp I1S  0p10EP0CES0p&O-`PBp0SP UC0S0001XPPPP+PE 0Q0CS00LN  P[00`F`0WP/  W P) 0100CS0G'(;P; 0堑0 S-ڐ  S   P!J &00CS00  0堑0CS00  0Pyp&p%*?A-`AqW ڬQ1ECe R10  C0|00哲PP5! Բ00CS00 t 0q0CSQ00 \R `R `p&p%*?O-0D0!105P` Ѝ0S/T SPPP  >P 壴X TP800CS00  ^0Q0CS001Ѓܣܓ! P 0 S*"Rʜ0Upppp00P 0r0CS00 1 Q !@o!S/ %S pW U 00 0бP 0帱0CS000!000\Q00pPR# QUpp0pp00塱Pb 0q0CS00ik0p 1 1S 0S11a0Sڐ  S`l  tP5 0a0CS00<>10P!pE S:`00  1S `<qP ʼ10PE pBR   0 Pp|003P 0q0CS00 p&p%*?8&l( Q 0@30/@-Gp&`01S @-@0!S @P /P /p&7@-A00 S1 RUWʐ0\00ްPBC 00CS00- 000 @P R0 R P Ѝ00!S JP >L0 Sڴ 0R0CS00000  \00sP 00p&@%p%*??A-O0 Q .#p WU ! GYQ]YRZ~~mopHuuo{kPllmnopphqqxrrshttuDvLwz{o{H}}P0 nR pR lR 00 S P0PP1S (PHPFPP0 nR pR lR 00 S1S 0PP0PPPP0 nR pR lR 00 S1S  P0 S00ЍP0PP!R "RP  R4 00@ `P P0 nR* pR# lR$ 00 SvP TP PP0S!S 0S 1Skd YP0PPP^` ,+0100+0 R00@ 9PJ 0!S 5 P0 nR pR lR 00 S&0S  `JwP0PPQUX )PG@oG`GoobPVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 SX)0S) LL %P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sr1S P xP0PP  P  P 0 nR pR lR 00 SMXP0PPYPN 0nQ pQ lQ 00 S - PP8 0  7P,P pP'0Sh `Vk0VhVPPPVPU0 p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0 l0C0S30 Sx1SP 2SqWPP00@ 0S0 0c`Pt P0 nR- pR& lR' 00 ST1Se1S0!S ` 0S1S 8c PL 0S0 1P0PPPr`0 gRG  R: 0 B R `@p?0"S;bpR1 rR1 Up020 R 0 S$ 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P m呭0b200CS00UN !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"@%p&&9%%Sgt&p%\,P&8&#&%6=4 Pr" 0"0" " P0PPePZp PPU0S- `V0V PPp0 nR pR lR 00 S*1S;23P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@k `P 00 00 P0 nR, pR% lR& 00 S1S0!S t k0S1Sp bWW 0 P0S0P0PP1S 2SqX<0S 0 l0C0S30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK ` S`u@p0"SZ`u 0  P0 nR pR lR 00 SN0xS P0PP0SPLP0 nR pR lR 00 S,P F2S|$P0PP -P"  t -@-0 0= ЍЍ/'t&-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-`ᘁPp0 SS'PG(!RJppU``0``0,0姪@P.I 0 ,(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A lP0  0pS  0G&t&&p%*?p&9&!p@-0 PJ@p P@01S?0A0S S n@P P0P 00S0``0 0P0A l0X 0堳00a㤨P`0t, (P$&t&P\&`&'p%*?O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00嵩P@ 0A0CS0p10H0 P \RI0P 0 S 010S P/ 00P S)  R [ U   u0P٫ 嵩n00CS0L00} T0`00 p<P P&&&p&&&%p%*?A-@`@0@P X0@ p>P" 0 R00R000 1BQ@` @7@p0"S,@gR000&&O-cSp圳圣M@00 0GS T`SXsTP0PP00PO( $+ 00C0-0&SM0 L\  DQ<Y 0C0@p \  0彨 0P] l hd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW B @ \  d P AQ 0 T Tp p pp  AP p BR   @e0 P0CS0,000  r&&p&p%*?O-M0@ T0P0ߍT40S  0 G0 000(0 OpPPd@ p0 S pSx 00 0(00Y1 Y   $ ֧$Pw: |  B Rd30    BR  300S 00  0 (@P#Qb 0bppG XxlY 00 0P\!, ($y00CS00 Y(1 Y   a1P ĩ 堧Y1  B  BR p100S 0  = @ Q 0 00"2 00 (0|P1 0 0CS000SUW#00 X00S 0 G @  0S&&&p%*?p&dO-- *0AQ0C Mp`01 00C S00`Pt :  P Ѝ5 &P!` 00000`P00CS000  [  r0S00CS0x00` P  Px&&&|&&p&O-MRB000bsp 0s`Ѝܑ܁0S1  ,0 0 0P@ 0##੟ɐ Y Gt10S 0000000p0CS0D41<  \$ \  00#0L\ 0C000@000000 0C LN &%&&& &&p&A- `P0 0Cs 0p 0l0 d  0C B R0@pT oᑦ@&&%&G-p@P0 `R0  Pz(S%u0  d #P 0 ,ϥ(]&p%*?@-̾0 廥fp%O-GMeM0PS@p$Q403/P 婋GݍЍ0: S00W +  P8:?0P0: S 0SP0: S 0S 0S 0/S&ٙP7ޙ00ppP- VsP #0vX PvO+ 0P ]@#PD]⡙P 3/(/P(P 0P,I [)H Z& U9..0 0zPT:..0 0nP@D!0Q\ PT1RP  oR00S$ 0ST 0: SPPO 3  0G=00 04K G=00J0SP/ HqXG< XⱤ00CS0p Pp  pYW 7QX0 X p00CS0 q0 0S PP l0 R;c 00&In7b%%p%\\0\\X X0p@-@P@@DDT` U H H0Rp@\\ppX 0Xp@-@P@@DDT` U HH Q\p@\ppX X0p@-0P0@44T` U 8 80Rp@\\ppX 0Xp@-0P0@44T` U 88 Q\p@\gppX X0p@-PPP@TTT` U X X0Rp@\\MppX 0Xp@-PPP@TTT` U XX Q\p@\2ppX0@-t pX0pt0\@ ^0@\\X @-0ptX pt \@ ^ \@\5S %R R S R SSh -^L^S R 0/0/0000&O-Q-MTv u@ 0 `0 0L0 @@@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$X\ T6q0 !00`V0SE 000L0刐S{ ,0000D0400800$0S00( $0(B? $pp ,0S  @?C0000D00H0X$0pp  0<$ Dpp $0S00<00@00#ppy ,0S  @?C 00 0S 000 # 0p͡p` |#0pšpX 0 \ C@QC003/040 0S .YT RS0 00 R0!0L0S XP$0x |S(0D 0$ 0(PHH050D5[<1p0tQ@<0 @ Q (8.Z,.X , , 0  0 4 04080080 0Sf QA 0! XVX0:Q= 0! dLd0:   0S0  0  R 0  P @P0@ 0S00P0 0P00aPP}\0.S}0S 0!w10P: 0P: 60 0 R P0'{P000Ѝ&VUUU'-k$eO-@a!80S 9PP" bpW  ЍO<0Sp|倡倱%@P  @@0SL H 50CSĦ\o $寣 o00L0S \0.S0S K@0S40S  J <0Q?o20S X  ˠ040 Ѝ&G-p8EP0L0  P0S%00D0H0Ɣ㈅` PP00  pZ\5T H0J0P 0 <P B5X0 s0X00 00dt |  ` `R`S Y y( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z 4 00Ѝ1@GPܫTpīԬثЫ@ ,@dd|Ȭt0L0PP P 0H0PPLP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030P0LP0T0PPLP P0\0`P%0`0\P!0d0``0<0080 `000DPh0lP 0DPhPl00004@p؞l0 h000  L00S   ž5p%7BX&\&4&$0\ 0S 尞 ᭞`&70L0S/0 000/0@-M0S 0 00!p|p剞Ѝd0d@ `0R@X0 0B?J 0Ѝ@r&&&%`p&GT&P `00CS`0p S00 P0S X0X /Xg%: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\)@T10S H10S. 00 00,10'4p   @0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B? 0ݝT00S &&&%`X&\&T&d&&z&4&s@- }@P@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$Up&x&p@-P@Tp0 0C0 ,A @G-@0M,3(30S`V0Ѝ0 0C0| 0XPS !,Q0S 20Sn 4 "; $\p4 x 5⁛00  p,L20S 88$ (( $20S  $0 : SL( 1"6000 0@001<"$010S10S41 100H 10S|10S : S0: S s`w818q 0Rp(1 B? 0 Ȝ'Q p{ 4 p崜P^4 00S x&0&&&&%`H&&-P&L&X&\&T&d&&z&4&1O-@0S,0010S 10S40 001q 1000PS ЍO\a0TQ ᡜ0P  00`Sp᥵QPPU& Ѝ  B 1`0 |0  ,R4   V 0S[     &&&T&%d&%x&010G-S,0@010S 10S40 000 0000PUG`_먠pY0PUG l0 0C0 W cp0,S4  `YpP S`&&&T&d&%0G-P@0T,@0@S 00S40 00@0`0娀S㨐@pVG ,0 0C0 W ,#p0 00 S p0,S4  Ep` &&&T&%@- M @ p ЍT P 0@  QQ 80 LT ፝P S  %0p@-P0S``v@P PX )A @P8! {P&Hp\&C-CM@P 萟P`   T *F0 ⬜pPPCߍw ? @P w0S ?@cP?oP@ȵ%@-v fp% 000/&@-e0 Tp%@- MK0P ! A00P00!0 15 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx>ŏ 2p4  Ѝ "$ 0P @000 l0l pX   DH i"$  (0i&BG<6tO[zO-@Xe-MQP 0pPp ? 0St  p<P 0S 5P Հ Țt00CS02p1pЍ0S P PP pPX b)8$ Q440l0pM0 ! 吚0 X ̓00CS0 ap YX 0 P 0S  tܙPP X0: S (P<P׎ P ŽX0: S_PX YpPIg`0S ㈲  @ P= tP.K  R $჎P 0 ¯S , ! 00 A '! 0  A {{zp00@0 AP @p l>P ,0S X0;X0X2P -P 0-S ٌPVPtpW  DLpY@&*4p%%6%qCs@-@ `PyP0P Ua哌呌ЍpU WT\@兌僌0 =P4C@@%@-~MQM0pS  0` 0 `֍ P`! p~,5P 8!o1@~܍Ѝ00 `帍Pm ~,@Pd ~,P 0` 0 `嚍 PW `  Q \00 00ჍP8 0( '1%m 7`00CS0 K0 /O-`DLMp T0|$|t00000 0000STTLV04`0p Q 0SI\#ᢋP#00V 0030p Q  #ᅋP0 0l#00V00<30(#nP#0030002PP0"0b0 0LЍp(0: S !0 S%l ČP000`P3)0-V'V|VЩrX2PUT  ? x0M1PP S0 00 0HqpM0S0 0V00R V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 0~, e~\P0 P ;  0 \U0Y 00V T0<%&x&%%%%܁'&$m8@X'T'%}D00S/@-~M0@0S~, ႊP~܍&%@-0p@$0l00S Ѝ0 000Q , /xP%&UL0@- R<("00# Tq "  #>܍4ЍT 聟0S =! !!0#`## Ň0S1p1 00<H!0ӓ>0H!041 0 00,q(10`(00C0  弓 ᰐ  ᵓ00(  ,0$ $ 0  ᣓ 0000 0# `嗓#)# oT%%&$'p')Ă'&x&`'%C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 G 0S ߈pP (0: S)0墈 p10S10S P?LP  00 0S q4@ 1 00 0S00p0000 S(00(000 P@0S !000S x0]P 0+P0p0P 0Xؓ%x&&''''Ă'7&% 'g$'np'`'sA-MM8 㲆P #,H 㦆P"+bR$0@S 0@̂0S2e+pP| Pw 0 t S( -xQ+tO+p2Tr0h0CS``F+C+PA+L?+H=+DK+P4P0@0@,+ 2 ލЍ#+0S  R  sS SS YS~P +yS+0q儁+x*H +P8P 0SD @P4 (1P *0S +@(*CPP P0@0@**꤂'%&\'Ă'%% % ~   ! @m0@4@~z=0 CQxzw8 o6 wv PF@$<P>4S(40R(4p l$hR\00 X0S 0(4} 00H 0KލЍ0qĂ'5'؂'܂'%n!+ %*'***/O-Mp@ W 0DP 0S8 00<000SPP0C080pG0S `0S * 0R 8 00 x x/  P8 M@0 X2@ ?@8Q*>@0 -0嘰 R ሃP` hЍTT   ` `@W+9+h'd'I+p'l'Rs@-Ѝp@ 0@`PQ< 0$ vP 0o+'W+0@-@MPPv00<00S =  J" Ѝ0蘂'G-zM@`Q M Y #P jvP P 00P=! SR J(@ݍ ЍwPJ8| = $ HL0RP J(DP 0PvQȄJy8 +++G- AP ;000qPU+`00CS0pU 0 0S U 0   XP 0 SP P0SP 00S 0 S P ꜁''|%% 0 0 S@-0@0R00000S0@000S `P PP40P'''' +'p@-PP 0Sp `π@Pd &@P0/S00<0 fR P@@@@p, ,'h0 RX R  H R/< R/ $R/Q/ ꜁' '''l0A-0S X0XPX`Xp@0T R S+ .0@ꘂ''p%G,G-@c- 0(MS 0SzB1@(Ѝ0 0P50C S>t%%%%$%%%%%p20S X00 00!P 0 000! " WPPP  0!$!$! 0!ꓭ  X}(4 : SB  S<  S)  S08 0P!  0'TS+<  kOꔂ'%- -Dx2-+-s@-=XM"@p:(~0 XЍ:-07@-s@ PP Q Ѝ00  >- Ѝ0@8-0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0\  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  0C@-0S0" ^":00NB\Bb 0  \@ 02W"!N ^*040@-@T@@  'C-A-P4q4`Q VA-QQ@@TQ S AA_:TP h0d`?@ 0:S@ 0S00 0@,'%~-p%-/s@- `a P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & #P00PG- 0S謗`P ,}0P  p T@R 00T0\p0S ,=@PpPP O--ȁ'-s@-@6PP0p C30@0Ѝp0  R R00`|@P$0  `F Q00ȁ'@-$+6|p%.0 Rr @-/%@-00+$(+ +  +|p%.6/ 01O-pᄠ儰  @h0 P0p`4 0Y/   `Rg1O-@-lM/`봯PQFPP p/刯_0 p00 h?h/~pP?L?A0s 8/S XB\    CRX 0F>{zP񟗳97\479777779799997777977777777777777777777777777789D977P9\97h9t9777777777\4l8777788877779877\487 9797,97777777677$7077l77x777777788 8888@8H8P87`8><P p,PM>J=0 -R,Q0 000;l= =p, 4h(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0Shh w0S X 8 b0Q00 vKꀂ' +7E7h7p%~7C-`PMM RP s\SP RW P0S #  P0S:^w\SP R1 PgQ PQ' SQ GQ %Iw(0 0@pQ sQ00000Q0 R @@@ۍЍ00S P wtt@P p P ; ,0 iw7 87'77A-`P 0StVpt@PP P`P80Pp P @ @@ @>8S8'X0A-TPT`Tp@0T  S& )v0@ꀂ'p%8L1p@- RE jDTA ,PU; P8 \Q Q 0T + v04#⻎P  0S/  00P0S/  P00 @0/S000 0DPpR0 ꀂ' ''88A-0j40@TPp 00S 00S0 00/S @Tt0oPL0D0S sP040 ꀂ' ' 'x2A-@0PS' 0`.S0.S0S/S 4=P 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p I00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0@%A-@QpW :s0    P0d0 +sH0 R @ @@ @:;Z;v;:;9;;('0G-@T pPaV@ U@ p@P Pa @T SR0p 0`@8'=;@-<@0S (qP= 8' <1O-MX@ $PR4 840S0 {040@ 0`[ @ 0SY $P ^ 0@0T Xp@P ΊP  0000Ar| Ѝ d  P$0R0C  S $0 00srqr8' 6< 0A-@T:8$R4 CSR [ctA!AT0WV0 $P ^  @S0@rA=r8' X0A-@T`D'L@PU pP*r(rUT8'p@-@`V!pPxz @pd0dP` 6叮P0p@08  e@8'GT<''<%<@-<@ 0S (pP G 8'<@-<@0S (pP2 8'=<  @-o`O-Ma0Sq K0p40 $S W00p p00PP 0+ P UY   0Q  PPD 0 ZY00W00S ;oP5 0 " 00 RQ3 0S0 V0P QP LP `0 oP 0 `0 $`0400 $Ѝ "8'=P=@-<@0S (oP8'==C-M``0S PPp0@T " !(@PUЍ8'O-`0-@XD%   pPZ 0 Q PQP (0S0n@P  P p `(Ap O58'==A-0@T `pP1AT  RQ( QP (0@ 00pp8'=/@-`0M0MSPp 0/S PP ۍЍ(7n@P x T ۍЍ@tpᢈP 00$$`!#!0 00  @؁'=>8'A-P`@p娀TЍ000S$0S  00 0 00! !B<00S y3p1p@8'܂'% %%@QC-@0A`@PP!@p WT  0q ! 10=0` Ѝ 20p`G-MⰑ@T- `!PApT |0S! @T m@PO P00 0QB )P4]"` 0! Aލ00!!QP  z P }   pP] $ 0\0 iD Yoa( $8'G%8>P>h>>>1G- `V@0P RpY  ,m@P) ᢇP! ᜇP AZ B@P`<P VoᄇP< LoJo@8'>>?d0A- @T`pH P ATP @8'p@-Qq@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSbB 3 30p0pp P <  - R0 R:00R:/0AA-M pa Rh1MP0\p.@Q 0  C0/S' $!$ 01m -P3ڍЍ *\0@C ?\0@C ಀ0 pC00 C0  0 m P d X 0l P 8 ( 0l @%8? @?K?Y?p@-`0Se\p@ 1e #*@ &PVn000p 0 @-d? .00S  /X'x000@-^SQ 0Q00PX' Qp@-!0PS   ph P@t Ll @@T@p00@5%?@-P`p@P   P 0|Dh0` l? Ѝ0 0 P0AQ$ 0  ?2%??+@X'A-`PPЍ@"*:J0840K0CS 2  `40 01  +  d] } (lT <tO @|qp  A=L / $  04 -B2P" 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$d' l'C-j@EM0@S( {${@{{p{P{`{p{p{30S EߍJ(dJ(J(J(!L 0\ ` @ 3 30ZQJ(t S7000-00 s++  10>L  Rp0<x P J<p0@ P J11  = 0upP Jx<'d@家Y   EeXM  e} 0 PpP J} 2P MP$PP P  0$p pPt s0cR `2PX'BBBCC5jCC"Cek@C'DC%JC0@-MM@Ph  =X X 0P U+@0  $ $ ,  ݍЍ0$ X'p@-@ PP hp@+QCA-p0-S0S) uhPP%zj 0NЍ0` S0 BP@P,0U ۑP`'gC%zC-@-0@P   zЍ@Ѝ/ဃ'p@-@ATp@0 R P6P ` `DP`p考'-P@-000  x0 t000 h@0S \ 600L0L <g ,y$ s6 Ѝ@ Ѝ/ᴂ''''p%Ă'ѱp@-xZ@Pl囐hPP \ᔐP pcZ000S  pC#'''C -P7@-000  0@ 000 P0S | *600l0l hg XmyTiD 8g0 6 Ѝ0@Ѝ/ᴂ''''%Ă'ѱp%@-遀 qgeCp%@-Mf@P" 0/S/P~/P [p \[p 0RP 0RP @ލRC8@m 000/ሃ'@-@ 0gdCp%@-`q,M@T xx!gpAPD00CS0@@Da Pp= @Y@DOoB0S@,Ѝ0P: S _[P T0S d Q 4! P000 @ 啴0x @ATf0 @00CS0᫐0 ꈃ'Cp%% D6%ADO-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S@'p 0-S@(i )e&c#a@ ^@%l'BJh'`'EQT'Q0 @-P'Q0s@-P0`0V0`0S@ P 0R@P@t  :P@l0S00S d0ST P000 R  ЍpP'x'%QpBBJQ@-L ^xdТ$D ܢ\T @@~, \5 01#P?0 C c0à?00à cΌ SQŒQQP0R0R0P0QPQP !RR,RO-`ps딀 %RP@? &R X(3! /[00  @ PP@ ЍP'9R p@-8M@ T 0`  P@8Ѝp @P R 0 0 0SP@V P@ 0 F/P@( P@&a YTP'p@-@P0)SpP'O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D ` S! uz!P n0 0@@! b0 @PYVP'T  `@P,  @` P'pRGRURO-M8Pp`6! @20 X@0DS '00S^^* PU@  0 S 0DS00SY Ѝ` pUU P'DC-`p  0BS00@SP! @00P TQ@@ ЍP'G-`d0SP@! p000 0PP@P'@-$M@` P1PL0P  IR NRpp 0PPEP@@0S@ (} )1$ЍP'RPG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 Pz1x1Sp0@s0PH0P@ 0,O0a1%%%d'x'@P/- 0/SSS00p'@-@PMލ0/S\ Tp Tp 0RP 0RP@mp@-`\ 0@P 0D0p@L0K0v0"SP Vpo2bqp'Rp@-T` RpH0@Q 8 PP /pp@p'X%RO-pW,S 0S)P x` C000000000CS020S @T  R RSb|b|/\h2@000/SpGLL/pDPR0S 0/p0CS0p@0@ppW000000pA0P00 `00o/ Qx Q00CS0P10S 00CS00W0@0 pR0S/S0@D00N00W@0 P  R*0000t/S0S  P 00CS0p@+0@pK0S 00CS000@00@0p'''RRd'%%@mA-p`0@00SP 00CS000S @ 00CS0PX00S 1X @06 R0S U$0$pN%萄''%p' 2G-p`BMx6&0@T"BR@P$ 0SM .S00.S0 00/SSC10  PPB ePpZ% ``VT&PP@ <` 9. E`K0E[*@!\`0-S0S0@T@@QP.RP0: SVP >PЍ%R'R|FRp'RR@mR@-5$0Q @ P@p'RRp@-L@Q50P000S LTPP 0S{@@L 101 M00CS00 L 0 L0pP`R''Sp';S%\SG-PRp p@1`0V1 NPp GPp `R\TQ @0Ti \0DQS񟗀lh ȷзط@00CS00 NL 0@ 0 @T0S 00CS00 7L 0 0SX00CS00 "L 0 L 1% 01 0@Q  0BPA0@D@@@ @ @ @ @ @\@%qgSA-@ ` PR 0R 0S SKp0S0 R BL0S  ;LU  %LT0L"_ x*Lv Td@00CS00 K 0 AK%|'Є'ѱ%.% @-0S #|'40@-@Q L|'@-x0@T   @@@@ @O@00S 4060S 㗻ۻЍ|'`'%-$0@- R    ؄'-@-  0@-؄'-@@-00 H@-@  =-@@-  3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0< < @-oK,S0 / DsS'0/᠄'p@-@PPPPP ,Op` 0O`P  Op` $O`ps@-|P30P h0 6 N 0X0X`@T P~LD0 0 @ M@Ѝp耍'%'B ̑'s@-P`@0S'@<0`=&k Pg{{'jfk[[Z06S 00S\  ЍpJ @0t0S0T.S N@'T0    /᠄'@-@TЍ0Ѝ0CS((\h 000 P 0 3@ 00 0@-M@ PU 0 PPp '+P   0HPP p 0   Ѝ0 [0 0ꠄ'\%ygd%@-@P 0S0S 3P 000  Ѝ̑'0G-`S q0P00#h@T0PQS$@^&$00CS010S .Ѝ00S P UN7\9  R 9)P00CS00S U@0SM@ UMPM@ꐄ'''TC-@PsM^P`( UPG*릐) Q<(T`(X|U2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S 4E@ P10S %E10S Eo^0St1 R$ R @T$@L10S E(10S D10S D00S D  @06 $0?o2$0-x0$@T $ fd00S D 4H0cH Ѝ%'''T%G-MPp@)0 1뤀夐夠`>PP H*Vx0$`W U ^0S W 6P 0`S)Ѝx'%%'P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 PF*D*S p0@?)PD0(00$3*0 $ 0$/%%d''A-P@쀟0`0p0}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S Sꠄ'%O-$M࡟A^`PV $`()pWS0嬱p0p堁00WY 0S, |1k2GlG G00CS00 zG 0= H00CS00 hG 0 JG  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($Ѝ%'x'%'QC-$M@쀟 p( 0 0`@T+ 0S0 PU@ 000gP x0 0 SP00U$0 @ R^PU $0($ЍP0x''%G-@$Pp0ESoᩒ' 0S$ 1a11-G+GZ/&GU"G00CS00 F 0 FtaU000 S&PE U8q0$0! E#$  A BPP00CS000S 9@00CS000S U0S0S<0<0F1FDF0GGFUp%'%x'TU U'''$U,2p@-FM000000 10S 00S 1Q11 `FF0@TF1F⩡PP% t1 1@=0S @T D1娡 rA@gF4eF1E0S 1 $ FߍpA 0 000 0?P00CS0 0@ 0 00t0 J=00CS0 0S 2Fl0FD0EX00S M@00S Gꄄ'%'%x'T5U'%0P 000S I<I000 p0CS0(00S +'$Ѝ%'NU'?C-@0mM0$8@P0?_00? 0,@0X@ & 0d00 0d@@`PჀhTh0,o@ 0p 0l@PpT 00.Pp 00,0d0S,c&d0(S( 0L0>60S >0S,0S(00L0, (01C(0X>0S,0S l@ 0 @$0 ?PLE\g< 00<0,0 0C0(000D0004@ `N00CS0p40S P% 40S()\0S`N1H4@ 3 3 384D)0093 8 0S '0R\#CX#0LClH00S0ڨaM$0 #0C0000lNG3@ 2 HC 2  (0028 \0S"00CS0 l2 R   $0L2L0S#mߍp9H20S 08"SS2 @0@ T0P@H020H0H0S1  H0S2 1$ H0S x1 H0s1 R#$0S1   B H0S H0S7SHD0 10S 09@,0S 0  [;,0Sl@Q zC0,000(P D@T00S t00xE 40 0L):Eq̑'|''x'x'%E''NU`''''%p%'',%%%%_U'؄'!h' qUDB ky0/᠄'0 /᠄' 0/ᬄ'0/ᬄ' 0  /᠄'P@-@&P<80PP cR   U' 0S0/᠄'00@-/0M0@0厯P FP 0: Sp  Sd PЍ0FP0 : Sb" PP̑'qDUp@-Px@x`M$P)00S ["0`H000``0"!`"$Ѝp蠄''@-P\@$M&0S0S 0C0BS00 000蠄'//A-PM)@s @ (`0p8D@HPL pPP  0@PЍ%U%A-@P`DpWU PK! 00'p舍'Є'O-pWC R``%` P0S:S2/EԐ @0S,W@  @80T/S/00N 000S00P R:R0:SPPP@DOP!S!%%Ԅ'P@-@/` P*  0 똿PU0 "U# "`VZ0S  0 o녿0S 0S }PN! ~pP@P> ER~    0uԄ' @-PM@Rq4`1p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 ~? 0* 00CS00 n? 0 ЍU ??U P000vJ00CS0L00S <??0,̑'UUU%U'' VVVp@-P@@Pp 0S%SpP @Op@-P8@Pp 0RϻPp@LOP0P- 0S RP P\ 0%܄'G-`@嘀0唐0P0p 0S0 S0S00PPP|U00CS0$00SGQpꐄ'܄'%'0G-@0`0Pp Q :RQ :QR``R %Ru 3$PPP0T:Sp0<@ 0 /PSu`P̑''2V%A-`P倀000p 0Sp00JTP@T`|V00CS000SAꐄ'܄''0A-PSp R+sh`a@T"W p0006m0 @0 0 L00CS0H00S `P `@Ԅ'''p@-P$@Pp0@P0LO@-L@000@00 O00CS000S@ꐄ'Ԅ''O-PM/`@ 0uP @@@ (CP00š0 0S 0S 000y#   P@ 7P @cP< R R R 0S  0  # R00 m P B0000S - Q p" R[0 RL"00Hp0  pP[ X 2@x 0=00pЍQ 0S/Q0S[q "P  P x"P R ݼ R ټ( BP0 Q<Q 7 0@D\ P Q  qP@0000S R p  BR 9D R5 u3 s̑'1V%'Ԅ'%2V:V%?V'O-@ 3M`p%2PP*0S*[ "0 00 `0p0Rz0#| 0Z8 RhB<01 P =PЍbPEUppppppppppppp  `@Q D <V  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0SLXT 0s  P aw=TTV'܄'%^VX'̑'%p@-P|`0000S S@:H000 00 00000CS0p00Spp@tꐄ''0@-Ml@ 0P0000P0>00G 00CS000S UЍ0萄'%'@-aP 0SGO-`-|MpP@$P0cS    @RpP` vPP VP@ E RsYcS" 8U;ܢ[BP VP  R񟗆 0R $PU`D;%U 4; کP& ;;[ 00S A00CS00 B; 0 0@ T Ѝ;/᪩PVd!     [ZU!Z;;@PU;U~bNU U UUC;0 f@000VVV'V%V0GVWW%.W̑'V4Ww;WQWfWWO-$M,,R pC0b@  @T- TT:T"  T /T" 00CS0@  @0D S8 F$Ѝ0S R 4a@T00000@0S?@PG?)>P@ @ $T аp~X =W 0 0CS00 S00CS0 0 00CS0 0 y00t00%\'d'%FLA-(A0S 0PS0 0aqP0S00 P000K00CS00S P 0SRh`hp0P RP000K000CS00S g\'''`'s@-0!S1Ѝp*S@SP``00P Q0C RP00C S@Y `1@R0S00S=STT00 D0 R 0AD1U0 0S 0S%h''A-``pP0@S  R R00PH @\'O-Ms@0S0000 0000,`آ<000000000C <` 00@0000$00CS$0C0S00CS0(20S  P}=P(0Z00(P= P J(P 1X0 DC{0@0CS0t10S Ѝ蟸0SJP$ 00[. [`+ V , R:@ 0 C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @\'%'%''d'FL1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SΦP ɦP@P P弦Q DoP @@` \''`'(%kgA-XPX@X`P0p00I0p0CS00S \'''@-D@F?0 @ Ѝ\'Q@-p@0` 0S*00DP`@坴P@0`SP Ѝ `P0@P0`S@0S0O- [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ RB0$x RP  R \$Ѝ$;PX:$P 0U0/Sl 00EspP $0S/00E0S``0` xQP  0/00S ^V/00D x00SR00Q: 0  R@?Ƽ0P . B.Q/o" R  0P V 0 8D$\'@mRg'0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0SP P $$$5G0$000CS0L00S 0S 0P 0\'''p@-@ PTp 0@ @@\'G-p @00 ST@D؀0P `V p`RxP VP V V@ S`` S =RR QU  K0P @BJG- M⨀0`@GP0 ^(q000e U00SV-00ED`PIPE@T Ѝ00CS0@d' RO-@@0M-S`P S! C R,d$ddddddd?So @Sy 00C Sh70 0,`/0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 6p즟ؖPW@A0S 0f0CS00  P6FBЍx6P6l6`0000Q00S 6 pR &V(0 0S 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 !00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 RL 0ppUppWㄣ~0m R  R9 V} WHs 83 BR  BR j ~  BR s `2 BR  BR  ~  BR   g ~ a   0S  QAQAQ   Q61  ( ~ AQUd Ra 4q BR  `VaQ~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00ꈍ'h'FLd'\'FF%\'Ą'%'(%O-0-$M00 06 0=``dVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG| A@ TZ  + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80-0  [ 0 + Z R CR 0S00[F00[ 0@S30S 0@0 00J S񟗸#"X"##""""0"`3 BR  BR  ~  BR  ~  K R  BR  ~00  BR ~0 0 ,Rw[B0mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁00I00 : P 0C A 000 1 1 0AO0000T00 :LP 0 00I@[@R p R0 Rp Rp B\T   R0SBJ\'d'd'%%Wh'FLO-0M  P0 4400̴̔0@ 0~Q  d嘤0 p0@Q Q#:Q =Q Q Q     BR  P AA  p A P񟗁(%(((%&H'&'X 0S@ЍQ Q@Q =R 0p(0  BR  pwp w    BR  u  r u  BR   a ( R  0BQRQ B  X  BR  v p}= v 0S Q AQ~@AQ  RX  ~    ?@@ M  7@P)  ~R&=Q0S! 00   @'(%\'%d'x'x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S000`0`0CS0!0 0@ p  0    0  R 0s00k 0p %\'%%d'x'x' @-0l@U%O-TAT`0$M`F:0PEPE000PCP$Ѝ0000\'%d'x'O-aX P0@ 0p R    000XP X 20 E0P0C0 Ѝ0S LL ."008  @D0000D \'%d'%%W|FWO-@ r  DPR0400 ` R}먂 R    00h2TP`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C`F0T000@ D00C0CS0 000000C00000000%\'d'%C-M@Pᬐ`! 00000吀0p0p00CS00 p0@ @6Ѝ00p\'%%d'A-Pp@-A00CS00 ]- 0 ` V-00CS00 F- 0 ` V#`-00CS00 )- 0`k$%˅@-W@-W00S/ R%T0QH0 0Scq o/P0//ህ'%0    B /ህ'A-@P堀0p000` R$ 0 `0T    0 0C@ S000SADꐄ'%''0A-P` @0p0W0 ᙧP 0X S S0 000 00 0h0    0 0$PT j>00CS0 00SA %'%''A-4b4B0 Qcr 0S \,Z,r0S@0PP0/0P2b000r0Sc00CS00  0S 0X0#S 0P  0P,0  00P0 P   PER SP   BR 00E0CS0000`0L00S Y,80+`Q%'%%W%%@-L@00CS00  [p00CS0@Rꈅ'@-8P@P 0     00000 0$00%'A-P@`000# 0V |`0Pڝ#p0PS H0  0000CS0 00SAꐄ'p3%''@-p0a0M0P0/@P[1P(0: S$0 0 /P  UrP/00 00 /h#T/L00CS0,00S Ѝ萄' XX X=XWX'A-Qd@P0`00 PHpP <0`00CS000SAꐄ''%'p@-`P@00P0"P < 0S00<0X 0000CS0p$00Spp@f$%'''0/%p@-@,`,P0SpSTps%'oXp@-P@0Sp%'p@-@Pp P0Ppج"0@p% 0 R/% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0ԉ'5rO%A-R0S20SPA`R p U".ppPpW*1 N /p ")"7P . 0P 6|&&&. qP /p=  7p,v= . P /pg=  7p\= !00n&k&h&`ԉ'`'%CX%=\'XX0S/p@-@PP1PDHAq8a 000P0R 0S"0D@[05#0s  0C?o2^0SP{pAP =A xP0S *00CS0p\00Spp@   PAoQPԉ'Y5rO'@Y'Y'p@-@\P0P00 C;@00CS0p00Spp@ꐄ''O-@TM` R0 TЍO)ؐY. PPY  x 0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S|22 F! R0+  p  !R -  ")p 0`"0 t) ԣp0 sR0 c70ȣ p)00CS0(0p W )e Z 00CS0(0 00CS0(0 | 00CS0(0Ѐ YZ(000v ) #40  )  )P S#4;  0 ]0p@ gp  (Jzp0㓉(ЀH4p6ԉ'%5rObYkYpYxYYYY0 @- SS0C 0.^\Q0  @( CP/o" R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S D1@@YZT X@1 r9 002#00S 0S 0p?Sp  /P T"@` I Pr P L `0@00SJ R Q !" R @%YYԉ'YYG-$a$0S Qq0l0@S, @ 'ĠА0Sʰ00CS00 h' 0 (0 R  0 S !'ԉ'%'5rOYY ZY%A-pAP`'P00Sʄ10P 0S hjPp pPP gP`W@ P(1@@A'PV QPU, 00SJ y'0 r'`00CS0 &0 S 0 000S0 S 0 0(p(`ZZ'>Zԉ'5rO\Z6w+%40@-@T  kP@@dԉ'Y8 P  /Q 0SZ//ԉ'G-pQ0SPS@00SoZaP000M:0@ C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i @D0 Z8@Ꙃ! P00B R @ԉ'''%@-@S`!1pP@! [$Tx1@WV2 h1N0SP U 0S0+*V $13p[9!p"m"060S% f"c"`"Vu$r$U 0S P 9*`!*P PPkWT$0   ЍV`''\'ԉ'%%Xw X08 N R S  0S  P %O-pRBM0P0 p` +0S0S ЍP$$0 000P@00 !T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 02   \ P 0Q R0 @|. \ ~  ^Lo \ Q  P 000 QWP@~  ^Lo \ 0''ԉ'`'%%' G-pPJ@P DP1N0St `2@*T @*t2pj-8 k㠠`@0S0S 0S0S;`@Y 0 X 000 E%%jXԉ'A-@P| P PT0Q 0S YlP@ pP@ ZP@Y|06 R0S@@Q`` 0pG  0 0 SkbZ'%%O-@Sc$M5 PT  %P )P pnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP pjY  \   0`P 0S00Y 0STP  o'$260Sg0`00\  \ 0?o2? TW K'\0#Q 0 !X R5  p"P0S 0S00 0 RZP S  R 040Tp/o" RP 0 S0C0 3 p0SYX X YPPVZ'ZZfZԉ''k$%p@-@'dQ000` R 0S <10p 6!0S 0 00D1  S ~0 0P0RB o` R\ `` R00 ㈓0S00CS0000S ~p萄'%DXԉ'5rO'D1@-Q80@S [#qP`0SP00CS00 " 0 $0j0p a$6.b!P0#pP000T00CS0@00S $ Ѝԉ'YYY%%X''@-z 0@0%'@-@ o @%p@-`@00  p 0Qp\ PU"00pԉ'ZO-TbTPLLLr 0@0U0S  U"0PE0P ЍS S =S\ 'S " C 0CSl___```$`0`4_!$0PU0 R$ \S0 \00 S0 @ P   0@ P0#P!"00 P  0  @}00 S$0 )0!"0T 0@ 1 }SP0  :0@4 "0 ԉ'ZZZ%ZZ:cZZA-@dcdsdMTZ 0SW0Sac8b0b0bbbbbbcc@c8d8dccdxacdccd0d0d(b bR 0S  "%#00CS 0S2l""\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8P dP aP ^P [P X PU @,ԉ'k$lZe=[Z[[[!U  [[[ [,[%[Q$2[m<[8[@[E[ZZeZZP[8Vp@-@D`PTpUPU 0S G@6p@-Pt`t0PP6 R@N0S@2@@0S@D. 0    p0 pԉ'%A-0P@`Tp R@ 0N@T P 0S@@g%W\0HU 000000V0@ `'%%@-@ قp P 0 Ѝ@30ЍV[O-Pq 0M00S 1a Ա100ȡ 0000 S  @PЍ0SG 0 RS/Q L C%P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@.1 @00CS00  0 ( `0SH0@ ᷚ00'$''|F8'Ԅ'g[%d'u[%%A-M`& 1 000 0 0A^W0@ 0QS$ 000'QPP Ppo-00CS0H00S UX(. <)f '''B\%\R\@%X\w\\O-hsMf@PS`P>Ls0SC<30@TDUP3X  !0  @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S8X0S UPǗP= p 0/S9S W:00C⒋+pÿS  p P 0 ( : p~A.L 0 Z @0(IT0 S PX.0Sykz0tS xztg 0  0P]\E']O/\%k]]\ ]\.](]G]X'`] BR00/00S/@0S/ R /0@-@0000C S ʓ RR R1\0*Ѝ]]000C S0S//QX0 0@-^ @P U@R000/%p@-`@`P6N0Spv@Tp@  p@P %P'Z ^G-pPR@`Q7 S`r@0S 0 g `V@A00CS00  0aq唁 @ Q  R  D@TPP,aHqH0 R R .@TP@00CS00  0 Q SP @1@ST@Q@`Q @PGB`V0@ % ^.[^%^~% 3p,^6^l^S^=^E^80 \#P0@-%[^^^0S/p@-@PPEPp@!+ +A-@1S`@D`pPU 0@P00` P\h'G-@PPaP000 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SGh''[^r^%A-P R B0– 0`0Ճ0S 00S0S006X pWXP TP6p60S0S60N0F S60N00 BS/o" R 0 0-S0F0 1  QR00SQ 0S!0P   000S  00^0 PA. R   R0 0%h'^Є'PG- @@P0Sp` 0C  0XZO0A0C  R0 0CS0@00S 0S )^h'^''P0 @-X@000D00S 00CS000S i萄'h''000C S/ @-P 0  h'G-0p PR 0S6Q 0S!0 CB10@?`! :,k`` `@c0i `` -R \ -Q0S `0@T0:SE 0R@/T/:Y  @`2@T0:S   @`#@? `0 :\00Y00 X @0 CB!08( @ Ѝk$^^^^%%P@-HD0P  Q 000CH Ѝ^h'x'!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0@:T($h'*__p@-H@HP080Sp0u`0CS0` 800C80%d' 0R @-@T ( 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @% 0S/xQS  00 S/00 00 0S/00/BJ04 00 0=S0/S 00BJ0 0 0@-%_p@-`R`@PP t00P pd0 Pp0-S0S0 0pV ($00080@pX'T'_%O-MRp00 p R pl2l"lb@h  0SXy XR00CS0` 2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { d Ki%F%%d'%0-@0LM P R00-0 Pl l "$UT 00T<0< A 001 0 % `$`M`Fb`?`@-$M@ 0Q 00SPp@`T*vpPT @T%PLP @0 P $Ѝ@%%'r``l000S p@-XP@T T D0T@p8040@p 0/%̅'%`L'%'0@-@̅'p@-d@dP\Pp P 00008  P8  p@%%uG-DR0@T @ B 0S 0 @0r 8 0 00CS00 `)V*V V v va G ` 0F SȕLX V0@000 @\V. |V ;V&P0 @ ;P0 @ E@0L Pp=x&P0@ 6@0o|P0@ -@00@0@.p P  00P000K0  %%''JNG-pc00@ T T+P,0S)㰀" PP @̎ n@@`P  0RP @FDA@@T 0  %0Gp@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ p%`@-y0 000%@-@oPp@- @fP P @0 000p` P 0`@`%O- 㰑`P0  P㜱@APp0 CR00S00 p0@X ',10S @%X U \@P@W W- V- L0@PpGWPV VoP 0000 V p0S 000%FG-JM0 5@0 000$04 00400D0(Mn`P $0S $$ 4 0  |4 Int$0000$`SH4 `$妍,4( ($00CS0! 0S$@PU3 0RPPS p10PS Pv '30S l3p@p3ppL000 0S 0 s`PPA P5 \P p'200pd PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 P`@0000 V@ "00CS0L001@@PsF n@m1000S 1 0 A0 SGl!|V@0  0 @00C0,000#0$000CS010S S0 0 0 0 02 P B1 0R @z0PEu`0PUZJߍ6{00CS0`R {00%'%'%'%d'`O-؟د0ϟM0 Q002202280?_@? 00`0"00/20S@0Sʴ@ 2PةTh̭ЮH0/Q00S .00CS0.0.Q00S 00C00000Pa210S0xPVTP"P_ SPMpMxU0@#SG긥ĤĤĤĤĤĤĤĤĤĤLĤĤĤĤĤĤĤĤĤĤĤĤ Ĥ4 p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lp0 S00C0t00" P *'P 0p@W00@S p p p p p pq0pG00@Sq0pG`0@? @?o2;R0Sp ( \\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~00ĕ0 0C@0pW'*00C00'60'3?00  R ~ B   ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R ~ B   w$00C00'<0'9?00  R ~ B   ĕA0'6?00 Q~A•W?p00C00'?0'X,UP/>P0 |P000P$@90 ЍP0 ,  0P$0 &P00 0_<P >P &P000p0p0 ((0 @0(0-P   p 00 H%%HMd'%''`ka!a8aPaaaaX'T'%@%'BJaG%aJNFLDK {P B@ < }  h p {S D  B p/#P0p*0}P$  @@   ? 0 }PJ0 p 0C$  @ Dp0H! , @ BR #@jx! 0 = BR@ Ĥ0O0@Wj%S` :S/ #S0[ 0 p;0C Q @ BR @:W0 0 @ R&  B 0(0:E!p0ᜲ S{P H02!R1S p0HS2@p0 pXp{  X0`2  !o,!!j00S }S Go᫲[| p'P023Q w0 00`"0 !`$0 0 @ B "  $0`2  !G-`ԀԠ0@T@@0PU 0@S 0 0   B/o"K`0 0pS 0 R 0 0 0&%HM@-.P20@-_M0$ 0 E1< 00100m1x0000gPI1x 1@Q  @<00 do 0S $Q. 4QG Q 40 1(0  ,8  (V0000 0 0 0 0 S00_ߍ0 t0 `0 H0 D0 H00SFgS,0 0ꄄ'%|'%HM%'%aG- Vp0 00 P" 000P6(((((((H(((xx4 xxxx0xxx0$00p@ [P 0 R 0`     u00S 0 00@% P0, RPU 000@ 00 00 R, RP4 >00300 0000    BR   00n` P 0000 CR Sm0  P P` ~ ``xs 00008 @0C 0 F009`0 SpiP \0 R   L000`0S0 R Ӻ0 0P 0 R000$0  oP 0@S P 000b `@` 00P0`M P0 000000S$ T 0S y0@00000S0P0S@0S 000@Ѝ0$00pV%b3%%A-QQ@`` p @00 P 0X@p 0P R$@@`,R ( W% R"pk0` 4 kP %/Px`P 08 000C0%04`Ѝ Q  0Se0 00 00 @ 0%%b;bA- @0P P/ 000`P 000p0@``@@xP 0`0 U000 PPe``0SU (P%%Mbp@-PP @0 @LP P 00000Sp pp%`b P/0S/80 P/0S Q/0܍'p@-@ `P800`Pp@-`JP宽 PP  g Ѝp @P\ $y!yyy y  NU 0P/܍'RQ% Pp@-@ P3  P _`)  ]! pS0SS|h R 00CS0K0 - Gk$dp@-@ك0T PR R R& 1S#0 ăPpR!Q QT " "D0600S0T0S 00S0'''%0P@-00 880P  F ЍBek$'QA-@ 00CS00 xpxP ` C?U U P@U00CS00 `A-@`xPx@0p000S 00S p`V@40`00CS000SAꐄ''''L0P  A?Q Q R:///'@-@bM0pS10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 sp0 0S" UEodsp$ W`RUp7@D0>T000 000 P Pt0N R  DTR 60SЍQ Q2 1 @D@'`'%|'PO-P@p P `P P 0PEpSUpUX@@&` PP{`Ppl44mPPEpU]X (d(t(P 0E0 10ST@ T@P@UT @csP1 R 00ST|y@ TL@P@UT ,0s0@Q0S 00S iX@@T`X ̢嬲pG`Y P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP  cPP 5PP1 ~` a0S\  0E T0 S R0T00 @1 R  U@ ^00CS010S VP~`PPP@q0S 000T 700CS0t00S /@@T006GeBe%'.eeeP|'g%ee'G-PP@0`嘐 ?pD 0S 00S 0DE0@o000CS00S pW@UG''''p@-PD@`02S@20CSpqV02p',0T0SP/0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2ѿNPᬸĿP 0S ǿ'Ą'$0@P/!!R /'p@-8P\2Sp@xur\Bp'0-MM 01`"R !R X"R   1 1d"1!d2S 0U\Ph10 0M\P L!0000E\P(10  I @T0d`0P0 U @T 0S SP100CS0 !!p0 0$0(0,00D>S '00  n"!031'Ą'''0@- `"d{'p@-@H#'Pn PPp0B/U00pHHp@-T@TP0 0P0 0 0000CS0p00Spp@轴ꐄ'%'A-p`@PU _0PPEU` XD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 00 00CS0h00S \sDP`00000C0 T'''p@-@P@0SH00Spp@00CS00  %0%0%@-@P<iЍ f-@-  Ѝ Ѝ/-$0@-  ЍЍ/% -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`mP$ 0S! lw0S00CS0>0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 6fHH%0R%@-@@%@-0rS@;f[f0G-@0 p0R(0帀P0=00m=`l`F@V@p@DR000 S=S B`` R`ť` @GYP%d'%0@- 4@ 00C000 0Ѝd'f0P P PR /0@-@LP^ ^ R0L00/BJA-' 㴀0S RP'p`@PU pWp0 \ 0S 0S   3/P@P00ꀐ'0SeA-@6vPxU p`pp0S'SSP@HAL'LlPP,  EAefff6A-P0@S`p    3/@P@PX "W p0@=SPU0P0 00CS00  0 00CS00 w 0 T xP%0tO-@0Sp 00ЀP0 `V S0 g@PU* ЍY   R Q ʁ f @0aP`0 ld''t'@ 0R S=R/=R/A-Pp0S=SRpGp'yh0h`U!0@a`T 0S  CPU``@d''1@-`0@S @ PPV 0 ` K dw  `C Ѝ@@q   R <0 2/0` 0R , R  c0a0 00000@!L @UP U0 ]00CS0\00S ЍY0#L 00P P %f'd''@-@P= `&P pTpP Iwpp0  BR = T   `\ Ѝ00@0f\0-GM0000WP00$0 0  Gߍ䄄'p@-X@0`P @0U<"&0 `00$0U p@d'ffZ ^-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝh'f|'Є'%P'p@-@XP`000T 00CS0p,00Spp@9@ꐄ''7@-P@T@ PP0 P00p Ѝ0 yP 0 @%00000 00PHd'fA-Pp` 0  I 0D @TPUA@ 0@00`ꀐ' @-;@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =i@@꤄'O-p@Q0`rSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf 0P=S@7 P( PW0 00 0  ắ`U 0 X  ЍU0 00 U 00S -W BP0>PPPP'fg@-` pk@P@ Ѝ0  R@ PR000 00S |0000   2 0  - @@DT@00S ήꐄ'|F'A-`pĀ@TP0U0  :u  0 R R   0 02/0  00 0000d'%%A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V Y@,g'PP@- 倮 b1gC-pԑ0P000币-S`@TQ t@ 000@0CS`0d10S / Ѝ @P=hP 0 @0 0 0  0 00 000000  RP 00 00=S l0T 10=S100C0 PPPꐄ'd'%%'  d'p@-@PTpv@p@-PdP@ \NP@ xP@ IP@P(P0 P pWcgQg'00@/0 S0@/s@-@x0 0#P`x0S x0"S U1r0p%!*0S`0Xឭ000 @0C?o2R0SЍpg@%g@-M@ P ލP@D0 SQH0PP0@-M@ qP ލiP@D 0RPH0PP0@-M@ PP ލHP0RP 0RPA-@`mP13@ 0SC PUA PPPpPJ! 0RA2 @- 0-RS# 0S00 0 Ѝ0SX00T0 S00080 ,tP$48IHI(Jg0I0@-P0M!S@0SPЍ0P{ 0SxPUo U U jPo U P? PPEURx x @ x  ( 4 x x x \ l  O  P  P  P  P  P  P P p0St00@T @0(S0)S 00qop@-@`P(P} 0Sz00CSt       < \ t     ( T x tooptPt tP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(EbK0S0!SPpp(S0)S0S pp@-@PsPPEsP.U)0 0     0op=Pp0\0!S0P p(S0)S0S OpW~fh h@-坫0R@h%(0@-0 00 DЄ'%bh@- @o R1P\0* LЍhO-PM@( U0pE `-R lRF 8R -R| P*@P 2 000J @P l*pe pGW` rPpW `dd`F %RX aPPx8(pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\#*p 9*Pp ˪dl㩪X1Hr@P )@P0S0Sp@vu  ;o Y0Q Ī RP!|0*QPWu Rpu`  ᐪTT{w%@%6CgDx7iih%pBbFih0@-DMh0   0@@DPU# @0     a P xtt, Ph DЍ0=cP "kꔅ'ԅ'\-k$i(%E^Z ^iiZp@-00S | 00t 0tl l0l@0   PU L@L0L D0D P p Ppꈄ'''%'܍'%%%%%p@-ޠ0@@倶G0 0@0PU@000kd @0PB0S00CS0400S np@i@CĄ'%܉'%'''P/p@-@PTp000@p@-@@aPTp0   SCx<Pxxxxxxx`x @p@ o00  so00@ pP0@ P  /7@-@P4 0 P  S'888888H880@@``0 0 000@0 Ѝ0O0 0  0 000  00 2  0 000  P0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /P/ 000/' 0P00/'A-@pP 0` V  V @00CS00  0@ 000CS00  0`'%A-p@`xT [TP 'T` *TT "T[ RLhH\0DS7T /T@Pp+ 000C R&AET@ 0@P 0 \ pR 0  R0 p \@@aC\BW0CAC\70C00C@@ @ @ @ @ @@Cj@%j'i@-@qP`P \P@0 cS 0<0 Ѝ0S@00 #10#7Q00A\ @5/MS0-S@5/^S   4@^S@0?S0@%'0 0Є'aj%A-pmX@P@ULᏧP00`E ,V`j00@00'}j'@-@ R Q@@q80   r"P djj'l s@-0@T 00q` `PUEЍp'j@-p0PU@` Ѝ 0'R"R@@0 @`0 0S D"00q @k@`'jO-0xd-0d4P ,M1P0@1%~`P#3p3PEAULPE@ꋟ0s  00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`b0*S>`0.S0@*S4@YLጦ<G`(A@0xY0WY BYR +%Yw AY* X0I S' " " " " " " " ""d%x&'""" "' " " " " "' " " "& "' " "'E0IS0Q[  $0'S"S"Z 0S 100吪{[v' t  iTP  lP T" l^\s00v t 0 }%%jj+ kj@%L'%gS'k\\0LST%\%D%4%L%,%<%$$$$$$$$$$$$$%'\ \\ "\ 0 \ M0\? \@-ÕÅe0\fnrtvabXP m\ PX g \  P\  xo 0vs  t 00 p{ X0,  0u @ Pt  pۜ0 R0 0C0@00  B+ 1H 01 *t v0 t  to0$o0$  [ 0t 0wNVBT,Ѝ3 פl0C-M`q 0P` Pp @P 04 p@PC 0p W  ) PuY <Y{lPP0( 0ES P Hژ 00S00H p^YPH0?S0 -S00H0,Ѝ(,kl\p~ppppp P@- &=#=6qQq@-@00 0 \$XPX`Q ] X  0Ѝp@00  Pfq,kqqO-Mp:]Pؑء؁00 @P1 0S. =]PP00 Hc[tkP 00 \a8i[PkP 00 8kP H 0$00SЍl[kP 0 0o[kP 00 kP cH 0(0 `Q 0 SkP00CS MH0 0 0S@lqw+q,kG qqZ q0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 8 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@Nk0@-d00$ 8 Ѝ@-@4j000@-@4b000@-@(0(S00 0V0,0Ѝ`t p@-@PP}~HP\`8~<~@~D~U~\}~`, 8`V0,0p8*@-@4 80,0@-@48 0,0&g$@-8@( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ P; Ѝtq@-P;nt q@-P;ot q0p@-MP`0@-S00(000 0P P0P  (Q`   R4 4F03/Ѝpt-Dlq\pA-Pp`@Q`-VPQIjP 000 0 `T`P($F$V0S:ЍJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 0 d @9pԁP0SU jthT   Q  0녑 P0t  UKtIP pt7tMtZtftmttts{trst,kt(trrrrrrrrrrrrrssss&s.s:srCsKsJsRsYs`s_sfsmslstsss|sssssssssssssssrrrssssssttt@- Ptp%00@-( P 0 0 @d'cup%0us@-@`i0 00#S@oPi0S 8 700S 0 7Ѝpu0S/#Sp@-@,P(p0P 00pd'cf@-PRP@ p`7p 0R" Ѝi0"S0SO 00SS  00@O@%p@-Pd@0S 0S 0SS <<< U   S(000P0px'R@}@- @Q|^7 mf P X0  P        Ѝ@ @Ѝu\}x'0@-@MPP 0SPH00Ѝ000 0pP0 0 u}'}O-P||Mp` 0S ;$ , P 0S ߍP/1 Q 0S s?@0   P P@ P@0ST WpU: 0S T f 09/PV/ 0` `x'}}U}}@-h0S S S8 4 ЍFS$ Ѝ:~d~~~7@-lP$ R`6;@ H5$0S p0 6  v6 Ѝ0x'&p'Lwp@-@P 0S Da0PS P00 s 0R0p@-H@H H`HpHP0S00 xp% @-T[PL0 p@$h0"S-6Ѝx'@-T[PL0 p@ h0"S6Ѝx'@-@MPP 0S00*`0 /`7P$ /Qp0` `0 0'PT 0`2# 0 0P!00 00Ѝu}'x'!0C- @MT R2!<#K( |hG, pXC0 dH?8 X8;4 L(7#4R4" 0.("4S ' "4S  !4S !4S !P0S x !T0S \Tat唑Pp8W4 (ЍCW0S@ ሥa 0   0 (0US. !S 13 0U SS0C SI JI J J J JI J JIS 0U À0 ppP>%u߀ipw~9%€ˀӀ_6ۀn6O-(Q ,@Q 0QP Ѝ4QP\~PQHx80S,00 80<0S804 <0PAfPPA_P1 QB">Uȑȡȱ`p8W0aS R B <0R :P 00< S /P0pS:`(cQ !(cQ @P0S0 BS `a 0h R R* \*a  `0(SD0'9Xx'ځUkقO-;$M `*R 0P$S ߍS 밲@pĠ$ˌp@0 0뉔ᨛሄW YX( 8$ f Pf/jSa,"R 0Q RR !,"!R !` !`!Q Q @p 0ꨑ!P#.   P," Rx `b,a! $a$"#. !$$("(Q* R `Kj 0S 0P R ` 0; 0! 0Ro j+ 00 @1S jF f/j`01T T%Hb p'x'&VEW}}WEV%ND'%A-P@`!pP5S$ Pv $0f0Qp G3%R 0R00000( x'p''p@-@, P  P$p@R 0@- 0S, Px'@-P  蠒'O-@- CMk M:P p00*8P 8OPP008800S : SP  y@00t l0S aP,X@ (\(0 0 ( P Y:PHHἂY90 $0  P$0S <$02 aP,唙唩$ [ 0S$00  %P$00  P$00  P$00$0  @ waP丟$& $ (>P($0S  S;ƑZ0;s 00 0P$ 1\  h@  Y= 0SX8 0(S(0 (0 0P$0T0 < ` P 00 $0.P$0`0  ` P 00 $0P$0X0  ` P 00 $0P$0\0  `P x `P 0 0 $0P$0d0 8 `P 5 0 $0P$07  ` P 50 $0P$07  ` P @50 $0P$07 r ` P 50 $0P$07o bD w` P 00 $0P$0x0_ R g` P 00 $0P$0|0O B80 aH0 S0S  _0Y: Yx0 *$ 0TPSH H 2 00S> ,0 0S @pCލ Ѝ30"0 000 0 SD 06^  RQ<0 8*0P4\  BB! !^ 0S 0 0SO 0C RS\R\RRt]R\RR ]RRRR\ ώ 0 0 R0 00S 0 <0  d2000"0$0 00$0 P 3@$0!S +)0$0$ 2 B 0S P 9 0S$ _v. 0 S Pl $ 0S$ ^ 0S[y 0 Sq PP  0S$h ^E x'3}l,y7Dy_u'ѵ''ÄЄ!.2=GT_s'u}y@%υ0s@-`PU V  P[@P hЍp`PD!J]<0 L0@ӎVy-?$00S @-a00L%p@-@5S4 0PSP p@WPp 0S 5S 1S /Pp5S X `Pp@ LPp(( Pp/x''0RWedArdAus@-PA1( (000;ge( V 4 5S Pga0S ca0S 005S  P0P(5S `ЍpX XkPH`4bPx'WEVfdmdL%a'gd@-@P f/\@ꠒ' 0 DL%l'md0P:/ 0#-3@-P?X P 0S S@@ ovP@Ѝ0@ Ѝ/%p@-4@4PQ$p@`  @T%@-Mp@p0l Q d P0cS CS SS 4嵍sS00ۍ0p'9I@-MX@X0T Q L P 0nS yS0 $咍00ۍp'؛#r0@-MMd@ PP 00YSP ,tۍЍ0NPꨍʍ 0 cD'%@-@M,0 XP ۍ؍V@-$ $0 ЍBD'%D'@-YMMt@ hp\YލЍ<0< S <f%Pژ10YS<0<09rdA1*@-0gj z gz z4 'z'&z'z{zgzzz{Ѝ5H7@-P0@ 0$S0S ᵹ0S7 TQ,BQQ, Q/210S 8@0 Z0000 ! Ѝ0C0ASlgPgPgPggPgPgPggPggPgPgPgPgPgfgc0A Rtpzg{{' Q{ zg{k Q{ { { @p'\kP `00CS`0p S00 P0S X0X /X%G-` 0pP0pY@P -pGZT@Y @0 @hJH&뜠pPF[ 0  QᏝ V ZPUP P pXvЍ诎,e%O-M M@P`%%u倅倕0S0#!pO P 5\P88 P(p 0 p3 P T dtT(p  P 0 8P Z$Pd⁾08Hd8tDT( p P 0 8P 0(0csS, p P 0 8P 0,0cxsS0 p P 0 h8P 000@csAoLGT|5NXdqx˔ +=]C"O-销-YMR S@`paW 8QT ,[Q X X  ZX0"@Xr 8 X,  X  CX0H"@ \80 F !R2!` = 0S 0C RlSilyylyyyyylyyyyyyyyly00 0 1 0 0|8QJ X`  <0P+8XQ* 80A0W @2<0P+8eXQ *ЍOw0 0 0 0| l@ \ ЍOPЍ葕T|%Õ!֕ A-@Pp(D@=`8SAjK 0`'7 0`( "4`#/A-P @"440 "440 \`pp8V 4V(\(,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQp`pQ(P"440E("440E@`0`V@P ~ {0T0E0T0E T"440Eꐒ'@-@l40Pm08Ef/UWEVP@-@P TP8#!00@QWEV'80@-@0S C08f/U<'0 \ P0//@-LL@LPL`0 @88F RU 0ꀖ%Hp%P7@-@ P 0PPP 03p 0 0'(VP0 Ѝ0x'vdϖ0@?o2P0Ss@- `P@VP VP0 VP0 VP00U`VP080DPD p0 ('Ѝp^3'#ՖpSx'udP0@-M wdPd@ p H' 0 400+ +Ѝ0x'zd@ؖs@- @p p'0  l0 f0`P   ]0   V0  hO0  PH0  8AЍpx'td@,C[%yȗp@-( PM@`PX Yp  ( XV V h PЍp (PH( >p 0&0 x'}d(@I~d([mP0@-M @  PP@ &4P4 p0 &Ѝ0{x'{dЀC-P!a威0,M@p00 Jp0Shh@@@ p  @&eP qP pP $0Q `0S*@P &@`QUW U0 qC R00zt` 0S,Ѝ00* *  jP@,%x'|d}%5iO-P-MM )@UUP40Ss40}=$0(,0$ tp P/4@,`D8V (0, 0(000SڍЍ!# С!!(@`F UP BCp & U@PdR81ppV @0: S \"\\1040}=$0$0(@,@0@0 p ,4p`V1(000(S0P:*  0P3@@p  눁刑刡T !  h`!R0$@((pP%(G `F@ @p  0Q` 4; $eO 0qp`p u, P` N GLx'wd?Sxd w$Wp%ř>%)~PA-M & @0P 8 #0P 0P 0Pp@躂op@ 0xg@dp@(U@@壂Pptcidyararbmngnts&xzi P0 P-  #B%B$14!8<䀼'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @ꀼ' 0"!#/P/ᨼ'A-PT0p(,`?R@;R,0T@@DA?@?@@耼'@-?0<@< (20,20PP0  P*0 002耼'> 0R//G-0`p(,BP O EQ@PPW ,20CS(20CS G0耼'p@-M@`42S%^  E@ 82<" 0 (2,"Ѝp@嗁<"82El@`劁,"(2H0X"\4Ѝp@ꀼ'%!*Sz1s@-P`vT  0SЍp00S@eT0"S1Ds@-,M $O0$ 0 0 0%p%A-`0~ @TʴA"Ϡ<,pP 0d  ? #Lqp  RЍAL`0S`@D@,wO Ѝ%Tj'@-`  ppP0p@l Ѝ!$LR@ @dQRQ$ ጳ@zRU'p@-P0@0S ( SB01p耼'O--ʇߍ@ h QS/2SrW#, `p 0 ಟ00  0p`#W0 002Rp`" p qp <T"QP20H"Nl 0(1 RS Q0S!Q10! p12S  ?01DP& |!Qp10l4!?h02S02S 0 0S>0)S $pZ0)S i "Q  R ^Q !2PN00 0H0@ G i 0S<(ꀼ'xpl%%ƫիޫLnRpltU)Ѭ`:c@-M4rW@Pp@YЍP(0P@`  B1 @PP$SDЍ@8 1 48< ČȌ P!1 11< 01 1 ?011< 0`1 P1 ?0<Ѝ@ꀼ'%vͭޭ$O-p-蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S- 1S* &, W000P0  00SW0!14!8!<!14!8!<W0,p0,0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 00$00 0PDxS 0S00$00 0P P HWT $0P0 J 0S pD 0S 0s X2 0 RS $0 @DkoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`%PX 0 1<Ap 0PP,2 0C0P0PO`x(2? 00PPpTpp0`Fa ?`1<A 0?``PP,2 0C0P0P`(20? 0PP`Fa?`?`` 0S\ 2S@X @TVJ041S'5V%о'+wu'̮߮C-pHBM42gS4Iw0r0bP42S_ 0P7U42S 0S 0w؁ؑP 42RSgP:!w42S^1!$1(1,ЍC10S dS'tpdt 04rW2S 0``p 0LP"R S0SЍCv@D> 0ЍCSP 0Ѝ耼')s':x~^د@-0@M0@ pp`PhpWߍ\ E0  0P \ MIt02S 0S " ` PD!SR ™0PzR #',@-0Xa0 0LAP d2S8 P($!p! 2SP0U  $tp" Rp\EU$p0 00P d2SP vP@ Ѝ0P0!!1 %'md'g'A-@T2 @P%FP  FP FP@ `p@T 00S p`V@FPD00S @@E@P)RՖ'%A-Pp` @ } 000 0@@@@-`@PT DpD  , 0@`@ ЍY @z`O-MM0t4 P@ T\D EP @ <EP44 00(04QT(0 ,0Q 4@# 0,0@,0S @@((,0@`00P0s唃0C@0PP@P0 !0P1P83l0 (3Q,# ( U s4PT0> p@: PE ,0S ,db<(00S<(00@1 $=Pſ'0FSʆ` P0S -S@= 6P00@ @P壿,0S ,)'܍ЍA0 F2P D8800  0 R00S' ,10PAPQPa40C 00sC>G0S0SG0S0S C T0S C JCEC@$0# t PS<(0 U P('%*, p ؛.S%7TF0/'0/'0/',@-@-   ㊧p%G-P`pMG@0S W 0S XN rU `CY 0S 0S  2nЍ'ѱ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  =C-M Mq@` @Pݍ Ѝp!rddPp=0D@@rOP,0: S0RP00 0KPPP81: S`P% S  R  r_PPt'PPPU ruPP @P'Rg'@-AP 004 0,$Ѝ  ;'J0@-4S 3/ '@-NF00 @ 0 $6BF@'@-!00S# 0S,aQ7400CS0"@ T 00CS0! P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT'%%#؛@-0M 03sc000@Sd0 SPP RxPP u 00Uy `Ѝ0S 0S y@ j n0S\0Sp\ 0/2@ T\0Sp0 "@u 0@kp 0S0S[p @\0SPp # @"  @0Sh>p @D @P@ @0 @ `0x P|"%   T    P  @@``L 0@` 8G H D''')%/?bxE\$G-0@  0'P 0S< 0  Q* PPz  z 0P` d !URQ <e l gB0 p H0 0W40p P O u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0ppP iP 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `0):00 QP  `Ѝ   0P p P yj `P1S1S1US1S 3S3S3US3S, \ X`P0`$ D30@31<313 00` 0`900 QP    e 0P`00S !14!8!<<0!14!8!<@040  0940  QP <  X 0PA0O  A0P 4F 0R  = eYXpW P0E> 07#;;S`dXX $ R,0T ,0T0T0 R(C=D0P 2L0#1\0\0P 0P 0L0000P 0L000h00Pdl0d@I+,Fb+RRaArrAaU8\@-p@ `P 00 P0P8 00QP + Ѝ 0P< !@ !0 P08 00QP 4 g0PI+7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4U 0LP000\/,KG-PXp ` p P@ Ѝ0:!0㑘0 0g8Q P D/ X0 X0 PO-@,M0p@$0l@`P P " 6 pP $xPh?$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p  00,Ѝ4( L0 Q$2 q(@,"  P "  @P*"*  P0 SP "!"0  0@PP  @ S@) P r0 r// /[_0/,O-`MP@0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp h`P0P@  `0P 0 00 P 0 00` P0A s `0 Pt P0 0X ` P :f+WkR0/0@- PBU02S0P^0A-p`|Pv@P  PlP P0R*"R0R05PO-0p` \PPX Ѝ$P  qQ 0 Q0\@T(2 R0@ PQ SC0 BTX t0D s   0 TX Q  0 0 n | P [ P J BPTQ2P PEP5O-X`0Mp@PPdЍ =0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/BP )9  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0w50 QP = P=O-ḡ帱@`PpP0S00S <q.p@q8WO$0S  0S 0S,0(  0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  l\PP 0 RQ@0 P 0Q+,@-XP?`\@#@3P@T@TpW @@T`L'O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2"0㒡0 04 Q P VP 0W:00 04 Q P PLU  P<0T 0qB'O-M@L0S<`@DHp S$!P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:t@'0@- %B?@kP/p0S t70FS `C 7p@@0T Ѝ?  C0'0 PK %/'O-`-aM 1V  0. SP0 S@0P`(0<@@0$0 00@`D0$ R! X0p1#r#88  ,0380, QP r0P@0`(0<`@0$0 00` p0C##   kPW  q2pG40DD04 SD00S   408 24000 ,0380, QP (100  RR R0(10@00D0 p0D0G > /&P2 (1 0(11  J   0 0B0 @0 Paߍ0@ S100S  S:I@(1  0I@0;+ ɗ P(10(10@0 00 0Sb 0@ K <0(0/os" R$ 00 ,` 0:0(0 0$00 0<0P `S<0! 0C<0< 0㓲" P 0P  P P :P R: U 0`$00`P0 4g | U?0$00`P](<\Q U`V  $   P`$ PK/T~: `0p!Pg0hQ P P0S*0`Q`  01 U$0 0 `H0h H0 P  0 0 P @`  Q .0 A  L L G?L @0CLS \Q*V 0 $L0t!s0<80t1 0V4 8  b5S5夢05ET0  t4P05 ET dT 5d 05 !d5P 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0/ JQP d ƻd0P Eh0K/0h0 60D! ,qr0d 01( Y2 j  6  6,10,1#40L0sK?000/1001001#40>000310 00 000T0 C.(%,5QP Hd Ud0P{ m''w-@-@ P 0 5'0/'0/'0/',@-@-   Ɩp%G-P`p6@0S  0S X U 3`Y 0S 70S  nЍ'ѱ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  yC-M Mq@` @3Pݍ Ѝp!rddPp=0D@@rOP,0: S0RP00 0PPP81: S`P% S  R  rPPtcPPPU rPP @P'Rg'@-}P 004 0,X$Ѝ  O;'J0@-4S 3/ û'@-500 @ 0 $&~5@p'@-x5@V0 &&n5@O-MMP@`pP僻P0 P: S3/JP 0rS Q500P 0#0@0@@ U  T2P  JP PU .500@23MP@ S @X帰张/P60: S)^0 "PP@THP X+ S R"ƹP-P +U Tḹ@\ S㜹P@`-㔹P @U8PXp!t0#PU000 0s r@P P40SzW PPxl0 PP޺PP V80% ܍Ѝ FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440h( $0 $(/ XX/ddhhllppttp p@-"440 P"440@ '$!DD@@HHL`LPPTTX~X\{ \`[/p` pW/ p@R/p@-`"Q@Upf@p@-@PpA-P@M4Q->C->?n}C@X=X\:\79>9>:>C:>CF 0? AC>C>mGFE~EnFG 0X J~ pXW}m  $$((,S>,pS>GlFiHHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P-+ PP1\#10AL 0 0 0B0  0? 4 0 808#<4 0 #40# $!4" (2 !8!"2" Ѝp@-@0Sg7p'00S 4 /<' 00S/<'00S0`( "4`#/<'O-M 봰P 02(2@000` 0 `0pX #1WQM0 0  0BWA? RX*10S@Ѝl10ST@Z000@S0@0 ppg`P @0AS4T 0 0W (,\ SP @T P(0 )@T /T @@V@TD00S 800S0PS E@0'<'''x'''2O-@0t4p 0 /0PXQ8"R000U00S.  =`P'0SP Ѝ6  0p  X1P0``` 0(00,0S/(0, ( ,R00Z P000 `0` R0( ,0 0Q  0R000V00S  P0P`(0, `F0S(00/PS0P, \a6 P P X00 0''!D'p@-@@PD  P`,00S |60 0pp0'G-`@Ds+@T@@@@pu   0@S( lPh rp崐0S M600p DT 4 0 0( 000p 0'4'<'O-P-"MMp`X @ /0pLv0h0[<6p$08d04P(,`2[lt-[p"5_ 0 0 I?[0G 0  0 Q!0 X 000G0 `T 58Y `@` P0 c C0S^1\13 U00 Y 0000"ݍЍ 0 M  0,  01S 0 0 8800  0Z0 q'ጁ'0p?0t0 0p00 P0# C. c37,P00 Z85   @5 L0  [0S |l* 3 00 M0S |^* Ԣ K00"0 Sa:0 02P 0A0\1: a 7:Y0\85   @5 L0  0pSH G &10S8 [0 0? 0 1000$? p0l 8 Z 00. (0(0(0phh(  \  F 02P0@00p 0R 1Q_PtP8  L4t0 1( P( Ph@h,'%''%5'IUD'A-P`p@|4p0S v40S !SRpk4p0S e40S!SRPe@P^@A-P`pV@ `$P`PN00@AO-MHMQ $#@02`0F/ Ϡ _0 (Q%6P(0,P\r 04P@`P (0, 0S_`(0,PۍЍ20S,  1q VQn8.#4n4#0 44.4 40P 0 0(0, 0S_S(00,P```00DHQ"R0 P 90 00  0@Є03/`) 0 0 0 0  000 0C ᔠ0* 0l040S p%0 0|L\'''0'<'4''8'@-AMMP@p`(h$^ 0 P@3U0:t0 R0*d F$"@0P [404   P$4$AލЍxP'u};17@-0 Ѝ0@-\M`PpX @ ,0H0T0 `'DP!@0Qp8Q Lt2P\Ѝ(%,'PA-`:P`p`P#3RP3R#\@A'O-M`@ ) P0F: 0 0@40P$? 0 }622Q p B("({qsQ0<30<420S0 P2Qp 04  0R  @P.( 0 1б  0 4 Y: 10S0<00D0`r2 0`Ѝ 01 0\20S V20S 0Y` `$E2A200<20S Ep32p/2000 4 0b'<'%'0','O-GMM@P X `|+박尅p:0 5 R"0Sb 0S! 000S_LX00 1000$ 0| 5H0\00Q`04 00"ppQdth/" 8"0S/ L000`t 0 HP% <$0000S $IX0  0E.P3GލЍ.P3 0n"0K 0 E @ }  0 0S  s-j  P1 (F"$.P 좟ЀL00 0W0 H    00 `020J21  +1008r$10SXT2r0"0H000H0Hp 0 0 S 0 RC 3#004 S 0040P!Wh 0  0 0 0  c 00000C00 S I 8  0000 1    0000 `0 !0vs  0q00S *','}~x'%xVX'D' 'AiG-P`M@HXpAZ 10S t10S 00 0I P<ЍG(PE@U> 1 RP1H X0  P=!`3 H 0S$00S U 㽺!0S V0S G 1@ЍG_Xs-P L0 ЍU'''x'%}D' 0`( "4`#/p@-@HP08v200@ 00 b/00 @W)p'00S 4 /<' 00S/<' 00S/ <'P000R0S /O-@("`0 SMPf0SD S0_졟ď080T C/ S ! R 0C00 0@gἰ? 0c$\5h!Sp 0 0Ϯ00 ?@U '  ϬR 7 R  07 \5S0 00/70/0 0 "Ѝ P L R  H00 0000 '''T2RkPO-0P@:1 R0* 0딑唡0 `P3Qx 0 U0B: 0:0Ï|!1\%pR 0 0/.p 0`0 C c00p0S   0 J.0x`0 nƃ1!0x 0d000(00S'''Tl','O-tCM0 RS !R0*< 0D`X 0:3 p 0  0:0ï\!2\%PR 0 0/. Px 0`0 C c00d0 PS CQ c$ :R, Q,040(p0p`ßp08`,10SC 180Y@`0!X (e! R<`?0 XXK&o[H PEp1 Q R>KI/V08:‰ V/ PlYFp8 0,80<00<0S<00<0ЍF`FFFF V   R0K Q  Q''T '','X'4'' 1G- 0pP `_0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PS#`4p$Q$,$ (,`(PP8)'','@-@8P k080'G-`P0pS100 B?4" P@P 0@8@Pt1 ?`10pA G 0  000 Z`0 0 p0 `1 `#(p"(,V Zp`0PQ(d90S\1@@ 0XP\   0^P0d000 A,''T'`'P'L'\'P0p@-P @?800P( 0!SRpT'`'>p@-X`0SpL0LP@1D@A0S庸常000p䲸`'L'\' 0 0 /l'O-H0MS MP` 003/ ލ Ѝ40 pP죟00 ,0H000 t /0 @ S 0V 00X0x3!0S' h3QgQk  0   0励00Z0 02+ 2R720t0S2ڤ2 Q o   Zh"$➶$+<2PD" R{!  { ! t R1W+졟W000d1 Q5 10000S1H Q B/o" RK h!B0   ,BLD>)P: ! RP, P R 10S0Q 10S 03/     0P  0p`V0.'',''pUD'v@'0O-S㰄0`P0 V0RM#@M(, : SL \p(5R,<R  P  RSV !0 ,r |0 sB?P0`0  0S0 00 000Z_ 85x @5D0LT 032 b< RP1QZH 0j 0q0SY "00  G1+Gf(P0S00Q )Q2 <P U`P80 00S0` 0ƯPPQG 0 0H  0 !40t ?:#b 0PU p0Y0Nh0SK  gV _08001(P Y 03/ RލЍb0 1TP+U0H 00R00S 00  G*Gq'PK0S@ PXQT0 P,''X'D'v@'@@-@u!SP80< S0 80<  D [p@-@@PU D!P RP 0 R0:pp'@0@-P@80\U< S0 80< 00p@- P0@ҴU0p81 R0p8P@ô00S 0SpP0Sp孴娴00S rt場0S 0T嗴0S(Sp@,匴','t'xPC"'ѱ@-@M`p{WP 1!  P p`V( EP 00S0H0S 0 0 P0L (-00Stt, u)00Ѝ@L&P0S 00`Ѝ}Dx'','''D'0@-MP `"@? ڳK)Q Q0 $0ASЍ000d5O-,Mp0 /@PD` T00: SR) 0Ḱ0 倡 R09:` V `3 V `!óP@P(0S @P(0`S @P0!0b0 0S:R 0ϴ40  `(`!\Ő\  ? 崣 ? (0嘳 0S30m Sm p3 R #R XH3 R ,(03  R0\ 0㵯 30 " 00C 0L40S$40 0C$0娂*2)|20S S 0: S ( S,  Sg000 00r@( %2Zp N *v0M0`S 1 00|10800 0ˏ I0X0 ✙Q0T @ 0`; C >!000O00S 0C&  ,Ѝ*!P( 0ˏ d d 0 T @ 0`; 뫴 hd'''H'-T''<'U W'8',''0'O-lM2@ 0p`aP!\P  ? 堒 ? &0 t2t0S0 S 0X"S 3S D@X  (20p`Y2QpQ\tQ`Xd   X 1 R, e'00X0S 0 0 `0\ *L!00ST06 0 !S0\ 0㵿 0 " 00 04$0L4R0@ 0$*00G(0S WP8 P& PlЍSq tl'd'T''<'U z,'''''8'O-`2|2PU@PpU00 Z0 0 Ѝb0 Ϡ˿S 4G g@ WVLQVg TU A0 ;&00100 @0  @T` T0pIT Q 0@`L @Q 0 `  T 0E0 0@닁 0 &P 0 _0 T`0@S 0 000l000 %[P00U0 ','O-P0-p,MWtWhfp`0 00`?00S \A3@30000PT Jb ? @00:e @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0p20SA 뉑  0 04 Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0YlhA W *%p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 OP  ,Ѝ,''@- 嚰Ep%s@-@P `Z0S 0S 0 ЍpO-M|E M`P0S 0S P pP P 0SPލ Ѝ000S  P i0S 0S 0S M0Sx 0Sx 0Sdw0SP(0S 0S0 08Sd s/2#' 00 " " 0D@!1!? 0 0k 0hd!! 0a0 pPdV0SS "04 0 R0  0"? 0 ,¯ R( 圠*,4ï0A80/R%'<0P 8` V Y0" |0S lhbPUt Ϯ@0S H Db@PUn Į,0SP@PPDPSH0S  `嘕Cn* lxlB%|0S llR0p00S00Y%P 0,0UA:000S 0S PL1 H0S 0S,0S P  P   000(PP 0SP ᚮP ᕮPP P'/Rv6l''Rg,GO-@H0pS`M W0R0: 0P 0 H"p`/<"0 S0 v20SW $JЍ 챟쑟P  BR 0S#/  !.V  R.. P x!`T  R0  D lP  @@" 8 < P`8 <ͬP0v P0  b$  RP `  ^ V UV U )'9'S '',h'D'_'00S 4 /<'00S0`( "4`#/<' 00S/<'O-M,Mp `@"Z:$ 0 0S`CZ ` pP# 0`VP!0 00؍,Ѝ0 (P  X0`VPh0S t  0uh P  N0SHH, 4; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V0 0#03 R00S :0S; 0  6t: 0S R` P 0[@4< S0 4`?0: :R00a0 B? QP%90S 0  ׬  0 0` 0YP0  90S00, 3P$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P el80S (00 0(00x 0` ~ (@(#70S 0h0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U87PP0X 0ZP] D'000s0@PP6@P"Th0S0P%Q_!1Q 0PQ^100 U0 EPP P00t ?@1#R 10S0@P0  ޫ Z$0S 10000S p50S $0S 00 P0 徫t ?w$Q  40S $0S  士 Qa 04 0 S 00 0 0000 0=$000 0 #600S040S T4P P g@pt3QpQSLtQPXd00H00S1 0S p30S* \P00 4 0C(P2 2 0Q\00&& :000@{0S828040/<0a0#QP8` QP`U`00S 00p@3P0p<`$\5SQ%Ϡ<# TD ?=0  (40S 40E SE 4`V0x@@0`S y0,  d%0 -0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S 0 S\00T0  @T`0VT? @`1020兑A0^ 1QS  0`a 0P0@ Wq 000 Y 0?* 0  000VT pW  `@ @p \WV00!03SR @1:0R@4a p0  00  P C0 TS YQ! 00  0`P Q00* B  ^`d''T 'p'''''<',''`p%''U H''O-`pܐܰ 0M @ 0 0  BRЍ P PU QP X` {{@ pQ RP Q @p0'', 0`( "4`#/O-lMX 0X0X10T1p LL1LP` 0,0SlЍ0S 0,@ d0 @è00ట@ 0D R`pT0#:#P 0 ARpQ R\tQ `; R  @P''0''p%<',' 0000@/00S 4 /<'00S0`( "4`#/<' 00S/<':O-M`@@VMP`90S 0P )S0*`00#0.吉Y pP 0 WP X)T ,PL9p`0S 0S ) P00 8 #R0p0,S00000b8 00!"441#0"q    0P@ fbf}00C0U 100 0Sz > 0PtM0$S 0S '00`PX7}`{60,S00,0007 00!"44'1p0pp00ppP*0S  zPe 0 1`]xnPY `@   y80< 0 80< @00C0 şr0 00 R.*0S  2P  0" RVލЍ0S 80< 080P5 0< S <mB0 00$001 .` P 0S 80< 0804 0< S OB0 00`S $`!  B("(p   ᴁP 80< 0 80< 00C0@'80P<.\SP# .P #P*PP3P`080< =D3 Q035;:,pW P0Sp\\(?0AS񟗮XXS3 0020S04000yP |2 H#R02 00eP026 0 03#R0mQ" 0S0S@0 xGPp  : S000 !0 #R0 Q  x 0 FQF?\!\  ,10 S$ DaA#R0 š!ʡ0S  0R 10 0 %00lPd0`00C0WPpo ) ,'4''0'@mD'<'B1 bP'>M]n'' }yqO-MMY0AS񟗀4ėԖ hėh; dPX7 L@. <P j$7 00>@0  6P 60S 60̆V6 X  0h06`$00嘦嘶100V3:6 Rpttt0S.`@aViPVohݍЍ( >P:P   u 0S i @ FL10 0 @00@(0S Shhu`%sp(P* 4 0  B, ! _50SW 00(000_/0y 0S 3@p(0G0S(F GQp(Ac,xd4p0(S9@0W78Q,0 S1 #0 R( S000000!W"!#-W l'px3  (  _/.   ,0 S1 #0 R S)R ) *V { { x 0 S( R , l"2 pR)@ W(,`0@'a V!W#W lp Fa V @0 (0S $ 0 s00Q P0S"0`10S x10!1!00C0!% P0 00000C0!" Up0S@0 0 0C0 00@D'1_0'L'\'ЊL'''Ha}p%,''':<'' 0`( "4`#/O-Mܒ܂Pآ1EPQ@Tߍ0S `@EDAF@D dt0 |`t僣00@   B 0    S,"[ "[ "[S[ P0:000S1 a 1 R R@0 S 00"P X100CD<(P X 5 X ! ! Rph0QbT0 e R\tQ ]` h00!P\ t00f 000L'\''p%''''x'0 V,'<'WVO-`0p(4弰 @$M? = $P\P  ? Գ ? 0 o 30S30W SW 0 S 3 S x;@ 002 P00 00CSFTY! P 80R0L003030 000? ` a Q2!,S Q0B*2+|20S P9 PHB P$ЍS U Px?00 1>!W 00S>>0Q#c ! RR 3 T0 0 S`0?000 ? S  R.. 0" !00S0H0S 0 04040c/0 P0L 50 8 QT $  $ $ $  L30  ^\ {0{< 0_Pp0'd'T''<'U '8' '''00S0`( "4`#/<'O-lMX ℒ`|20xB0,0SlЍ`R0S 0,p d 0 ,p$厡000pP1@ 0 0D R`T07:!AXpX\tX`Xd  X  @RHܧdX %P 10S  0ᱠ@PhP 00S  0M0S  RQ {{00峡|  0X! 0T  L  <0P'''p%H',''(0O--oMM@P00 0t2l?0SX0S $5SH0SY<PZX0S $XnS X Rg>`0V\2 PT20! X" \" B1\"T000B`X$dPp0A^000h21`l2\B1d2>2d2V0C:=SLq QT20B   0S 0@$5H> *$>3>0S B0 0pS0  B$511  !`0P00B1- 00 S $|䌟0S$ 봀 -⎀Ḁ$1BP`R!B@ L֟PP p bl 8PN 08S <P| *堀#<t<0S 0 0/X0bA?:T<5A?T0 =80T0.H0 ; 0VHQ RX0`0@ <0 8 84<ϡP b0{ S Q,0 Sa?^< kP< ,;0S < A>+<B<  C P: <@ Q 000:J*:L|:0S [0 0؍ߍ08008``!.Q  R  `0" i0S ,p@dC  0@ PpH K008y+\0#Q  0 ` ?옟 0thS 90y Sy 80S 0)S 3S  0S 0 0 80S 8 0SD(0 08( 0Y (8H8o;\Ş&"\ ` 0 0Ϣd h  pBnj `b"36'+?D "@ D @ 08L<PLRPP07L `V=S؈<0D 2L0VpC p,00C S=Sy傷{S +\0#Q  0分h ?xY d 6J0S <jP#50h (60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h  pBnj `b"36~ @#  iYp%G-P`p @0S   0S X &U ᫜`Y 0S 㯙0S 凳 "Ѝ4'ѱ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @嫎Pݍ Ѝp!r8ddPp=0D@@rOᒎP,0: S0RP00 0PPuP81: S`P% S  R  rPPtPPPU r)PP @P4'RgD'@-P 004 0,И$Ѝ  ǘ;D'J0@-4S 3/ ;4'@-00 @㑌 0 $@4'@-@@P/00@-@0S  @ 'ѱh1Q0@?o2P  R9 -P0 P0S 00SS0 000 000x PP  P R0 T XL PQLL 0 0/TTT8 T'<''''T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/('`'T8 T 8d'0p@-000 0 00@P22=000=000X0X0<0<0@0@0p \0\0H3H3L3L3P3P3T3T3u/ h p@t0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p H3H3L3L3P3P3T3T3u/ EEP  4444K4K4h  5 5d0d00000-P5BP5H5H5=Ch H5H5S>S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//,'4O-P@-TM t圴圔pqx-[?ldp:0  0@ @P @Ѝ`\VP0S/ 40S40S  ?):0 0 P`\/P3#0S #S5| P p0S d,0CS Ds*0S 0\%R#\\5 0C"?o20K`h0 0 S`2 0 ᑣ#0d 4:; 2  ? :010S?,A!Ϡ\<# P  0b  ? 0SQ0S 0ġh 70S 0x\%R\P l10S%`yXQ5 L!0 0@! 0 * 0S p 0 0 00@@ .2`h0̰00J00V* 0R A 9\'8@'' '}''l'T'<''8 T(','3'h''M8'`'d'$'9O-@*@M0M08x`P 屘 ލЍ80S ᕉ:P囘 p 0: S X gP@888X04HSP )000S Ǖ008 78    8@ ܘ8p ֘[WppTp\7PpWL P 7@T +P |"H8P 00s 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p,gp2S )CP )>P ).T4PZM-`Y 4[ 0S0:<관X V.+0]  0 ,P %Q$ f Q춝C ?yPu` 2S<404040$4ܔX02P#W20AT2@02 Gr0GB < 0 lH ? 0pl3& 8 S20#"20#202P` 2S d#0\P@Q=S00 5P@ ) 2RT0 S @x0S IC 5*< 53 30S q0 0@20S 0M|3 0 S@ T 10Sd"d2Q`d 0D^3" @=؀C2,0刂0000t @DO.0 @7'p0 @S葟0S0S0=S0S p(8000J p 0L%000X30P%,q  *1 10S @0 0$'L'P'l''@' 'x'h'9 X2<'@'^,5\T:W pT'c<"X',Uzh'8'aFvm0'4','\''8'')Q' 'iH'X''T'L'P'\'`' ''''<'_D'=S%0S& <0p 0P%<<00X30*0 00S [0 00S5 0 >0S WPLq 5*N> 0:#: 5p1y $10S 20 000S(3Pq00*1Y 10S h0 00<cQdzP\r 0<0*p29 $20S H0 00S0L%r0L%r0H00q" P 000cH00SPGP$s*a43 20S \#0 0 00L40q"  400cL00SPs*9330S #0 0 0t4pW.4E  ^  \pWR 0SPt*4T40S f$0 0 0t0Q,%R0%45S R! lf004E0S|PP*`5}50S 6%0 0 00(0Si xQ$ =0S0x < (%0S^,P*6Q50S  `8&0 0 08%<5HSR$  H00850<S6bP*|6#|60S 2&0 0 0@%D5LSR$ t L00@50DS4Pp*N7470S '0 0 07 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S W)0 0 0T PYd P4TQڨ0QXڌ T0 0S Py*9k\90S $z)0 0 00S3 6 ,0S0QQ*P "0 0Sl xP`z*p:9$:0S H*0 0 0 ,0S ,0S  ,0S0+ Q^ NQ L ,0SQLd ,0S{v<Q ,0S ,0S {,0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*p<$<0S r,0 0 0<0S <0S(L*<<0S T0 ]h < < PRL PM\= 0S@ UPL \  `\堭p@PUWʸ- 0 ?001>00.P6  ,P܏0>P<) 3D^ SH.;00 0 S 05t>|> > 式>p嶏>PWppY>@@5008PEUPHLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 T?0S   q0`00p] P?复 嘒6P k0x& 5000h60S 1S P QPD6  <6@ ᥨQ$ V @ 0`P@@  04 8 <%c#!$c4"%S 50S :P 0 0  ``Z0  0 0 0 05a(!"4a#Q  0SgwPh0 $"448#8 S  0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40hte*0S 00 0 0 00  $P*0S 0 0 000  0<*0S 0  09000 0  0p#*0S ``&d``0000  0`p *0S @000u0  01 1Q1Q,+ 0S  A 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP `@f̍0Pƍ0UPQb R E/ !0!Y pG Pd''P'X'@'x' 'LBAL' Us:|m'' F'H''D'*V%|00S!4!: S  S :C / S : S 0P/@-y<''}1A-`0S lho@ %T L10S@10S4Y,1 10ST00S Hp@A00CS0᩷P U 00CS0៷ P PYU YU0 P0  0 0 SNU'_l'''m'%%@-@P 鼌$ P2Ѝ'_O-p,1 p$1p 100 P1 pp P 0P  ppPPCP(㝋 @ PT`00 WT ׍V Ӎp pXP @@ 00p'l'''x''O-1P0- Ϡ,"ʼn$MP   p ,P 0L x 4y`,@T 1 0`P$Ѝ?0 0 ?     P 0 00?QR0 0# Ϡ?D0 88`0@p 0/@'<'%O-p- M0P8؀:0PϠ,"  `ḇZ0 Ѝ 0|@Z ЍO輋 ?   囇P l ? 0@`@''Q3A-`P@U ,1U  U0P PP0 0T3p䀟`+0 L@D0T@S    8HĒL d  B 0b<3l@"y0 S  0P00`0@TЍ@'%_j''<'' 0S/A-@p d`V F0P f02Qf0 SR P00@00 0` PЍ''' '@-0P0@T@T$d pL `l0̠p `V W @00 0 0 000P@0@00 Ѝ''p@-XM`P@X  `P @XЍp0@-S |ttH0@S  T00S H&004#,~P00'p@-@8`8P0 ,$00Sp p@m'd'<'0 /'\@-^* 0<80@400 01Q0'H''(%O-\MPpSR E00 00S` tp@ [00CSD \ЍOz`T `$0XYH`o`00E0 0PE00?0+0F`F B\ЍO000D0P p`  x00PpD@T  0F 0/ `@V @:P pRg'oxV V\%2R/C-@=MS}QPH 0SVPV.10S %10S0 L5as0|pS净  Q0S   0 0"W0S  70S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT'!'<'\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,.TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= ϿS*330S Y0P 0VhSXSXTsRP`UU00Q AP 0S ?@?20`P"hR0"00S7 lr002Pb0S) x#0S) 00RE>0X4* 2920S H0 00S$WP10S $1 TQd1*f\1 P10S 0 0P10S D$41 P0*E000S 0 000S 0d$  0w (0,| ЍC(| Ѝ4'D'' ''$'\''['@','8'<'x'''yp'l'E`'('d'''O-PPMp80S# \/ "C / Q @aV``  [ΑYP ᔾd \P  ?88  ? }0 M2r0S0` S` 0!S 3S  0L? 0!0! !!0S`0 0 0 `U\/0ϬL3 80S30Ð0C03` 0S300CQ"À 00P*Z00S ` ` `Ѝ kS  *$0 0C$040S 4 $ P@ P V'' 'Td'''<'U ''8't0A-P`p`ATR A@P<:0S @ 1p0AD'$80 0 1S/ 0S/D'\0 5< ÒH0\ Ò3S\ Ò3S\///'^FPO-0(P,0@4p8`E P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p p''H'Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS lp Q 00p( 08pQቐሀ@`0SxT@P/100 P000B00   @-`@`0S,o/0! 2/B1   P"/   @-l@`0S|00/1000/0B10B1/101/   @-p|@`0SX< 00/1000/0B10B1/101/   @-J@O-$5S[  l@P`hT00! t pbR$ YB,  !$  p  R !U101Q+DP 1 @PA Cό02 R&@@00Z   T   @U   @ Ѝ ^000 0S0 B0O-RMhbP   @PHp@<  WPpߍP(  zppP0S  k<08 (00,0 0000400!4 04$0D0(0 P gVph yr 0 p HdX <X 0X $X X  Vzp Pzp   zp 8p?pq8SPr   00**0@0奸  0* *\d@edAszd@A-CMMPPp`;8 ችp@P  0P;PxU00 ## CލЍO-MMP@`pPyP0 P: S3/ P 0rS 00P 0#0@0@3@ U  P  yP PU g00@23MP@ S @X帰张hyP60: S)^0 "PP@TyP X+ S R"wP-P dU ;yTw@\ SwP@`-wP @UqPXp!t0#ѭPU000 0⬃ w@P 6yP0SwW HPPx!yl0 yPPyPP V80% ܍Ѝ FF F@00S 4 /<'00S0`( "4`#/<'O-pt1l1`00Pɯ 0} X@ 03ˠ121#@ R` 0nA0P s00`RQq00S" e% 0%3CC(0QXp000Q  X00 <P00F'''+'mD'AD' 00S/:<'O-p-M 0뜱`P@0V000Ѝ000/U0p00 0 Z000P00S I00 ?0X000  1@400    0P@4P@ 000/U05:00 0"000P00S  Ѝ00 ?0pp%&` ! X|yd0  a'%o0 S    ,'D'<'' D'p6O-PhhVd6d04MCTH@ Hr` pr!0_ 0 CR($(%$|$$$@ 1  50S \T 1 19 1  @ a0l  1\  P 1   x(00 0x00P(0 R. A00!00  Y40SF 0a!(00 0`M00@P(0 R4 4 0 $4$4\0P 0S 0P *0S 1  ( 000juPl3 @ 4ЍjP|30S01 0? D30,083@,[0 S,0(,0h Pn@P,@, R)0,0, 0R0( 000 [0A(㈀|2 Q,, (,0!P7Pm,00,01R0 00 0Cp"3P0 ,0W7! 1 1S2K T10S# ;, 0R?R0(0$0 000$00?y000P$00S  [ P0,00|$0 0 d 0 0, ( 0S     `Pp@+@c']bF'!'Dd<'F^^FD','' m!O-0P⼁!QPP!a`$Ma !S@r0!!1  `00 0p000P 0S @~D$pPU PU 000/ 0`P&P0[P    0S t    RP P@0$Ѝ'@c]bF''H'H<'~qD'p@-P0 % .  @Q 0S p# #300# #:>00Tv0SpP8P{}p'^F'_R/G-P `$ 0p@V` 0@`` V`@&!D`( G-P`0 4J Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@p0P2#U 1!I ` R J` U9# c! SV Q V3  P! I P` 09# c SV!Q V3  P 0 P$` U P `` Ѝ2 0A-1àQ`P |0| ||I0@Sp࠱ P$` p@QL ࠁ PQ e p@-@P0080P 4 PR*SpL0L LS@04 <<TI0C800S   0~@' * ,0S/`0@-@0  L,~0,0080S 0  *I0@~'W@; ,0@-S ,0, ,,I@TP ~@~pN O-p-LMPU`@( %88S80@ @4@D2@D1@DS@D50  00 0Pn} U0#03?[[[UW=|@D `0P 045Q ,R}O0 0 r~;D 0 XR @4}"<p!8pL0$0$0 0H(0 0 `,0`4  0 4$HHP 0 $PL40  $00T 0P}, 005RSUSP3S` 4$`UQ{V  `F000,040000 C3 : 4`C#,0PQ(0 $,80* f@P,Ph3Q 0Q+ 0CQ 0؃SP` T$P$P@ }T@P P0{TpW@ !}P` !T@0`P`0?: p0T @ u8< @D0RP Prv0 `S2$0$0S@p :0 P  S Z 1!A8  B`40;{40 040 00Q800800pȯ0T0 `S2$0$0S@p 08 0 P 80S0 0C800S   0B}`|O@  D e @ LЍ0 0'LBAW`| -q NBAWtA * SG-0,0S0 ^GPz@`00qW40S*|Ѝ! 0 W@P   l@Ppq$ A-0`c,0@Sl0l ll%GPpQ L0< H 0P@DT@q> ? C-0`c,0(PS0 Fp@Q |0l x@PEU  0P !  0 P P ЍqO Q X0sC-@0Ђ D`P 004 0J{ 0PЍp''X0sC-@0Ђ D`P 004 0/{ 0PЍp' '0A-PQ H`p@0P R   T0!  {@P 8%4P;y+l'' '`@_@-,@P,0S ;00'@-,P ,\  D Ѝ'p@-@Pp0p 0 SX0d0RX c#!$c4"5 D006.8 Q#3SRpp,'<''27@-0S S2+, R0 ELh `Q tp"PCxaQ* Q( H<P 4,B 5*< 50d30a3&210S ᆵ0 00@ 7.Bp#x3@ Ŝ & 0P xtX|PA 5*< 50d301$10S Q0 0@ d3S+ CQ+aQ# 0AS"HP M@0a3d3*|0kp00S $z0 0@S Ѝ08'''_'8'<'' @-.oO-0-Mp ""#@0` 800%؃ VpPs0S8P-# 00" qp*z9lU tU bU(Cp8P)J 80 00 P 0 80S $00"+C `E P P0V ~ЍVp FpP`@ i pp P`P0V:P0V" aP pH0P0[0$$0 ?+S* P l2 0 +S P@  8q0 00$ 0S Y(0,  $ 8 yp C 8pT0 00$ 0S Y(0,  $ 8 \pq ` 80Hh L  H0 Pa%,%5Pdk$G- 0pP@P` V  0  0  G `00000O-0mM` $P0@004080 0 '~pp40S+ mߍbW AW LW |8y4ycW iW0p8 4@0 0@4: S@ @0(0D0,0000408`0P  P 0! QT| }mp 0Q= $ 0! $刡匱@P 0V$0 0/S {<<Y, `Ay`0"<P0<0$v`P kP%< p y kw <yVD @"$Ay 0#$0@0P!SK `VHmp 0 n?C0 < n?n/ jk0Pp < 0S `0S  Q B/o" R 0S! m0H $8HP`$0F00pI $ pC qp:0S  (, PQ S RPQd T .%H%8zd@Vk7/T4O-`-d,MPp$`` |p@($0S0$020S'$00 P W 00 PSk0  0"%fT AT PT xZ@pT$jp@,Ѝp00` 0pP , ? o0 000 00 p p@00 0`*qp p V@p@`%`%UG-Pxp` 3|p@<P10S<  p o0 < 9X $$ /kp@- `&W00S $$ Zp@ Y``V @fT rT GX`$$  =p@$XI.%2Nkx% @-錬oA-@P`pP 4ُ\ XvT DD v8 ᝈU  AvA DEѱp%@- R0ЍpP`@ pDP0 0S 0SS 0S $$1!BS0S vP ,, P/00#01"$#8O-@`V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! O-088P@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR !O 300G-`$(Ppt@P 0'0 0Q P Nv@Ѝ hPC-P$4 p咓`㓁(`@ 0Q P Ѝ  hP404-0@-  Ѝ Ѝ/-@-00@w 0 Ѝ@ Ѝ/-@-P 4(t { tЍ Ѝ/ѱO-MPp`@PЍ P P 4S P 0uT0P$ Q$YP 0S 4S $ X0P4 S $uSG0!!p`000  0 0  0 @P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڜ  0`  O0 0  @"UPb 00pP0S$p#0O-,MX\Pp@Po 2R 4S  0u,Ѝ@ 0Q Q0 '  PS[  "S d 0000 00  0 @Pt4S 0S6  00 000 0 @0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3  1 # 8 0$0@S4S 0$R  @0 RS 00 0 00 0000PV P0P 00000 0  P1p>\UhG-`MpMP!s@PYЍ#TC^t E@0$4$ 00; ̫p+p f*t@3hpP @4$$: S R B., 'hp $4S ($,40(B. hp E0dR04<$4($,40 K>؀C$$0 0E 00`d؀E$t0  P0`P 0$4S    0p 01p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"  ,d@8Od@f|@-@P 4B BRP gp <\4( fЍ@eЍd@p@-@PP PP \.p4PS4 PP<iA-p @PP0T ` Xp4@ p@@$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P-p M@7RP䀟䰟`  `P0P0000.r V:Ѝ 1000*0 Pr`P10 0 rP U P%p%_A:-C$$0A@-qP@-@ p`R`kЍpP ڰP 4 R 0 V, '7O-p!PR0_o|M`@R(0S00S "R0oU |ЍP dPU 0SIQF (0QSB!RS R9"R S R0A +00S000P#  7/p  7/p 40   m0$80P P P Gs@-`@P0zPЍp 5/p 4  5/p 4 WC-(00pS4`  Ѝ$T@ 0 0 h 0P 0~0 ( 0PW0auO-0 0`Pn뤀夐嘠p@T Ѝ0  0SP 0 0S Cp n@ 0 ,p 8A-P$`$p@0 'p@T8O-`p lP `@`T吐  00  Q  n j@ T%8~O-M Q8`<@  00PЍ  P P0S*B PP  00040  0004 pp `040p` 04p  :V0s@-SX`@ P= ?o2R0S Ѝp,'@- iR sR aR p` T~v7@-@P ,P9P _ Ѝ0,p@-@T 40`PᤈPVpp,iR@-. 0 aR bR LR) BsR& tRP 0P0S00 T(p` Ѝ(h0 ,p@-M `@P` P00͵00n0S n nЍp%QA-@ MP Q   ЍA~☀ p$0 n 0`Pp `B~ `PP  ozR9O-$MH@P`P 0P`$ЍpP 0 0 0 $ Y># P0*Q  p0 0?Y S0STp Y0 p G00 pW 0np $ =nP 0000 0 lP _o4  $\ P  0U,S( 0$`84 0sp{ $Ĕ'{!#,  RP P{ T P R*L0Sg 0p^ L004 0 000 0PL 4$$  4 $ 0$$?0p6 T#00S 0@-C^M E@$m$$E0 0  P Ѝ0 @x("(!m"`#XT 80  @mP8mꤪ%%CN_qk$0$ 8O-LM@Pp4 ⴑ崱  1D0 rp  0S$ ! R t!LЍfR lRJ  I@1` 0S  LP mP   Gy Zn蠟 l܀P 6 LnZ V  0Dm@   #Z  C 0`` P` p5e%t,'/%%A-p`(P@lP 0p`P @00! 0$0@-@P$0S m@mO-$MHLPPDp`T   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0 0X0P$0sP UP000 P1!!U111w@^P 0yPPJ T0 0X0$0QP 00  R@P TP0 \ 0 0@;0 0ZS  R@PP0 V00IP  0 0   0R00 0P0@SP@@(4($Ѝ:VO-4MFpT0X\,! 0 0  0 ᒴ1 p 0 0  0 ᒄ1 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0 0 1%4 00$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 0y1!$00R$000``O-M<Pp 8EJ@`LU 0S 0 0 0  0@`@ `000Spa. 0 = 0 J)`VT `@ T0 0 P'@` 0T0 0@ ` 00 S0 00 Ѝ  0  0  J)` T'U@ ` Q  R0P  UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `gV0P/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`lP<g,Ѝ, p`iP0  4V@-XXPX`@HL0 PDDDj<<b@uTnh_A 8 p%U R R R D@-R R/////  Rp@-0@P! R8tttttLtT R\dlpp B R"Sh h@}i\0X pppppp 1 pp ' LO- M0`u@PPЍ0!S R j8P(P0p \4S\ 00$$88P44 8S jQ QP0 4S ڠ0"S1 @i0  <03/p 8 H0 0($ P 0P 0 0 $ P (, Pp!WEV2!R!]!L 'O-0-,MP`p$0  np@d30S$` vP 0" $ pT AT fT E@,ЍsT0 0$Op00 00*:@=qp 4 `0}p0ᴐ00004S 0 0Q-$2!0  R8 +R.R+ꨈ4TT4T44TTT44T4TT4TT4T44TTT444 Rh!h@;h\1R R8 0S8 0S$1 +10` 0`[ppr pn 0oO@@  *:|Cp@@[hW 8 H00 8 Y$ (, `|!%!%L! ,(!l!A-@ĔQM pp A^PP`|t`QPd PЍpP4 $0 'PzR""7"G-@`pP& V4 t" An⸐帀 ` $$ <0 P ! p" $ppP P 00p$Bn  0 PzRV"s"G-`-M"@=mp ЍG20SP5`pPx $R  4SЍ4S_P R 0a $ RQ  nSMP 4S P P 0UpL0 08  0P ,!?o  0N0 00 [ pP2?RP P  V0p 4S 4S  0'%%"""#UB#@-y 40z40P (, \   X \ (Q,6(VV,,(X Q&ZH!V0p` 0p4  V   0 P\"V_ QY QV Z 0 0 ` 4p ` 4\ "$p0 0S 004  $ 0$ R40H Lp 001S0 S 00 sr/0±0¡($qpP4t 4$$  ZzZ~wu$%(%y$$$$%%>%o%%%%%&C-P$M0@ p` P!! ip*0S00 P 0SP0SM \^H 0T' 10S#!Q `2.NP. a@ P P 0`888888x88TXpT T ],$ЍP`7&%@%@-MQ a@P^ T4<DL̛<Ѝ@c0 |cxtplh 0 @cPc q/@ 0Ƞ0 0#30 \S0 P pc $m0 8 cЍ0 0 ppc1S1S|pЍ@c2\PL  PЍ@c&&&&&&&&&p&k$&&%+p@-M(@,`6#,P X0y P00͵00Sc0S Mc cЍp%'p@-M ` @T $:D0S@ P0c $$0 $$0 0 0 P , c 0 tcm0 $8XbTb#H  ݍp/'G'^'Ik$l'(V((*'P `00CS`0p S00 P0S X0X /Xc%C-YMM P0"0b,"  b $r@TYލЍ b  b Q] b   `!0!0 P\ wLbDb0!0(xb$vb$ ! @<#⇋P$ !<#`b ym0 $8x VbTb# *-@PGbCb   F V+d'wj'|''k$l''' (%5(a(*'G-0|MpP `@ P! gpD20S!nP$@1 9lP`Pa@ P $ 4uP .@ЍPP :pqPP0S007 P 0S0S \^ 0 Q t a a븀帐帠pW a  a Q a   p a(%(`%+d'wj'|'(@-LM@P`4 p 0D0 fp T$  ភP 00S 0 TR lRxLЍT pT8yp((%x% w@-0$Mq` 0 0@P!! fp$0S00v P 0SC0S@ \^; 0T 00S!   0*a@ P L$$$$$$d$$|TtopT eT " $ЍM)%%-,M0$00 0 00 00 00 00 0 00000000 F`,Ѝ)7@-@ P000 00 000 0 0 0P  S Ѝ0C-M@pP ` 0 00000 0 00sS̀@ ᛖP0㓔$ Bp0lS|p@ ᇖP0㓄$ .p Ѝ@T r@TpG-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00,0 Ῠ P #00R R 0S T `PP0c# BXP)p@-PP@M <@` @ `  5/V@@ЍpA-`(@(pP0 _PU@)4p@-@$P` Up p@A-PP` 4  04000 00:#:900 @0<<0@ ,Sp@p Ѝ S PX+S@@ R40ipWS8*)*/*E*@-؀C$dP W D(ЍPzP W00 9PMpP @JP$$0KEPP?.JPP *JP (0gEPdP 0@pP%@-p0( 0`P/ R/P%O-04M@@ !T10* D`Gďp P(0$!pSڰp D@T PoS@ڀAP`@ "p00L\pP` R  P Q R/6 0TS $P\(P  1/ P TF@0S Gp "SR(0 Sh㏏\0 2/P W0 [ * P(Iɚ;6eTRIO-MMPp  Y p` % f pP$ 1000$ ≊-WR „ Gp8 ⵄ vGp Q d;R Q8 p$<Q ,+R$_X@T ⎄X00@0 0KGPRh 0 @0v ,0@4@4Gp 0P0Px0t 0d 40,@%GpPj 4HQ S00ЍO,:qO4(rp%O0@-M@z<Pu<P p<Ptk<P d0P P P Pƽ< PNp$Ѝ0POgO4(7iPs@-@~h O '~P LOHPH`4~ P! ,NЍpN@%P/p .PO-M`@PK Ep pP"ԋ(  v  @ Dp% (h( px" <@T t8PNl2P\N UR TЍ0 P2N@P㒋 $@Cp k}Nt 0R Nk);N 9NP `\|q|||pN` R#Q\gN $Nm?P8ЍOOP\ 0P   1Q   IN0! RS} :N8N" M0P R ` V 0P`p`` `Cx;C8i(i;PKP:UP\P҇OpP6 ;~%/l:PP|PPp@-P`@f:P V  ;`P N0`K0߼ 00pR:Tp@0p@-MPP̼00Ѝ`0 000p@ 0 P @0P 0 p 0 `P0G-@(P00p( b P1r0`*0PU!V0"R0 "0ꀼ0"SЍ20Pt 0,  vp 0 @0@-@P / @O-`,@pP(0V0S 87LP$P$P 40S 04S 0S(0p(`8P0$0S(PZNO-Mq00W $000Ѝ`Q Q 00 F  PP0PXⴻU 0`fP x,,,h4@[T /e@P00 D▻0800@00X5{8 "10#Z0 ?00o 8 ]@pG 0YP@T 0CS0 0 xC0X0^ :T 0CS00xC 0xRaDPW@DADP7@D@S 00@D@ TSS0Z`>@'MTh l 9PM.U8 @ 0 0 0`0p pBP<QEEA-X Pp@` P00'0P 0 p 0 `P0O-,Mp`@ PP 0QY: P X 0  P 0` 000   0QEQ@=LQRQJiQWp%Q1A-0%MS@F/ p p<8德 Gp- 9`08N/p`S^ P@8e`px0 p\dXP0,00N/P0,0T0($0`H%ݍ0(KipB8VQ$ @-&pӅIiQp@-t`tP0S s/o" R@ ps z< =p@@pP@@$%`(O-0PU` 00Sp1 000xSP PLD1p@ Q Y Z1P @ `GR B$`U     @ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  G<%@%R8RRQA-@Pʰ00QQ00S A/H00Sp0 000xSX#HTp`VH`   @0@%IRQ<%*p@-` MP@ ⣶U U( P00 Ѝp00 0TPTT@ !ᇶ!0P!!`FPP  @% 0 `A-p`Pp@ @P(㻄 ,z A<CCp@-M@P` N `ЍpO-MMpPP!㖄p`p!t pX!` F/ +  w<1W@4444TݍЍz0P0  R P 8嵱)0  !4  <0px-@0 "' R R00000O/ 0P<1S O/,:G=CCPRi0(_RhRHp@-`M@Sp 0+SЍpP  ḵ  y R #\D =<p 01S 0/S - iR 00S/@-@F(RA-P@`TpP @ 0SP p%RA-P@p f`P h 㣭PX0 000 @ p`W㛃R@%:iR@- M @ph h㐃` Pz00 Ѝ00 1px=RR9iR@-(M @p g CPQ00(Ѝ M00S L P02 0 pA=C#SR9iR@-M@ lp 0QS S  -FЍS S/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PPoASPPLSGS3S8S 04 8 uSiS@-(M@! X 0 p@ @H4 p E(ЍKm>SiS@- Mx @iPd0d dq\ _pL 0D 0Vp, ЍS,>uSi[SiSA-M< PUp!0P 000 0(0, 00` 80\p0@`$`4 <0GP8100 0(00080 p'߁ R P000   :R00C@p0 00 pP00ݍ@ T0S T㨁00 0P0Y>S Ti8>TT@%p T@-00Mt @p` `ㆁVPL   خ8 p${0ЍX>NTaTiuTp%TA-BM`@(  ` pP 0 P P PP  8 ! ll pz l R5?DlmU#0P 6bp 6S30S |(D0dP 6Pp 6SP@30S <D 0P 6>p 3Q? DI0P 60p 2Q8C8 ◲  p 0S0 C8 pu p t  p 0@\ zPpD2Q <CBߍ10S C10S CC 0  `0000pCPU0``0` Rڬx1000 0:S RL P<C`(PpQ {CV pWP ,2C+mCH0S LgC $C~bCUYC`0Q SC C8i(i4U^UieU(oUxUU) UUi8iii>UUUU@% TUUU3pUU0@-T@-M@  ᰱ( 9pЍiuT@-MT @XP@0@ @@i< p(ЍX,>NuSiUA-`@dPBTp``V``<BP`0FSBUA>B-B*O-MM`@ 4XP04 lP7EgEP|7U 0'S`@0 `F@( 0R tPy['V:0:0: 0:0 :0:0 : B(@!0! P T0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` 0B!0@"0$0$0S= A0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS$$t$X#$X#X#X#%2SK Sp 0SC R< )SS0C'S񟗶h*`*))*`*`*`*`*`*`*`*`*`**`*`*`*`*`*`*`*`*`*`*`*`*`*`*`*** *(*0*8*@*H*P*X*0S 0 tht0 `A0$ 0 B@$ ^ R 4&S0p(A$$$p`W>7A 0R 0 nA`0S eA0S 000 ZA00C!圥娀`pXP0  @ FAp` @A0S 8WD 04 8 <%S8*A0S 0"AA ` 0dY)1 pG(  `0,0t4判pY$( 1p, sgqpW!ևӅ|H@yW-0S\ ,  W ((I @3 $( P  #P# ß P# @pl3I#S0S @0S%  l@ ST@0S @@W2VXVVV7VEVJVUV`VjVrVzVVVVVVVuS@- 8@]P(0( (  ЍyU,?uS0@-MMP "f4@PۍЍ0@& P+ 2P@%ۍЍ0@30S0S1iS'XAX0@-MX Pqp@@%Ѝ01$)|p@iPXdX@- P@HP@0@ @@  I\p$|ЍU,?AuSX@- P@*P@0@ @Mw  >p {Ѝ`u,?uSX0 /'%/-@- M,00@(000 P  Ѝ@Ѝ/P00  @@@@0婞-@-  AA ЍЍ/@-@zAㆨ38Y 0S/@-(-@-  qAmAp ЍЍ/-@-  cA_A ЍЍ/l0@-M0S@ 0  0000 0ۖp@@Ѝ(IY@-@H2H22p03&mp(YnYY@-|MPڸ2P0PS 0P@ 0 000 0`♖p TiP@H 00@4P8PSk`!0310@- Mx 0 ʕ@P \dz A<LPP @ , 0@@巕P 020Ѝ0'%(҇@-V4@4 = o =};p%[\\?P@-d0 !X !T@0 60\ (0000/[[[Ph0@-d`  !TD0 60\ ,00 00/[[[P-P040#^4<\$0000/[[[PD0 40#\00Q 00/00[[[PL- 0:# ^4 0Q$0000/[[[PL- 09# ^4 0Q$0000/[[[P 4 <# \,4Q00/00[[[P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00[[]][$0@- 00:P Ѝ5 '%A-Pq@p`WЍ P 3M@P p7@-0P@U , 1o#= Ѝ0nx`A-@0nS0oS@p pnhP`1:P=0nS0oSn>PPi>PP'p @-iU0 W<:~`p%O-MM<(0<,0p0PEU!+ e@ P HG0HGG 0@0D00 p07,p¦0S SH ~: 00,0 0t5!hhhip@-@P_P,p@I0/Sp= p@9ffg@->Q .85Ufp%O-`@ Pp(,娐.뤰0 0000 =p0@DTq oP\0 gP@htg9 O4ꤪ%(i,E,,zf@-M@A> 0@0D00 p0+p60S SH /9 00,0 0)tq5,hhhip@-@PӇP,p@0/Sp p@ffg@-=O5p% lO-`(,p崐崠崰0@P0 <p00@DT oP0 \gPTsMg  #5A+ѝOE,,k%zf-MM0An @H 0P ,0@$+p s4Tlp@-@PaP,p@K0/Sp? p@;ffg@-@P 074 np%O-PM@ P00r`" <p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k `+pY SsuPfPMP9 9P$ GP g@PRlQlQlQlQQ,RlQTRlQlQlQQRRUP|0 0|00|0|00|00|00pt`x 0yfPsjf|6Pw[,0p0Z00t0X 0;;0x0U0$00|00|000Ѝ,on%2dlzf-MMJNP0 @P:00 0-*pl0 r0 0N/0 4 m000@053fmn7@-P @0Lo S? 0 r Ѝ0n@-@&0P @c@-@c(0P @@@- @0S 00S0?  arЍnp@-@PP,p@0/Sp p@ffg@-Crtr@-N40 0000,00(00$$0 5{3rrsEsrrp%@-  @ 0 PR\  rЍusp@-@ \0P 㶣0(pdNPP,rPC3p@&6(ldO-@H `p喣<H @000V o:p60`FVQp 2@FPlXHXWWWWWWWWWWWWWXWXXWWWW8YWWVWWW\W\W\\\WW\WWWWWWWWXXXYWWYWTYWW`YWWlY\HX4\P\h\\W\\40S =4 40S4 0<007aE0:8d$0000000D309@0;g)04 0I 08(0@0080 dP>q0@B (Q  Q@        d20  | d000$0 X d000 0 4 c080$0  c0:0<0  c0:080  c090@0  c000,0  c00000 0 d0909Rg01ra00$00 0 0tT00,wM00 xF00007000+0^40 F Ѝ'%s'%,%(((nzf(lFsssssss'%A-RMMI>0PC@(0L P@Bq吁H`( L0`'p#0KSh0  R<( Lh0d1T0  3% 0 p( h0^/P  0;kPP 00,@ 0.0T0 @\P 0$00 00000|00x00t0 0p00l00\ d0XP,2RݍЍ(tfqstp@-@PzP,p@d0/SpX p@Tffg R R @-o/u@-@M0P`p 0`&000 'PPЍ0P0 0 0a'0 @&0P Ks@-`000/@P &P0 <Ѝp 0`( "4`#/0@-MP@ L0 0P@h00SP P @.@, 0;2@Ѝ08(Nr4u(002P0/p@-BM`Q+ @P41010 0000000 0P 4< 82H00BߍpBߍp@o꠆VrO-M8@@P`ppЍ8#<ă Ƞ,Ƞ D<~4$03 00<D e4408< _0\,YD0 0(0@Ep000K@`p PH00@AP= PD 18(a_brTuO--M * 9@P`pP0FT0rp<00Ѝ 0  3/X0p 0PP 0@ `J P* 0[1H D@0 P3/pp=P0pPTP@`P꠆krduC-MM`p/П cP  P@1L#d8$#4d4# N@41@nD0 0@000 @pߍPHڀ@Td$ d 4<(O-[ 4M`Pݗ@᳎@P :L@P`p4Ѝp pu 00x 0 @P s@ PX0D 0800 00S X0S00000 tpp cP@0Sp!0!D0D00X 000 0  L0b"!4b4#@0@@ 000<0(uu<(@-J 0.wp%-0-M 00H 0@gP ,Mmq zg qЍ}wwO-PM$ 0䰝ݞ @00@"b0"p0@@@" 5p2 0BPa g@Ppj j j j j jjjj j j jk j,l00p00@op l!  0Z`PlK` ȖP    0 S Q l tl@zNz d!!L ᥖP    0 S Q  0z @z'  $op 00i+儖   $p|  0S0<S0@pS(@p @Ѝ?B,,%xwuzfwwwx"xPxxx@-MMCN@80 0@ 0(00 0#p Ml 0 L/"I/!F/(K"0P( l?/, 0P , T8/0L5/ލЍ4./(*/xxxxxy1yy#y7@-P @v0Lo S? 0 k Ѝ0n@-@K 0P @c@-@!0P @@@- @H0S 00S0?  kЍnp@-@PP,p@k0/Sp_ p@[ffg 0`( "4`#/ p@-"440 @"440 P"440 "440}( $0 $( XXݘddhhllppttp p@-"440 P"440@ W}T}Q}DDK}@@E}HH?}L`LPPTTX~X\{ \`⋘p` p⇘ p@肘p@-`"Q@Upf@p@-@P}} } }pA-P@M4Q->C|->?n}C@X=X\:\79>|9>:>C|:>CF| 0? AC>|C>mG|F|E~EnF|G| 0X J~ pXW}m  $$((,S>,|S>G|F|HHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx|0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 PlV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd  0@ `?50"ST0T00  B "0PSX000Y0.d  0@ `5?먠ʿ 0Ϡ:,0 0:1#  0 0ݑ! ?Ց0 00C000 xS p10S  ' dϠ 0@Ì `0 1! ! N7(J40A^80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30T ( (U 9p%(%cO--MM̵p, 51N_R0ePS yqሢ儒 ?D 0Sdd/~D ?0?D4OP p؍ߍ51a 2@ŒD 0L 04;20d04 0[0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p 04`0S7x 000 0p0 0 0`  0S 0X 0 0`S`a ,B 0#\0Q ?,040<09(080? $0P@X  0@Dő$ L00 /4;0> 0 d0@0o 0P 0r ₱`W3 p&{S< yq0//~D22220OD0? 0 04\0hl 0@DE 0L /0d4;00 0@$ @` 4 <001X?{\0X0`0d090?,0{({{{$0 "@őDL  0?$+4#1 0( d 0@Ì `01u(%(T (P)%`+%Ao4 ( (TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0 0 #( ( (8 (L (w 0@P`P84p P@ 4 pp] 3T@  (CP` *( (P S(0S0,5 S<0x0(5002 0,%S0022Q04`%G 0QX%?b" 0 04 0A J%1 040A `A%( 0 4Q@8% 00 Q$*/% 00Q(&% 004 Q%1 0 S0 C' \1\cX[Y1X0S|% 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001$ `4F[0 P c 2# SQ,Qd0Q38$Q<4R(:#L (D ((%(% ( (ۆ0^ ( (8 (fT( (ň(%HT$ ( (% ( (0 (T (D$u PT0\5 ?>C00`#!3x00084$0<0D04t `@`Z000`XcL5P5| P4`F   ?d8@pD ?] ?ZZt0o1&"  A00@&"n@0  4%8$05<4R@*$11 p84000 0<SoPx8S @╏P0@? @P:ڃPP0* : @PP(5#R0:vP@0$- 000Z0 a``8 !0/  !.1 >0Z `  b0 R[ Q[" Ϡ  ! 0   B0SB00ゃP`0*2"0$ 0 ?nV`1V`#T0`10F 0⒍I :  0B@TPἐN 嘀 00B1  BZ!0`0Y3B 11 0S B!I0B? b0 `*똀 0 BZ` S2 B Q 0Sp >#%\u @P`x1ᶎ 0F<Ĕ84CP0S`84<$-0BPQQɑ,`RB1ȁ@L0 0 0000L60S|0` ?L4 40H 00 6amp>'/\#R2\3PPT``0 S  _(7\5?>C00!#4t x0VT7(T0#2! a, A3 31  0 ᵌP 04 P G 0H$4  $ (  B, @%LV.  R*h ( < (R X $( \ ,( E.?.XT+BA.B,-0 HUPcx8 @40 PKX ,p8d A YZQ XZ 0{X RA pW $4?.t{ 4 R?D4P00@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+ c됺 zz000d0S CQ c6Rc`P z'z {'+S! @ z0犸 08z'(cXȊ (+Sl,! 0  R0:1P000\hP2#00Q@@00 7lp00 R00国&A0 U0S_` R! PP0 t`y6 K  XZ⋰>4 (^FX8 (sz@ ('%ht@%D (T (U 6%T$ ((-T ((%E ( (8  ( `00Sh  0 # W 0+ V.㜋|00S  - 0=S,ޏ0S 0S0 0" ,0 0CÁ!$!\^   0 0 0/d! A, a3 1 !0  1@ p <PP04SP0 0R0 S  B S0 8:0,0 p0P0B 0,0SdA p开8嘥ȿ+" < Q \%|0R@.$00 @DU`@,( 4A7W2( R,0@ `0```0T0D勼(s 0 C` p`3$0[`0L I9pQ004 帀 P0x0 0Sx0x0t\00\ ⨁  B`[d HQ   h ` lS2  B±dd 0RXD%J8U0   $0 C00 0 0 R R` ` = 0$5S  l01` p00040S2dᬋ0<%ST0T00! !\%0SP5bX0`P5`S$0d먰   $0偋00080` W9Q iV@0+@  P+@₎ YV@0-ᴐR㰑 ,  BU (039(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@pw 0`4 8 0 RT:  $5SʸG $`$`(0V70S ,4 ; d,04  0,4 $ 00`  VjॉX80S   0帀0 Xx0#`Hx X\># P 0d? @Œ `0 1o @h9\%R tI0SP+i\`/ `ƌ$  $ k0)`S`0 0$5S  l01` 000:0S/df0T*ST0T00! !t*0PSX0b``[d׊먠 ӊ   ͊>00080@$0C40 0400T#*< Q`?0@$00$0l0h`0@ppT:S $S0p0S $S00pW`@P_뀐 H)_ 00@T8p`0x1 ܉pZ90J@Y!@_0@0  T: 呵@$\ Q  @080$0 崉 $0d O@L LB l; p  o0ST=0S0 000S.08C =R= 0ł."\5S 00 0 d 0/ @. `3,0 0 (0000P0SD> 0,@0P0 l>0S 0S >0S  >T 00|:x*0XP>0SNc C>`?0S3030404040p3pGVW*PZV.PhoV.GV.0S n?0 PS?\5=S,??^ E?w0 0S 04 4 dLĒH 0@Ì `04 1,$0S0S 04  d ,04 0H 04Cލ Ѝ<00 Egp@nSaZO-RMhbP  OZ @PH Z@<  xPpߍP(  7pp0S  <08 (00,0 0000400!4 04$0D0(0 P 9Vph   0 pw H <1 0- $) %  p p Y N p 8p?pq8SچVPr   00**0@0@P ~ 0* *\d@edAszd@A-CMMPPp`;8 $Up@P  0P;PU00 ## CލЍp@-@PlP,p@0/Sp p@ffgR/(kG-P `$ 0p{@V` 0{@`` V`@&!D`( G-P`0 4J᪊ Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX00\0p0`P`m0 ,0, 0S% P 0 bXmS aSMSASB0C0b0C S         |SSU@@@sS@ @ @U00T 0DS d9R$ 0 &"P T 8 0U$UQUDT P 0 @@@ X 0t0  P X0S00 000 000 P4Ѝzz{7{g{@-4,@, ,p%|`@-0 @   / O-@0p stP`G0 00000B_I0V W `B@ ᴐ((P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @-hWco`/Ds@-PL@` 000V  @SWЍp((_s@-PX00SL0@`ă5#0004V @4WЍp(((#~d10 PS/C-@LQM8MP`f8 aᛅ 1 P0p8 0 T:86S/∅ <6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ ;0PT` 0+ۍЍ((((((O- R`$(^U2+ k [S!Qq 0BG 0߃콟ڃ0 S 0008cS05=0:ʃ0ᓊ 0Ń0UC 0 $ 0$P   BQ 00媃  p0F0L  00060 6吃< 0 p$p0,(@ (X20740x<080@0h U,<0DHLP\P`PdP'   0T00U@뤗p%ϗA-p`P@ቁP V0 0 O뀗O-RMhbP  O @PHoO@<  PpߍP(  ppO0S  <08 (00,0 0000400!4 04$0D0(0 P Vph x 0 pۀ Hc < 0 $   Up Op O ᲀ p 8p?pq8SKPr   00**0@0E x 0* *\d@edAszd@A-CMMPPp`;8 Jp@P  0P;P~U00 ## CލЍ-0<\   RS  0 S8%0 /)Q@-$ Q:(0BO-@-M Mh {`01000: 0: 0(00L004000 000(0H02t000040080 03D0<0,04p04\04X0F0l0G0T0H0040P0x05|0$0802L S00: 40?;;04 4 ;0T?00 SR <H0S f{PHL04 04 80S:*0>0i/p ݍ ЍL0@ S40@0w P xt 0 @waeF@P!Dp bP }Y80S 14L : SRQP7  wPPPj VPrPE_oR0: b=p 0wP0U p  |P  |@DP$ 63m`Tb:*0 P0*0 :uw:*QP *:s@ $,0SPD`Ap0 S1|0S1t0S0x0S 11011h0 01,0Sp0| RSt 00R0x R0S /ὔ; P0@S 00 T @#P U,  ;,=|PD;P0 101000*BT 0`S`Sʈ0S 1S 0S 1S 1S4L04 0@w?0 0 lp^ p`P`C0S\*Lp` p1S?V?`#0*@pT a1S *6pJ Q 1S A0 y 1C0 S Z000 Z00 000: RS3#*:Q 00S+ PY@00T Q!jmP@ T0 k" p d "B?;;@0DKP?`|0 QZ# Z Z  G ZD0S t5,0S D0SX0\ 0D0 @0D00 (+\0S &X0S    T*,,00S0 Z0S000S"  0C 0T 0#Sz0S0T0S SL t 0S 0C( 00T00D0S0h0 l0Sl000S1\0S1X0S1(0S /l(0P: &9(0P:  p`b 0P!* RaQ xV000S(dR00S00ZY` 1P00V`5U0A $ &z$pY㤢 0< g'JzU0u<0z<00S:Yz$  yU e ?y0 S:1SL5 R 1S *(0: 0`000 Z P011$S3#SQPPQOU Q1S 3 #S RP RM Z yP3UP1P Z 0S<00C<0y`VZ0D  y*10$00A00 @00,0d0p 10PUWP1 Zd0; S9:Q0C?o20S P PR*> Z  2Z$ 02#Xy@ d0 Zp0#d" Z΃6#0\0:Pp> 00@0Pd0S!0$0$03 qW 5q:$ *R" P    G$  im Zpa ZdabV10A0 yd0S$ 0@R"0PP0Gx1 d00Em0 @P!d01SW*;QӚ~~@%Ä4AR$gFjœ:C/?iŝ5l5i%ϞI)p%gfff,UןRRaArrAa 3;CLTjsqC- Z0 Z00Q* 0R P ?o20 Z0 Z00 iQPE0! (1,QR0TL 1 00S 0S000 Z01 00S03 15p5 1 Z40 d00 Z01 h0_ ?"802` PP I8?C"Y$ @0T2#D0l Z00D 0080001l0$40P0<0#40T0,0#40X0@0$0   Q*" *  H\  0d03Q0Hh080 S (s0S 0d8w800T0 ` 00(0S( Z0q@#W030#W 0W00S  pR:`*ps0V0S ` pL T  ~ z0S Z1 S C/o" R P0 00 000$00<00T00,00X00L00p01t01x01 00 Z40 @ 0 1$00(01,0F?03G?03 )001 01100 04L"/@!b$ 04v 08 0#$ #(#< 0  0%V \?h R(0S00d00H o00 0 ST u&?   p T]  H R 0 Q  !R R S 0S60610110D @QS*@ CtwQL000l R Z  R   0D0 00BQ?o20S (0 00 25 010P C0024 01000pZ40S( $00 @0! <0S  0,0S  0,L0 ?Yp0 L  <0t0A?0x0! 0x 40S  Y!  xhXQ  Q  80S Q39,0S$y 0`( "4`#/   k B*@-{S-K A 8 /eAD00@- 44@4P\P 0B"" )-@=B'($)@-4$ $ 0p%G-@P ` &y!>0P V0 0  7PP G^qFpP`0!X 0UG0S < NG0 tV ),ՠ0@-@tPM 0  j\ \0X PЍ0 P 0 0Y 0  ))@-044KQ     Ѝ@-$MPp  Vt @1 @00 !0 0 )) 1 p `P\pAT  D TV@D:$Ѝ Vq}*wPp@-0M,AP`  t 0 0 010R  2   $0Ѝp@ R  #   $R s0S 0!$$("( 18#! 0Ѝp@ 0Ѝp)ء  @-pkF()P@- 0 R * 0 #  @0 $)P `00CS`0p S00 P0S X0X /XV %p@-`)x@8!RP#<10<10 .810CS81V <1S 0<1p0 h{hdyh`0xPp <10C<1(0 810S81)3%%p%@)0@-@-4MT A`dhQ `"R d2RK d2SA = hk0:P{PST1B k? * +['Hk<[E{7  (+S PPP  0 @@zj{ k[@  k[+S4Ѝ00B:k{{'*k[+S@@?-C6?Y@`))5Ndu3%))o@-gi0d2Sâ)@0@-0S0@d2Sg`2"R23%)@-@ 8!<qH 8!s{  { ,00X@ᚙ?333333?)3%O-ppDpd&> ^"44-"P40MRP=p3 204P0S0S `0S  &@$*%8@$*$*/*RL$*p0A-0S _P @`pT V @\PT$@ 0S$p$00a`@$*%/*O-!1 0RR㤑S -q儡@P  P0: ЍS DP`P( 03_ l000m PP@:SR  0Wm Q {p`P0ti0 000&_000$*$*P$*%·X(*@$* p%!BXD2O-0S 44嵪0b00- 6o 2 P+p P@ 0P 0pb: P0 *@@ F W0: R0*0 S, 70 R S U0!:W00#03RQ00S &0P0000  0 S 0Px0i00` \0  P@ Ѝ$*%pX(*@$*P$* p%C-MM Q@P 0S  0 cT000@T0S Ā@p T0:ۍЍ`PP@p0 > Y 6  #000PU* $*%@$*0A-0S ĩp儀P` U0(@TP`0  RF000S 5@$*%@$*A-p`P@P pVpDorPT 00 0CR?o20S $P Ҹp%p@-/0@P\ 0Pp SRp/*@-8k0S$ $00  0 a#*{\9p%$0?S/ @- ZP/*3%A-P0@0/0000 Snڨ/0>+b!T0 L< YP0? 4 O00?/*O*7%0@- @00b0@0Ѝs@-@P`P @TZXX Z?0 00?b+"+R  + VЍp誹p% 2G-@`BMVy a@0DXBߍpTW B/ =j0 S'4tx'xpe w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S 储0 0S y0 000R*Q p`0S L ]`X0`S ! #*I*XW*%ι$*p@-<p@ P(@P0P0p7% p3O-P0_MS XX0TsTC P L0H#0+b!L< SXP L D0?0H @L $P$PD 2i P n$P7P|_ߍ$*%$8$*#*$*7%CO*P#/*3%dRgX(* ƺ\,:;?*p%;%@- @ 00: SX(*G-@qaP U+ P00S 0 S00P R GRڀ00S |plP Y XeP Y 0:0S ( T@$*$*p%5NRgrO-AM M` 0j@0 pP@ Aލ ЍO/9/P( 0`!`:cPQ D D @P ,ePD }@T ePD s@D 䰟`T Aލ Ѝ  A>00C 0  R + | D M@D n`0 R  0 D m1O*@mp%C-M Mpp0 /R 崀@` G PP 0S P@ۍ Ѝ00 D :Ec`D @P 0V _P`RgO*p@-0@ @P  P@p@-@@ 3O-tM0 S ttp300RS`3`  T3T#0o@C0#S<88tЍO,g$P gj  F B0p`00ܢܲ@?` _0@ 4¥W6 ! h`V5VW b@P p0 ?0@! $ 堥坥 ?0@ 匥剥"tЍpJ`10xSiSP@P 00@ 000 0C0X10S 0S`$Y\ ` @X@h0SS  80S d00X00\ `0U0P!^c 08d$*%$*8$*3%#*)p%?'/*it $*$*ɼۼ 0$*<=V@-AMMP 00 pPpP'h!hu@PX T\L'Wfw< 0SAލЍ QD D<Pq`Uhf U + B p0P +fH t$0S p T0TP 4 mf08 [Ekѱp%wO* $*X(*@-%P@-H@0#S 0[4#S 0@Q3%7%0A-@P` 0 P0:| 0pp ? W0@$aH00S$`c0 $ @0@D3`P P %c  1RQ rQR1 $ RP P0dEW0 P\1 @1H1@10S0" 0 AD(C@ (@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t%P  $*%@$*C*@mjp%9[e$*($*X(*8$*#* 0`( "4`#/@-@MQ 0 3/00؍/ J 7 #ꕍꆍ00@-@MT[0Q@X0T L0LP  @  Ѝ0@Q@I*IX(*+p%0P @-X(*Qp%0@-Q 0@T0 R ||0AS@ ЍH0H xP-b( 3%P$*I*p%x;%mA-p@@P 0 0S(y ` PF PI*L0@-  Q4 0P ((J Ѝ8I*X(*p%@-0xP 00S@%*S` P@` 40P  $ 0 uЍpI*X(*p%0@- 0MS 0 @B4/ t00S`@@YqpH0`PPal4 0P$EЍ$*I* $*X(*Cp%p@-hPh@4S 0SP LLH H0P0$000R0p 4'I*X(*w@$*X, , c 3 F` 0  W '8#`Rp00"0Ft Fd实00@ Px.Ѝ'*F%0X$*W;hp%$*V(EV'*gO-@ᴳEM08aSP  넣0 @00T*0 ?o2Q03S L30S @3 T<#<$ 0S  ZEߍ0S3 0p0"00S 0"p! 0 V V V-    0 B B B 0 zh"p+ @20S P 0@   0 B B B 0 X"   0 B B B 0 J!0S  0\ 0P \P. 0S xV V V     Ẳ8!$!p0S      ɲ V V V|     ᒲ x p z     ᤲL $*%/$*%FQ;%Tiy" 0P/00S 2;%I*PO-0dEM940MS` P < 850SppލЍ90 Z t400RSp 40SppT)9S1404040$4@렴堤 ;mO B⩾00  4 S B3PP'Z0 S  0ᔩB )R)  0B.q B Y pp pahS PYH$O B` P PhB[P u $ R B  YU $SR g Pu  .P_<t.2 005P 20S )8嫜00A,0 S x l#R QPSÝ\U  $   )a#090)S 3) 0S 810S.0S 3 W#3P) RYPER00PES @!U<1<0 PUJBJBGPEU 0S 14S 043P UB-PEI*P$*DO*$*X(*p%+Ik4$*.y~);%R#*$*b%8$*($*A5i% X$*k$*;%J8́p%yY,C-MB2P000R0 r 0M0 0S a쑟=聟0=P  RP 0AS^|{|{||=0=ꀁ`0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@喘X(*X$*TI*'*8$*$*p%@$*SgxO-AM30L(0 "S d#Cr0(#͡ A5/0(0#R00 Q#00Уh Z0 (0S @(#C5/0(0,0S3,00?0!P#0,0@* W P Aۍ<ЍP(0S #Cr0(#͡A5/0(0#r0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B 0S 8#R00SR 00S \0l 9P tlx3  P8P0SX$*TI*$*;%X(*j$*%60 X(*\@-@0SSX$*O-M@ 00 040<00 0b@P 08  b 0@ @ H0LP DpI* `P` R  R  R;  R  0 PL RM  R"  R`60S TT L60S 868PU),-P"X 050S  pP% R P 0  t% R hh V PЍLU000L%LHW0S50S ( 940S  PP 0 0 8w t  u uW00 040S t 0  a$ R < #PU# R ^ :  0?P @X 0x T TW 0 0 8  \30Sc X \T 0 kI"0#P00 020S  2PU-20S PW 0  W 0 0 8  20S 0 0 "P{00 0f 10S 403/  !TPYW00 0BX10S00S 0 0 800S  0 G4\p 03/PU 4   p0,P sX(*p%$*%$* $*I*s3%\]0^I*$*o.\ARn$*M*0_`A-1(   0 !S@ 1 1R 4S8 !4|q04 |0`a@00S/ P0S  R+* RS-<P- !0 010000 QP 0PW 0 $P } P ЍPE"0P;C0P|;0S050 00#0 @ 0@0 0X$*X(*TI*@$*@-M|c0S pplClS0S Yx0SV`0#00,; R0E3 6r 0500K rP5"0C590C990C9000lP|n x堔0S \2d"`2Q09T09 <0S 420C90S 20tS2"CC2PP47V 0R0%S  P #V H;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S 2\)P 00S )XK0STP=S 000Ѝ$*%I*;%DO*p%P$*#*#*X$*#*rTkXS*I$*'*($*8$*@m;[$*bL$*H$*-@-  ) ЍЍ/p%@- 0\  0P UU 0 84/Ѝ(Q Ѝ$ $*Gp%$*l%x0p@-P@T 0P lU/@ 08 p,00S   @ $*}p%$*%p@-@T`P T0:pKP 0S 0@P@$*p@-@PT0*p3P 0S 0@TP0@-@  Z0  xhT0 dPN0 P8H0 < B0@ (< hW*wiW*@- @P @0 40D0Q3}ЍL$*p%A-Pp` n9E00CS0E@ T 00CS0; P yTnTyDo0 @00  0 0 Sp%4$*-@- T L00S @P@0P/Ѝ@Ѝ/p%$*R@-p`P0@T$QP!lT/0  ЍR0@TTP WTh0 X@H00S <U8 8 00p@ $*p%Hu$* %@- @  P   P  P  l$P l L\0QX X , H@0Tp%(;0@-@MPPPP<  P$0$ $Ѝ0PFV]h[*0@- M@ \0 00H ^N; ۍf@-@0S g,00S x P 0@00SL H0DЍ@%800S ,,Ѝ@Ѝ $*p%$*%C-/`GB@P @Dp/0S Ѝ/SpPP.0 0P000@-@0S  0S  0 000|00S  P +S H0DЍ@800S ,,Ѝ@Ѝ $*p%$*%@-@0S 0 000x00S  P R D0@Ѝ@400S ((Ѝ@Ѝ $*p%$*%@-@0S 0 000cx00S  P R D0@Ѝ@`400S ((Ѝ@WЍ' $*?p%$*g%C-0M.S4P@A`p0/SS Ր0 02U  Ő  忐         p  xX  d ㏲00@ @b Ѝ$*8{%p @-G C-PAx@`p P P6 00 S00 ЍW00roh_*(p@-BM @P`0E CR V URPD0FSd0  AS =MP0P S00@(; )Bލph_*=A-P@`"M<0 gpMW Ah_*p@-M* BP  PB 0SP  P0 PP 0@ 0z@PS ! 0C R: p  d!  `V$@1@a0Q -CM0( b Cߍ/ 0`( "4`#/7@-Pރ0Q  0!S@d \ 8P!>T0 0d Do Ѝ0_*@-@T T  0Hw ,o(Ѝ@@ %P 7P P / //  --M M? voۍ Ѝ%4`00CS`0X MX0 X /%O-pQDMDЍO@@x%`pP W200 RR00u0PS0C000@@ Rp@T+ W-Y* U U %   O  8K0 .   ~O  (K.0 e p W8%:_*.3<0S/@-@PMQ PЍ@ p31Q``X00CS<<<<<<<<<<<t<"2PЍ@M {!0S S/   kd0AS&(8@P|HH\ <840R 0SPЍ@*| E A =0J1hS fS5004003001 200)j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ( xVPЍ_*Gѱrx%7 /xO-@R|Sp@-P!P0@00 P ;P P P % P*@ P1:P:P*@# 0   soU#Q0B000pP*B4 8#8S 0S@@D_*P@- AJ0 9Vp%O-`ဣ0x#S00000P0P0 0@S 괰$,P% P@ @00zJpP0H0p XL0 0L00 Ѝ@@ @@[8 "[: L`0PE 0Np W aNQWNANQ7N^\  "V  0C0p}Y/;0H?o2 P0 Sp L0 S yp I  ЍOG`(p/00pPxP XL0S P!P*X pvA(pP P᩵P 000 o1 _*=%=^p@-P(@P IPp@<%0S $  R RO0 @- 5b*@- (0 0$000 ЍxP P P q@-(M0D #\S@3@#:@ [(Ѝ d$P7@-  Qm,X3DP Ѝ0 @P .;PP 7IP=^b*c*0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R P Q ,CЍ0T%<ʔ @%(T h X%T @ ,~P" $ @ub*=^52/, p00@-Q @\.P!P@QR00 00b*dd*0s@-@ `R  CP.c:P ,C0S ,}C|Ѝpp0 !PU U H 04Ѝp@Ѝp@=%c*=^b*;@-@T T 4 0( ЍЍ@+Ѝ@Cb*p@-@"1Q0P Tp@@A   p@70  p@1-lO-\M00@0"0 0(p0 @@$@,0@s4PP PP 0 @@`4P``wU]\Ѝ`P0  FX y RAx   <y0P  byM 4\100 0 S0C000  Q4P <0p p 80pj0M x`00CS`0 X 0@T:\ЍOX0 X @Mee%=%t@-00; Ѝ@-0  3 ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝ}@-0@ 0 0 Ѝ?@- uHp%@-ũ@-AMa Mp@0WP0`qT1T!TL0P 0$10 Aލ Ѝ`00 ! !01 ?t0 !R 0G8s@Po: gf:<T0 <V<@D0L0\0\ d0 DDe*#%j*5i?a@-Qj*0@-6S e*@-):&:#:x :pdm/<@P\" TN  @  4D, @9ȿf*f*@- p%@-0h@  0@ 0\0CS @C@%p@-@Pp00Sp8PU``p840#U:cX 0rX0X00P4080 X0X0p`P -7@-@0 P0 0PR*00B0 Ѝ0@Ѝ/O-dM@P H@DPU 0 S udЍ`p |0 J0]0 0^`!0 0  -D0  ` .0 V0BuP nHP*@%A-@p帀`P@"!023 U 0 upp p yuP@T0S0P   Ѝ˅%-,M)L0$0H00D00@0 0<0<  $$0 Pdmwp%-7@- `P`@ T@ R 0@  000 Ѝ0@Ѝ/=%ѱ@l*p@-PP@ 5H0S 0CS 3 00p&Hp@X T 00 H, ,Up0Sp_@l*Tl*A- M`0p0 l1 pЍ P  @P 0 PPS1pЍAt01Sh0h 0XXpX2`00S ` FP `@l*=%/%~C-@qM10`Sn1SP1SdV1 묁XV lЍCVR 1S  @1ЍC6V,p0S) S S BX    BX  rVЍCl   BX  `_ TTZ ЍCVЍ@l*=%/%ѱqC-k$B'4 0Q 000/ @l*=% A-JMxAM1She=p5`0 `PF c40 0`O0p0S JލЍ;X P0FA7J. H00A1$L  $Hp`00P0 pPF0pF Lq0S8j!10 @l*2WtG-p\Q `1S1S@1SHV$1$ 1SV nGV1S 0G 5VS0  夠D@d0SVG1S  Q 1S | <wG 2V@l*=%/%ѱ*BQC-a$M0DSP@ pTp/ YCP 1! 9F   0S\ 0Sy0S#F0S@@0 /po$ЍpT 1S!0T0  rq 0 0CT !10!sr 00 0204 0*00 0"@l*\O-hbM0弐SP@ mpTp> ,pE,0 */pYЍ  0[ H0S  E0S@0 .poKpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d , , 0  0$0(0!008 0d, , 0 @l*0C-,M80P 唐R/ ~!!4P`,ЍC``@ @x@(0`0$0FS PP=%@l*Tl*Rgm*O-\M`H@@PQ% 0rS P @0  00000 0 0P    RQ  \ЍS @0  0P@m*A-p!YK@l*=%/wO-DMhpXP2 0S 0 00 (0PEP ((0(  `@PDЍ0(0(0 0(0$`s`(  $0 ``y,pDЍO9(P 0u(  0C$ S  u'崱堑P`( r00R0S X 0H0 0,,`!10< 0( (0(Ps ( {B( U((0$ 000  00 0 000  00 0P$ 0 0$1SH"<!!!! @l*K>%SWѱC-M⬀p`` (=W000 0DP !  Ѝ0000PK@P PP 0  PP+pЍC 0R 0 G0W400(00 (P{ 0SQP j0 Pp0!00(`P0Stpt1Sd\p\`D0S U   PK@l*>%SWѱ~0@-P,M@0080 PPQ+p,Ѝ0 R  0 01SP zZj{e[fk0KZe[KK[K+SK@l*ѱO-MMhbp9D00PS@ CTO P"J@ BA 챟Y:@0@0 *p/o;ٍЍrA0 0 p  Y ` j `A "QPR(% !*1 "! 0T 1S!1T0 0*}T !10 0*qvpr< 0jX h@d<  0[I@l*p O-JM M`@pPJ<3 0 S0!4sP40S$ 000    $ $ 0 `000`40 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( nP ,( 9H0 'p0 1wH0 'p0 p g;㨀H0 H0'ppL>0 SpH4pP H0 'p 00H0 |W: e8pH0 ppH'p0pH @P0P pH0 pp{'p H 0HTl*>%@m%y/>%@l*ѱ8V9Dp p*W`hrz}z~(Mo*=%O-пqM`=P`,@Pp Up#*0Tp?SpDp00k(x/`P0.0809` R   1PS<T @`  ]=00 14@V=0 ,&@@<@%@v, pP0@ @00XW!3X0 S7 JRED=T,`@P 8   8@8@:P T ,B,P  x:P+Y =y - 0S%T G= 8՛80T  0S6=0S PG:PY@8=:P,T 6:P 1:P0p40 ):P0p40 !:P :P0p40 :P   : PT  < 8 y80T4L  0S<0S 9 P"T  < 8 ;8 T  k R< R!P 0:{9P:TZ 8@80 Ro aBQ*DT\dlt8|p  `080ikklgj   p5p3p1a< 8 ϛ 8X<  0S N<0S 1P00: <00140k0!S0< 2  x 0G0u9Wt)  +< 8 ᙛ 8Xl  0S <0S R0* 0%0%00140k0!S0404@kT0F74B7T* ; 8 u8X 0S;0S `  40k0!S0 (S01W40Sv  kW01Sk4@T T0G?o20ST0G?o20ST0G?o20W0S lNW`J 0sWp0;p005&&0@A4@P900.`d8 `aP P8Bw380U08080S@00 @ c/4 4 6@ @$58 80 p@ @0Y 1=@ 0  ! `0400<0@0,$p<; !105 "@04qߍ 1PS 0 : 0H0tc?D`D0H 5p`b$pH0SX Z:H-0A1 d! N`0D00 0@`qa$p: !10`100CS$$1" =)@P qߍOdoob4S @0404(0 0,0c?0040(00000, ,4p$p;W,{W RT=00D@ 2`P0=S "8 R  2P 0=Sd "8 R ` L }2P 0=S x"8 R  qߍO( T V0@4,0p@[VD@70S 1S X'  KPP `V-t T 0H 0(00,00 p03A6/00 HX  00( ,p0,S(` T'&: Xqp  :0"S : P0 SX0T R (00Sc SW S0G&P00CsL =" @l*8=%4Mj&Uws8O-wm*D.xZ5{8V7>%LLUko*Tl*0P LPT00T0pP#pW^m&&P000&00' T00.hPT090SY@@T T TQ0P 000L @C0' 0 0& 0.00000h 04؂`@\PV|9PP\0 pP"p WqߍOm490S0 0\0q000 j0000s@-P@  | p d X L @ 4 @p%Yzt0p@-P@T`5 P  p@4|p@{ q*^3+K-M M  P(Pۍ Ѝp@-IMM @`PHIލЍp ⪾P0 30 p-hP 0S 0S0 0S  㸽Pjq*@-M @ QPD ۍ00 R  㘽Pq*H-3MMHp@PPXY %Pޯ0  4D5`P00S = 85P ߑP``V - ՑPt2  s` ˑ`P_ H2P @5P ,&PP00 [U,00P`0S北W J1! PJ PP xJ1! @~P\10S P 040z 0\4PPPUqeWP P  0 V_ᶽPiP`ZZE_oR0 7$P  4S J P x#6hX0 "q*OI+D|Dx =p%bO-M M@`;j/@p" DP@@ ᐽp p0Wp0Y:p0S y@Pm ލ Ѝ0W}@P @p440P 0Z 0 p 0V9 H1Z ]P Z.  pZP Z. 20Sa00Z00 00V9 0Z 0P Z. l@)0T:Z_P wZ.  p$|d/edAq*b@-0` 0 08PP 0 P@P8P Ѝp@4(PP 2Ѝp6O-@-\M, ($0ŻPPʴnc\ЍB`0P0  㲻Ppt U ` T] T` Tc<%*KL+8D+D+D+C@-83800S ,0,0 p rk**Hu*T0@-@@3@00S ',0, 0S00'PР**Ġ*M+Lv*C-pQM%6*/[0UL+D+A-@Pp@0S0P0`|0 Rl  R 0L 0S @ !P@`T !D+X**h>%D+8CP@--0 RL+P@--0 FL+!yP@-,0 :L+P@-(@ ,000 L+* 0S0!C:P 0S0>PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0& 04 Cz:PL+w]M+bgL+L+lG-MPL,04 ލP 0$C[:P 4@@0 1PY30S CSc l5PP /3 cs@0S0S PU~T30S4 0 P. H30003 0E>$3S3Q 0Q300?o2S&Q20S 2 0P0002@0 0R R00 R P (2<"00P0 22\ Q100?o2& Qy10Su 1pP0001ph, $/$0 QP$0S0L痏$4PU Q 0S 0S 0P 0 00000Q Q000?o2%Qx00S d0 0ZP00080L+ܻ* Hu**Ġ*L+*L+M+gb**L+G-PJMM0 000 0``S+1 @ JލЍS2 0S! %9P 0S0n<PP V0  t1t p1 R0 0S0Q)Zp% 41 @T (1(m! 8P[Z@#P͡0 =/0S @$00 R   R 0D e't0P04qp %R0@FL+lL+L+L+C+*wM+0 0 0 0 \M+0 0 0 0 RM+#C-KM MPu*|2 Kލ ЍP0\"C8P H2@@@2000(+P 2 0S@2l. CP0 caQq0S 0S 00 v3@P -`1@0S p5PH1` 20-P 818!0001 0K0S ⌴P+ 00 000T   /o" &t0Q00S 0@0P0 00d0@`L+ܻ*M+C+* Hu**Ġ*?+L+L+L+#**@-PAMM )0 AލЍ@ؿPP0 廿` pF x&t0p 0hphp0+g7PF0S 0 `XL+'*M+# 0P/ 3pP@-0@p)000 |0L+*7@KPp@-@PoU p pQl0l0 `pP `@^P00 WP 8)p3p* [0 @- 0c̠*L+P@-$)(0 00S/0kL+**m0 @- 0h*L+Pp@-Q !0?o20@0`Q   0S 0 k0S P (00p`@tPX0 LP80 4P400 0ؾL+ M+3p* **0 @-R 0*L+0 @-H 0 |*L+@-(@(0 = 00S0  * L+ M+0 @-- 0-*L+P00P0SA-$a ~(00Ѝ AP0q?oѣ2 PP%P00\ Q 0S k000oP ,$7`0 P0R00D00$\(  ,LL+*H* *E3pPw*ܠ*>|0 @- 0*L+0 @- 0*L+P00P0SA-@ (00PP.p`P0 `0 S   S  0S00hPL0 4P < 0?o20L+* X*T*3pP00P0S@- '0 ЍP 5P 0Pd00}S`00S T0TNj0HP80 0 00( 0L+4** 3D+;+;+p@-0PP00008@Ppp hᑣp@P p@m'2@ 0S80 0y00 jL+*;?+*LeP00P0S@- K'P0 ЍP8 [5P 0 5P0 L+wD+@-M P*'H1 ЍP0! :5P 1@@*P0P`p N0@P*0@!0 S0 0S P Pl0  Q0S P0 @ 0P000$0@L+ܻ* Hu**D+*@-P&0 ЍP 0Sx 4P 0S0TP0@P00 ( 4PL+D+G-@PpHoᩒ @(P510S1ЍG.iZa01{&x1 Ѝp.ZP+P'@PA 0|S@= 7@P1 T ЍGlP*Z ' `0P0`ZZpʤP0 Z pXj(PPP 0RP%5|0 @0"P000 @0"JC+*L+e0#A- MP &2 ЍPO0S!4P 0 1Cz'P 00|S U7P P 0tf'l1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S ] 3P00 T0000^! L"Q|00S p0 00P00D0@L+le ܻ* Hu*Ġ*#**p@-PPMMn%1 ۍЍp2)` @PC@@⚮T%),h(A/P@=?+P!00S `g00CS0 ӻU000 0AJ|0  0 /xP(Pt00(+@L+ioX***$0@-M0P 0$d1 Ѝ0PL!  300CS0,P@0S0PPP P@$ (T T 0wg0S0 @ʤ@P @Ps$ (Ul0 ,0S0D @^$ (L+KT\g*o~Ġ*p@-0p@P0 p@$\0\`0XPS 0S/0S0p@*g $卺00pL+;+;+*p@-0`@P0 p@g$L`LP0St/0S,p@g k00pL+?+*eP00P0S@- C$0 ЍP S2P 0h-PL00}SH00S <0<f00P 0 L+**D+P00P0S@- $0 ЍP 2P 0hPL00}SH00S <0<f00P 0 L+M**"LD+A-MP`+ E p@pET` P-+ W+ @0 ۍ6D+@-P#@0 ЍP( 1P  L+T%@-P#@0 ЍP( 1P  L+i@-Ps#t0 ЍP 0SP 1P 0S0,W r1PL+w}Pp@-L#@0 p4@0PP0 ;Pp6L+*0@Sp@-1#@0 p4@0PP0 PpL+*Pp@-#@0 p4@0PP0 PpL+*QoP@- "(0 00S@+L+Ġ*QoP@- "H0 <@0S 0S 㐶L+Ġ*@-㈶0P@-000P0S "P0 ЍP@ 4@P@$d" &L+p@- M P"1 ЍpP! 0P 0$#p`1`2e0S@1D0 0S 1( nP9&P.0 0S 0@T 0 e %&`s@P  " d@ y 0@ 0 @ 0@3/H0T 00S00%L+{* Lv* Ġ*&*M+0 @- 06L+L+0 @- 0Cx*L+PA-PPPPU㈀ "00Ppp@h0hPd00P0` 00cT,0PA YL+L+*]L+L+P7@-A P000d00 Ѝ0P!0P%0SʰP 0 00 00S@ 0 S  @@00\+0 S +<4 /PL+L+*j**H+D+uPp@-@ 0?o20 0P !00pPᕹP0 00xP0t tS00Pd \y0DzP(0 4sP 0L+** 3p*|"000 0@-S$000 0 *,*L+4*000 0@-S$000 0 *0*L+8*p@-@Pp@0 @- 0M+L+0 @- 0M+L+PG-rR@PpZPYTP`Q &-`PbTJ -@PP[$$ UL1`H1@W <10S $1$!0$$ S !  U1`0@W 00S 0 0 S  ȶ }$ z$PKP`pỸP `ᶸP PᱸP Ѝ* ** *3p$*(*(&  @-u0L+P@-w |0 plP \00}ST00S H0Hc@\P40 , 00$ 0L+d**iD+;+;+P00P0Ss@- D 0 Ѝp0` 0S P@P 0Q R   L: 0Ѝp@b$Ѝp@-L+C+*M+Pp@- (0 p@0P0PpL+*C-PH2 m@r0S424bP80S20S 1b0@ 唀 K0ܑS C!!"  A   㒃# P0 U0CQ00CS0F PI00CS0J PAT! -PS0 p` 0Kb0` Ѝ0 `` V`0 㓂" Q000P UQ00h0PEP00P0 0 Sp(0L{0 0 SL+***A***%6}P@-00P0S`  J00ЍpPl  [-P 09)qpP@ 0 $0$BU000L+w*P00P00@-SM@  00Ѝ0P  (-P 0X)qp P0P0  ) 00 0S0000L+w*P@-$0 PL+@- (0@P0 @#*P00P0@-SMp  00ЍP  ,P 00`P PPP 0RPY@V   . @ Hw  s =00-+L+l06P00P0O-SM  q0 ЍP  ,P @P@ 0R@p`-|0 `@P00 Р00000@@0 ޴L+w0 M+M+*PA-p '00`@P9P 4P /P@=*p0 ` S P@@ @00 0( 0L+8t*'l*p*CA-p`P @Pd0 `AP 00i-400SU0 Aꠠ*n*A- PP   R ЍAP   R   ó@0S00Ѝ@`pL+>%*%A-0p`P0 APPp@P @A螳P -00 唳00L+*nPp@-tL0 p@00S40p@,`(@0P 0\PpL+C+**0@Sp@-Td0 pX00SL0p@D_@@0PP0,:Pp5L+C+** @Rp@--l0 p` RT0p@L_H@ PP0 ,Pp  L+C+*!*NV - BR0 R  P R 䋳O-M$M PQ |3 ٍ$ЍP 0\#C*P H3HS`@pX ,3 ( /PP@) 30t'` P0S 20P @B 0S0BD008pK\"lF_<"0SP$S \S00P$ 0""  0## P00C   BR 0 D)b0 0!@0SPiR 0PS 0 D )b0 @P$18^1 R ! R0 R Ȱ^ &   尰2/ R 0S `0) P0 0000wX& 0`SM!L+6****@%*Ġ*&**̠*@-@P 00P 00P00p0- lM X00S H d0 P000p ˤР***Px*-lMxT00S D d0ְ P,00p **Px*@-@UP p`0 0C0S03  .P0 S 0C0SP03P  0 0C0S03  ЍP s@-P@:  P, 0S1PS !,tЍp@,*`)P %P008 ,S!0R{ 4p@-@P ϱ00PU  APp00p@-@0`PP<  0 l.0Sp 0h R0 0 Ѝp0 0S0C B R1"  `*P/0S/0@-@\0%\#0S P   R   0W7 0C200W70 0C0@%C-pPM0P@ -PPP0   -P 0 0P010S&"p y-P0P 0 U *** 0 011P  ~9mЍ/ P @)`@ P 0PS1  `P):` P P)^P Z: PP000S`U' 0}0S 00S0 @Rđ.0 3~@  ) ` 0S 00 0 ) 0S S St0 PUt 0`S)H0PU ),P*QY`hP*xؠ*RgԠ*% - BR0 R  P R bO-!M M@0$ P<@8@4@@0D@@@,P4`0 p 0S 0S 40S 0S }@4k!ݍ Ѝ<P0S ;x3@P D墱P 8᝱P (ᘱP} }0040S 0S 0S{T0sX0s\0s`0s0Sd0s d٠+'P>0S|0 /|1P'||'>|0S |00S(1S XO 0X 0 -=0S z_|P' (1Sh=- {)0S zO`)P$->N 0 Q)00 Q /l>0S->@ R*p` @,|0 Rd|P<0] |00|SY X|Z0Sh<0K|\ )ZN H= = {L,i<@0S  (1RS  S ;+ 0qS 00S K? 尐0P{ 0Sx _&|P`+y@P@ 0S :0PTsV :F)@PU Th@h0S(1S h0S\ ; 0 Pj$P A% P  0P!Q/1L1H1D10h0p P10D1S 0S LAT# 0S P  zQo0 0 cy0S 00S P @0L1%LGSQGύ00(!0R _@@Q a0000[49_/01010r<pP WZ0 7zPdPd0S !.zeB<Tp`HPVu   0g_0P0/1Pp90S qPP<g/ ` $_ [00S t g?/80 S00?o2)$PP0 P70S P 0SH%P 0S@%878G`4W/@P3)>707P ;00@T F P ,00@T 7 P 00PP ;NpL6DF\P< 0d')P<60S'Ph@T)$!&G&&5u`V;df 0( FW & |A@6 h:6@T pK?00,%14,@($!&50SP  P4$& &`h$4Q&&px0S``\4TTPX 50S h5l @\ i&V 40S (54 ު@$ Y&T T&&p ֐tP40S 4\WCg0P:xP0$ 0 PG  P  q0 R$ @3000@ @p`P@ Pt $ @p`P@"0  UP[= P ?x2Q00S I[ [ 80$0 PDP 4P 0*S x`Q0-S xpQ P0000 /R *R0 w0Q@00000S1 0Dx*Px*   *   *M+" ') e%D O Ty*C+{qe o r   Rg @* K  o %***E ***e `*   L*,   d s  \* 7@ [ n  ~ U 4 O i E%@%~  )     % - P d j  | J 1  ,M+*i M+w/# e p*Px**9 M+@BF4h**l***P 0, o<0<0o]P 010Sor DP "PdP tP fwP^wkp00p0P P xP ܩ0x0 "xP$0S S 0SX 4$0K?CS3 U 0SpX2 0 Y ᬩ 0S ᧩U ᣩ[H [ !"2Sw"$2Q0S G?0 0l2< SGA2h ܨx0SD30= 000Q00Svz30 00 Q 00S% 30S0l03HU0st(4@VZ | Hr|P峨0S40|pq|x|F`B4 RTʤ4$ds4R P 4D! 44p\0ǟs \0\0* EpPU>  J%PDWv0 t0  2t RPx 0"0C?o2?  "t"0A0@q0t0t0 R ;R tP 0t0t0 R RU 0S;0S(0?"( ,0"-p0S ?0-U0-͡P!͡!--R0m "0R0-͡ 09$`P#PPp0Sp0S60S#PP 4&8000-R0040# -0 x(D @寚@D pL HHL P #P V | R70S 70S7P #dp0S PEU0S HhB  1Q 0!PZQ= 0 Q0 Fh#}8 8pŸp U00R0SG PsPq  N$P  P$ Uc e490Se09 Q `T) Q0d9 FUx9#A 9R-sr VO-pQ!03/P|Ṛp9@儡  : R0,:PFT=X <\;`:(#0S-:| 0R/G0S p00x0S xi0x00S b000S [00lݍ Ѝ0S 03/|0S |H0|0Y @p`@Y@p`@s@- P@{#P  u#P0P ZЍpn`P  b#P 0 FU 0S S TP 0S 0 I#0PP Ѝp@Q`dYq@-M0h 009P P10S 0S00 0 Ѝ)  qQa @T0 S 00S 0s 0 :XP 0 S000Br@T hP 0|S ᘦ00 0S00 0000ꌥ*Ġ* p Px*P**e@-$MP` @I 0000000\p0P/S:S Ty@d+ + L `&8 ! p0/0)@P/:)`P s@AP =$Ѝ@ /000`0 ?@PV`@00l0@@DcT@@00@0CcS1S@Rg L+PP00/@-,0 @  000@Р*`z*@-x0 @ d00S X0X0 p 3<0000S %@Р***`z*@-@`00S T0T0 p 8 10 10S p@**`z*l0 @- X00S L0L0 p 00 101000Р***`z*ܻ*d0- lM@ Hd @ <000s  ŗР**t{*0-@lM@n 00 00 0rS sS tld  `d T000s  0(d Р*ܻ*`z*M+5*t{* @-`PP@ 0@s8#80@U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /ڤO--LM|00?xp0  W`"?p0pW (╘`PPV0W B8⇘8 (0,0R< @ 0PZ0S= S0D 0Y 0   @P*j0S f0#S b|0Sp L1 R 0@@0`5 pP`5刵P<000CS0a0 S(P50S5U <% 00e ;0We S00G00S,+  0S 0 S Z000S800CS0,PP00CS0!l0d :0 @P00CS0 00 0 s`83 ap0SS 00   00BލЍh3@@<30S VW@@ c030!30 V S$ " R 5U Q Q$Q V RV"d 0廢0H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U0    0ZR3@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/`z*  L+`***d****sWt*dM+C+@%<*-A-` @T p0 ЍAЍ/p00$  PڳxNl0 h f oB0S@ uP 5/ꔦ*L+`z* 4t*O-FMs M`@  @  00$0p3$ 0(00,@10P S ң0 ,o$3 @10 @,Q(2@@ಟ@aGT  o2  1 0 PD0P2d L'P x"xdl 0S 00S DD 0d i ˕PP dg@0S00?o 2Pw  06j16D01@ @凕pp >H1pZD0(66S0d000 d0d( A  a0PS oP P 0 00S 0 0OP@ 0 @020@p,, 0@Fލ Ѝp*@*L+C+*K o*  *'*#*O-JM$GMs~0`0WXg700S00p ݓ9 P崆X 660 9Pl塆`60 00L0 Δ97S\4640S# (X6&0S0 0]%Q0*P! R % BR$5L00E0S P,97S9 5Lx00\h%h0G0 RS0$000(0000  0 aPV 4 5X O0000Y4L40܀C XSX t4000C 0h00d0$ 0`0 lT C/P $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""4408'0 PT3Xi97S JލЍ00000 0S  0 p妅J8'דP\20 00H0 ̓0   ˓pt 087PT}97Y^ SЁ 0S [R0sO0010S ;70:70?70='>7<8T0S0,< 00 00,1 %P!1 R  T 0 0ZP 0S 0097S0 0S} [[YX  SS00000 EJ`z***|**T*,*Ġ*4*X**AL+*Fm*Ex|*P*r%x*^  2@-`pBWLM LЍ@ pPk  pe 00011 0S<0 |q?!( ( 0R0 0SZ=9Q ='/@#b?!"/p8 0S 0#S 0(60 8ⴑpp  0S 0#S 億塑 p哑p 90S0 000 0᧒.LЍP4_l僑00**`*Mb\`z*?A-0Pr@L0 @2T ` R]$B P 2 Q  ,00EE?AA?R1 $!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 0 l!l! +5+1+W-+W)~ 0S000A/R@PT@{`z*< **C+Ġ*p**L+*D+D+t*M+M+L+L+L+L+H+D+*A-/`u!@P V00T/00PPᒃp]G+.0d`p@5G@1pU`Vt0t J9WpPpp0p̑PP<0W0T.S10000D@mRg}X***0@-M`QM0S PNkL11S@1  ۍЍ0@#0 S@    0 P 6 *0 PP  &01S0  T  0+s  PZP000SRPۍЍ0蔦*`z*L+*0@-0D$M00 0[P@`4`$\4Q00P4@T D40S@ 440S@@$40SPt40S3UIj3 X3GI$Ѝ030SCP PA‽PDhK `3 0 HpP@-30003 & ^P@#R000 00 0^AP  t9P h6@P  H 2@,20P S R0S S @T% 1Ao0S3 1o10S 1 {P5a_X10S  P01S0  0S PU P 0S 0S h01S|ׁ80 M+gbD+C+C+D+mĠ**0L+`z*H M+DxZPt{*4 *t**pA-M`8  ? %H8H( 0@0<8@P@08@P@$80$080SP  8Q  Ѝ 00-S0S 7 y7 s770SP0D00H0L07 0J@PtGPFl d \H P]H7<07|P60@P7 400 0 40P ,0( ( ,0PQs AQ <p<sQl $ k0Sd6 H0sjL0skDFP.00D0Se@0Si5$  0  l 00|S  0PL<<0SD5@5D0 <<0S t p5D0<0Xp<0hP`0: S 4 0彚4 i<t4 P4 00S,  P4 @@0S!HMD4@0H@ST4@{ LTP@@0S @#0@0 4 z(] 4 R4$Qe4R P 3S&L0s L3`V 30S 20S`2`30SBr< 00CS0~<pPa U㈂S @0 0 0 0CS<0"p<0@0q@02`001!P D0S D0<3/0<0@@@@S1 R09PO0 SJ1#0 ? 0!%V %P0@00@ V<00@ @00@ @ [0 0 0 < 0P%P00 D0#?HXL T<0S D0<3/@3*M+b* M+****dD+D+t{*#t* e%M+g]) L+*'/lPDxD+l*+X* M+$*@-GM D,, <@_4,$00(,0040E@PL0<@@P@<00;0 0oDD0S?;0SW 080< @ + RD00S0 H0PKPNx41S<,\P ,00|S ,oP,/@`0SR \0 SN , ): 01RS 41S ,00-S 0S : :, ߘD0S , Gߍ'0SX: <0sk@0sl8JP0080Sf40Sj9 9 9T00,0S  T, T/00P90S 0 S,P,0 S,P,H <90SD09Q0SP\@P=D0S! 0S'O+80S (P  C <8(p80sSt8  h-Pw 00S @"Pl4[440SP 7 7 R0YfV41SC,P!700D74! @7 00p00p 0: S &00&0`7 R,T7T'TTb,00|S 4@,000S,}p64! l6 680,$000S6,6R P ]|6V!6PU 50S 50SP5P50S 0CS0D0S 5  0p0Q,}40%p4000q005P001!.PM0 SF4B80S 8003/00044L0Sx4 SDQ 0d40S 8 4R  qp `⧋%,'`0x0pw 4, X@( 孑 ( 09jp>}P,\8}D0SC4 00CS04ppe WL0Lc0L0 W(s=s 0 @0 0@pP`m T0000 0pP`0 00CS00pV P @`0 0@#z0 ? 0!%U0  S0  4 000CS04p WH0S, 000@ U0400@ 0 S81000@, s4 0p0 6WD!000hwwe0&4 0pf%P01 0#l}|@L `oTC@00S 4 .<@ 00S 8003/4* M+* M+***x*t{*t* e}**dL+*Rg@mM+D+D+M+PDx'%p*(3#l/X* M+) *~ 9 T4 /0Bꠠ*QoP@-X@ P0 R dP {0 @ ꘦*L+@-@0 ЍB0 Qp@-P,@P@pחP @>% - BR0 R  P R 9@-T@0SHP4 0( $0R p 蘘*y*@-T@4SHP44( $0R S 蘘**%0P  @-PU @W p`W VN ^ Q/?%O-@p$M`xT oTP $ЍO+T 88@DT#$Ѝa1 !Q Q@+P $ЍO_ 8S 0S P0 0 0pP  P X0  \ 03/ , *2;C?%r1($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/ᘘ*E%p@-H@H0 (8@08080$8P  Up$80ꘘ***@-MAa(8S @0 S ILL0) P p p( $8S 80pP U 0S ,8S @ (8S  J4p0 08o 8$ 0p3/48S 0S 3 D0R <4 Ѝ蘘*xP*%&  p P/ @- P0C  P; Ѝ&@-@@0s.,00p 00CoE%*t4t$0 00/O--KMPt0 P 0 0SZP=9 =: k{!`Y0 A8 P@  A{ Q(P@0I03 3# `#(0划{x吚Y`ڐ Z\ ?@#Z43(004# 0fp` F +Z (f" 0_`< 5$00000S x`0S 0s (凶0000<0sT $ :1pĠ***M+;2O-AMp2 M0BS t20S Wt tW Ypt W` 4S4pW  $Aލ ЍtWh1P+;004P/S +d+`PrꌡpU0們p| 00g000000000S H1o81 1 R100CcSppW000S 0o 000000\ⱀtWU00@R *0@V1@P9@,@*@(@&Ġ*eC+;+%;+;+/A-p`P @EVP0  T  `00T  0@ R   `FVx`00CS0  PpTL000`000 0 ST00  % A-Pp `0崀 @T4 00)a@x 0 @P`0 \Ӈ]L0L 0 P 0 Ѝ*?*!1!%7!A!**O-MMP @4` 00T X3  @`s P 8#8T,  30S-  pQ pWp {p@0E. P00002H P E"EPtwmލЍ zppDD0T gm@ xzp@ TZm010PS  { 0$ 0/ 0$ azp@O0$S*F>C0S  {X$ (0Q`$0SZ=9Q =)/@#b?!"/0 0%zp7m0S i0#S [b0AS  T0 0000 08{p 0S I0F 0 zp@@qX80T lkP3<00o*R!pSe!!`*MbK @-@Ѝ@zyp@-P`L@,P@ 4&0P@ 0S lpEpB!@- P  Ѝ!@-PP"@-P p  Ѝ;"P@-?P\""@-0lMPQ@00 00 T  40S P 00 P 0 0g 0 kPIcsPI 30S @@@ `\  P `(P@ 0S  Һ@P@    P@ TN T S2 @0S 7 x@p0P @P/T2 P42 P m00 PU x  P ^0 0PU i P OlЍ巅/m0S f@P@$J 0S @P@< T 11@T 0 0P`pVPP)000fk 00 0@Q XGP@P*h***bT\g"L+"%A!"~;+*Ġ***E ***;+;+7@-P#1 Ѝ0Q0S 1 1)Pʐ! (0 CRtA R hS0R L1P 0S4k,S 0(P 0S 10S 0 0@ @L0@0 @D0 @>0 @80 @20 00S 0 PL+Ġ*C+"**ܠ*H*"Ԡ**#!yD+D+C#D+`D+\D+M#0000S 00,S 00 S00S 0  P 103/P H0Q    000000P`]+]+^+[+,# Q+#H%]+E%#]+d]+'kgM,SUѱ## 0$^+@- 0 $( ^+@-8 0(^+S+P `00CS`0p S00 P0S X0X /X⋁%C-@Pp  l18C8S t` s0S  0S`V $ Ѝ[+H%^+#T+@-# p( P@  P ЍX0/LA P00<-, 6-$ $H%p%4$$00@- @M{s1P8C8S 0S $ jsL fs@0 s0nS Ѝ0]+H%]+]+'$-\M`P { P L00SD0\ \ЍFtP9$XY+H%?$ $@0@-@UsT K }]+S$X$D0@-|AT 0S  0 sXH%[+@-/8 LA 0 PЍH% @-@0S S S 0\ \ \P \ @P0PA-@` ?J렀  ?Ep  ?@x@P 6P@T*\ЍA01 !QTUQ s00F%a$ $G-AMMP`PGB|R p2 h2h r\2\ r 0 0 0 0 r 0R  0 S"!ge@D`ePpᨡ0S1 nr10S00 0SR'@@T  ;rT HD1< ȠLȠ\ Se P0 \!1 "r#VrAލЍP0S S  S0 0< ȠLȠ\ ~p 0圠0CZ qZ <U0 @[+TY+^+]+e]+^+l]+S+L( n$H%}$\Z+]+j$0@-EM,P rP)@P.Eߍ0 ,PP q q qq x0 <  TPrq [|$$$$L( H%$3O-PM t@`hqp`pT#<D3D qUPE,dp S00CS03\p 00R0S eP18C8S5 P1 P8C8S 0 0 X'VPp2d2l18C8S  \qz0 P\S,18C8S 2 0 S 18C8S <18C8S p}l18C8S 00幽t1 #q RK\1P+ 㫽 X 0118C8S V`F(dP`ᛧ <18C8S0 p ЍS R   RwSP0 U0A0QLLD]+^+e ( l]+]+^+H%[+j$^+TY+]+\Z+$}$ %p@-BMd,@P4P1 Hp,!E 1  pPP`1*]+*e+{+ @-FDX+@-@M h) ]0P0 H!00@10S  10S0S@Ѝ P  㴸00S"l0@㨸P _ 0000S'm0S l00wT0T@0 S0904 mG DX+h]+HX+[+[+ t A-U0S7P@@P)xt%0P /Q4 eX f`PHeDpM@u0S+ 45 ,5 @$5 5 5 R- 5+ 400000@T ,4P  @Ѝ0400/S@lP v v vd`sFvPoF 0SvgQ d0S )hp=0c !hp;0c0S00: dP|s R  0S \3Q 30Sx 㒴l: d$\3P0S 2Q P o2: @dP2  : dP2 l!: dP2  : dP2  : dPx2 !: dtPX2 ,!: |dXP82 <r> 0叼4Ѝ0PY+H%@-`0S@ hP10S 0000q20\@[PY+,U^07@-l000Ph@ R R l  R  P4u03/ Ѝ0Q PH%PY+,F%p@-P(A(a1S 0SP vIAP00pPP0P P0 P P0 t p\uh'0X@X  "  \ p0H%PY+^3s'R2͘,p%G%[+00@-18C8S 0P ҞrH%^+(0( @-h0@ .h]+^+]+p@-BM` $hP@0 S`0018C8ST01y0 u0Pn00x0 gBߍpB/ BR 0g00P y0001]+H%^+]+ 0?o2 0/H%H-AM M$r$00000a0P01 gPھ0  gP 0SS WS BSq1 +g P  5Sq0S  ' 1 0S0PY eg18C8S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0St]+W [+^+H%TY+^+p@-PH@P@pP P P @H%10/@-go/A-@PP" p00CS"\ h] X] H] X] X] X] ] `V mPPt᳌P0 P00TA7 0S P0000 !0S0R 00 --< `00CS`0p SX0X /XEt%7@-P\A00C!SZ0000CS/^ x^ ^ ^ ^ ^ ^ _ 0 "S 0S!sr0 0P0 *0 dr0"S0P0 Ѝ0@4r0 0P0  Ѝ0^+,Q-0@- R RR \R ^R^@N  @0 N@T 0N@T!0N\!, n0^00@ 00S@-G-@|P2 pqp =`P`MPP2 00PF 0P  V @P 7@0S@0S>00@[PP?P PPP P  0!SP1r&-^+H%A-M@PP\1  q r@P `p崀  @P@u00u0ۍ0 P 0@ 0000S q  \P00 ZH%.'X\+.p@-`@:PP 0  Tp(PC@ps@-@P`@TqЍp ;e f R f| f(R( dBe0PjP @OeP ,K`P [+f@..xt yt ^+0@-M@@0(@,0 0 @P Ѝ00,報x0  eᙱPPPP0S 00@SP`e ^+H%[+@-Mq(,/^+@- @tf  nfBnkP :n d0P3P x$qt"qh Pf\ dn CfdЍ[+xt yt ;/A/D/[/f@/0@-4MP3P4Ѝ01<18C8S pAL 0 9 0mH ]d<O4M0 Ud0E, R Jd Fd8P 41PP m0(0S"=Rp00ES h @h h (h 0h 8h ppdp`\XT HpKH%/[+%///^+/h////0@- c@2[+-@-Y0 R   ЍЍ/_+-@-Yn-@-^?0 R   ЍЍ/_+A-ARp`P@1T cpP `@DO-P-\M @ oPo0P0 0 ( 8$@ P@ p P @ `00, $0S\  R?$0SUXN LH P00P$0o0$00娂0000U"80 @PI  0Sm n n n n (n (n m 0 0(R00S @` T#X0 (r  7   P  0@0o 0[ /#P8,00SX d P80C S  R$0PS  P0C [$0 X 0o0 (c Ybpl>@` UX 0A0\0y0_+000000 1171X1p1111,0O--lM $ lm`imPVPP 8@ 0#|  0<0hh2 @0`2 @0P 00.4@P 8 @pP R6pP@0S( P @p toro$0 lЍHp<`@40S(  a Pt  ( !6( 0PŸ4 0.P,0.P<  B, ( ( ,0pRQ@p(S<`@ 03P%<0%800%4000 0(<0(800(40` 00m  P$@p0/K%01U^G122C-paM00PS@ p 0 00qp  Za?sp >@0 m00`9 Ϡ pppppW0@0 @ 8@Op`6t00 }> ?@` $m00 S @.  C< 8n0ЍCrm0K%#2V2p222%P|p@-MbP! 0: S0 0 S P@` 000vЍp `p P @TPT0dHS 8$    W_+222O-]M0 M-SP0S 4P ]ލ ЍOv/x]ލ Ѝ謄@p bP$ 00S0W0S 0S1\ ` kpP@ = 9@pl0: S  SГ0S w`PP Vu `W ]ލ ЍOmaP v`|B0v: S+( `P@`Pnj :`P p  00-00 0i 0S0S`-`P`~``-`vL`0S 0 '`P V  `P z{ RGayRw_pPT iaPx!1Z[ h 0_%aZ"aU_p`4 0S!P !000vk P: v?b T 0S -v_pPv(*P-U_ 0S _p<m_+K%҇224-23A02 353K3a333/3%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00XP0@-@P@@0b0S 0S Gnt5Bi`+@-~kPE6p@-P@Mip 000/d`+@-@uP 0S`P 7i i ffPЍpPU P$ S00P@dd`+SdT9@-@P @j 00S@d`+@-@P$00SЍ@Ѝd`+A-p `P@P000 P P0 0%@-@P P0P00S@d`+0 R d`+xR A-`0QS`0@S@ P^ ,KPX #P1 2P1  0X00\00`00G?000x000020"00&^ 㰱 P0ЍpnP\1  KP4 P. P01  P1  K P1 K P+ 0P$ P0  P0  P! 0P0  P0  0 0 x0 l0 `0 T0 H0 <0 00 ,d`++",7@- D_@PP0PS0 P 3 xP0S00UdPPP ! dd0SP0d0(Pd Ѝ0ht@d`+ad+:-@-0@ ShS0CS괃 ă ̃ ԃ ܃ (S 0h i0 hЍ\XTPLHD@{P0ih0(d`+gdjdmdpdsdvdyd|dd`+@-MM0D0TP _P00P00l5}zw t/P0000S000000T4 L400@0)P04 , "P004P00430S 30S 4ST4STP 0S00P 0S P 0S00PHP 0S00$34P 0S00Tb40 0P 0P00404 0000404 0000404( lp0$0`PPTTPd D25<QP``0S PfP!DQsPpp0S   BPbfPta PXTP`H eNP`4`H0PSe 50S0  ލЍ04,.P 0S `d`+l%dQ#ddro+$a+* ,{+(`+df$n,4e+ d*-Qu\8rIrdrUsA*o+W@-T@5SH00S< -000S %05d`+Đ+xR Ȑ+ 0 d`+xR 0 d`+xR 0  d`+xR 0 d`+xR 0p@-0x@Sp d00SP H00SP 1P0S05pȐ+d`+xR Đ++/ 0 @-@ d`+xR 0 R/ d`+xR 00S1 + 0 d`+xR 0 d`+xR @-x@5 l 5 P 5 4 5  05d`+xR 00@`/@K%p@-hP@ \ x D r , l  fEpd`+xR D0@-0S K00ET@YKU@ꤐ+d`+@-@05 0@d`+@- Bo 0 2d`+xR A-P/o"`bp2qp .@P UA1p PUPHXU`X8/pP V@ P@T*U  AV dddd 8 d 0 0A.0 00S/e+pp@-@ P 0s 1@p8K%eO-@`崐0尠T$0P ?990 VYvT00S[   [1 RP Z@e+e K%P 0S  R $ ,0/8<//e+l4O-M⨔`VЍ0(tS,  RQ0$R00:?002P?00"2 Si@V !sr% 0S 4 30S $S(fP 4 0 40!@0`000 00 @ ` 0 0 000 PPp @@0,t(dvyf`p{V0 Z$4SRA 4? 0 qp0dt2 0Cw RQ&0$0@R*0S 0 00@0 @ 002  @@04 S*0LPe1 qM   10S 1[0?0S  Y0$ $  [ 8dCB/e+A-`pOPP#@c0 DBC.B $-0DBt P 404)0$rdA{X`+e+p@-`PUp4 @ P@ D4p 5WT 04p 0 dd0@p@e+X`+ 0P/e+@p@-  @0S p@P B bS .S 00CP U2"cS X- P:80BS e+f+reep@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR @ @pe+@K%0S B- 00P!P* C\/p@-@P& PP`pQ P @tPQV`u-PPN0Sp PppDK%L%ep@- edPP0P 0S .40!0`,@$!$Z3eP@P|@Px@P0 0 @ @P0+P +P |+Pl*P PsP %eeeff+ fff+eee@%e+eeeee 0/e+@-  01SP 0 Qpp_h ЍR @0!00P< 4 aQ 0! Ce+O/%ff+)f 0S 0S 0S 0S P////// 0S! @-@PPR0 `0aR R S R0/@- @P @ t #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p !\q`?`p`ĕ @?@@e+0p@-P@P QT4@pTT@DQ`V D@T0t0S :@e+ M% Q% Q 0/e+P@-44^,P@P @ $P0 b`0! KP0!T@0T0  T03:T03:T03:T030# S,,A #c!8,!0S ,1 ,!?  $C %ff+)fe+ _%00P0bA @SP//D%A-R @Pp8`TЍ`lP 0T0 0fPP 2P TP00T0 0f+s@-4 @P 0S 1PPЍpt(P Ѝp@T @P 0S J `~(00$ 0P_jewj7p@-@pP Pd0 S P @<` Rp|`@0P  jjP P / l~on+0@-@PM   0 BRЍ0@-P , `@ 0P FBЍpf+@-`@ (8R808Ѝ< 0 CS  8 0C 8mf+n+p@- M@8S/ 0  0S R(0 (S8`0P00 0C?UR B( 0 8 80C 80 CS Ѝp 0P)f+`+s@-P@`8 R8 R8SЍp 0b 80 S08^) 8 0 8 0P0S08O)f+`+p@-p@XU 8PE``VH0 p8Sopppf+``%p@-P@`8M0 0 0 00C?UR  0 R 00C8.Ѝp 0P00S0 0f+`+@-@8 R 0 0 ( 00R0 8 80 8(80S Ѝ0CR80S  0S(08f+`+(080S @-n/f+p@-`|P@p Q0(0p0CR0R:(0 p00f+``%s@-@@`P@T  ;A@P Ѝpp@-D@0S PX8 P 0 ppf+``%(0 ((( (8 0 /f+``%0 ( ( ( 0 /f+``%C-@KȀPp0S Ѝ @`0S 0S  80 8808'P oPg (8P 0 (f+f+7@-P@@@@00S Ѝ0 Pf+0P$/f+0S/p@-P@`P P !@'000P @@00p@- @$P$8  f+<7O-P00GS-M`(X/ Q008(X 8# 0S0S  P0S08 Q00((XʜP  PЍ0 80 8XU080H?o2P0SЍO$Q 5Q* PpP0@S ( $ @ P ж L     8 eP 048048TPP0480488080 SA?0488S0S S 8S0S S ec0488A04880S} 048x048048048Pk0488S 0S S8S`0S S]8SW0S SS048(04880 S 80 S C80=08:$0X483X3` @R( B H W`X  oP`PZH80S 48PS8P ]088  80 Zt2"8Q WD 0`48 wD(<8RqDPp4@P 0480 QZ`Z ` 1 币0 0 K 0 Z@P40U \40U h40U 0S P0P 0 /7PxUUt0E Sp 0 0 0 0 0 0 0 0 0 : 0#0%*U @U !UW<50SQ07SN < 60SH07SE ;07S0? >P 0#0CS>P;50 9e`0 S &0!R0?0m60S  G e`0 S '0!R0?0R } !R00 !ıFp70S!R0 !R0 0!ı3 !R00 !ı*70S!R0!R0 0!ı !R0c?0 X80S `M0 S 080Sz 0 S 0  G&px!R0 0!ı2n!SeR0d 0!0<0<]P0WV0S\9 qMJ$  C@90S0S } 9@  <P- 00!R0 0!ı=0p:0<0!R0 0!ıw?`0000!R0 0!ıe-``000<&&9`S:4  @ `0S T \+\ rh;0S`D; P  ;0S 1 `+` 0#;" w,P m!R0 0!ıP P P v !D R0D<D<0QV,Ph L!R0 0!ıP ! R0<<09!R0 0!ı,P . <Pq+qpm < { i!R0 0!ı,P$ !R0 0!ınPP Q Mh=` PBEP h? =000 0g000 0SG- n0% @>0SP >0S $>0S P P 0 `(ih>0SP x>0S >0S P P [0S  % M>0SP >0S >0S P P.P0P/ %$Pg0 b!R0H? 0SX?0գ?0/0 p/0 S00C0? !R0? 0S?0գ?0/0 /000S 00 00S080?6+00S/f+p@-@/!PpO-pSPM@`PMP800 `@0 Y:X80  #1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 `UP VYZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0SA00p0   /O-PR p RSPP 蠟@PU40PPp0 Ѝ S@0n00@`P` {0S ``F0 S0S P B 0 0R R@0l @-P@do+l @-P@ho+l 0 Pdo+ 0 Jdo+@-`@ CP ~P  0S 2P Ѝdo+G-,2@T @Ѝ`vFPSU P0p}F@R`P 0@圹qpS MFeF?Y W S0 R MR +R GR  SR 0SSk SER SnR0SdSP0EX`P 0 @vT cT eT @ Vx@T@ @ ?   @P $`+po+lP7@-@P KP P@ `P, @]S Ѝ0U*m@-qD@q0 $$ @ `%;mMmZmimom1C-P0MSP; 00S7 00S@/ `p PP@  0@Sd@ 0DSd@ Td@ 0DSd@dT P PEUЍ@`+`+`+@-  tPsr ;X@,`V . qR000 00 !ЍpX`+xo+O-@Ԡ԰ֻ`Pл0FPPPp R ЍWpV R  0h0P@p U  PPUP@QpP RpPx`%y`%p@-@QP ᚻ0S R SppQ0 QA QR P/@ PRP/@-@P X`+P/@- p@ "0@-M@ 2_ @DP D10S@(PaP! DP OP AP dP cPoP qPRi0|00SRЍ0 DPP0 00ɷqpD00@L`+wmm K%mG-Mh0S @0SP ^0S`  IP3PT{$&0 0`pP 0S ᢼPO200U p2PWhR00@p PH2  0B,2P 0S HtEP"!! 1P NQQp@000S _w!1W10Sڐ`oQ tMP00 XEP00 ?P SQW  KQ=GQEQTrЍCP00S rP|P `` YP CX`+T`+exo+8`+\`+`+H`+``+`+d48+ncؐ+nP 0@-@X`+00@-ԱP &@xo+EneA-`pP`VPU@JTP0ꐞ+ 0 X`+ 0  X`+ 0 X`+ 0  X`+p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@̐p@PXЍP`PPfPY04Pu0SEX`+@- 00S T ЍX`+@-(@0SP00o+on}n@-@%Ӭ0P 0sS@ @G-`dgd@p00CS0 _yp PP 000 P U 0D IS  ELOp@P@- 0PnuA-@+0 0Rp@`0S00 R0S@00`ոP0S U  zP@00x`%y`%O-MpG@ PṸ 1 !`Q[ Z@ᬸP[@P* 0 000p0NЍPP P :  X0X P VP/P  LP00pWpx`%y`%n@-@9`P 0S PP Ѝ@u]@Z@@L0L 0P0pM9O u@3O Ѝi'D|@-p`P@ Ѝ0S 0P-PPM@P T0P 0p0M#PAPO@OARgG-p@,,`P@0S 8P@0S0# CV* UR@ R %S #SP @# C V* WR   R %S #S 0P ZK@X`+T`+p@-MPPލp@ 0@Zqp `, A `P|` 0S:T  K0S 0S   A 0S*PkP@ܐ+C-Mp|10SP ~s`1 RP[NЍ44@P,A 1R@_p\pYp``0000 000pL 3N밐@@@`V 4`"NV @wu0SN 4N NP$`+enny`%x`%nnp@-  R@ @@0T PnL@p̸`PM@MM Ѝ$`+n1G-0S" 10S`pP 0 @C|R0 -R L៸P P,J@1 ¶PῶPP0  L A` MV T" P uX%X @P tT@@P@T 0l000@Ѝ`4PR@t0S감+$`+ lenn00S/RC-p t9`P% &Pڔ ЍCbP_\ PP@0 PK@9MT  ЍCt Ѝ$`+no0@-MC PAP@JIDOo@BMЍ00@-M1@0SPP !V@IJ @Ph@LЍ0@T@0: S *5@Iؐ+1c%Ac%@-M@@P͡00 0ᔲЍ/@-@ߵP P0@/R00S +h00S /pp@-qp HqpP@ TUppe+@-P4P03#0 R/ o+O-p4`08@PV `20ST20S / R 0200CS$0S 200CS ʲQP >)QP 2`V1 }`_`P|0Z0KJY)Y @ PVL1L H100 ut 010S1 10000 0000S"qp@PX  PPAP qp Z /80 ЍO0 `V `+++lc%o+(`+X++ oH00S <0P/000S $0@///o+++`+'G-p$@` P*P@T 0@T@@XJ0ZsP`X G hTio T 00Sj`++G-p`P P @P qp@PV00SЍG0AhP00 0@ЍnP@P 0qp@P e+`+A-p`qpP@VЍAm0  0@cЍ0P  P/pc%0P  P/pc%@-P@p@-@PplPW 0S L0 0S8 00C0Jp@J  B 0X`+pc%o+0/o+A-p`P@T0$@*0 "0UP00 00(@0@000 ᣵP @   0S 000pc%o+P// / /00//0// / /O-@0MPut@PЍ30Su200 ?QfPp0p P^R`V0TIp@ P P``0t TV 0S@Pm!! g0P@_ P10S 00 P0P *3t10S``V P PH p ЍO!(100pW r 0 `P `V˯[:p T` P0PPڔ0[00S0O Ppw\0@Pp@P_}@z0 7ꐞ++o+e+̐+r++++O-@-$MpT0  $Ѝ@ p20S2T0T00 02000T:0: |PP20S 21P U U P PB p $0 P= P`[P P p 00 000000000 P00P+H1 D100%- X#*0 S0˯0 zpP` P0 0P00S00Sڬ0 0 00S00 PXH00SO 00*:PE * Bꐞ++o+++̐+r++qpp@-@P Pppp 0 P P @0@`@@PP60@p@P0K%H(K%O-PM@`P"@@T M00000 0 `F?0  20S1 ЍOppP ЍO$  0s00U 0SqE Wp |!00t!`F0`!H00 0@Ѝ00Z 00S 1 0@0000@ 0qpP@ pqpP@ P 0`0000 000CS( d00SWL0``00 0@`U꼐+0o`+o+o++@-p`qp P@P 00S p0 Ѝ@3W0 4@P80 ), Ѝ@} p`x Ѝ輐+А+Roso@-  Ѝp@-2P p@da lT`P@  Bqpp@@SQPpp@o`+p@-P@`P) P pGP@000S  p@I꼐+A-`pqp`bqp@PA40 P0T0A ooА+@-04 ,    00a+ a+a+a+@-04 ,    00a+a+ a+a+$1Pp@-`0 S@pP@SP@P%P}` P@@R 00SP 0S@pP R @@P[00SP f+o+G-`  傀E@E PTPppP FT F     F F @ Ѝo+@-xt@P 0S\00XP 0S<00   ;0oo+YopP/<0 4   $ ( , 0  R 4 /o++O-paP0$MS1A0S 0 !A   W  R ! W @  000000S c 08PPP ,`P 㽳04 `0 `04 4 Z `J P0 p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ 凳 ჳ0++o+0K%(K%P 0@-坢P/o+P @-@P$0匢P/o+O-p8CM4P0 0C BS0S0` 00W[0`0C00ppЍ Q0 QP[` 0SP00 `0 P + $20Sm o0Xv t0 CPPP Z p   `PCl10S900 VQ X ҷ P P  X   P X 0 C R p Poᩒ SS0C0`J 0 o+ܐ+f+0'o+G-00pxB4$0`0 00P P U 80< S 000@P8p<0S+ 00 0 p0S5V@ ` 0 0CR; 0 0 LP6Y pQPpL 0 0 0 0R* m0S$ P0S0SpP'0 0PP(PjP P~pPpPP 0 0 0  4 0 SP0C0Ѝo+ܐ+`+A-P` |pjt0@ @ @D@L00@TpGЍ `:PP@K%o+`+A-`HPp@@EH0S 0P H@@o+PG-pP|4@T pT04S Q   R0  0@P@5T T @, 0  0p4 R0R000S0 0  0 0C 00 `0P0C0p0 0Ѝ P0  V1PU(0S 00011C(PPHꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S q0(R0SH0 Q0H @`ʈztPP "E E"ETP0(0E7PH00C10H00PP(0o++r+r+f+`+o+@-(@(0S&>C0(0o+G-ppA0P 0P0W0S %> 0`S@U `0PS mўP 0 QR00 0R 00S W 00S0S0   000    0P00SX 0   00o+ܐ+p`+`+`+0 0@ /o+d0, R X00S P@0~0/0P 0/ 0 /o++0 ,  /o+qp/G-`P@P_p p倐x X 0 B 0 V 0U@00CSʝP 2P 0=@o++PG-P0P`oPp̀@ 0@D P V 000U00C@C@p T aP0 0C J0 Q@ @D 0@DRCo++80P/ R/0 0S 0 /r+ 0 R  +po+p@-L@ 0Sp0dS 0p`$P `v PUp 0r+7pT0 0Q 0<0< (., 00/Hr+r+H+A-APU  ^%(`P, `(,, R0P`VU, ,0 0 P ^PQ p0࠱ P 0r+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)lP ` AY0 0 v W0@TP0 0` &qp .@PCP tA ` W0 0M0 0`qp @TP+r++P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /000 r  0@P`P`d@W 00 H000 r  0@P`V@r++G-`S 뀐P@p0Vs 0SP@`@ P@tu TUP`+00CS0 S0 Sy?0 /O-P0-SP  v!'WK2p1\1PA2D:P0S0@ 0S 0S%@T S=E?1$21*YX CA 0  ЍOr`P 3@0@ c@C8 0 A=?=CiPpo+D|G-@ $`PP,$epPPw >@yz  0Z`p@)f *d0 y(p Tt lp@ pap#Xa=o+C-`qp p9 qp@@PP1 .Y T0 0 Ѝqp 0 p 0a0@S0  /A0@S'0@@-H+p.Pp@-1 $P 'P6 Pp srpp^P@<P@050O00pPt\0,\ O  B%@ $,P P $0ON0@4pppH+X`+o`+(+ 005S /H+@-o0@-M@P P)  000Ѝ0X`+@-t @ sr NΎ004ЍH+X`+7@-~P! 00N.P ēO.|~@P@BT  $@ P Ѝ0@  P Ѝ0X`+H+А+@-SP ,0 0R KX`+p(00@-5 @P0QAC R0H+@-@0Q"P P P0@Ѝ00St T0-Ѝ@D00S<Ѝ@ 0,00$`+pH`+p K%p qq0 L`+000S/$   ?A9c0/`k%`+CА+@-P M# @0.S 00S Ѝ 0S0 0 0 R000l#&P0@  0R 000@0,0$q`k%&q @@Y 0 0rxY@`Y LYK #BYf DYF  @aIY ha a a a a a ` ` ` ` ` a a b ` $b ` ` Hb ` ` ` ` \b PY0 P00QQqpp40SPL=0S > P ; Pa4 P3 qp P0 P PYs 0 0TY@AYhBIY de X` d td d X` X` X` X` X` d X` X` X` de X` X` X` e bI0 SMY Jc c c X` d X` X` d X` X` d e X` X` e X` X` e c X` X` X` e  Q0R 0 )qp  82~P0$2 R P B?ᨛf qp]0[P P01P 13P 0 0 S0:P0PvP4 0P \ 0 0 S0:0P SA Pu pDPDD,P,|D+X`++H+r+e\`+`+,`+/S%0Sk%l0@-@d00SOoBL0L0AD0<00A400AA9$0 ++D+k%`+a+a+\`+(0$00A00A0A!`+a+a+k%0@-0  0SRP @\@R @ TP @S@ @  TP@PT0@100s@-@QP`@ P$P 10T0 Кb.`@ƚ@0T T0TR  QЍp c2P  X++O-MDH RQ. 0`0DPH@0PE1p?J 0@0@QZH0 S50 S  0 000H00D000  0CPЍJo ^P DBZ@pPX+k%0 @-oP/0      /X+0G-@0S >PT X0 000Sx@/ qpp` j @00CSo+X+$ "ut$ `100@_0 rs Y0 @P0s00V 0S (0X 00 000 :000P"qp P 0"ut R0 @P`000@_ V0`p80?V `Vp ` pX+o+0@-MXP @tu 0 PЍ0@-0 00S@X++0QA-@c MP 0SFIP2IP  .P20S 0S   Pv|r0S0S 0S 0 00 0`pP! VN$qp1( Pq0S 0 0>0Sy10SVJW 0 Vda~|XJ7S V1p0X  ~| ~|  Ѝ000 0000 0 d`PP 0U0C?o20S 880 PX+`+h4+j+`+А+0@-颋$ 00000S@z +$+0@-鑋$ 00000S@\z +$+@-J,$ 00000S@tz +$+@-@P XlPiHf@b_\Yz \z z 1A-@TPP1 Hq@= `70 @ `Pp 0S0S 0` 0?00^80 (00S됞+\z o+`+`+P`++A-` pP@ᯕA)0Up0P ᠕տ2)@-4@P(0    0 w,k%+O-AMbM+pg,W Q p @P cU0S0000AލЍ0!S   PA>04S S S0E0@S  00 [Q30S 0 C Q ? 0   ^R000 QR S$R0C00 0S00`000\R00000k%'+O-pQpPpWCM Cߍ@tcPSTp`3`C`# \\Hs FPZ PUA $3T SpP 0S @DT2P@ ỔḔ @@ 0 KX + 0R@ +T@"0S 000╔P @B?1P SQ@ 3 Pp 0Q 1T RP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? ^00p000-ꔞ+k%%+@%c΀'0@-@ЕPɕP ĕP p῕P `ẕP SPek%ـ߀e@-@P DP P P,@E T1O-M0SM A0 ЍOn` 100;  0p `wx@PЍ0S  0 |00 0z 0 #P 0S0S S @P@Pꔞ+++)\0@-PP P^0S @T  0@ ꔞ+k%\0@-PP P^0S @T  L0@ ꔞ+k%0/ᔞ+0/ᔞ+00S /ᔞ+ @-~0P C+/@-H@ p P0S00PЍ蠞+FP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`Pp?P@P$ ?0P0T0S@ 0s@-P00@a0C`SP 8 8 @ 8 t 8 8 8 8 8 8 8 | 8 8 8 8 8 H  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 &e \ Q [@`V1!0 e[\[0F?o20S7 @`^V0`0]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 d\Vp0[W` W nW \W`Rp0 V0ܰ+԰+?p7@-0 P @R RP L L D6 D   Ѝ0@E{ @@%ܰ+԰+Ɂ1G-QM`딡@``P0pW0 p3PK P1 H1 000 0\d\W R T R 00P@0  p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR,0 R Ѝ贰+԰+ܰ+4+00@-M00 M/SP $S, +S00, 0 0 9S$\S @P0 0 c0IS0@S0 W00ۍ Ѝ00@00 S00V@ܰ+԰+%O-@((MTЍ0tS bS rS aS @{S000`V Fp` 0S0QU 0W0 0堒 0P PUP @0@ `<0 ~c2pP'ꤞ+l+ܰ+԰+GO-`-M蟟_? @}Q ;Q <,0 b \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4 P <40 @ R @\T;0S00<+<p( -b  R @   R @` @ R @S 0R @ Rt AT0 1p @ 9)0 4" X 00P0)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$,04 @00T0S@ 8 00@90>: 009 Q00A0 0C S0 00,4 P8(0 t\QG THP R,4 R $H,4 00P@0) 00A  0哾0+0 0 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 00P @  y\R0)0\ P0 A  R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS00 00 1@ᜒ0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQL4@ S 4$0 <$40S $p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0  p$pp`p2p"0 0 $$$p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0s op$p000p WH 0S  x$p U_$ m$ppXP 0 $ 0     囱!1  ! 00$$p (ڌ $ p$p|! @%++ܰ+԰+ek%ˆ7W+ +f{+c .ӄJȵ%!ܰ+԰+0 0 (\<0< @0 0_00܍<ЍG-`@p娀@XP䘐U@T00S Ml0h0FX0 0S0 0 )# Pꤞ+ܰ+԰+l+ +4+0+p@-P @(000P @p0@oP 0 R >0R*0 0HP0S40P 0 R 4>0R$>0 0S > 0RR0S0S4 0S=0@oP 0=0C>S񟗐 l l l l l l  l l l l l l l l l ܹ l l l l l l l l l l l l l l l l $ P l l x ܵ l l l l p  l l 4 l L0 R: L ` 0p0080800400S\<; 800 8\4 00g{<0S  H0SPP80S4PU 0`  E>}P080 A E4 p0T P 0   004 0 0  0$;W{40 0:0R᠚ <00s 0P 0S G0S 0T( @P2S 0 H⣋` 0S0`V: !$ 00@ 9@֋0S ы 0Y H0 $P x0 H$0p$ [89`0V:, $ ` 00C 0 30P0 80 R:`8 0 z `[ Rp _z`80P  R:L`LL8K D`(1 S:` 0  0(8 0R7 800 g4 00Uz<0S  yPdP0800 0 TP80SXg4 00/z<0S  S80S0p4  H|`P <000F400<0܆4 0z<0S  4V 0400<0,6 800 |V4 00y<0S  sL0 R: L -` 0pX00pY R  Q T5 50X4000  P 04`Z Z 0Z 000 G 00 00 V,شZ0 0RP  0 0 0 PQ@ `VpX 0  `E0P  ßH`<(LpLHp<(L(0000S c4 00Qy<0S  u` P/ 000Q00  0  0`Vp P\   `VXp0  `Pa 80S0s "p0  X04 040P0 P 0S 00P80S0s"p 4 0e40P ^P P R`03D0`<pL0p<q80Sn4Xk 4!p 0`R$l0004 0V^*00000(0S!0 ( 0Z0  0<H0 0 1 RP0P' ԰+ +P++İ+p+%Dm%-ht@L6 +7ڈܰ+8+ %ȵ%+԰++P+0 0$ ( 1 0X`PH`<(pLHp<(x0h0<0 0R,,0Q 0{Q  ꤠ+%p+p@-@P`Tp0wS {S sS 0p P 0 H W0`@p P `G-`PL3pPW00V01 R P @vs0PV(AGU !R <BPQ   V    :R 0SP0S X00 0P00 0V 0S`: \wPP 000BS ẻ҇+0p@-P@0`T P |P# 0S 4 T ` H 00C?o2S Pp0S000S000V0V@꠹+",0@- MMP @P X :V  p82V+   P ۍЍ0H0  BR R R0 /%p%@00CS0 S0 / %@-(A{0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@_꨺+0-01S ^00So^ P0\ S0S Q0S R P0S0S00QR 8,+0@-  `Ğ\ @ T\    %R    診+8,A-\A0 5S <0S 304!0<R$a$q$P0U&%0 ! R8  (P =0  ,P 40  4PP twA00\P MP D 04 0P&S8, +p%+p@-@0`  %T  rt=wh pydPPT p uP000ST @%p%++s@-P GzPV:@P-0?S0SP`@ ᫮p Ѝp/P@ JP 0S S @o0Sk00uT`lX;@-1 tp%0@-@<TQ T00 0001S R0Slp@vTX` T@0$P@ 4T(8  0@꨺+ĉp%8,ˉ׉@-0 b묊p%7@-@P   0S 0@T 00 Ѝ00"S p`@-@BP  p SЍd0p@-, e@-6, e@-., @-&D, A@-, @-B ,  @- 0, , B@-D, @-A , @-d , @-,$0Qa A@-,@-@DLP d 0 C% 0@- 0|1堉",p@- P PP P$[vP P1QkH P y~1S(ʰ1 \H P y~P K 00P1 RF40S 3/j PPP j P,Ѝ0R0 Ka 0SpW 0| 3/pv P 0`H P y jj `F~ej0010A\70 b"P 00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P+ip%Ϡȱ,RS@%ı,A<% 001/+P0 R0//+O-PPp`*@ [ !  0P@ Ѝ0w00 0\"<< P 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @+nP/D0 R/0@-A1 P i< @w+O-0Bp W Ul0 00p0_ Ѝ`(Z 0S rP  [00010P@P 0S 00@ Z 00 zrP  [0S  [00000 00` Z0S `rP  [ [ 0 0 00U0 P0HS0SPPCr 00Fr0S Ar+C P [PU n0X!0C0S8 3 000 PEt[$+VUUU@% @O-@-$MPZSQ0 T 0 /(T`,D ;0X0 0S 0h /okor븳@q qq0P@0@ 000000. 0DSDU 0 E 0U00ө?0U0 CR C 0E R 0 0kqY 2 k0 BXYY Pp} PC ! PZ P P#0STkpD E[PE@ D)k&k0#k@P002P? P AP7 0JSI1000 C 0 E0^[0@Pp1P1 pW 0p00@0p00@pW E@D=[PE^|pGT@D¹0 X@P nnqP@U@§0S 0 B0^Z00000S 00 0 0Gn$ЍOu0XS $+.V~f@%p%A-`PlPp `p@p@0T  `P@ P LP0000$+@-@PMp 0`T` P@@Ѝ0 00mpp 0 0 @jQPu 0r@P  %$+Y'Pp@-@*TP0Ps D` R :P 0S@@A@p%$+@-@D0000$+0n$+0n$+-@-0 0  Ѝ Ѝ/-@-00   Ѝ Ѝ/-@-  z ЍЍ/@- Ѝ@-@p@-MP@` ,0 0( 00 0`Ѝp@- Ѝ%O-P0-M ` HpLpoUs\0 0_Xs 0 YPc 0S` T00S\ epP@PT00PXP@ 0sHਏȀ0 0W 5p cPUWpV`JЦo`0 S`J 000 tPF 000 `.@P\0 0X$ 00T00 P0X DZ  u `f=z[fYfЍ@00Y00S 0S oT00P@#@3@pzuP 0 fu뜰9JIKhNh C 0 E0GutV`PJI`/h2h$+aȱ,@-,, ($ Ѝ%@-`$0P@ 0  00 0`Ѝp@- Ѝ%p@-MP@` ,0 0o(00 0`Ѝp@- Ѝ%-@-00X l $Ѝ Ѝ/%p@-Pn@np$+@-_7@- @g8B$R[\PU % id;/00h@PU o%T Yd+/00000S$$ Ѝ0<,,H+p%O-CMl@`P \\\ vP/Cߍ@ & @Xʟ0P0 bP@Q n :0P0Y pW    姟 0 =RPស P,l0 0 {k@'3p%`1@-[O-0MM 0p@(v`P2 zPP* P :P 0S0 0 *    3PmPRpP 0 Q0 0PsۍЍ|0P 0 0  0| Rg,00S/ 0P jE@-U,,,X@-fP P <)AD(T"P@RgC-@$M S @r00dA%P-   rF0S$ }P 30Sm Y0] )Pf \BPaD' D* TB^ ($ЍP@RALP@ [A`P'='P'`20S Ap0$A PA" $ X$P 0)AT 'P P  AP  pXPP0 +Q !X0p 7'WpT+ApT3 {@p 0T3:X#  VAPQ  R@4Q p0Q  R@ 6AP`DVp003/P,00  h0S  R l 410!8@,",,0@-M M+@(i+(S\B+(iB+I\(Y@PP BT@PP l0 @@@@@ @@@@'Pލ Ѝ0B(+?dI8-MM+ iP+ \+ i+0\ @P  ?ۍЍdI80@-M :q1@@@ #P @  P A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3&P/\P+X@P'@P# 0P n@  0S 0_ Z'P @P0o,m&)z*00,",kvȱ,ı,@-M p0@@@2?f#P* (@w  kP 00*!R00$Q 1*@P  M0S 0` 'P%(4*Ѝ,",O-`M 00[#*0S ` 0B00 SS@@@kp(@ 0 S0 0`0@k 0S :hPP @B 0p00Q %Sg0S iSD %S* dS $ $0T !PsS(200P 0 倠ಠ@Z4!@ P %Q0 @0S0 aR7 cR0 3/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S 0 ! S 0 @S$SS0P @U:U 0 g@%7@- @PU W! A`+00 Ѝ0llP \ ?!L y )`ox( (0[,#/7@-@QPT80800 S    0 Ѝ0@:,<,7@- @?PU ! #_*00 Ѝ0-PP |  _d00S `o#L L0[Wo0 ,<,, q/p%s@-`4Q@}>mw[}h chach] cg[:hwc;}i 0Ao@PxxL^:xP D]Dbb ᯇo}Ѝpı,p% O-`-* {MPp(b0 "p6@ E 0S  P R O 0S l dP _TP _Qp@T Pcjh O-V^0B? 0FW.P  )@P  )00tkPdkP; P  @; D;0S @;rP <; 00|3,"0{ߍV3 ,m0z"!03ˋ1,0ʋ H0,0,L0 L  0P,0 0 pz?"!!03  PM p WU $ lRih2P ll;m0S$P0 rT 0  <SR 1P ;^1 X @U,2 @vgPU my UPz?0WC(90P 0[ 0R0SQ ӫ^0SGO 0Pa{0SP @ v 00TP@@ ,2 @@7,%ptbtHf@<,,wYfhB ,kK},,G40@-0,M 000000 00P0 00h0 PPP@P DDc@0Q ,]o,Ѝ0@' %p%<, -O-iMs?!0YP 00iߍOЍ/Lx`P81P ,!,0%`P z[p P@P)PY-(U0P 0n0GSW030#[0S 00pP@ Pp009&'<,-O-p-(MT@X  pp]`V4  @Q'U` a[PPgP@P :H E0O.PU 0'SP0U*S!/ ׁP00 oX/0 0P g0@: 0H: s1P0Z v mWp`PUQW v2S022SP0220C2   S`` ̈́z000 0 0PD*U  @0 0 PA fsf0 R` ! `U 0 V0C?o20S 5`d2`d`fzU @ v 0P| f@Z`rz(00CS0000?'VP a0P G]0S  :W,jRz`PWUU S  0%S @S, B B*Ak& 0.R> 0*0zcP6 00Zp  @P 0A0 0*O! P:iW z00F ASz $d_;dtV P_y(f}(ЍO Ѝ/+Q@6ht@ı,%C0@-CMlPP 0S .QZ@P8 &cCߍ0 Pc L+K+G-p 夐夀PB`A@T:00Z W ,/Z 000 YP EQ 0 @J@%A-`Pp p@ j4 pb P@J+A-P fo@ft pb0S DQ0Q.SVP @$ $U UL+@mK+@-M4 0PDP  b 0PDP  b p@ ( &j rb P3Un*p@ l`lp _b @*PPЍ T T`!iJ+%ih+J+8i(|+Pp O-p-MQ mj|@cllP0S feV:=80$d w-B0$0B. b B b0`Q>d0 a@400@W R?2, 0/pkp x#|3 R0:P$P o P <@Xݍ<ЍpP<\J.̟ 0  0/P `d< 0 B0 u`````- \ 0tD0D Dq i@>0a Xta da@P  ^aP;@ 1sS1lSD;"00`&a`P SP@;ff@P,Ga*0x*0wrNfP\8 0\8TY0 yV *0z*0}\8t*0|_\:VT* Q0:$DR@* , Q9ʟP \ʟW ^/H0U>H B0C   APT  8T@Y DY0X649 @p A\)}0p HA0jp H0S[, ,)A0$$ @P @0H0 H0A@jp AA`LVp@fv& Kh! HGhH p 4P p0 0\6S 0 D880@P ]5( .+( %" [7S  # l7 P~P7'AA\@P G@P 7X'XP\8<'08\8(GP8 !`8R V&8P00P8L `8@ 4V&8P0060S\80\8P8 _8(0S \&8P8 _8 VP000S\80\8P0S\80\8@nN /N B0C   [0S1 pP 2@T `k\xHHp#p00S X 0S d"<|WN"3S3 V\ #C?00N?C0C Y`0  0@F0@`xIP;A?&p@x0Y4!S< "0 x0 Vo ic<,p%@%%L+4,D oQURgK+J+++",SY+h+ȍJ+/'i+EIFdo{+#-=^ ^364#8U`H++o/0X6S/L+P 0/ȍ%A-鿏MP@(p6cP3S0 `0 0` :0 00`@00`Fo0/0 0P 0P/S/00 0 /S 0/0 P0% R $b@ ` @0ߍIPX@-pCM`x@bPlP#d0RXPP @ W<00040 `(PCߍ%eD,@ ,i ,@-@( @,@-0  0 P @0@ t28 0/P  3Ѝ@,O B ,,700@-@XMP70  0@ P x0x t0tPEI2@/Q  0 LL =2 /R@0 @0(Ѝ0L+@,O ,B ,@,7,@-MOPNb@P  3] /]ލ0 00S@`0` `y@PP0  0@ 00 d ,@,A ,,D,,h,@-CMbX6S WP \8lP'XT20S HT2\6S 8O2424"(2 rPP 10 :4S / \@aU 10 t:4!SO *00 0 Bi|f||W2@P) 1l \`YXVHS0S 8!8L0!0H0S  @  <7P:\6S 52U TCߍ 0 B"L+m",J+#H+\+FIK+8J+PxPT+at0@-P@ T\ ! 0C @TR 0 \ @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-phM@P 0S'hЍ0 L03/P 0`  Q 1/P P p08℠0:/P 0 083/0 \ P0//!01000/ 00#0//O-`$MPA@T ^ p[P00 Y0S 0S0S$Ѝ@-@M MP!p! *0 `p+ Wd5\\ SS=S 8 d3R 40 $0 ڍ ЍTTg { 0G-Pp0 '"M@p!PP `ԐԠ` 0 R [ PЍ 0L03/P 0 )^놁 0#^  H,0S P HwM HsM`, p@-P`4"00S@ 0p@-.0p@-!QM0L0` 3/P< 0t@T 4/@0 0 ] 0] 0Ho,0S  H+M,0 H&MT d H M HMH]0S0CH ,|$H -Ѝp, 6.P P00 S _S, R ,0S R : 8 80R:P#3///@-M`p@ GPPЍbPP l_PTP t0@$PU@@wT @D  g0 @P , k$0S/p@-@P 0000p@O-p|M@P YP+`@>P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P 100,`00S/0 0T100 0<000 m0_pP <@D<)@0S  P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0,0 0,0Z W @-Z P 0P 0Pc PQ\ QTaPQD "P 8040P/(/$//p|p@-Q4@P 0@@DPp ,Pp%p@-P@P  -Y K00pp@- %@-z (%G-`zMP@PN/` Y0  0S1 0S@zߍX3P# aC-P@l0 1h0$1d0(1`0,1>1S$ FoP j?x%0J?`x`0S `0SAT FP r]P @`^̠p( p$  @ $0,SY 4 P 3SS X (` $`00,?p p؀ܐ0jP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$qP mP  P ,04! @F<#=pR[2P  @000@"0`@0@N?@@T@0Sz?0 C,04! p@<#!0 J  ~_ z_T Iv_00I? 00111F01p00 84p1<P( s1S%4p ሠ0!i 0Ad 0_,0! <#@  03,0! <#@t 0p t ,/}Dȝ+QNEFX՝ %@%  'Q` @-@M`p 0 @@HpЍ ,PP t 0 @@HpiH<@P 7/P[}p6@-0 0P Ѝa @-0 0PЍb O-aM,MQ0=@PὸP6 \ `P- |\PP- Vl"dT+"WILb+bOI`ZP@``V!aV+"?I+b:IO-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`F[P 0000!N9`P 00S 3/p003/NaV $P 00S 3/p $aV 0P p PP pb.x;9/0  PPpxP".;5/0 #X R1   H 0V0 0stqttP`V b ,PPY  Ht}PQy+"Hb+?"PPi[P# [P  [P [P [P ZP UxT RH  NHP ,ws`"Rgxz:",0,!p Ֆ)R") !00C-$0pMP `A@P00 >P C 0 1/PP0@0 @P@00003/Ѝ003/$Qg!O-UMMP|x.`@4P.].z*]Q_8Il(/XpWp$[ Z T  7 00 70 0P0@0\⠗z#P40([Z4S =U?h400C2<7\4=1 W =7h400C26\4=1 0 00 0000 00p㠖p  \0440h40s -14s[w0 00 0000 0 0z|pp 0440F40s -1tPw003 E "T5@ UݍЍP =2 (XL=1P⺀N0c ⺀  h \ p$w00?00[000ӧ?&N?/'"T`4`( 4@ TP40S N?/$"X4@pWH4 0}10  A `T "[T WT04 1p$ ,01(.8,40001A B7`$ 1(11)1S04 $q,0(84q,0$1Spy 0 0t ^ pWn, @p#60$1 0H0$4;B&|2P p>{` {$10 $! ,,0 :0G80C0(1}1S 0}1$1S! >,!  :6$40`040,ı,%D R0%",0,` ,,%<,X!YPP ,0 0/0@o//BO- M@MPAE0*!Rp0)Q`U0 $0   P  Pp ,z*,(0$0 $(pP l4\,e ܍ЍD4p E80Spp0 @0 4p0SW00y , Rv  000;x8,9/Pc0  x08,;!\ Dx,$"*"!9"@"G"hEN"!g"m"!'"!"!""!"!!!!O-MeM08*QU"U&m'u@& r X &0x0 MT 0Q LݗC0W )qW e4p nP: FPi' fP @ @ P* @H0 pX 804pVp4 80P<I P U d@D`@ V p PU 0  $T0S-    0S # 0P00P F0U[P #40p80 P 00 ,0ST0 S00 P0 40040804 0SS40  0  0 x;8:/0PST0rԢr S S Ԃ Ԃ Ԃ Ԃ Ԃ p Sb  SU 〲xr 0x <0U<0PPLpLL"@ @ 4,RP Ÿ ,0$ 0 ( P g 1ıPp UP0 0ꜱ5S0+^Px1x J t0 S\ rT0? iD%< 00 014s10 5>*+ %%}%0S x%v% HލЍ",##P<,##9#U#%#b#,n$$$$$Z"f8VRg""""""""F$',"#$#?$"$%%"%+%2%O-BM@MT\\p P`   @P`T$$  P```PP@BލЍ؃[ГCг @Q3(4@$80 IDP@T@@< \   P  `  3443 0 88@4  $2 0 YĒ  P   똢嬂  8@4 t20 h2@DDAT T2T"TT$P D2 <&PI020  ' 20)ATp !0   P' !P%0 Z#P@0SW K0S04@ 0000@;x8 8/P6  %P !%P 0   @$$0 Ip@FW:B p=@ꀎ;%"J%,`o A\%n%t%%%Xo m۶%%,#",->%&P@-0`M2 pRЍ!,^04P0 @ PP@4 xp8;7/P   PB++(0 @-@"!P0(@+@-$@2S 02+O- PPPBpPP   `PP Q@Ft$ର@P`V* ЍD P P    R0SP pPBND@%@-@00 zP Q P 0 IAЍpW C-JMM bpPU 8U@4PTdHP`Y)P8 Yo`GFWI  4SP 0000 !00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,01 010100 0A000@00 p@@@@z,J@0S7 0S'8JݍЍATP 08 RT<0$!QQ@0P 0 003/@<08 S 0S(0S 0S8j(0S003/@<08 S@0,xZ ] % 0S/p@-@P` !a(0SQ 003/@Qp@ R 0@-@4M`pP0S4Ѝ0 0L03/P 0@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0 PPA.xP;5/P A> zo& 0@o/b 0  11/+10/Rp@-@4P0 `L1111p+O-Pࠟట@p`0* C  !0  PT0+S   +S 0P,SR0B `p@P X 00,0 000`00 Ѝ+ 0@-MP@*.VT1( 00 0d000 0X0@@@@810 00@0 $(Pmߍ0 +O-P4M`@p 0SpqP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  @L0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- +R0 "P&STP T!S000: SP1 t0 0T1X00 P1 X SP10 ,0 e 0=+% +T Rg` @-M M`FP9oۍ ЍPp@ PPW+K P*T+= P*+= P*P<R<Rgp@-Mzv@q(}.M`P9 k< 00P!#N P (/9(/ kq!@aD |@P SލpZ[A&,*@- L@0,SP@ +S 0   +  O- -M@c0 r 0n袟p` W  4pP 0 0P0S:P W%0]P]JP 0 a0CS0Sߍp( `V2p0:08V0S`p R S`0a 0 0  p 0U? s [ 0\+ P 0 0p0 0  0S  0  @00t00 00S 0  0M0P 0 0`![0R@0O b= O 0 R*? 01BV4a0 y&-> d@edA+4&+p@-@PuP p@!pC-pPAK L1`90D  #R `)0 S 071DH<LHa@LDP LU `1<P1 LU `1LP1 LUP1 `1LT0T U`1`8 ЍC# (0(0`9`90 0+Î%8&@-M@ eP0:CoЍ@-| 0S pP`0 X00T T0PL008 80<, Ѝ Ѝ,&h,d ,7(@,A ,,@-Mp@hl900 0X0.0 B00 0 q:h $0l !Ѝ+@-H|2@,$  E~@`[&-?@-@P  } R4 (0@(Ѝ0@ Ѝ/&&@-0  0* P L0L D@D @08`( @0 YЍ@, B ,7@,,-3M MX :P0  4MP Mo3ݍ ЍRg^d-3M M :P3ݍ ЍRg0@-M0  0 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,,l,'h,C,d ,%'(@,A ,,@-0  0 P <0< 0440000 0$Ѝd ,''@,C,A ,,( 00S/ /+( 00 S/ /+4 00 S$0 10 1/++11<0@ Q !@-0 " !/+0 10 1/+@-7M[*.~O( 0lh6 0X 0000080 O(@7ލ% +H 0D *Q/QQ Q/+%@-@0 0 0@QPЍ.'@- @0S00h,B'0@-AMhd@ `P mG  P@00 0p9, /6>Aߍ0U'+#,d'h'P@-@ 0P  Ѝ,-@-  Ѝ Ѝ/-@-0XX0@P D  g  Ѝ@Ѝ/q'~'-@-0XX0@P D  H  Ѝ@Ѝ/'''q'8@-P P P''(@-@&JP@ +o^-@-@,KP$0  0P0,d ,A ,@-@,KP$0  0P0,@,,QA-@@1@#PP1P#T|p|` cP (B(Ad##GBDB::\A\ı,,@-@KP  uN8  Ѝ((p%(0@-EM@DsP ^F 4=P0000U (0($p:@Eߍ0#,+op@-MTMPA <`0 0000 H0 0 P 0PP`HRv0H2B>Up:d JX (E((JߍpO(+#,/- d(Ė %(U'@-@P !0`RpzJP 5PP x 1P`pZuX &01O@0HPF@T 9$\ Ѝ+C-%@-@<@-0 0 Ѝ@-0 0 Ѝ0@-@M00 000 00Ѝp@-P<@0*SpQ JPp@%@- 0P@ ,D,O-$M@1p`P0  P(  0PP0P00P|0 @P P0PySa00ͅ0݅ 000͕0ͅ$Ѝ(l%8,/,(h,B ,(ZO-`-,MGH$v@v;[pPe $;fPe@T10S@ &HPPEUN X1X!XX\$0 0  @$0 VSS00R00S H 0 C HC$;$ 0   0$ 0VRR  P # 2R @D G@ QtG `P$ i;@,Ѝ()A-`pPw@P!G ePP 6/ApO-@ M$;;`P0 Ѝp0P0 `$0VSS00T00S$;-@-0 0Ѝ Ѝ/ -@-0 0Ѝ Ѝ/ A-@PMM``P `G`ep`@ F43T0(3T$$c3T &j 0So 0CS+PDS0 ) 0X 0S9 0S r0S 0S QN@4P% h0 X0 @oH2@P 000C?o2 h7o00`1D(0SލЍ!{h7SHPg1Q! F?@F@moh!H1PJ0 H 0M( ' 0S 0S| q0Sx 0Su QN@EP 0 B0 @P_F? Q. QF$Nj)ikT)8))#,|)G),l,)7)+%ge%)f,D,)//-MM P  !P tۍЍ*-MM P  P _ۍЍ*s@-gP' P`bP >%`]0S $ Ⱥ к h @IP Ek@TT/Ѝp@m'*x0t+R/ @-dt+\0X|T0PxL0HtD0@p<08l40+B*#,J*',T*#,%',_A#,(,P@- ! 0 ЍY,p@-@M L(@H@7J0 #H ,0@,0@03Lh@Pp0: S, HcBP  iB   eB܍p,J 8 JA @@@DPPڸaL <UPP?8 1!æ8<mDQi`1 08808@TT OoBQP@10S nt<  R t00 00000 000lpP@ mx(Z(0@tA!d ,@,A ,,(+ ^*)H ,h,D O-EM08qSP @ ` 0!@nF+0S`PW!000 @@3/@P EߍW! 000Z 0SX 0 @T W  00 0  0S h00S \  L0W0 ! ! 000@,B ,x#,o***(,*+@-Q0@  R < P0 000]Ѝ-S *Rg*O-PDDUM;44Q (W H$ğ0*S^P3sC00`*V`O# 0SPCUc@ A@ LPtsFP `AX>P;@1 U,1$ PP $ 0RP 9P .^ 0 10S 0S= 0 1S900 000S MP,000pG 0&2 G4V 00a !0 0 0R R` 10 1000pXR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 .UQ U@P@T xTx y(,*#,%+!+&Z++++Rg++, ,a,ȱ,ı, +@,+'*A-Ph`hp@TURU LP  @P`T%O-MM@p\@ @P tPP6P  !@ڍЍ tP tP cPoZPP YPZ`P5^ s0B {?P0=S@  8 &PT WP R@P  sꤠ刐P@ ?@P K@\} {wq'-s,,#*0p@-4 P@F 0Pp@@-G-P`4 F@T$ `V! p0F&04 p0RSP pPp Pp40Su p WBPp@V/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @P`FP  p@&@-@ (@A-P@p`p0S 0pp RA05#Ph0020#X00Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0pЍP@` p᧹  pឹ ᘹ 0ɩ`ᐹVkɼ0 t@價T d  >PLYP <UP 2@/}Dȝ%,՝,@-M M@`p; @p  P/pE`E`ۍ ЍA-@P ET`p P  0QP|d zd@@-M M@p; @`sp P0 @aR`jVE`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP@00/00/4\80S0 S001/\80S 0@- ``@0!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q P 0!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/0O-p4M@ {PPp`+04ЍO%0 L03/P Ѐ 0P p* @D Z[H * R T Rp ?8``pp 0Sz0P 004Ѝ, [ 04,O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R0!S,0S 0 p0p02#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/P  T P l H 0O-P-t(0M000`S@p0( p00 ' 80s$(3 0>(h,@lQ@3p, (0h@` L3`R0000ЍV0V*8q 8 0L03/P 2HR b0 ( 0 0 0080,0<2  ,04 b>D@04   Y>0p` ,04 0M>P23W 4Z0( 0P0,000SPH0 M L00SI0SD000i h0,0 0 90 000(000  i0 -0 00000PY (08O09/4>0 PhQPQ Q*:p `YXT]h ,0a P0S h^ 0$0h0 0  H*:p ` 7 0h+,u-l+-%-C-`FtM0pSP^l =0SL=0S4=0S_=0S=0SG=0SH=0SI=0SJ=0Sx=0S`=0SH|=0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 tЍCd ( G_=0SWCW@0 x 48P Q< Q44.0 $b4004 0=0 1 tЍ3003 0<0300 0$3 0<0 0tS(` 0  00 ( (SH P0` 0SH P0` 0SH0\000 SH0`000S$H0d0S  0pP 00 (H" '  h0 P z R>0  H0L0  H0L0  H0L0  H0L0  H0L0 p H0L0  Xz H0L0@ @s H0L0= (tЍCj !SH0000 0pG P d 9/0 00(040h+yz{}~  H %--,,-l T  -0 x --. ...).1.9.>.P C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``50 0pp07/@-M0@0 3/P 0 00000 003/ލ@-`,MHP |8@0 0 0PP@00 RS THP pW t=P00P00P0,Ѝ @T@0/W/0  0B8H P00P0@%e0@-$M@D0X  0P 00 00a0PH0Dd$Ѝ0-O-%,M@PV `@\q pXXP`L7p@3,p VV !R "2 V pP vP`!V$Ub$U p 0 ^0 0000 0 0000% 0MaPP /,Ѝ G.R. 40C-S,MP80S,ЍS S S !S S @P p萟```X 0 000  00000 0 00 0 0M`PB|  O-P(AM@0pP U ! `<#_0!(p<#TUP <NP 700 P DP )0<00P7X@10 p0 `@AB$A  !@pP‑00C  X!0-  4!0DP `:P@!@3@:T -`t>T@D@`0@@< 0 0K-f>0 0@`0 P^.㨠嬰p 00@` POHzAߍ!00PRPN%,h+..l5O--0M 04`00 0A000 00```,u0S @8:P !0P40 0H03/0Sp0`P, p p0C@ 0Dp0p00닟`@0SugP 1x'x0p(1XP ! B B2%":" ,0R B"*=, = 0 R80pP 0 Rp0x1Gx1p#0q000ЍQ \2 0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@1<0X ∡0L0 3/ 00X0<:84P0`080dPS<00O>0=C0H048 <02$xU 0S T0 Pc0 000H0P0 F0_PT0S x3P 0S4 `Q00Q0S 0 L0aA3/P Ȑ0 0&003/f0F0P  !E 0 11( $0Y(00$0 S(0 0R0$(@0D 0@ 00 RD 0S8XV"a`" 0 0'H000 ꀒ  E 0q1x 0 d;0  0c1` 0,- F0Y1Ȑ 0 #0l01h 0 t0hp++ +   \ [*pV 0 TbU 00l0 Tb0@ TbT0P0%0 Q030#Q0S ,0 A, 2F7ip 0$(&?0 0L 3/PL 0`P!Q.VP S(0 0K$0 Y(00B8p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a",M$0pQ@-4tV #"T R0//@-(@T@Ѝ0 0 0003/@PE'/@-|MPP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p p+ZP T D  ش@,N0RgW0f0,|0`00,00/@-] @0t///@-0@Q0T˺@o?0 \ 0P000@-4M@0  /P0PU,0U 000 00 0B4Ѝ0,//A-pሀP@`VT0S0S -PH0P$1U,0U0 00X0`p@`0,0SR00/p@-@P*<0<`P" 6D0# A0$!p,,A-`8P@,pP( ' A,@-0@-AM Y/0p S0S XT@P00PU 88 0, Aߍ0]^d,0011G-`1!MP@11P|!M/  ppqpq{l#`PdLt a/$H 0[㺹!ލ @P i[>* ;'@P 0=S* !>A@>@uT@  P p0 P L <  53q'Z['/&1<,;141B11s@-P1@-h`11PX M/  L L P D ] 00 eЍp<,3]1g1111p@-M00-0000`0P06@P @T 1X 1T1D 1 SP1 1 Ѝp156$0 @- mP +C-`CM P@ `I.[P pܐ܀0` 0`0S1 1 Cߍ5S  Jt tP\ ``\0S H <10 1d ,1c ,6),22#2H2e2G5QԸp@-P@1 1  p#,17@-@Pf@b0  Ѝ0@s2p@-P@᰸P $~11P . p221p@-@P|1(1 fP1.1 p2@-醸@W2G-M@,p-T+Rr尒@`T5 TH Tol20$0@TPt"tt0PB`pPp0Sh Sb  @z- 0 0`P@MP2 0PP ލP :P !080 0)P !0x1X 0 , (, X0*0 ( ᷿X0101L0d,b,0!0^P P0M?0P0@; F;   & 0F 0 0 p000  @ᱱ+ԗ%,2#,c ,d ,),,/22<,Q32733ȱ,ı,d- (- EA-P$p3۾a@P-@T ( Ḿ"廤P( 0 P 0 ᡾l P $@*oЍW``'kX ኾ)< 0ȿq3#<,344D4[333*4h//B{O-04pn@T Ѝ@T@T( ^& P@ U [Y  [ XY P{ UPE P P$@ @$0"/*,O-4MpZ (%t,P@ P @R000f 000V0 0o'0 V0 f'V1!U@0P@0 0 000 0 U0 00Q0#02S4Ѝ;0 0Z   R% S  P@0     0P @V0V0 'V1!U@0P@ RM RJ RG  R ࠡ࠳$( , [Q$[3UU [ 0Z0P@V0V0 &V1!U@0P 0@ U00U Q Q 0   +0@-4MP!! 0 P P P@4Ѝ0@/@-@ @R4p@-P@/@P `@ Hs#0P P `Ra BQQ pQQ 0@S:p @-H⯹0RH #@-U#0@-@P4M0Sh!1P4Ѝ0 P*  P +0R0#@"*S Q 0R *,p@-0@ ^T00PUPU' \$ST ^/p 2@Q^U@.P@ @$ $ 0 00C 0p0 b4p@-,@P*0P ;pA-@H`HPpFRT0ԗ@0"T01 PS蜑, 00S@- /,`,C-ẋ(pX,`0@P( 0 XWaV V T0   ? ЍАYĐY R  U:0V @ w"@T0  44y&~&@-@P 0  咼@菼440@-@0S~h 0T0"S D0 <00R( T4 0,*,*,G-Pሑ`0SFp@Q 0Q02@1;1':X 4DpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $v& Q 0S T v! 0@1 00 0R"01 *,up@-P@mP000p1O-@0pS`P  0PQQQS SK0UȰС0r 0 $R 0 0"60(Q $&0, 1QX#  E vQ 0w!0  R [ R @R L0L L R# Ѝ 0W1Q:P ,4ȑ4p@-PL@0Ss!U @ p(0"E0P054 3050 0(2#p,*,*,40@-@0SYDP0@Е,A-`Q@0SG!V P p0 ST  4V(Ѝ0UPP 0P4p0@00 (d 0`p㚹L p P@ `0ᐹ0('p(0,0P,*,*,-mH5|1A-`0pS@P 0 PQQD R<0 f(2  0 r!Rv?000 ( 0RU$0X3,000 1Q\RP 0 00  W1Q:P0,K@- @00S T $卲@Ѝ7@nX0O-SMM2"τ\0@S2"`0S2"bd0S2x"h0S2\"|H ) 0SX8 80R\ , I0pQSPPTP[  @@`P. @  \00`0d  00h X 뜱;S/ʐ'!@0;P@_oRݍЍ RQ8 R  0:S 000a 1 00 0 j0 0C0 ^;0CS||WPpP54h555555#55636D6v66@%O6g6L6p@-@XP0S Q0 >q   R@Cp *,O--BM MpX\0S@P 0` ;( ` pPv\0 ₭P n@Bލ ЍQ   d 000 0 00u$0!`4X00 v`$00 00; Sҫ PbP +RQ 0P \Q S0Rʦ0S R6 S 1 S S"0S000000 000000#P 0S   0 R$ ? ! 0$ S0S 0$ `edA6O-$p6# S0 ! P`;+[0!p0 d00`0\ h0|00 X00 P$`P`l0(08 H⪴000 00 00p;5@-`X0S0 gƂ\0@S0 h`0S0| id0St0` jh0S\0D kpP0 U &Q ЍP54h5555{O-TM0(0 0,00$0040 0{P{ @p{00@{s40PX^ TЍ@`DP S S !H0401R < 80 80< 1#4 0@\D0 0L R0HL0( H0LR, @ D`(`,^  ( (0 p S `S(0q0S( (  pQ ʔ10Q02p1;1':X t庯$0ž0\CPWPSWP 0S0W0S0G?o2\0S p2 `$(0 (0(Q $![  0S G vN00p1 0$ 0 0 0S  0"ıR0S 0$ MB"01 *,uO-M00D@TЍpܠܰP`@D0SW0@    0 0 `1/Y  S      Q R  0@000Q0 0`p1/P *,A-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-㙴Pp`@1S 3/P P`VUd0P側T0P0S@000S4000S(0000A趶*,*,p@-@4`4P0Sp@覶10S 3/@*,*,0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 `P   ‚ 0S0P000l 00//00/00/00/10/Q@-@@L 0A0003/P@g  @ C-`BGM0pSP;0 0S0Sڭ 0Shӭ0SP̭0S_ŭ0S徭0S00$ R"000< R&0pG 8d 9/0 0(0 ` 嘭 |0)( 猭0SWY @Y Y Y Y Q 00000 0T0 Gߍ0000 0D00000 0Sl0 020 Q0 ,yz{-e,,-G-pPM 0S1 =ߍ08 L03/P H0 8 L00S4A 0S 0 0 0000 0P@T 4/H1@ 0  0` 0`hA0 R Z/00 0 Th0:/P h00S0V0S ZZ? V F 3D"? 0!CZ? fh0 010@0`%f',,6O-MP塬0@坬0` P8 `(b(0  000 mp!@000 _!ȁP00p@k 2@p@jtlw@l[  \!0 زfR  8!`0β(H$! 0pŲ0 R   P| Ѝ 0p!+0i `⩲ ` h OT0 0 p@- Y NT R ` @%,,-e',666,60A-@\0P3/ pW@@P@`ỲP80BW  \W[0 V    ! 0  0 1  |   p  "d , 000SJCT L0L LL~H0D@,ki a otV 6y27 000000 060 00 0]p`@&ᠦ0S @, 0H03/p,T@8@0 0S001Ѝ(%",, 010100 060 00 0埥pP3& 0eߥ(p0S 0h 0Q*08 @,04/P,qP 0p00 0S001xЍ(%\e %O-Sh- 0:\4UM@08 p D 夬P ៬`PЭ Uߍᓬ0P P ,0Uᾭ,30 00S 0RD 80S:(1SK 1400J ,HLAP4#0A4  H@4#; $別< 儥< @0P5P11@T 2"B ,04 P0S 3/P|20 SU0%0c@D0ps `2RR1Y N JH@pZE(HD! @<#8PpT@3P p F@ C0@00@ @040ݪ @Ω 4   0 é )0 庩40P1: 1 !  Tw @0 000000 00000 0Xpp D%D0S, 5#7Q[T Y ܬڬج,֬w ᇢϬf*,*,%j7V i7C27G-pJMM/0`@ 0 pp2PP+y\P) Y0S% Ut"`0`!` p//0P T 0CT *0C/Q 00PI@m+F P:>?0  ZP+0: S `V/>00 מPJ>00C0/S@!0˪+ S ᩟P+   P*P 0/S`0oo`bS >p; & 0 PV|+] P*+W P*᤟P@ᢞ@]᝞JލЍ@m7/RgI@-(@-M @ҟP(0 : k@P ` P wt "88S 00b"!4b4#$("(RSЍ O-p-M PU@P` WȐȠȰP` 0PNЍ R  i0P:0*  LFpP P W` 0  巬 匫877I+G-Mx\ `P`P PP<K+;U@P@?  0ኬ@ =3@P +JJ.0m+J J.X0^TX WPP~D4 NPPu$+JJ.0>PPe+J J;` 'PPN+㈁刑PJhp0 0J>eP 0. P UT ލ⯞P@Y+JJ⮞PP|pJ.@0+ ثP h lJ>ѫPR 7778 887B8o8N8a8#n88~8ș%7%7#8,8/68/00/00/00/00/0@-4M@0#|0$P 0LP` P0T0760 PW P @#T4Ѝ0,',,O-MAAd2(0!P0B(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0\%X500L%`ⓨ0,0W45 # 500 0`00P0 00倢W D4`D 0S_ @X%SYeP X:000`@ @`@0S 80< 03/P0p80<P DЍpv'80s D@0 0 0Q:8`0S}0` L0$3/$P & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C   a& 0X` 0O 1!`00;000Q!|  (P R`q02;0H0@20Lp,!<1H0"``$P R0$ 00 00S P V[0꒘ 40P+ 40S|p , S,0p  08q ^ Q  Q0 0 0 , p0㓒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`Spp,%C9,/@%/",*RgG-QM|0`Sxpp 00 0 P  "  "  0@T0P S"TPu@"&0P@@@,0S\|X@T"(0@"#r4"P@&0 001 0I!00( XT嵴XP!0(֦P@0p00+0@080s 0=0 |0 UT @XЍPU PP@@P ()$!X@0(ᦦ 0 h000X@0 400t0S00XTf00P0 00X@0x (}@l @8q 3/P,%J9aT9-C9`9Q9Y90@-)@M00 p\*3 +ʟ ,ǟ 0 PXE*㽟X [-㶟 F 02.㬟0  0)Ѝ0!0P8q0 S+P ,㑟P Xa `,Xo9, A- @"(0M( l0PQ2X1200500@10<1 081,01000,1800$ P$p 0@`PUp 0S0p\'Pp,P(FAᡜ(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0 X h O-4P`pp00W)ZYp !!.pPR 0p  0 @ p0|Q 0S   00,0 84 $0T0 0X01@G$, R,R P Q   P8q008TPR40  R RP  P Z0000 Ѝpt2O-M04p@$-P`jPP $0 S{n?2@|x 1 0100 0A00000ܛ@l嫘l%nx0ST(ብPPM p0(P噑!1P~0P(0A x 0`R b ",0x  B   000 8P0h l吾(0, 040x0?o21000Ѝ0~\Yl",4 o< O-pᨁ娑娡,M@0 S0 0000 /00O0S,Ѝ/S  u/00P`pU0(`P p㘁!PP PP%0(` 1`K G0 `40T 0 ,0X08`ۡ0100+ P 0 0壝 jPᣥ`,QvO-p\M@P4 `儰0 SpU  0  Q $0S  0 0$ p;P$9\ЍO*. P0:0pQ ",^T ^ 08  `00000Y(0S`l ` 0 RH03/0p``0[ 80s  P!\00000 SPU0$U00[P 0RP  0  p0P0   RP P 0$U$p0p[PP00[}p P 0PQp0[x?[00S' q !P0!:0p00 0RP  0 1!ƒ \ 0 0PpX0 0S( E 0R 0j  0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S yP 0 0 0 , R 0S 1 `R <$ P` $ P 0 Q0``T R T  R X `( 0S0( L03/P <00S D0SS000(( vL0( 3/P 80<00S (0, S004 Q00( `sT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀 SS 8q 0PUp0pp R 0S  0  0p @ 01 2 04,",,8Rg*O-@-M`,p4 00PVY pԡpPT Pp0Z:`PU`J6ERUA 6&Cm00#h R 0  80s0`F`pHU p  h0S 00  80spHY pPp  h0 0l0L03/, 00Y:pPp峢p0z0P805ЍOp0H03/,08$ $( 0RPP$P(0<00W]:< R3*,0pp0PP UP`p0$0$ PS(0Q (0$ $2", 0 Sn@DS g0S 0 8P`p0V`:40S00004000,0(X~$0( 0c1!$08` 0@<00< R:8`ppLp < p00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(0 (0$ $2",P p0a  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0Pr0H03/u8P0@0p0D00[p*p 0<0 `80s^00[ <0 0RU40@ RDp0  0H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/00  000 80W 0 6  1!7400000Pm۶9C]94,0 04 Q000Pp`,0 0U=:8ӟ  0$ $ 0S 0 p0p SUpዞ`P p b"P0RTp YT Ye:PpW 00U0#Sw p`Ѝ #"08,0,0 L03/P p开8 Q 08y\ X W 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*` p t80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPx 00 80sh p IPop@-@P(MS(0Sם(`,`{000P 0F0 0(PP` l P[P,((P(Ѝp000 ,嚔(0,`(Pı,< R ,O-phM)1$AS TP T(!0 "PPPЍ00> @ C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!R( CP$ 00S H @3/X|$HLPbU X],0( 1/( ,0P, (0, (0;P0 L03/P 00S 0SPX003/PX70PH03/ 0! P5/P%$%$)@0 Q0TpYI@/Q P, (01/(0, Q 2"gX$Є  0/PP  0 Hp0  @D@儐 0Y80Y> APPm}Lb,0S 0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000",,%p408 *, , < o Rg9T9m@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PWV`4Ѝ R00S 0 //O-`XP@ <b"080 0 c# p002    0 S R( 0S% p q' R Q0 2 T 0 p < k+800b"0p00S    $0!0R!/S01/,0! /,$1p@-S@ x1SP $003/p@x1P$1 0SO-KMM@040`DpPH(00S >I @I  0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0ppK܍Ѝ(׍Q(0S*o< !80a&@@D o'O-`MxxM0@0pP,0 0S ( 0R> 9 H00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00嵐p`ލЍ,~,0S*< !,00C#X0S000C0C0000S0 0,0A$P,D o-@-@0  !<$10(10,1P001.@-@0 0! 0O-4M`@(0TX\d0hp`P 2"\ @ @,0;/,0P R7P ᪙F2PpC Sp W 2 J "0  00 0(0 0 0`hᱚ(04ЍO/Pս4ЍU5p@-@Q-  , D \ P卒 0  P冒40 Pp倒<0h p@Pw80 P<q,0 P(k00 p!:"#:%&p@-PMV`@Y ) V $ P X  0 p PB0 UP9 Kލp`.00PS( 0` 40PlP80S80  V 0X0S,!⌘@0 P\0 `0S v@`d0Ph0Sڬ f@l0Sڄ \@tp0SD R@PL`ȑt0P3:":567u9.:8::;k$=>?@-PAMV`@ᮑ  ~V( $ L t D`qK0 @00S    8`V@勑 0 P僑0 Aߍ(0St  @d,0SL  @00S,  @6):*k$+8:-@-0AMP@0Q*  4 L d | B q0`N  ~ 0S (0S  t  p,`VL :Aߍ8 q0`N   Z 0S (0S  P  L,`VP $0 P 0 P0 Pt0 P0 PHݐ0 P4א 0 6.<:60S O-@MV M,Pm 0 0x R#p R0]娥娅qt8`  0@0S D` Pș ` ™PC H   pW00(0S%$B00,0S$$B0000Sڤ$$B0+ 0 t0B/すPDdp᭠x 00 0; Q <0 Sy0n0!$廖 Bz0#0 0=,0Sy0n0⫖ Bj0# 00;8Q30#嚖 BY0x#0 ᝉ<0Sy0n0⊖ BI( J 0 R $#{ B: 0 R "m B,0x 7#0= 0Sڴ"] Bx 00 0=$0St"L B 0 ᝉ(0S<"= B0x 7#0=00S"- Bx 00 0=40S! B0 ᝉ80Sڈ!  B0x 7#0;! H! B0000B/㟘pWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/',:,wC:^:y:::::::Ֆ'/:1:::::::: C-`RGM8 C"U0S1 ` ` $}똣0p⇞ 0S    `,pYV "n$ D }`P 00" `I2ލ@= 0   0S  "| `PV ( 0  "1 S !  N00S @0S"@ 2ލG<0040!0"0y@0n$ 0DL03/00 Cp p q r0S !0 _LD` 0S " "p8`Y a0 x 0QW 8 <0RN  0 0 0 ".@+@墍 0  c R0Ul 0"  ';e8; :<6-C;I;W;w_;6@-x @+0 @0p0Ld㴭@ |i;@-@ @000(0,00007d㟭@  |ꐯr;p@-`xAJM0Psd!   0娊1SBX p ( 4 @ lJߍpP@0 00 PP@z`(PVU@@ 0 (ⓓ0 0(0 00@0a(6P(6,P#n0`0PP`%o./k$1p@-0aPM,0$0Ps@!  ( 0>$1 SP 4 D ` p   (1PP$PЍp1  , ,0S$0޷`@VTPP 0 0 0 000 00P005P05X`@P`@@o<` @`@%o, k$   O-` X l x 0 P 000 PP 0/S  T!0@@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SIOoVTPP 0 ⾑0 00 00P0ጌA4P=4 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N ",k$O-4MbPp@ᨏX Ȳ XZY   l @  l bP ׊ X @@04Ѝ<Ppʊ1PeS`# "1S "N !: @ b 尊 P0Pp妊1PeS` 㟊|0 1S  1SX!0 @ b< 1S 1S$1! @ b 1S 1S(1  @ b 1S 1S,1 ݐ @ b 1S 1S01L ̐ @ b< ,eh-,'k$O-0PQWMu01 `%0@ 0Vi40Sq 4000S4l`V$P |X003/$}1S}atd4x 002"+Q:  Q 5 0,$XoY/X({0.}1{.{ K#%1 0  &(18!X  X" R b㄁ }b/@ZxXXP0}11P }1aS 0S`  1P11UTk p弲<W2f0S20S D 00D0Xb 00020S 2D00H02`L00P00 0000T0D010S D 00D0p` 2R!P0"t!  1X! 0 SL!0C 1ġWߍ 0 `2 0p0 0 0)1S080H$0X80`$P8 0 S5L0X 3/P h$ V `V 00%$1/`0,,y;',:, 87` , #, :,#,Ȗ  t0S _P V 0S0q001 000; 0" $!   8 0X L03/P ht0S 0_Sʚ 0  0" 00080 LG-0ĠĐ(MpP@0 T㤳(Ѝ 0 ^  ^ 0S0 @ݎ`=P aV@@y0,C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@,YT $0Sb S L L0S004Ѝ0CS@D&4$( ,@d:, +30S/O-@SMP 0p#00p\s`P HH V@3P ( O  d  000 [X,pP0S* XZ'0 jPP Tq 0 x0.0I1P/S <(ċ0(0 00>V0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V7! 0l!  0pH1@!Q$1S  0Q p $ ㌏'pj ハ00!15:% p wP p Q 0, ($! p h$ cP]0 0 8a4Q101S/',D:,0,Rg7%&<a8m<<0S@0@-S@00 0S/H:,O-0زEM 02@PT PP0 2P  `|1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 َpPP2@0S- $P* 0 x0D 0SP#,:,=',D:, #, +:,=A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T @ T7 @pW4dpW1V 82# @ R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0#,:,#,:,',:,\0p@-T00P DPPp0AS@  1SA` ,",0,0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""*,p0\ Q0/\P  ^U Q0000@-*,O-GM0M40d2@`TL2 00V 0 0000000@@@@ h~0p@c<   G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0`@W 47 4U|4 VH0G, <0," B0,oD ,0@-DMP@T P08 @\0 D@  d  0 0DЍ00S,0@-@DMP/ P0, P\0 P  T  0 R X  0S0000000 0DЍ000S,p@-@Q@M`P<Z@P  T0 0SP@Ѝp@茉0@00 D0QU@Ѝp,17@-@SWh   X p    Ѝ0!{P4PFP<<0@P0<09P0<03P0<04P+P<0 S, 0<0 P<0 S@  0"l{080#f{0,0$`{0004<MD@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍpnV4Z@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P B0 $V< : <U< ܯ0$#P0 |! ٫|Ѝ0",[80@-S`4M@Pc00 0P 003/00$1U Ut  4ЍS0  000 xp0 7/( (0㜉 y&8*>&p@-00MPQ0@$ 00x` 6/< }`Px1Ox1a1S0C€10Ѝp#>p@-@<P P $ bPp0S@}p P OPp0S 4! B! P  :Pp0Sp P R P0 &< !Ppp5>E> +U>śc>x>O-uM M4p Z-]H0cS_ Cڪ0SSyB0S 㘆PBؒ0SyȲB0Sy2 P    P 2     PT2 LH   @  P00002 @@K @xP@ PHPP< ,h@ ,D@51 0101010R0 0K000PP0 `|p@  PKy} 0S10$1S10 0Suݍ ЍP`HPjPi1S |!R |tGP %,#,:,',D:,#,:,',:,d:,(:,H:, :,:,, @ ",0,Z@-(00S P  Ѝ Ѝ(,>@-@PЍp$QU 0 `P > PP C 0 1/0P $1$00 HL Q>",80S 0 @- Q/ziܖm >G-`ᔐ唠@PX0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`8 @ T P $Qn$00S U  0|1 08ЍpP ?P P Q i P + s P ,A-M|8 PU`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@080 3/PDG 0!!0#`'  03/P"0#"#0 03/p 0` L03/Tp p` 0SXpH?  !0|1 01! P0<0S P L3/00 L03/P @0D t0Rv`p00 L03/P @0D t0R 4 d00`RP  w00p 0Sw`h,zi >O-RMhbP  y @PH5@<  VPpߍP(  aypp0S  j<08 (00,0 0000400!4 04$0D0(0 P cfVph >q 0 p H)W <[W 0WW $SW OW  yp yp  x xp 8p?pq8SڰPr   00**0@0j  0* *\d@edAszd@A-CMMPPp`;8 Np@P  0P;PDwU00 ## CލЍ /O-T 0 g 1!^ 0࠱ ^0.0  ^࠱X p 0000 @00R00000 ^ 0(00R0#02S<Ѝ\ 00$00 S00)0R $X' S    0 ` 0T0T 0  1!^ 0࠱ 00S 0 84p< P ,04 WR,[6^ ^ [! 0 S000T0T 0  1!^ 00࠱ ^ 00^ R pR0؀0@-4MP!! 0 P P P@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`@@

>@-@ d@?p@-`0@PTPpD P P @P@-04MHPL` 0 gM p&P4ЍHց@P 005P0PS80080#1 PU0``PU`@00< P$`D0pB>0@-0\S00$P (0 0R` D00S/q ,$p@-@(P0S0S0<0 p,@-@0S,O-PA0pX :S0 0<0币0P0_0<`8# ( U 崚Pᮚp< Zl0P 2! !180 04 0 PpW00040080,*?@-00@T\3#%:/o"\ R0 t 0Q    $ ( ,   @A-@0PpUP3#:/o"P RP`0SD zW@000000P,O-]MMp 6060@ TR3#W:_oRRPUP  YD R R IR 0"1 0 0`K !R31Q  @#-#-@0S D0S## #@ #0);.7`P 0 upRe0S -t]ލЍ@ D@Z@0S $|а up, (,0Q^ $0Q 喀0P0  0$ 㒳+ 0Z;  0  ),hu00( S:Q0 ]uPs 0000Y/ Y@ YD0S0 L1.D@0\P(!) T  00P ؠ0,à\P00 YK 0R  Pd0\0\ h 0R T kPS@ PO(?yd|d{dЀ@%K 5?>->p:"0$\ (00t S  BS kS00/Q 0P//0S 0S P/!R808 88@-JR )r0@/N?> 80R*@-0M@"P0 0! 0!  P0Ѝ/A-Pd`0SU@ @T@p  H@<`P pW@,S@-@P ' d5P  Ѝ<*P  `P (PP )0P`  P P(  P` D|PppKPP 0SP` P `P @00@0c?j?p?v?~???~ș0@-M  㟀Pڔ } P p@tP}PЍ0K0S  (0f?@-M0 0 y 0@S|( |0PXwT x@08~8  P 0  IЍemL>@-y0SЍ@-M@ yT0  CR$00SЍqA-@lP0ST 0S` @74P7 #P.0'% D0S(0 D (rd0{S  0 ( 0 0{ ~@00#@#000@4(0 0 0{~d@???W@w@@<@"@Y@_o@p@-@P} # #0S S z}娕00 00$00(00,00p@-MO0`0QЍ S 00W@0Ku #0$P (0Vp k P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T u0p04 4`X \^  R  0  `04pX ^S@-Pp`lM8V00 0! (! 0 &PV$8 80R:V t#@RD$ͱx{@PV008P|0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0u@A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* {PW000 f0 0004P 08000 <0S $0R 0$ A 8< Q\004, \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p{A@-@ 0S PO--UM M00 5%F50S5%  P|PP Uލ Ѝ5 %:@0Y|PHjz@P T@x0 $08<0(40PP$xPD 0 ` pX0,D>GP 000 0SXUPD0(00040(0<00a@08`0S XU D 0   z0U0Q0SpPX X X0S  X~ Xz z` z0P,0 X P(00W80400<0tXP0 000$0,0S @ XPcXyPP @{ 0S$00)zI` D0pp0<00008``#004S``V Pp0p`00S00PP 0P0 0C50  0! 00$0080 0<0$0500D0V/;`M0PpUH HPLPnP P`0`xL`PH-z6m0S 4 R 000 0#ᷯ0P 0S ᝯ뼀8 0<$ 0S P 0$ 08000S`H nP`T0S0P 040 Q\8<0 Q\   P`OA*>#,ZAcA,uA&6&&=|d@-< 0P 0P#,(,-,M0$00 0 00 00 00 00 0 00000000 x,Ѝ)7@-@ P0060 000 0*00 0 0 0P  S Ѝ0C-M@pP ` 0 0 0000 0 00sS̀@ P0㓔$ p0lS|p@ ծP0㓄$ |p Ѝ@T r@Tp|G-pP8M(@ 0S    wP8Ѝ70 060050040030020 0100000.00,0  P #00R R 0S T `BPP0c# BXP)|p@-PP@M <@` @ `  5/V@@Ѝp|O-M8`@ SFf* "R]  BR^rq/P X" HBbB@- Q1`0d1@@Q`q4ЍOA~B>p@-@tP0S0SX DR00T0SR$D0 p"@ p ,:,08S^/J,S,p@- @ 0(  P0R0PS 00S:i  ppC-NMM@<ЀP`u 0 @ @ @``o@; @媨PPD #epcc NލЍ(?ydG-xM` ✠堐@p"P@J!0@P 0S PU 0 R<\1\!\\/;00S 00" !PP0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍZ Z Yd   hZY < o @(  oO`Bx B->p:"A-P`@(P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 04,O-`BM Mp@P/0;( @ѧpP@0 Z@*0j0 #;$  j P!14"S; Wbxo@ U01U01Bލ Ѝ 0mP 000 0j RZ0 0J$,$0 0o 0 RZ 0oS 1 SR 1S  RS1S1S `2?B冏@0Q =0STE 0"0S@0S@@xnP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0埤먇 劤 00N LURX@-04MHpL` L1L!LL9P)n@P* T00ሇ 0R0 !?020 20$P000204 p2o@4Ѝ 0S" $0Q00 L03/P P P003/OAB>A-P2uSvw_10000“b\œҁ@FL@$H @A- P@ \T@@ 8ž\ @T8f `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa n00`T08BGP08}?0@ T\ Qp`82S40 @0 8lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXrBO-P`@p\M(}4000PS2 0\  \^T 0SQQX W@\Ѝfb(0,F 06!!S 0(0,0 P PQTU Q8b0 RW(4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(,`80400Q!`00 $0rq? 00((2@ 2S 01 $  0hPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S$2$"$i02#38( R,00W? vLe< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP 'm@UD0S 1H R0!0Sq?r0 8 S 0o s, ( ^\  Rx0 F7"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0BCziTdLlBO-40M@`p0PV00PT8T(TT 7bPV@8:Ѝ}  P 0 "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVX7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@240r/q?0840s80 0(8  R    T R,08 S000f0D0jD0P7V50Qo_P0"Pyh0S SP kh#8 @UU 0 o?0 R S+ RQ  0^/o_ S㴒P!% 0 8,0 S0000IY0X0\04024 0P*h0S PS khԃB I z$)<1! R02 0C00"@P0 ^(T0^X0\0Ph0S SP rkh堃0T2S2Z 00,jPR?" 01@22]UV 02w?0"S0 L    L H0H0P LY0H0PSB 0D  $1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP jh%<PR#38H0 41HP2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V00/GCB^C4,UdLO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 2P0 4  0 P!P "0#"#0 D00 xP 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0g,O- Q-aM M:0@ 00/;㢡`PPaލ Ѝ ^p H6*P:0@ vr,W 2S 1S<2<"<<84u0   &      0S!?⧻t  0 d T 9 6dPTRUC\L&HRQ  0 1Z!*??  @zv0Y!)? 0? 4gpP  c?XT D , cbi?X T Pd@zi̞BUs@-RU0 3@`d0T `Š P";0H0`04 oЍpC֞ BCs@-@P04P00 m3o0S  `VRUp [0P 003/8_ohVhЍp@h>k Bp@-@0AMP 003/00; tpP   g`P 0[he[AލpO-p0\M0SQ `sa8Q0 P7g P0,b 0@>S@0 P&g P0b 0@SP0 0HL R ?  o ?l/Z[\ P @10`d ἐ 09/0P@\Ѝk$",G-p0@PHL` R0418S ^ @Z R  0\ .X0?Pࠡ࠱000^ 0 G/",>00@-M 410@810!Q`0 P00 0LPU`0 I0PU ! 5/᜸Ѝ0",+@- bI\@ Z@-s  0^g e%tEp%@-@@0sZ,00p c0CoH%~,-?$M0 0  Z$Ѝ-4M0 00 000rP4ЍO-p-MM U q[ " @h[4 Ѐ0 p0 pW(0 0CSpW"R 0pğ|D0S 0s d0SMߍ0S P $0d40S` $1e`#S006 I鋟0 A'B# A0f{{JOdTd@0e3 x3R - B`P  I BRڒPL"B 0@# f0#2e`$ß 0 RSPSB010000 "fe 0 `S$0(00SZP=9 =:k{820\  0 A9 צ A { Q0 \RQGA f0 Q +"+Z R+"+ Pd@./+"+ "%+ /+"+ 0"%+C5 `!+e41@P0'10 PRldP  !"%+0Am,Šˌ C5W7 d@0S00d d@0 00p XY@.A~,~,~,~,~,~,~,~,Q%pD ,~,@~t96P0 P 90  A3H0 A k{I{7{zW 0P | d`k~|fP<}00<@`~0 d@ d@-@W@QRG-PP @ R700Lp`P:X:00X 0edPl@-Pp@`P0S -S :S S 000`  0 P00 ЍU0S00T  KP@%p@-P`(Xp@  XP4XV@c@700pp@-P 4`Xp@  WPX@p@-M@ \Yp$ ЍA-`p@T/  0 PP**P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M Xp 3ݍ ЍRgp@-P@@XpPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0H 0hhcЍU0 0  f%$^,^4^@m@-`0tM0FP?o2p@ pX oXpUWX@tЍWp p2STXp D0V4 - pXp"Wp0 p@- @ p0 S " 0PUPUp@}d0 S  0 0S rdpd0S   0 0S ddbdF0@- @  V@0@-MP@ 0     Vp||XЍ00 S   000 00P0 PS0  Y p;Q^FC-M0Mp@PU `0S@PE8  0P00'ۍЍX700S @ Q@BPE@C000 p 0S 0#S u@UX F[^m^^@-M< @  @P`yppH 0s 40 lp  0f p輡p@-P"R q@ d U01p@@@dq T U02p@px0@-tM0 p@  UpPU@tЍ0C-QM Mں700ۍ Ѝ  Y0 ` @V 4U@pP`A-`R000Pp@STa@PT  Q*R@00 S   0 0S0 S *aP `bb 0000``0` @ 0@ @-@ @G Gp0@-M0@M0$+p Ѝ ] G^p@-P@ `S 0x8 , ?U\( 0 0 008 , @1pp@ ^q^p@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:tatbp1CaT10CT1T1XSa0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pSa0p12,P0C2bVabx2,P0Cx27@-@0 PP! P1 0L18@@ @   (   )    ,  Ѝ0@ Ѝ0b@- @TP p K00d @J 1S?70sa'_P 010 @ 1G0@1/@-@`'L0S : P 080H0S S@'^^/x!@-RM@ Q|x0 )+ Ѝx1S^0@-80@@N@ P@- @SP p 004' @ Q 0 @& BG-MM0+ pSp06S , ۍЍ;04@  SGp%ap@- B@SSp  P~Sp@ P 11P p1@ R  &lQPEUQ T`00CS`0X `0( p@X0 X dG%%@-@T 0S h@C-MP`HQ.0$ :0 0 0100 & 00 0sD00-PQ 0a(!"4a#   0 >Q & bPp tW  g 080 P040Ѝ 0b"!4b4# 0 0S %/%p0p@-8P`J04  :0 DH0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0  HPTJ4*0 `VT0: I0 ppps@-@7 @1 ` l!1P DQR0$ L Ѝp@%P P 1  p Ѝp@ PU%P P0pPЍp@ 0F@1)#90 -1S S _ 040Qp\ @149@1 4R041 Ѝp_G^^l_p%U^p@-@d @11P`PUp@0 0S%P4@1p@uI^p0@-SLM@P 0$M0@(p\ 00 p0 `P  LЍUtP @ tT  vU`  P10L1#G?_Q_@-@MPP` p` 0R  p g0 0 VU  Ѝ@:<Ѝi__0P!LA-@`x0 P  ЍA , 00  ` 0  01PU 0! 0SHP ЍA-ET 0S 80 ⺓P P  Ѝ___A-(M@`k P-H`$pc PD 0Sr PPUn 0 8PU,P c :Ep(ЍA$dW `$X;080SI $0P   A p0S \ U6 A(ЍA U. 0S V ) L0S p`MP Q,p R<P 0S Le; 0S )<I$(ЍA&(Ѝ_``^_G&`G`/ 0@-@ 0PHH0S$ `@n H0p@-S`@P 08PU $00P   @1 08006? $0080S  p, Ax p p@H@-@M@O-p@찟P`T(  P 0S!W 0 8Ќ# } 0@ X(00U0X0S @HX   ` \`@-M@aDqa0@ 8PP_ p0 P 4 OphhnЍP& P P' P, 8kP5 P!5!.P@1 0 P P` XL!d10B0P1]t tLHmp\ kPʦHQ^```x`h`q```````` @-@4^Op X00D1 ЍP 0\0H aA-` 0S0 00@p*TAPP8 0S,p`p`\P?HqA-`@  @P\00Ѝ 0S  m%0 S   0` 0 8 pPd` @P 3`00P@c\  PP 0S 9$0$0> > >0S **vV  0S S`0 S   0001  @  0S LBP0 S   03aJaQHSaiaC-MM0000!@0Op00%́P+ sNP`pQv07S 0 S W \00d!h1`P1 ލЍP  P" R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 PhH}aaa\<@-@+pI07S@dB0 S >0VS@|HA-`R@M@p PP U (70 0@ЍAsP"R 0S 0 Gr>XU$  *aP 0S <0 *. p \. <0$ <%V>P  *@ЍAM@ЍHab0bO-P@MpP  P 08 ЍO+P4 `001x@Tx  FMP1L@T@11@1Ѝ$@P000 @@T X@P`@   ` 0 00V`t`JZX3`#`\3@``\,#,3pd @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 JP 0  X S B p 0 0S@h0 0 X S  + p@11@1v 0 P  0 `` 00b : 0( @10S 0@69P 0S 08  * 0000ST 00S W0P 0S 0000S#0000C0 0'MbWb]bmb%}bbbI@->@T( "44p P`0"@"44 0W 2?L L0 b"!4b4# 0@> *>@D Ѝ耼x1p@-SMPD<"`%@P/ T0x18"V@5t1;0%000 `bp 0%S PP  @aY@ &0S T`s WPHl|A|ЍpxA>0S$ V01@T t1S L j@>0S@ ?`t1S  Y0 @1P 0 @  B00.V%p(4#t1S rjjjjHjkBk,k 0 R/ 1/,0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-M`P@vL (0t`p`FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!qL"W@14!<41Z(@`P 1!0S0S0\,0 0 @T0@T"V@P0\400 (P p`P,00@,@0S  0 S0 0@@ikHwkkʚ;k/G-@PЂL1L!LL"p0`81(!4qP000S5 \L0Q H PPL0H0L0 \ 0 S   000S00@0P `pP0P0 UPV `pXikIIwkkJ@- Ѝ@- 0 ЍP@-0 "q0@00Q 0Sz0@0 R    R 0700@R  0@00@ik$Iwk@-@^S00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@U,p0 000"# ЍMb@Bp@-P(`0 !PUPUR PU PTP,PP@4P`P4\pQ@ ik=I#wkP 0  @-y!0TP0/ikTI7wk0P0/P@-$0$ $$f!@008< D0ik_IJwkA-(MP` 10U@0$00 I!0@p000 0<0S NIp(Ѝ8010C>S@( ( 03(00@000 0<0S80 {p @HiksInwkp@-XU@P fJPpV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHVHPLPp0 S   0|V0 S   0sV0 S ,  0jV0 S 4  0`V@-@@YVC-@PM r`P0SY 00C01@0S D3/H2H"HH (PU0ST2g0S R,0 S ,  003/40`0P4P!0  P0HS 0 Pp00S `ЍH 00S0`   R 0q   QR("( `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/,ikIwk@-4 0f$@ #p t@Ѝp%p@-0`AM$MrP 0I0  Sp@ G@AލЍp$F P ڢ!PQP"@ 80 00@$   VP%p%-@-  Ѝ Ѝ/p@-MMP@ 0 `SV  0`ۍЍp-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  | ЍЍ/-@-  ЍЍ/-@-  f ЍЍ/-@-  ЍЍ/-@-  P ЍЍ/-@-  ЍЍ/-@-  : ЍЍ/0/P%0/P%p@-AMp ;Gp@ PA>0 dSV ~@00Aލp$P 0 4SdP%0/P%0@>VP%p@-@PPJN; @@m ,VT NV00ppP%p%!V@-@P:.@@oT@-@p Fp F1Sn"@]TkH@-M@    0  [Hp1$0Ѝip@-MP@`   0X BHp 1@ R! (0 p`Ѝpii$00 H0s P/0 #  ///A-XM>PUV0P0XЍU700p@ `R0 PU B0>00 0<0  ,> !PP> *k@-@T>@@-@TQ?@0Q/ R0 /RG-@P(Mk0'0S  gP P `P:4`P $0!00 0  ״$0S80 B$00(Ѝ080 <00S # $P`p  P`ᰴ0 P 0iS.S  P`ᠴ4$P 040:S@%O-`-[M @F/P 09`0PpP$E PCp<Sp[ߍ0S00:Y 0S 0S_0PP0 $ P PU0SB 0$ֽP 0PSP0SPP@\1S<@d1Sh1 $P=d1 S S RP@T1SX1 $P-T1$S@COoB@TPQ!P"d$  a0s 0$吽PD1P `1 $ŋP@\1SPö@@00STATl p1$k0P0; @T$ P p$]P00>Q@PD  ` $ 8 0[$0E  P/ h0 S 9`001P d0bFp `0 D000S0 35S S  CR0UX P PS y R 02 > 0*K@1 U48#88 S R p )S 0 S U  R P 0?D0{ p 0L0D0}>D0 PN 0000H@@@ITRlElilvl0@-@PDM QP@T 00p@DЍ0U  ⠼P @0SA-p@M`PT(@Ѝ 0S P 0S0Q   <@P @-O000Q/P1P/$0/0@-MP@    4UP 80 pЍ00 eEi~i @- R@$M`0p0 PR  RU U 1 # c0PP  R@T!@T00$Ѝ R @D@-@p !p !p`D8- 8Q  8A Ō8   "  0Q5ã0ã0A-`Ph@P─@Ѝ ėP\PP0P qlP hpP ~IO-@P᮹0"Sp0W"SpGP Y 0@s` PM700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C R\pT0 PT 0 0T 0T 00 0    00 `` 0S& T  G60P`0 NRU`0S  16T P00T0` @%P /0 S S /S/P0/S 0 S S/0/@-`R$MpP 0S0U00/e@P 0 00 0  0S l$ЍU 87PP0 T/00DU C7llO-p gPPx ЍO=%`PXX  ЍOuO@@僸 Y3lOgPP   iP9 Q0A0 Ѝ YO@ g`@cp oN0P! 0 @ l0p00@[    P0S Zg@PAIlA-@ O`P,p 0e SO$`P,p PP(0e S$ O0(0$0PPO-U  0 pP 0HRP,U H0}H1SzePHH0P00U LjHP0P0  40 00 0 N40SS  PU 40!00 0 Ḯ40S =  PU D13r8`&d6P$0 PP``Pp@`@P  RPU\ D1r8`&d6pP$0 hP``^P0@` H0P:0H *P P0P<0{UH# 0S /Ꮹ`P /㊩`P00  V /0P0 P0P0<0T000H0P60JU 40 00 0 XM40HS  P3h7 0 apP $Py 73P@H08SP7SPU ,0`P 0SP P UA 0 9p PH0P580x0 50408$ 00 0 ᮭ,004XP uP ,8d `f PV7008 A ,;a84@AK0:9PP880A ;p PPH0U4 0 P 4P 4P*0 06S 06S0P90U1 40 00 0 L40HS PqU H0X U PXdH0P;00]H0P90WU `| PO`,hpPд pI`PP<0&-J AKP0H0Q7;0UtQP% {P0Pt1 sPPtQ lP0Pt1 P` xJ0PPx1P|H0P00UH10P2DPH0P2:PH 0P20P +PHP gPH0P00H0P200hU3 0 00pP>0S;7P0H0P20H0P60H0P;0H0P80U5 D1r8``&d6`$0 BP0`9PP@PU D1r80``&d6`$0 P`~U =fPxPCl vPH0S P P10P<00+ _P   VP Pm  IP  CP  =P  7PP`P  0p,p 00 4p 00 pP ,8 05 H481   P  PKplL%wm%mBmgPmommm9mmmnq/nr=nѐ^3AnEnJnRninrnnnnnnnnnnnooo#oYouoIoopo+py_qp/,OqIgqq ᗯP  ,p# ypP 00 0 H,8   P   &P< pHP  iP40-00 0/ >J40Sv P NP$/.`P萄  PPV00 40 00 0 J40S P  P 0,P/HD P0H00SP D6, H! 00D&P0 0,kP/ޥH< P0@004Pu <6, @! 00<&P0UT H0` WEP`H0P20H0P 000$,PH0P00H0P00H0P 00{H0P 00u(076002P ^ *Y450S00T01=5 =P5YHPPUU D10@0P@d6`&P 0ShP:U HTH`PTP,U @1 800P00 00 0 .I00`S46`( "4`#4 4᧱H0P800 P P0 0P0 0P0 0PH0P10H0P10H0P00H0P50H0P50H0P00H,P';,UfH0P90AK&Od0h0UV Z7 2`P?PAK⚿OAK'OAK⡿O/P  400H40S  LPzPP lPq=ቤPPIP PPp`PW>IP`PPph /IP jPPpD P6PIP fPPp P$ IP lPPp PHP` HPi HPlHP!`Y <4  0x 0   X:` ml?o2=y x fW wPHPc HP HP` HP` HP` HP ` HP@` HPh 0HPd DHPe XHPe l p}HPe wHPl qHPg kHPg eHPl~ _HPlx YHPfr  PgW ZP0&, ֍P$@ FPRhPP002HPbp ^pP  R3  R0 0,PSP00,0%00 0$0(00XH`  p ᦯@ ắ dZh0PP ʎJZ d0PPXZ Z P<ЍU  `P004000 0` G4YpdzPP$ 0  p` 0S:PpPCP  0PH| ?0PQ4FP`&|6xvaPPUX HPH6P06H0P"800H0P80H0P7 00H0P70U2 6P0Pp2p2SIPxH0P00rH0P70lU `P 00`ᷰ@P ᰰP 嫰PPSPSpVPp ᝰP |ᘰPqPpP8H0P402H0P30,H,P 4,%H0P20U  0pHP9PH0P00H0P00PV 0U0FQ h  PU d0@T$(@?(Pqq8qq:qDooO-p@Ѓ8`P P 'P PgUD1P ЍO^B$0SX4 ,0840 ЍO' ЍIm\pA-pCPP6H,3&7,00000 0606+D1@!0`00 0:00300PQO-`S$M0; 0@ QpP  80:0D1H0  0 0Fp0 0000 000P0 U  * 00$Ѝ褪%bbI,A-PQH1`Sp51Sp:1pS> PD@DTD`fd6S?`Dhfl6S@hDpft6SAp~D|f6SB|xDf6SCrDXpDAmDlD1pPeDcD1pP\DX  OP T0 ST&d6,`0Cd6l6,`0Cl6t6,`0Ct65D6`0C6 6,`0C6O-MDM` 0P@ E 0%0  7p 6 +8 0 X 0 00 +0,ʩ0 P#Z1HD1E,BP0`d60,(@ⱩP4: ؍DЍD@0p,0@04CYP0/`6hv2@d6,2`dl6t SMhCpv@,t6t SGpC0&h6l6p6t6t"&x"6688@ p458! 0Z0P 00 R @0<   C 0 0 3 啬 @0 R R R P\R p@O@L@@000SS @3@ P4400  C8 ?o2@0@0<@8@,0@p0 0P j00 R*': !PR0PM Z8 @pPp@04CP000#Q00Su t 00;$ )$ @0 R R R P\R @@* lp @Ph0pAlq![Pplq @L ɭP 0S 0P  ἭP 0S 0P Ჭ@pPy@0 #0S  R  ᢭P W@0<   C 0 0 [z0S 0$: 0000(,@?P1RqKm[q0Q//Q :///G-p0@0P `P` Y 0 0 R:CS@"3X HGݯU( HG脫A-TpW0  T`@V0 H0HS @sP X X| |00 S DD0P 0RS KtLP_ttp@-P  @Pp+ B@-@P PpuP_tP@-,0, ,,y Q 0 TuP_tStp@-@P,0, ,,c PP pStP_tP,0, ,,@-O T0S@iwuP_tA-PQP0 : iU0x ` إ@T ѥVp 0S 90S@uP3_tOu5p@-@Pp PᴥPpT0 p@1@-0@*T m@00T0S0 @-  duP_tA-PQD2D"DD T0@ pR008@10 2T T'ᜤ@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S ?p0S 4pۭ0S l)PV ((P`PuP_t~uwuuuuA-`PP e_@T ݤT0Sp@Qp@- M0  T0S0 PUx0d tPe_`@P դD 0  ->  ЍpuP_tduuuO-4MPp 徣⻣  ⸣ 9@1@0 A@1'P  4Ѝ B t똣嘳@T}   kT0 RD1 0800/ P T8p t0SS 90SSxPT0ep| `P7 |0T T0R   P  @88UPY0Sx x0RC >⛣T 00 / XX4P  0P T T0R88#P gP$p0VS teo \\@T000vQvvp@-@PQp;QvG-PM@` P `bp, 0 b ````b 1 pW0p`W% b딪 0 0 /@ bT  @PЍ00C>S}`"P!@03@000C>Sm`"P!@03@0HHHH-3@- P Mp @ p@Ѝ0@ Ѝ/R A-@ww6wwxw xJ8́p@-@Ppp p@DRRA-P`p@@H0s  S  U@ p@@@dW0S  R H R U@ p@^/TwQ/p@-P0U@ST` 00p ᐟP@ۢ@T:p+xA-`PM1pSBT  p@Ѝp hPЍA!R @80  @z @p@ bp@V 0 !p@`P ޜp50S t|0 0 0#40  DPH SP   : 0$Q0x5xRlxOJxax @- @0P PT00Q   DPp@- 0S 1 `@\0S4 SP U \ @ 00p.S0.S0_S-S,  00  ?Rڟ"0T0 00p@%P `00CS`0p S00 P0S X0X /X8%p@-h1@SP0QPPE @p Br0.SSPP \~P LyP < RP 0  ./PP> xp@-@P'U^ 0 pS70 `N70 PI70  @D704,,)$&#  @       70  70  70 70 x6p@ P NPxod)xxxxxxxy;yfy y'y,y4y=yu Fy 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPX0p0 0R6QލЍA. !. t l0E6p`0SPE@Ep 0S:0@D0WbQyXhWyO--4MtpP $02 O끋`( (X@P74Ѝ0S  M l,P@D 0,pP@$0,PGY ]P,p0[.r7900 P,p, R DP 7, R, R0S x R $H70 $P p7,0S0S ,P! "xB,AQ !!!~fymy P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-Mp`P@VV:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?Rh0U  P^70 0 廟 .0PI0 0IV:D XK0 0 @UR  ES`O-p0 1!@` Y*QP T W%700 Ѝ%PpG@`  00T W 00  $P     \Eo   ' U/U$\U0 T WPPT W\%0P00PPpG@`T W pGP`@%RC-RM MPLHp`p= @=p5 >5p V=p < |-5pT=    T0 Ip P1 Ip I/   zRލ Ѝ   #  0I@  p@P0P@T*wp0S4 mp `@T*T 0 4p @ Up   v0#$$("( 4pw @  c0\#$$(B(   V0,!c#!$c$" 4pW @@  C 0b"!4b$#  6 H    .0I/l P4 I/ f4p. 0S @00SP%<W4pꮢ00E-k$~xA-p @MTP 垚ЍR` R 00L0S 0 -0 0p00#M0 B$ 0V 0  0)3qyyO-`-4M`@d00 0ShplP (0S;0  `pp30"4ЍO 0  ,   %p0,0 ,0SDX ,P p 00"0,X44ЍP U0 00!00  ", `0 Mp00h!0xJ p PE, 0 S(0SU $0$00 (000$ 0S *GhP @TP@-@P@ޠ`۠/0p@-` (MҠ00>0@SP  '0x Bnp0 q0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 ?TT0S (Ѝp0 8P 0T0S y0PT[ A-@`儂VPFPPP2Xp`E1P 刂"20 嵛V0  2PRp@- P`G&p@ F? }&P$@p@-Mp@`P! ڟ (֟ ("X( 8p`&PU@ T700@ kЍi///@-M @ Z/PЍ00 3"p 00000)%pxx,0000X0@ %p@D 00 0 "%p{z[Zzhzp@-@Qp $101p@1p@-FM>`V P00Fߍp@PF/ N9  0嘗P01 0 ` 0C 0*> P  9 ii@-@MP4@ $⇜P P@Ѝ[Q@0@ @@@-0SSL`///z[+z$00 Hp//M @-@ p000p0@0M00@-,M@P(  ߞ  +T j%p 0 00S p,Ѝ08i(p@-MP@ Ở ` ⶞   (P@%PЍp:iC-PQSM M 3 #  qT0S2"`V2"@p@"቞0B01801T0t0H0 0C@L0@T0H 0H0L00L0@ P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0T@L0 0$L0<120@ 2T@D@@@0@L0 X:  @L0  ƙXH@L0  @L0  XP ᮙUPEPPP@ D$("("p`Sލ Ѝ  ⒙XH@u[+zduu C-0M`p" 0 0```$`zp@Ѝ P@ -PP 0 ``fp@ @@&00 ( P|`Pl1 (=ᏔV 0@ T*00Yʝ00/ @T@[@-DM`@ pP@  m  ṕ !> U 134  4R2$ @0 |DЍ0Ui@i'0@-QM@ P BPp 202 "f#Ѝ0@-]MMp#P("p@ P@P -R i00@]ލЍ0S0S Sz SS wR@T HqpH@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0徜 H !>50H \0E#pY0S 01S XXC0S0 0 0 00 00 p/wPq>S Se  f@gPat@PU a jNPK 0H HO@#Tw?0SG HM P N0l<00S6i@[z@- 00 000 0 Ѝ\2S/2S00/@-@@xV002S00/@-@@iV0002S  c/\A-@MP`p @@@M-@P= P p  "p X0S p f.@! - l"p x e"p 6/PL Z"p +P Ѝ@zqB@zlBpBfB@0G-0 M@p`0PU   0S1P   GP弑 0 0S V1!o0 P000/P0 PPP0PU:000000x  Ѝ@-  ! ЍgB0p@-M2S@P`x (VP@0  `(!ꈛ00ލp@  \B@-P`2$MS0@p0  0*00Ö%T0PЍ 0p`$Ѝ@-@  -@-@-@pp !p`~B 0`( "4`#/p@-@^P T"00p``0@D^"000œ\p@Tp0,R0@-0 \!Q0 # R 0@0O-QRM@@0ܚ@00Ѝ1`Q КV00P,p0 Q :@QpSI B\> \ lP lP U  Z4\[X\T p Q*S0C0 +P 0 0r  0@ S2Tp0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S ᫕Ѝ@-@ 000UP 0S ▕ Ѝ@-@\0S \0\0@-@`q0 `0`00@-8@T@[0p@-80P@$ >Q! &TX01 RpR 0S TT0Q  >0S (p@ ;0804lTzA-p`KP*P@00<000S@ (0? @0K0cScO-0GMⴀĐ@pmp0 00KC*`PPS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0* є WW00 RS00T+ $0K0`C80$`P0 DQW Wd\ h P FZ <(/$ ☔ 8 FQ @p$Q DQW R <0S @FT60 <0 w @W 0FS80 0 |j@WWW 00S 0 84S 0 FS+008$A 8P840@W]0  0FS20 0 =@8 RN  FR3   ) 0FS 70 @000", Q2`6,0d&Rj I0Slp0 ?0S<  FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS9000 C8#< @73S Y 0 FSM007# {730@(1S 0 F0S=00(  i(100@ 0S W02S 0 FS<0 0" P20@W00@1 0 Z00 FR P0@ Q2Sa P 0 FSQ0[02 0 0000[00  W 0  ^0 0FSst00pp95SG 0 FSg^009% 9E@@6S _pp0FSS|00xK ے|6S @000DKP8:Gߍ0P 0"9 0F R-0   Ṓ @  0FR000S0 z)   垒0 00p000, {cSc253{%{79N{g{A-PR1!@ `u0P p@ R1 0R000 N 30 00 P0 0:000 P00;000 P006000P00ЍP 0000t |00 0gp00 0[p0 000{\{{@-0`0i0 MS$MPp 1 !p Dp@0S i `*i@ 0 P` @QQ0500 0pPQ&P4 ⽑ ۍ$Ѝ{%${\{p@-`\@T  PP\B0S \0\08  p88 $ 0p,y\% |\x@- 00806PP@ `V@ @T %@P  n00ЍpO-IMPpHLPL `PR <%0@P9IߍO(0,0(600 0|400 0 P` `p00,0S2 V30a2@0 0!,0 |T:`0 P :@@PIߍ@:0 P xVT` \`00T:D0 ` e:P|\!@|-|@|O-P`@pQR帰,P`,2,ES#PU`,@ ,m&P f&, Q 0S,  Y& `,P0]M|U|RO-600" `pP@T:]p ЍT  X ⢱00U *"0 Gp0R0  i @>:0  &p  [1: @ &p*u.@-RM M00`@PBT Tp@ Ք00 0!p"  hp ۍ Ѝ D 9 \&p UPU p@- 80SQ S   000 PЍ 0S 0# 0O-S-,M@ h@@ p00_0 P? 0o0 00 0z`P3;0T0 @0P000 0g`P 0   X^pP  $➏X U$8R `P@00 y0>`P3 00S0@ 0M Y000⣱   Q* "00"P 000S0 0 [0 i `  $Q$0 `S  S S0t0 0s  $8 eP@ 0S0h0 0h0  030,Ѝ00 !0`PR @ MYL  $$0`S P@$0S  S StPP4 1S 2S0 0h0?p  $8 P@0]|%a|O-MP`0@0400`p 0 ##p#X; X8l0S,0S0㌒,0嚘 2S08`,0嚘 8d6S0t,0嚘 x"R0,80,0H00`2 S,0d6S @8h 0pߍ00 0 $p $  0p 00 0 (p $08 0xp $ 8 0lp$(7p 0_p#0z0D,04l0u040 Mpl#0k@0"04,0c40 ;p]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 0⾍0&0P ,  B, 0 0 !P ! SP ,0 0L00 0 ,||||||@|yp@-PUp@0L0pp@- MP#%p@ 0` 0 0 `p@ Ѝp 0 `p ` 0)`p  0U 0;100pG-`@p 0崀SP$H` $000 0 0000 ``0 0 `  $6 q 0t000h4H0@1v XHЍG<0 $6 0004@0S4H000s$80406 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!600 ,m*S:G{k{'{*z8 S zkg{{'{* z~$n600 `H0S0SZ h W 0R<0S 0ST2P2H000s8040 P424 P 28 P 20 804 00@0S0i  000. gp 4Ġh` 0HN0  P0dh0Ѝ0S4141 PD1 @18   00S  0R`V dp`ЍGH0x ЍG??}'}Ew.}K}R}Z}u}~}}2~pF~t~~9~@~_]`A-P@T R0A A0p8` l0 R 0i0pP 0S <0S $5  y? 50 ` `m" ``i"000 00`800`0 Hp  W"00 0$008 % d0h0~O-Rp@\MP`@P; 800 #3P 0 RT0 00 2p` h@@L p 0  0 0@P|D ""X P 0\ЍL0S0 0@S@0L0L }bI00P 800 "2P 0 Rztgjzzz{T0d0S  $ P $[ <Y- y 20; 1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H0pt wu h᳊&h0 0<108#<48#8 10 ```P( `(1" (> *>Q  0*⹸   ЍGl  ЍG80  0S 0 0h ß Q 040 PH000s  i`Pqp 00 P R  \ v0 00$0C40 040800 8ꬂ0S06 PU R ` h L0&0 1P DЍGAp0 G|0 $A1  40Sm 0Sj 0Sk$11  $0  d0S  0R/.0/_O-M000PS㴐 @pT0`S 0 iЍ> R*hRP 0S D6S<ƚ Hƚ [  S50  @!  Q 0 S:500 0yp00 0  0 S 0 0Cs||00S\0 S0L040 !p 0 3 0 0 0@P0 [0S?60@ 600 0:p0 0t  ``P L 0 S\ 0@1i6@P "P0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40S>L0 0 PP  ucl00 0P0SS0$KSK?30500 [ i0 H4 @SS  00Cs00Cs 0 > $P 0 0 0S  0 h3 @0 R@ $  D 0 0S:0<0@ 0=0: P0 P3 000 000 0[P00S* uP )  p @ 0RZ600 0<P0 ^0S * LP ;  p崄@1 000 0 0000H 0 ?\ 0000D!0S 0   0S S0 rS 0 B0Sq0 00 P0Pc0 8[ 4.  h=tс| D_Ul‚]EwtςRA-P@` . 0hA*`0R. 0D0BSpb n0 A$>O-`pw 0䜠1P@T ЍT 0S R T0 S> R* OP  0 O@mC-,Mp@PP P0 ,ЍCPE 'mUZ`0@SV 0SS "448#8UL:`aVH0UE: ⮃1#ĠČ Ƞ,Ƞ\9 U6:1 S31C S0 0 $0 0  00,P   ∃aV Q Q% ! V I-  Lh,Ѝ "448#8 C!B0]@- M`p\@M0P000 p 0S LL . ۍЍ0 S`V \@T$]p@- P@ Pp@80S0p@\0Sp0p@]@-M4M0pP ;@p` @ `0V0<000C$00(00$0CU,00000`$0@` 4`8p02 p ݍ4Ѝ]p@-P@ST  (@1S pRq & 02p 0202p0S 0Sp 7@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}Zz  P<gjzz+S$0@  Ѝ0zD̃(p@-@P0 0Uph0Spp@x(O-`@PU Q Pd0S  0 40 d0Q{ ЍP0.Q 0S 0P +  08p|0 ?봐8 R0, 00C0 0080<0  P`00 00 0S $0 pW ! 03 0 0 R0H0@S^ 00ppW\0H0H   p威00_'}$ `8 #$`4" S /0 @Rp@--00pPQ0`PE `@Ӆ@d @DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cSc1O-`@ \MT. 0S pW$   { t|PP@0Sh0S d0S4$ {d0 0S BPP\Ѝ|0d 0|00 0 05d0  0 0/090 7|P }p8PP Q 0|0} |PP$0 00 PP 0  0 d8dXW {PPk  ||0d 0|0Xx`{U 0S qP 8plP   L U`  P < $R R0 0#  Q  {P h % <  dpP> t0<0t0|00w8sdQYx Xi x{P { U g{P {ĠZ 0$8 0  h % < =  [<}P]*p@- P =p`01S 0S 0S 0S  ;0 @T 0Q0 PSP 0U d0S0h0d0p@ ]0d\/08 /   0S/ p@-@T PP@0p]G-Pp`P@Ѝ0H @P00 4m@P 00000P00 000( ,0 $0  00 0(0  rpP0S t00@ |6P  0@R 0 0000@@^*uC(Gs@-@T`Ѝp`PV08,*:SR h0S LH~$` P (0R ,0R   `P G800000( ,0AP܂0S 0 h dd0S  $0R 0h0d`Z0SH3Yz0S/0S/   O-MPRD08<`@H0!R00ЍpP P0 U@ UP R R R0 2P!4b@PЍO    p @@0 0'  0 0S SY000000000Cs [@UЍOn^*u0S/C-P@$M T 0p `! o00 0@0 0 @d@$ЍP/@-@TP@<0S   05p@-@PPP ,p9}P 00p0000S0p@00:S 0S @\S000@:S @8,@%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/`% @-@A0S :^|^  ^ R S \0L:\\ |\ O-`-CMMd4!SP  I SLEpWH `0P0B@ @PO 00p@@*; 0400S 00,0:= ypP 0 R0 :R00Hd4 0000pPP u0S  OCލЍ P ; 000P;PV%00 0x0PpP@0S!+ 0P R $0$0SG @܀@P `P000 P00 SWB @DpW:SZ @\Sp S Spp0 0T:C @D P 0SS oPp0@ 00`Z@ S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[ @D$0 pG HP  0S 0 @p P D$0d$0 d0n @E 0S  D0A0 0T*P 0P:SZv8,`%#@-0  0 Ѝ@-(@ P K;0 08,C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ t0Pv Ps @ ; Q0P ލЍ s0P P 0@P:0 PP U PcP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0S@Z\R    B{:R|R  8,@%@-@DЍ@MG-p= @P@ d0Pv? 00@^S0S:S^ `00A\S`0S:SQ 0C^ @ 00LT1 0L\TS`ASBC\ t|bC ^0 0 0 0 R@AdCPPd @0:SS0AR0@A (P Pd : A-p= `P@ dP`FPd0~ 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P PP,'G-Q0S`pʯ PV00c `a  mP00CS09 Pp0 0 S  W00S@( 1{P   , P P00SW  X\00S 0 σ47,P R   S@T P R  ` ЍR P,/x,X,@0@-0S tP [PP,x,@-@RP08GP,p@-P@PPp8PpP,@-<P  J(087S@TЍP,x,p@-SP@ P@p p@-P  #(087S@TЍP,x,O-pWP`ө@P @ Ѝ0S K P 0bz0PT  RT1@ S //////@-04@0P {P萆,'O-@\M08S DbDPp < PU00 P~  kP00CS0x8 Pp0 0 S0 |W00S yPP \P 00S0WSXP DP 00S P P P P P P$z :akPuPЍ萆,/<X0@-0S H@ ;000D@SP0DЍ8Pꐆ,Ȇ,@-@`0P0`Sp 08P P ЍPꐆ,@-@P08D萆,p@-P@PPpv7Pp萆,A-P @`pP 0 0084SPUP@Ѝ萆,@- 0 00B;P ЍȆ,A-P @`pP 0 0084SPUP@Ѝ萆,@- 0 00B;P ЍȆ,@    /A-0@@`P@0 =&p00D0& SQ+O-@P DHxpDpG``b0Y:0z  Z # 0@@ D.x 0DA\0:Z: [=0 S: p` Ѝ `p̊,A-@`Ppv v v vA 0p@-Q@T 0 d `on2 0$pAT d Pon $ !0p0Rp@-0TM00`p<` @PVp0TЍTT0 ,p{@ R,0@%$0$ 4/00S d%̊,A-@P 0s P0p`ppGWp0P ```pT  @@P ̊,p@-?04@tH R|Y*y 00$0S  ğ0 R 0  80>H@`@C3^A40LC32 h  02l 3 p  ! dC2 ttt 00C0'0DS 0 000PxPP| ,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *  0  0"0 0U`Ph0U*P* 0`0?o 0c  `o `S @P U 1d*i88 U$P030#P0S d 200301S%U#2Q FZ*0U00S  Em@P 00P@P0 0#  0|0S0S ; p,ll0<0 0 p@  Z@P! 0  L%U#2Q JZ*0U00S  EmT LP )@T @0@<0< 4/ရ@Pm 006̊,҇d%D,%Ŗ@-@H0'0S 0 00 0T Ѝ@Ѝ̊,҇g////t%/t%00/@%00/@%00 /@%00/@%00/@%00/@%00/@%00 /@%00 /@%00@/@%00/@%00 /@%Q P00Q////////0P/ R//A-`pP@0 P @U*0Q R* /0/ȵ%b00 0CS0 S P0 /p@-P0`@iPp@ Tp 0A S00// 0P/!R/P/P/0000Q/  /@%P/000 /@%P/ 0S S//@-!@g00/<%00/8%7@-@PD@P 80R,PPxl; 0  Ѝ0%.p%PQ 0S///ᬞ% 03P/%?f0 AC\ 0AB0\ CSo \S / //00S00/ 4%600S00/i L%K///@-@HDP l(  B@|\p%Y-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A k00ЍQ@P k@0p@-P@ `0S  \*. Q  R R  ,  p 0 B##@%X,qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00xl Ѝ0S/1>3 !/0S 000/X,0S/A-p0 @RP:``S * 6DP` A0 PQ0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-@0SP`(0aL T  $ T $ Q 01@pC !aO0`0A-ŝMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0TX,A-@`P0S<0R"0!31<0S0 0PPR0S! !x000S!!!,p (B0P A, (0 ,Pȵ%<%8%A-`0 R*S\ ]\ tpPB@T Um vaPdPp̞% @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00X,< 08 C800/`Q'Q!//@%A-PRp 0@S` * TBP 0!kd PPA-@P`p0 SV1 V00W W0StBBBBxDxDxDxDxDDCDxDxDxDxDxDxDDD`DP 0 B  0  B  B " A A`0 F  B  B " Az  kpG`P  B0  BZ`FpGP|S`FPvA\p@-P4`@e@P@p Tp Q 00// ,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0P`ȵ%<%8%O-@P 0RM _ P&  _ P 000Ѝ 0@  AP ЍO 0P  S @ g 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 00000 60S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@  gUg 00C0b-Q [QR:Q =Q 0Sp: Q 0R00`S00`00-S]S0`S00`t4 R*000pBW R:0`S00`0 S<*R9 :R6 ]R300@  Pb0 ppBuP 0SK<0[$  @P    qP p$0  0$ 峠0S00``0R00`S00`00-S]S0`S00`=  R:0`S00`0 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 00`0S<0W00Z0S Z40 ?P   pxbGx400!0pᲠ40 P0`S 00` (B(  P   P: [i 0]S~! R, V08C8 0  EB#ЍOahȵ%X,@% 0p@-@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@@%<%8%A-@ `00P\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0 D #OU &)2U  0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050SP<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`X,)>{@%A-@0`pp?Q $0A  R SWUUUQ x3PP jT &UO F^{S0 SPp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000X,@%0S G-`Mဠ PQPE ^PL@P 6U: ppP PP $ @pxpSb0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ]0A 0;P  H00Xo p0 P>3S, 9S $S S <0RQ00 p< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:_00P  B08B0U0 RB@ Q U B!U  E1U, ^0C \!1L0XRU!U! 0>Q% Q% QS 00 080Se 0S  00@0000 0H  @  0S .<Ѝ0R 10C/TUU|TX,$O::Ee,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0_P`ȵ%<%8%0p@-P0@SQʡ@QD8@ p<0S P pP0@H0DH@P(00Ppp@ȵ%<%8%O-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T 2P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  u&P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'@%O-PQ ,@`p+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. `F`FPV0@0>N>0> ^0C|0>@01>3 St 0O-4M\00(0000 001@X( 0 : 0R00 0 Sd 0 S0^ PZ \00$0000 S0000``P00S  U E0F V pR p#08C800_U0S\ v D#00000_V0Spu\ 308C80000_U0SN wpK vI 0_V0S\p?Pu0 0p$ V 00 upv00w(0ppu0 v0X 0 p,X,w u08#8S0 p,,d1u v? 0008C80000_U0_V^00 0,^,000_V0;0  R" ( ZP $00 0`,@0,Pv00_PU0PSPU R S 0 04Ѝ@%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0X7  IS~ S F S 0>#0DϠ2@ 0p800 0gX I0  0]P 0 p @0P  0K 0TPPP@ pP@07800 0p.X G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  !P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'@%O-4@08pP#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0N0P BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ > E    R P RpG pGPp   >  e  ># !>c V  >  !># RHO--,M , l0*4 0*0 (0* @ X   0 h  R0   T0 Rc  R ] PZ   R    ``R   0m 0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p]X0w u ("(Rh pK0!u vS  (B(   _U _VP  h *0  0_Vh P R  R5   0$ 0PZ& 0$  S0 S 0 Sh `P0: 0v  _PU PRPU0S 000S00,Ѝ@%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , l0*4 0*0 (0* @ V   0 h  R0   wR0 Rc  R ] PZ   R    ``R   0M0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p=X0w u ("(Rh p+0!u vS  (B(   _U _VP  h  0  0_Vh P R  R5   0$ ~0PZ& 0$  Q0 S 0 yQh `P0: 0v  _PU PRPU0S 000S00,Ѝ@%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#   P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'@%O--lM $PQ0Z @$QU ``R     Q 0R S h  Z5,Q 4 Rz 800Sv Pm 00D0 ,pp3P 0S 8 D0I0C0? 00S,0 "@0 S40%0 (1(01 SP HP 00000D0 ,H0SPH`Sh  Z,Q~ 4 Ry 80 0Su P 00 0/ / 00 0 0 0/////0P  P@- / d,P P/ /O-$MPpWL0H0_ `d@P1!$/@ @ T0030#`W00SP 0@Z0* 9# 0  0  ?Wp  p $Ѝ 0?d 0? 0?@pP;X p ` 00 P@ $Ѝ `d@PꙙT\(\@-PQM(p,`@ U00 V Sp0`sЍpw`Sp 0E`e-00Ѝ r00 r0p`VO-0M@hw0h[ PA  8YAZKW  8 8X%  8 8V<  8 8 h 8X 8ЍVY PZ, P 8 8Z  8 8Ѝ P 8[  8W PX PV P PЍOntDd`HO-@Q00R0M00嬄嬤 04`0P p 0֫P R nR a BRrMT1   oRl JPM Ѝ  JPY U000T000 JP[Y U070T070P JPY U000T000 JPYU000T000 JPYT000U000{ uJPYN U080T080j r@ `JPY9  WJP  QJP  KJP_YK U080T080@ ;JPp  5JP  /JPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l IP T IP l4$x<,XttC-0@dMPH`@>SHP@@@@ P$P(P,PPP PPP9"`!@p03 @0 *p@& 0 t=p@ ^=p@  p@`tL  0P]=mLPkL 0PdLPdЍ_L00|ŸO-1MM   @`D00H "( p C.$ PpW @D;8 (@0Sq ءرp pQ00P$ %0!pt0p@ !0Q 6 0S3P 0S RL@001ݍЍK0S PEPU R Pp 08D<4! @ P0 00 R 0$0h,R X@1ݍЍhL1ݍЍ,FtH(gt0@-M0P  Lp@ .p@ P 0 0iЍ0d l Ѝ0A-@@`v/ PP0P  0Npp pp`E00prK`:Vp hK``pp.0`0p[K 00p@-@PCM2 /,:P4 4p@$ ` P@K00 u5 :{C>P F0 @4EP@ F{>0S@ VS 00 SCލp@@0S@l0l 0P@0  P@1: K?0@0@K0@0@$,p@-MQMP4@SY TD /9PA QP0s* GP)QaP` 0pP @ 0@BqpG H =p@ ۍЍp(0si/l10p" +BX@0 P@0 R P@1:J?0@0p04@J0#S0p@ J00~J@PzJP0<%@l`h@-qP`O-$(Y,PSp@`3U-00ï  07;X0 0 0/; 0R0*00V&(0 `#{`0q0 "4x " 0xkP@r`Up@-@M@ GP, 0`0#L` QC:/P FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-@4460 `$M00@=+@ I\b-0@?o2S00/ 0P 00d 0u QS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@\?o2  y 4YP$Ѝ0 0s 0 P$Ѝ0@Pb (P bP (P0 )P0CS 00}P Pp\ 0 41000.P0S0 0S #  00000S 3R2 x 0S' lRe d#S[ jDPU PL @s@pAP Q X %FP  Q000S rp!~Q FP  jtEP4 ``cQ EP0.S000S00F R ࡟  Q EP  /-C@ 0sS9 ||sEP Q 0S 0`0 4a4`nEP) Q .S0 0SQ0 EP` QA zEPv Qs0 0  (N  @ama.m.pmp.m.D%P$L$`# T#|#\PA-@PU 0U0PUP!A`FFqP ``zP 0!Eq1pP 02P''O--MDDp  (0,4(00p 00: H0T ㋟L0X 300@0 SE  !o0CVX f‚!   3Sf,"!]ZY ~"!{81*#bYI@21&%#tQ <200,1SD(" 0=S 00S1X"R 8 [9T  1@01S  OX< A {{P XPL0QEaC 0 ?L`XP0L0000X0"t T 04!0SSQL HX a PA&*021,1S\ U1X2Q SP0\XL Sp |0L0X P LX1/ @KTIЍH8(p0qtl'.%""""8 Q !X"RL P0R:p} L t[0 1LX Xp SK@QV,1P  PV  0P0V:pQ L`XP1 L 0 1X  @PVH@(00(0000,00,02XP0,^0# <P0  0=R%0@Dh0$0SXP"ExXP A PPH@[XP H@RS@ XP000 Q0S{8< {XP 000 Q0S{8< { &XP(0$S 000<\  =RHNQL0X \ 0@0DhXP0S <\  NRH LX\ 0C00000S ^  0@D h0$0XP0$0 0XP0 0$0S}XP"x(0XP0(0,00,0x(00(0sXP 000(0mXPP0L dS`0d 0 `0d E0E E0E00#OXPQ0? 0LS0$%3@Dh=X0\ 8#PF p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#XP(0S   R $ R`d D& R  000d 0x@ #d 0r@d 0o@ %&0i@XP 0dR  X \    Q&PT8<XP0 SE P\0sE `0d XP E !XP 0 E!XP  \0000 Q00SPT8< XP000 Q0Sv{8< {{XP  0 Q0i*0^b*{ r0s{P T80<_XP 0 !X0S(0SH XP90 Q00=:c 0 ?0" R  #Ό " d 0?  \00 40*XP0E0$XP00XP00XP9 0 Q00:($^0<P0$ 0=R%0$h00@DHL0c 0 n?0" R  #Ό " d 0^?  \0 4XP:0 Q00:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%XP h$ 0$% 0S 0000000XP00$0S{"xXP}XP0(0y0XP(0u$QhXP0 S P^ " \01"?!x"0X$0XP2p rp t t NXP  0 R< P9#R4 & E%9H R*  \Q%8< &"# &0(0 0dX D D00@$0 h00% 0A0\0@Dh0 00 0 C00 00S ^0  $0h0 0$$% 0%#P " R01"?! r0rd 0 P>d 0 J>$O-P-Mp)Ck`0 0$C0U0 W 0 2c1  删?0 0\@P/ 0v> 0`0?d000P0?T0 0804 ?+0<000000000000 000P :0\0P@ 0TP 2 dP 0 P{0Sxʴ Ruʠ RrʨQo001 0Sd `0?#0S/" ES}> `00d 0B@P0D E   P`d`F0p0t0Q RPx0|000H00`0X00\080` 0  vN@h 0)Q @D P \P40dPl`p@8 SW0 S S0|0\p0Tl0Vh0 Rd0U`0 R\0 Ry{  RRzP8 @0>C 0C0p0tR@ix0S 1BpPt`0(00(, \0 :RPJ p'?0! P ό 01l"?! R1 R?U0v Po 0=87v~@ pG0/ QPpp 0 =0hRl Qh A 0  qp`P  0qpA0S [R@Q @T A 00 ߍ0A\ 0qpK "'pR01'?q 0S?P; RTP\0 P0,P0  PpFZP S 00@ ~A0\ 0`uA0S0000 W\ ZR0``o d`Ϲ PT\ǹ 8<\⿹ @D\ⷹ HL\⯹0pX\0k 2A0SQ WA37#p3gS:3ß0#cP3: 1PN~0E@P  ሠdSdh0 `ZP 6pz0pw@ P\`@(@(,!P ? /& Rß%0Q0wt W0; 0" Q0P"0V#0,l`V10& Q#Ό3à\!=30S ( 9L^: 0( 0qp3 PPv@#00@0SK B0\|0" R60"c01 2c1[ß sR m@T00j@0S"0b@0 R 1&`P 2&>`\3à\&=3I@0 0 0;@T00a7@T00D3lP)\(\ ףvɻ @-@vT ipTat X00 R 0 R 0Q/  /    DQ p@-0l` SPPH 0@#  T\  Q p/xXHH  Q j.0 0#  Q/ܺ00Ɠ\ 0@-o>tP 0@" \ 0 0 /ᄺA-@P `p@P@0% (P PPA-`X@@P pjNP@0& P PP|A-`X@@DP pH@P@0& P PPO-P M `P8 P npP P @ @ % P P0Sp K Ѝy T p V P:  #0p`0pSꈸA-PpQ `@Q P 0@DDB(000S   @- Mp``PP( >  600S@ >0"S" 0`000S0 6/ Ѝ>0"S1Ds\0`T000S @ Ѝ1Ds$  !LT,@-@ @O- MpPW  pp2S^`PL P@C hPp G ,P P6 0nS# p= /-@P00Q Q P ^  \0 HB" 0A 0@00oSp\000S \Z` Ѝ, ! OM`XO-@-AM Mp>` 00LP:,PP , {LPp0:  990P: CP@@0K PP 0K' 0p  00P: 0 *PP;'p p $@P# \\ 0dQ `k`V`~ pP  r{ v( :P @PP 0 PbpR bWQ mP  =00P/U` P -pBr=0SU  p5PAލ Ѝ e50H00 PP&p@  'PM= Z000I5t!: 009=P 00065P`+=0  ! R0: != ZZ000 5|= Z0005qPo<d HZ0004czd@T4@- M 0  >&PЍ- M> 0  *&PЍ- M? 0  &PЍ8-0M  0>PЍ--( 0P    0/ 00긵p@-P~4U@ps<,0,0? `0  6/pX4p@-P&U@p[<,0,0? `0  6/p@-@P 0003/ꤴ@-@P 0003/dp@-PU?o20S@ 0 00 3/ptA-P`UV00P00S@$0$0p0 7/褳 p@-PQU?o20S@ 0 00 3/pHp@-`P5@Pp;( ( 0 @p@/p@-P@P p 0 00 3/p訲-@-M  hp@(0(003/Ѝ@ Ѝ/LH@-mhp@0003/O-$Mؤ @00`P /0Sp$Ѝz;<0` (P@6/$ЍtxO-$Mؤ @00`P 50Sp$ЍO;<0` (P@6/$ЍȰ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////Tx( h@(p\H8O-`-0:p0*S0pG0 00PZ0G"` 0 `00USXU Y p<0@0`0 p P(V ` BPE @@R> 3P 4U * 00 0 00*G0PPU  <32 7[`; YI Ii XR3"^P<^P `0U 4@ YEX; Q8V ` BPE @R> 3P 4U *00000 00*G0[P % <Y ` `0<S Z>0304p 0R 00<ЍPU 4@ Y,PU `14 `! Y@@ Yh;0:+\;0:'Y , 0<p0A FQ P  0 $0( 0p0)Q!*AQ S P @0S Q0| FQbQ0 30 `2 @10 0[0 X 3 "R Y 0HPE000$@ @S>03P04U *0000 0*G 0( PPU`<03`2070SE , P=S @ZA 0 `( *Q)P 0 BPE0$@`S>03P04U *0000 0*G0VP 0PU 14!`Z [PU *`0Z```0fQi 2  , L , `[,4 l:0 @220 , [  X 3 "R0 L Y @HPE   $@R> 3P 4U * 00 0 00*G -0(PPU`< 3`2 7 R FS 000S,0000G0 P PU0`00 ``<0( 0:4P<PQ$$ U 4FSY00@,000S0 P<R00S$00$0 00U 0 4 @ZK  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0XP `PU 14!Z [PU 4<0(0@Z7  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0iXP `>PU 14!Z [PU 4[1 0S.Y 00HPE000$@S>03P04U *0000 0*G 03 (0RP`PU*=00 <0(0PU=0304,0000*G0P40PU`0 X00S3 0X*:Y 00HPE000$@S>03P04U *0000 0*G 0 (0RP`PUZ*#00,0 0PU#0304000,00[) 0S&Y 0HPE000$S>03P04U *0000 0*G 0 (0RP`PU*=00PU0#0%=03040305,00 ` (<00i,00|,00x -M{00{*Ѝp@-MP`@0 0Q 4/ЍpG-PRM^  `UpP*a@/s%P T1< 000pp Ѝ80S 1 00< 0 ppq60S ЍĠ g60S 0 < @0< 000@ ppL60SG6 0 A6 0 Į$Os(@- @MЍpO-EM MqX@`+pF. K0PP@+T! 0 K@0PT 0 0FA` m  i V0Eލ Ѝ5 0 Eލ Ѝ5 0 L`@-`@M pP-P+ /HK RP  rR' rR  P   0@ P@gЍ0rS\ 0 @ZЍ0 Ѝ@t5 0 \KA-`@ :p@ 0P/S /JP @0 Sp  0 S1 0@p@-IMM@`PP qp 0: S p0 0sp IލЍpH5@O00IލЍp@IލЍp;50@0Īp@-IMM@`PP @p 0: S p0 0Bp IލЍp5@O00IލЍp@IލЍp 50@0n- M 0  fPЍ80Q 0 080/p@-@PP` 9 aPP u J%P  p@)PPp-40- M,0   ЍЍ/@--M  Ѝ Ѝ/ -- M9M<P 00  0 ЍЍ/<@0-@- M@EMP  Ѝ@Ѝ/O-`,M @RPP00:A!0@00Ppp @PPX P@ 0 @XP LQ!,ЍxP@-0M@ %0Ѝ0 0 d@p@-@`PLpp p@808 0@-0M @%0Ѝ@p@-MT  H P 00@`Lp  Ѝp@oЍp@0@-4M@PLp [%@ \4Ѝ0\p@-@T0 00M`P Lp B% C0Ѝp@C-PpPEUP,M` 0R@@t0 0:2 0U P@ 0 @T IL ,ЍdP@-0M@ $0Ѝ0 0 @p@-@`P%Lpp p@808 0@-0M @$0Ѝ<@p@-MT  H P 00@`Kp  Ѝp@|Ѝp@0@-4M@PKp $@ i4Ѝ0\p@-@T0 00M`P Kp $ P0Ѝp<@ Q 80 p8@-80@08 880/880 00<P 80880 t/p@-@0@00S 000 X[ t PP `00EA.L00p@f&P,:0$$  @O-M@P SD `\H30 0p@ P P00U pp00C lY 2ATT00  RG LD@D T]:[ 2 00p0`K &K0 V0 W8 P2ATT 0`Fs 0RB  K  0\ 0 BV0SH J@0Ѝ V0& 0@ J 0 60pHXB0SG 0) Jv B 0  B 0@  0 B  BJ`FtZ  B 0  BJ 0 v 0 m 0 0S J00< 0 0 @p@-@PwJpp p@0RS00 /D0D0p@- P@ [Jpp p@`@808 0 QR00 / @p@-`@P;JpT T   p@php@-P X @ 00`JpTT  p@pd@1!0O- M  D`R, H1?0Pd 000PV1!p !q1 W0C@8t0 , @@KD Œ Č Ȍ A`|0@p4  W0S 0 ? ^ \\ Wt ,0 000IC1100Q0, 0è Ѝ0 0 00{@404 0@-00 @?P80@080@-@?P80@080-M0 Ѝ-M0 ЍO-@?iM0Qȡ̑qaP 0 Pz? `K͌U PnP? K͌T Pb ? F͌(Z PU> F͌(Y PH|> C͌ 1S P:0> JB͌8W uP-= ̌V cP = ^B͌`p=@ 0S708T H0P, `P P P P P P(` P< P@ (P PD (PP PH PxP'( tQ780L0x100CS400 00C,0000h000P000a/ ,00P@`U 0e1P U.q010 `00V0q0 `V, 0U @ `dp少Wl` 0 V `Piߍ`0 1 S ,0 0 0 !1S 0D 0| 0{>p00Y,0P,0 @$000< 8P!P H, $  B@  0S% 00P00C1 0@S3 00Q !1 p WQ  pW,000 p0S,000P$0U1p 0 W 㟾pP~80Ss004 0R0031800P0X000<0P0$001P0, 0P000B0T0P00000P0X00Y,0 0CR0@,00`0QQT d!@YP p00 0W0 pW0T,00` pp少W䀍 0 [ +P 0080SG  !< !^ v : !' !_ !| !o !* !! !Qf ! R |1 R 0S8 ЍQ <0 0 &Dh0  T ЍHHHD0h0  S/GO-`D判@ M[p +(p($ W㻺0CS0S(౺3㽺ºP*30H @08p|尰tl8 `%TPLH(D@P<8x40,($ sß弁q03=ؒ@30`h3:|p R 0S1810S \ぁ ЍQ P2 0 AC(qpz@ <" ^v#x:'# # H# p--`_|opryz{@|h}PIl6tH%F+!,!-!.%0%`&i%j%k %l%m<%nq#s%t$%u4%v,%w%x#p#rd"ye"o{|z#`"FDDEp@-_(@@k( @3!T(PpC ǟ 7O- Mp 7Jm&0 &0ᄲ ` SW[  p p PP  pTPIS  Pr  aRR$TL&0 0 O 0 ; 0; $QPBPq 0 ;0 ,pt 0S 4   0 s 00bR44 $R % x5 P0Ѝ p PP' 4P 40 s 00bR % 4 00$$ !P0S 40s 00lR Ĕ4 S4  40400T0SW0yS ypP 0@    $ `004S 4 0 q 4Q0PQ40@ Q  0r0  cR0$0W0< SS+ p: CpP 0@  N  $R `004S 0040 s 00bR $4S4]00"P 0Ѝ0 ;0cp4S  200 ?cS  20|"0` py P20L"0` p 0 $ P 0 s 00bR 40 ;0 %p1 P- p 400s440040 s 00bR44Pt1 $0$ r0  aRCo $<100 p 0140 s 00bR400z 000 ?c0`000`00000e00`00S(  t0t0! 0UĽdW`WLWVUtUTAdTXSQQtQPP h80p@-P@ 0 P# T TTp PO-`T4P8 0$QDM@h v :Q{#R3Z 300S 8 0a0P @P`@-@P% HP PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  Q0RRRbbO-@0uSpM`d`Z|P DU0ɍ <r("( 00nI|"0R 3S(0$00 0tPK?T0 `TLP WX R 4$40T 4 |2`3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 7PR x3l2Z& L[# `P P g{0`ճ ӳV 0H5S4S 4S0?o28p2Y2t2 PV 2t22Wx2 P/ |2x2hЍ0 D $l h $ <% p 0$0(0fW uP 2l2Ym mPl2<l2Zk dPl2?;~0l2Y YP1x2Z QPx2?;~0x2T GPx278x2W  <P@1t2Z  4Pt2?;~0t2T  *Pt278t2|200S0X0  r("(bH|"R1S0/ 4S+]L%R(SZH0t28p2d40t28p2Y0a``,\0 00Щ0 0- $   Tt Xh h T  lp0tx"| S갩,C8 80 0P X0 0//O-\ M0`pP@T \2 !0S S0SXT Ѝ 0 C-\㠁r M Q Ѝ |Pl@P QR  *PK ,0 R "00 Ѝ 0 ЍPa t Pp P F Ⱀ帐 少帑 QLvJ<0<0 0@g;Y XXA-P@p(P @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@ٱ0@Sӱp@бG-lp@`S0 SV0S"Q0S 0SV1C-M0M`@@ZP0 , 0 @S@0@0 J~j  唐0p "†0|" QU  P* G YTۍЍ ಲㆮP>W>VX X0@- M 0^  @ 0  ЍP`0 Q0@-@L00S :T g/ 0 A-`0S :#CRPQ# # p:0:@P ##sC# B0:#!BQ##|T0T-0 M \ ʌ0  - Ѝ䠡8 80 0P T0 0//@p@-P|``p@0@ 0SP0P0:3S 8 80 0[0 :L#p,O-``3 0Xs0T*PL3B0 `p (VS p p PO p   r  `R  01Q @R R3 RV@ X d20\2#`lpv  @R `  R i \  lp P ` @q lRQ1  X6N @{? ` 0  S, (q 1lRQ    ?p  q`RBos000 ?c s 0`0`0 0 @  0 L99:9Q8h87 O6G-@P,S,3P`e 80$ RR a ʌ3S23pSzW " Rp *8' PQh100S 0   0P0Q 00  00 0z#0CW3Q  rP+p gPpTpir` `0 00 :\#3+Coꤜ$8,0 00$X@@-@Z5p@404 0@- @K5p@ @ ,0G-P1`AA0Y A p!ԱaW`F p孮W0 p R i i  T * @ T:V:p0D 00 H |0 +pq@V*00C  M 0 00ꜗ@@-@4p@404 0@- @4p@\@404 0@-0M @ 0Ѝ@X0X00@- P4M@ 4p s |4Ѝ0Ԗ@0@-4M@P4p a j4Ѝ0@-0M@U ^0Ѝ- M0  ЍP0P 0-M  ,0 0  Ѝȕ@t0t00@- @MP \4p , 0 00 0 0 PЍ0h@0@-M@PC4p , 0 00 0 0 PЍ0-0M 0,0 000  Ѝ000 00:3S Ⱙ/D0O-J3\p00P  M2wpa`P 0p lPD3nτ`3 p  "  _ͭ `hi bF?Yn 㴲 `00s  bMP` Ѝ,0 #$ 00 0 Ѝ̓|p@-D@D0@Ppp,0 $0h0i p@|p@-@0@P:#R|  l ^- # 0p P`p:p8pp@-@0@P :QthQp- p #P`pY :,8pp@-@0@P:#R| Ó \ "R-- ( p #P`p.:p耐8p@-0@DPSP @p (0008 <@%8 pp̏@L0L 0@-@0:#R#R"#0:x`0` 0@-@0:#R #R#""|}#0:0 0@-@ :QQ σ #p 7P :謎0 0@-@ :QQ σ #p P :0 0p@-@P :QQ |} Ãp #Ppc :fpd0 0@-@ :QQ σ #p P`: :Q訌p@-@0@P:#R   Pp @8 “%\8 --  p #P`p:pp8 :8@@-<@<0@00:3S 0 0 $@-8@80@00:3S00꼊$0 0@-@ :Q$Q' " ""“ "\`#p̌ƒ“ \`##ƒP` :Qpp@-@0@P :Q&Q)  "" "`#\“ `#l \pƒ  #P`pb :Qp舉pp@-@0@P :QQp “!h"L phƒ p@ #4 :ꘈpp@-@0@P :QQp “!h"L phƒ p@ #  :pp@-P@0@` :Q Q# hUh“l ƒƒp  #SP`p :QpDp@-@ MZaqQp* c0 |0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P`TD, 0 000:P/0 0 0@-00岱X0X 00:3S 0p @- P`/Є\0\ 00 :3S 0- p @-P`/h$0$ 000:#Ro/$0$ 000:#Rq/ȃ000 0  :#Ro30/ᔃ(0( 0 :#Rq30/T 0 0 0:/p@-@P0P`M00 0s Kp 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝpht@,A-MRBP0@Sw R `P 0Sb 1 P00p !1pN  0Q`31p0S0S  hx100S0S  \030p   03, p .H$ЍP Q  `*P 0 :# 0`x 000 00K0 0@00,ht@, @@@-,@@0S00@-$@@0S00@-MT@@ 0S Ѝ< 000 000 0Ѝl @-MX@@ 0SЍ 0 R0 0 0 0@-,MLBL2@PQ :3SX0 b3p ` 0Sha` 0SR1p0SC x0 00 B)1`00|PS 1 20 0Q 8H 20 0X20 0 :3,p 0 P`,Ѝ0`00|P   k0 R0 0 a0 000D  8 20 0`~L0 tp@-(MP@0 0@ @$@R8 0X`@ @$@ٙ<0`00:3S U ə(Ѝp { 0 000:3S/B8{X0X 00:3S 03p @-5P`/{D0D 0@-0 03, p AP`z@0@ 0@-0030p  P`Lzp@-@QP0P000 |P t0 1h000*1pxP 00 1(000*C"pyt00p@- P *C T |Ppd  10*p@xPp,  10*Cp@Dyt 0 p@-P@0:R P( P PpQ 0 10pht\ L0 r10p Qxt0 000:w0S,01/Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//\ , 0 B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@a!80-^\ , 0 B\ 0 ^O-J#d-0RdMbZSUd 3,p0CQB8 ?3 Q:SD0:pP8  0, 0p3S00 Pp #@  p, , ӥ3,  P 00 0  0 JdЍ|B 09dЍOU/O-*,M0`P2U 0!  @Tg `p$@ $冥T+:0pS`KP  0 PP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO:0@0S A0Q  B20RP 00C P0V 0 0 0C0I 0PS  P@0 C`PO-PQM 43P S-0S*U= 000  0@ 000@ Q k`@ p 8P @0JS 0TPЍDۻ P 4A " 2  -ЍP0Pm,P0  0 /x  D0D 0M R *P ЍЍ/TlH0H 0 M\  ʌP ЍЍ/l404 0  R *P /kH0H 0 M\  ʌP ЍЍ/dk404 0  R *P / k\0\-0 M 0@\ ʌP 0 Ѝ Ѝj0 0@-0@T J#0R4 |B0pQ $8@-P @H\j808 0  R *P a/iD D0 00SP:P4@//i000 000S :P /0iL0L 000S :P @-p @/h0 0A-0`V* Z3 S$P! #Rp@4S@pp3Tw A|B0tQ 7AF-h((0 -0 eg000 000S :P j/g00A-M `V$ p@0pp   PP 0pp@  0 *@5Ѝ@@gP  P d/p@-JP }3S P`4`30PV  03s$ S"0͠P |2 $R 0X0S P03 |20X #$03p03ppp(p@-jP 73S @P4PС30@Sp@ɡA-`P\ J3S%sW" P#@P03R4 R*W LAQ , W00p, #υ B\ bL  | WP3PSSpP4SPkpp3Upp@-@P X0P:|"C0T0XppG- Ѐ\-P@p  `gP LTL!VW R T VW  L000S3;0 R0 0bO- M0DZ =p`P@5P ( T9 ЍP&P T$   P 0 e0 W XP  RXd P P  Ѝ Ѝ0 G00 bh @-?C 0@   @ ,(   @@`PA-@PQP% pW# 0 0S0叠,占000 R   R   R  P xv4r`T `TX *P Q Sp QW02W<`p@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S LT00SpX@ |'(@ 8Q 0@0ppp@-@PTa`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pDp\T0T 0 R P@0?30Q @ $080///l[@(0( 0 Q /[@(0( 0 Q q/Z@X0X0A-`R p P@?`,GHZ@T0T 0 R X@0|78@08Q0@0/(Z@0 0 Y@0 0 (Y@0@-P0P0 M@T X0:|20T1S@0?;@0`@000080S@078@0u Ѝ0pY@P Q@0?30R @080///RY/R/p@-PS 4H `@?DppP X @0*|"7 8@08 R 0@0/P@/'0@-@PP MP X0:|20T1S@0?;@0;<000080S@078@0 Ѝ0W0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/W0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/LV@-M$@$@0 Ѝ@#0U@@-@M Ѝ@p0p 0p@-@ QP00R ^ p@ p@T@L0L0p@-@ P $pp p@LT@p@-P@$pp p@p@-P | @ 00`#ppT0 T ^ @ p@o@S@p@-`@P#ppT T  R @ p@P@Rp@-@P00S ^ p@y8 p@rO-`,0 0D000D0   0S` (@2D000h0S80@080, 0 R0X>$ 0(0QS, 0!0 8C8S^H 0 ,  @HDHT&,0Q0 (00SE0 R  (Q (,Ht h LT,,R(  4 ,!0 !8 <  , !  <$ 0pH D00H00|00gp( 0H SL01HP0< 8 ,    e, 8 Y Y  RR A P<08 0,00 1 1 01IY0Cڸ P0D00 L  ^/o" R 0YP@r00PPP 00P P p,0 0S0R0S0 \ ɟ`V0JZ 0Z k p 0  P A RyP0  P 0`p PV  Q  `$Q^D PX A0 S04 ( R(  4  R( Q4  *#r LQL 0  P0  \, ( (B ,P ,=P 0!!!QY@ڵ00S5 80q  b pX$ `V \R JZ @ 0 0@NN Œ Č Ȍ N LL\nɟ`V?;p80cT 0P TD0D0 R 0 R PP! YR *Y; $R   0E0 z0p  0E y D000P $ 6  \D000!R@ 9t <000V  0A B $ P=0X *1d"0pC5$  Z< ` 0PP8, ` TpP!Q@000 @0pI 111QU`q 00S4  <0pD P~ 0X *1d"0p<0V @ 40S pV0A0 0C0 R d1SCdЍ 1PVUPm 0 0 e#$ R 00S0 ?3xcQ@APL`@ 0?3T 1HX1QEP @?0D000L00@ 0@0 @  X X %{P7 0L N R @(080 { <00 $<2 0 p`dЍ80 00@ 0Cg00S1$ 0D000h0S(00S5<0 (0 I<00m< 0080@080^Q00C\0 Qʔ@t% -0$ 0, QNp! <,\&`@VP t  ܥ̥,HtdPt V@P P0@, ,p`Q`J @ <P,Up@WP  WP@ P0 @, A`,\,P T ,qDEq@DPP!@X   `  Y,00,0Q0 0, BCR4 R<0084 00C, 00S<,04 00@0@00,0 0400 00 S @`f` P 0, !Yp, 1@S  Y@pL bP0000 0S0000 00 0S 040C04 R00CQ8( 0 0, `FvK @A`j0, \ p(@0 <00  z 0PU`@0V0S 8Q004CQ0V0F0<00DPB  lPp <0P0pL V H3 D|p|4$  D0 00@Q. R+ dP(  % R d1S $ 5  DuPp:U U6p` 6`FV EPEE(0 @,,` 0E0OB0pu 0E B D000P DVP00:  ,0R<00Y,P 0A040 0 0C 0}ʴ& p 0&: 0:6080,@ 0 G40x 0pSW!P0S00Y0SH 0SLS)0 S+ 0PUa8 0a0 lFP@@D ,H6TH lF@ P0E0PE0PEQ!&00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0Wڭ@ 0S 0 PCD0U0 <000`p]P4/ pQ, S4S Y4SQV H5S4X  H9$@ 0 cD 00p0 V00P9  o0D 0 B00 c0P P90 0pV0 P-%PO p0SL 4S 4S Y00Q0S8 L5S;  f:$ @ /0 D0 00p"0 D000P D 0D 0 B008  00Q@00 0D000P  T P" $ <@ 0   D000P X<$  0 q R! U <$ @D0 001S U <$ D@0 0PL5S 0 0RU D=$ @D0 00LUDq 0 0L}PhoSPk4SP 00 0FD000$ >@ ]0 C0   0D000ȔY  z G0 {\oD00 H1UPy D00 " UP   @?$ D@00  U00 0D000H%RQC   ?$ D@00 HU0P0PU# 0``U @P @0:0yT0T TT0 #N@, @0P6묤 ܤ ep@-@P0P`M0 R    80x t000 0 00P80  H000 0 B/ 0C?00  Ѝp 0 00@C-M40\` d0hl8p@`Pp\ P Ѝx80 800 0 pCB`Po_`PЍx @-@P @T1!0G-` 0 DRHpp?spS-, P !Q@QT :!80|0[p@U0 S00? \ R!R0 S   0 00@ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $`U0 V P`巂Vp`f0P 0@PUpT` @埂T @pp  ! !@-@P@刂T R/0A-p,SP` @T @rT0`SP RQ A0@ ", "Q//A-Q*`@pP 0D "! "U0 "! "TQ 0A ", "^Q`X@pP@-@@@0S F$0PC$4O-:z-*0pM$P( , pPw t00^b Ss @@lRXaoH\0 04@Y @A@0 @TH Q@@[@T@P i``FF\V0^0  | aR\ x`Q'hQ"  @CP(H ,4QT S I@0S $0PC$vX0C,4Q| @CP ^_ S]ʜ80,40SmʈhH`@0,0] $P,40 P@0(@0S 00 CR ((   pp' 8 7@00p(`Y ~| `nR`F`V00P0S\  Q$0PC$D' 00Q6 $70,'0 4(0P0L0 F @& $P)0S|600S00l0S% 0 S" & ,40Q%0 lP,0S  $0PCP$,60 R(,Ѝ 6 0( $0(0\DEe@` % (00 S7$%P0C (00xP0S $0PC$H%  <0@ 0,@(@Q 4000XV 0Q[Q $ V 0$0C ,0(@  00 0CS[ pP40,H41 , ! 10z d 4`000 P ^$ $@$#@ P(@h0 Rv ,,Uq  P+ #  t# (@$@ ?#R WH( , #\ $6 (@  P 0(@$ R   $@PB lP " 20,,40 SN  T2 0$  4B@0S $0PC$ $ 00P0 ! ı 00(`S7A@ 10(`0 V0!0`Fx P(`0S $0PC$~,@% A@0S $0PC$ j,@؊@ĉ|pX,܈<,ȇ̆Ȇp\̅܄ < lȁ0|O-PsP3pLC@00 S ]4004c`(,P Zh34@2`0T6"0C S402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H"  4204@,P0T0hPr RP0 @P 0( 0CS P1  P1040 ,(  P,P@ @1(`0 R&T !P  @T 0 R 0 P'  q 00l P ~@T00,P0 0( 0  04@S\CPE@DSP4@,L04Pk _00SL004Pd,8~px~h~t~}d}|t|`||(@- 004 (, {(@- 004 (,p{`1`!0O- T *⤒Y|20d1 00!Q:|20t0`1=Q,00S|20lE0 0!Q:|20h7h0 s0!Q j0!Q l t/|0| 0p@- @00CS0 S 0 S P00pyP00p@-0CS@0 S 0 S P00pyP0000 0p@-00P~z@pp@-Ptz@p 0 @-@00J Q T\,Q    @P@0J0P\@-\,AP /0S/p@-     @ BJR@P`,PTa@@@AR  Qp03O-0PQ`$MlC@| BzpP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rv   IK T0?3Y00 Pq 0 vPP{ 00Y 00 W0(@p ڼ T D H0W D@ 0 ( 0C P7U$Ѝ00$Ѝ8T0 S80 D 10@Ԑ  B@DT [p`$ЍHȏ$Ѝ 00C! [ @ D0| 0p H0001K [ @T @]xT @ @kpz 0 0 @p@-@Pppp@@0@0p@- P@ ppp@긾@O-@dMpR0P H  0 v00 0KP8  #8 S R0?@P5/@T YЍ0H\8  #8 S R@0刀0ƪ@P5/@T\l tk Q" @-@M  R ! R "R pP^ 0 0 @VЍ /@-0QM   S S PpP$8R@ @ ,Ѝꤲ8- M 0 Ѝ(WD0D0 - 0 $M ЍVp@- BPP0@\SY ^S9 @% ,S'Sv{cSc\08ŸCA\C110D000000}p000%0>C0{)^A 00NS841@`00A 0 100C\00C0 S\S:S '00pP@0d{%tTQO-M  qDPP 04'p p 00R0pp 솟즟 0@P` p ,R&Ti  \@  @  RY  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R PsUP 00Ѝ %@@ i^ @ `f`00 0 "!.Q *Q0 0 0RS@  RP % p0 @  d^% @ @d   R ]@     A6  R< G@     A   RyP  % p0   @@ % c  RYP % p0  @ @%@ + c  A 0     B0  < @0   0 @D@   Tp P0 S\R$ W 0`C0@ T0  $ 0  <  n /0000>  0 0S0\S 0 S0 `Hf Df b p@-`@0@PM0S PS   00 0Ph 0 Q00QH  < x0  Ѝp0KKK|KA-M0TSP!00@0@P0S? `0  0Ã!1!1"b2c0A @ 0L0L  00210BqP 0 pW$P@WP 0fSPЍЍ 0 0Ѝ ^ NgA-M0TSP!00@0@p0S> `0 1à ‚0  @00A 01! 0120BQbP 0 pW$P@TP 0nSOPЍЍ0"0Ѝ耤\ kL>C-M0S!0 0@0`0S2 PU0 pLp\1G $@0!b4!b Gr1c1c0@ 00  0#3c`10BqP pЍ 0<0qW X $`0sSP p`VWT 0S mPpPPЍ[ -?L*S0 O-LM l nPL $0$  0H0: 0 P@P:  @P 0S  R `0V G #V =V =Q`Pj z0000`tp|P[  [Vp p  RR oP X,     P mV m0PSkp@y0 ᠳ p3 112cAp3L112c0B0L0H3#0210Aq#0P0 `H0 1 $ $@b`Hp, `V @T@pl0P=0`@ @0l$VP00LЍ`0 ,rp"22 Â0  @00A 01! 1120BPQ 0`0@7` 0qpl1#`!L04A 1c1c$0L2!b!b A0 0 0!3ca10BP 0tS0cS0Spp pk0@0`0c`@ p 0< pv0S~opHX PW NgݠV kL>dU -?L*S@ O-p`@P0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-(?qMpQ00 P` P? 00S040H $  l0H [ 0  R U0 GP@T `%%T 400 R,B*Ph  4 @@pTP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pmP" 400p,1S* 0C11ऀ R 3@4 00Q,*P 0 mp 40P4qߍ00f0\!0D]SA7Tf  ~x|{|x!00D R`@0A?S@:T AQ: AA DR3@D1p@-1 1OS 0 $pjP 400p,D0?oq2tT 2 jP 4 0,T 2, jP 400,@pS0p0@M 0 p F0 0A0@0<0!T0 ~T00<ꘚ':.00+&@D0q0VT񏐨S}tb\VM:}|{zyxwvutsrqp(nmlkjihgfedcba_^]\[ZYXWVUTSR000p0w- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ &A-PQM`p@ 0S! WC iP X( 0x0 X T 00ЍPP0T0j 00ЍT cT]p 0 0 R T| OUPp0S T< >, z^p 0S R 8(C8B((0 000ST00P P00@(P sP00@TT@4D: hV (V XV ,V ht@8$U U `T lT T 0R@- MA0S@  ЍA-pPP% U) 0S`$V  PR |@P0DV o PO-`RM pQ  0 Ѝ@ PPb % 5Pc /Pd \%)0 FS  hPM  p ` p pp0S  p  p0S  p  0S 0S 0pSa 뼐Y$ PT [i$%!hP !hPhP j뼐 0$YpP " Y) $ @ U (B8BBxnS0 sS fSS0pS  U R00000 0 + [ @:B ,뼰p[ qK +[p  뼠  8C8Rp 0U  pWe ?o2P  pGx?'x W !8  X P *   0S02 0C8#800<p  0 0U QP‡ W0僰 P000 0pQ pU00 0pj0X0   0p /U  R00Wdh  +gP$) p0(C-PA!@M`p 0f P 000S@ `Ѝ\@P C `0 p  R 0S 0LP` Ѝ` : 0 P  P`L004@@@+ P*@P8$M ""O-M M0p0:S%0:SS@ 0PS:S``E[ P* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`tP> 0/SN P gY PE SPP 0 ۍЍC`0P P! p eP40  PۍЍ0P 0S/S pP pJgX0 ۍЍC  p 0e3g XW P0P 0 $ۍЍ404 0 $!K J J J J J `I 0I G-pP @P  ^`gV  UP l``@`P @T P00@0A0G H ^^-@- M@00 Ѝ@ Ѝ/4 Ѝ@ Ѝ/@-@fff@ff f0f@f 0p@-S@M 0000Ѝp0P0 0 0 0` 000Ѝpp@-@(PS:pS eP!p+dC- M `@V pᬐP0fU@@`V   W0 nU sU  @ `V@000 Ѝ R@@@O- M PU' `pfSPU  V @8C80P 0nS sS  B@PU00 Ѝ 0S00PA-P# P 00`p` ,RR    0S,S@BcP   `p`@c C- M@`P(P@pW[*nUR sUI fUH0D Y)RD @ dP% H0D@ pH0@0 H0H0nUp@0 H P6 sUI fUA L00L0 Ѝ@P Ѝ @AP80pY D8 0400 "c 0S00 80 @H0R# ,0 0~H00H0H0@ HH0@ 400lH0@04 H00dH04 0H040, R0 0WH00H0 b a O-0M @0.Z P 'Y p p(080H0b0PC 0 `00 P00  P 0 P⺀Z P  P  P  p Y    p p 0@ 0 0@Ѝ1!00@- 0 @S/ 0S0Q @\T 0S0 Q000@T0:PA_oRET  \S  R 0S0@x0T00pA-`P0PUM@p"S& cP !   开0V00  pv000 00 0ЍPЍa  p_000O-@P 4M #P "d`Y`4 p|  PP p ".c 0P 0/ d` Pc0P c0 0 4Ѝ  0 cc,`0V (0 0$0,0$ HP,p, P AR   0S00XPr `V  [㼢  P"0 0cL0@ Z$ H0@0D0L0E ,pf[8 j ` 0 `P+ Z+  RXEEhn[EX s[ "`0S   ,P` `0 0$ac 4Ѝ  R`0H0 0H0 0PVY Y A-P`0`VM@p(S, WbP$ A  往U000 PL00 0D0 P P ЍPЍ`0@-P pW M@`R bP 0 ` 00P 00 0 ЍP Ѝ`O--TMD0 D:0,08:0,0`P| | |zPP00f@P00PQU P^T 9POPtaP  P T 0U 0, P  H)0 8 <)$0 @ 00 0hFhvZ 0s 0 PS , P R 010#.R00SOR9 = @P# PP @ oHDHt 0n  P LHL00SPP P%0 ! 0S t 0"000 0000 n0PM0TS0 P2$0pW0(0 $0S 7aP: $p  0S` 0@S  S4 p 0`  '\S  R}WC%Y^SY @Yw 0` 4 0&0HS 'v 0P_ a TЍ @0@S hFhvP @0f  FPA P;0`C RE C/RVoTSRQPONMLKJIHGFEDCBA@?>=<;:Y^76OW3210/?-=+*)ESO0PpS@ Ss, 400 @ 0 @P$,   P000Pp^3( @ 0g 00P0p0 00 00 0 0(  0B‐St 0 S00 P50 p<0P00L^( 80,  T<0aT0`FPV``0pp 000 000000 s0 P`P hFhv XEXu3 @0n  OPJ 0S00 HP@  08xP0 000000 000 f0 P XEXu0 0@s 0  P0P   0 v` TЍ?Y O  0 0u0 z0 rydD kr p&hP|hXW (W hQ P \O N ,N 4N M M P/f$P00//0N @-M@10 *0!1l!1"b2c N0L 0 0@@0$@B!A@C0PЍ赁NM g P0`0K?//HM @-M@0 0C B0  N\00L 0"2<@0$KAB@C1dPЍkLL >$0P00?//\L @-M@0 0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$D$C!d!bA@C1ZPЍ-?Lk *SK p@-0MP0`2Z@P 0Ѝpz[00  R 0S"0Ѝpda 1!0G-@q0PP03 0 4`S 0`02,0PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00Z8@-@P _^^ ^$^,^^,00!R  ! 001/001P//| @--@o \@\ @ 00s@ H dPJI HH @Ylp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (Ѝp0P0 P 30 0U f U{kkan!00 0P0 ~P L30 0U 0"P  0cP0J30{U 0kk yP  0cP0G20U 05{kF{{dPr  0cP0t20U 0x 0"RP=  0cP0x0 0U " @P?  0cP0|10mU 0 !a1""YJ)P2  p0cP0%ژ 0U " R b0cP0$d10U 0T1"" P  P0cP0$10U 0 1""P   >0cP0@00U 010""P@  ,0cP0@ڜ00U 0 0"P  G??Xl] 0] ([ Z hZ Z Y G|Y 8Y X X lX X 0cP000{ 0kF{U{% P  0cP0uڠ30{U 0kk Pd  0cP0\30{U 0kk5 }P  0cP0n30U 0_3""kPH  0cP0L20U 0=2""YPS  0cP0ڔ20U 0x2""GP  0cP0EP20U 06`2""5P9  |0cP0 20x{U 0{ $P  k0cP010g{U 0{ PF  Z0cP0ڌ10U 0`1""P  H0cP0H10uU 0 PE  70cP0k10U 0\1""Pa  %0cP0&00U 00""P  0cP0ڀ00U 0t0""P  W LW V \V V U U T U T U T S R G|S ,S R 0cP0(,00U 0<0""P  0cP0l00 0U0"/ |P  0cP0ڰ00 0U0" jP  0cP000{*Rk 0F{U{ UPr  0cP0`30U 0q3""CPf  0cP030U 0<3""1P  x0cP020U 02""P  f0cP0Wڔ20U 0H2"" P4  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{{ P  0cP0ڈ10U 0d1""PP  0cP0 <10@U 0' Pe  0cP0Z00U 0K0""P  0cP0ڸ 0U "7 P  0cP0qt00 0U0" |P  Q Q XQ Q GQ P P P hO 0P O N 4N M M 0cP0_(00U 0P80""TP  0cP0h00 0U0" BP  <P  00{kF{U{"00 t3030vx303 U""00 aH30@303 U""00 Q30\3 U""00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"!00 1010$ 2 U"pr!00 10b10101 U"G_!00 `109X10kh1 U"O!00 (1041 U"B"00 0000 1 U"B2!00 00400g0 U"""00 00M M M M L L hL 0M L L L K lL XL lK L 4K dK K J xJ `K PJ J ,J (J J $I I |I H H H H ,0 U"T!00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 `30vXd3 "ZI nI 3 "U"00 30{Ukk!00 20{Ukkt!00 20Sl"00 g"00 t20 0h20 0A )y :PI S @ P"00 K"00 F!00 A!00 kk:!00 5"00 0"00 +!00 &"00 !"00 "00 !00 kk!00 "00 0Sk !00 {0S6 !00 s0S !00 k0S !00 cP  ]0S !00 U0S !00 M-DT! @H hH DH 8H G G DG I 8I 0S "00 50S !00 -0SV "00 %0S1 !00 0S "00 0S !00 0S$ !00 0S !00 0S }!00 0S u!00 0S2 m!00 0S  e!00 0S ]!00 0S U!00 0S M!00 0S E!00 0S =!00 0S 5"00 0S -"00 0S %!00 0S !00 0S !00 0S "00 0S !00 } 3 H "wP !H H 3 "0SG!00 c0S  !00 [30 0c|30 0u"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &"00 !"00 I vI 2""2t0 02T0 0240 0>20 0d20 0w@20 0n20 0e10 0\1t0 0S 1T0 0JI140 0A5!00 X10 04Q410 0+h10 0"70 000M0 I0p0 0 ?@C C B @ @ t@ x@ @ A $A ? (A @ ? ? ? |@ > ? x= h= p= > > > ,> 8> = 8= ; = H= ; \; 0P0 0ڲ40p0 0Ѳ.X00 0Ȳ|00 0࿲\0 0000 ౲n0 0000 ࣲ180 0o41X0 0&X1 0000 hv!00 10 0u10 0l10 0c@2 00080 UH2 000l0 G 20 0>20 05" /L+SC @AQ0@-OQPPP 00 QȠ\ 0{ +C 7G 00+C03Q Q 00A@@1 0^\nk 0+C {6F{7+S 0+C0< 4< /P 0S $0S 0S P? @4@P//A-pP`8\* ,0S( 02 ,04 0 S4G0CV@1@! V @D8 ,0400 G 0, 400 (@ 0( 3/P840, 0S00R4000@-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0$ R(400  0=@0U 0PE@T$0S0  0 P=@0U 0PE@T$0S  ($  0  88( 90,K  @U 0PE@T$0DS, 0 G0+@\<0Uz 0PE@T<($(<,000@00<00SE 70T<0 00CSW0S; 08@;0 Q;0(0 S0(0u080 t0890@kL;0U2 0PE@T0S ;00;0ILQD0ʆ;:0\0T 00T :&0PE00@SU0 pC0 0,0 S P<@@B0S 00*S30 PC000000 00 00W0"1<0 S<@0@0R0 p RR<,0 0PUS0S00)D9 0 <0 30DЍ X R S R  %P$0 PpB 0Se 00 0 C0 S 04j0U 0PE@T 0 B00 00 000R00SP 0S($<,(<0$(0 0R 80080 00 80B4 R,5@0 00D 0R1 P! BD A   B\000D0Sx70t7 UR00\0 0 P<@@ *0|'S ʆ0  P<@@ ;TU 0PE@00 S  S7 S$ 6威@D00@T80PE@TULQ{X60 Ql H0 @S0 0CR*ʆ+R 600600 pC00@500 pC00ld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@T 0S 400l50U 0PE@T:0D 1ʆ0+8@DD0\Ux 0PE@T:0!H0ʆ0H0;8@DuDp840W U 0p1Wp!WZ 0 0C 00 00D0PE0CD00$Dpl `R*$0ATU< 0PE@0 0Rl @D⨁:R (0,00C 8 P0l0S>0p0P00X0?0X00 p0tP 200T30/ R=0 U 0PE@T20H?o20$0S0E "d2$($B0#22cR:0S 420020 0F$Q   R D Up1p!W'R0! D $ R! D $ R$!  $ R40,0000 l100BU  PE@T  & !X# 100\100+0008@D;Dx00 R 0 B D  0T005,(8 8 5 6?7?8?=?>?N?O?5?(2 J?P?h&M?0 H?A?L?|. - C?x* B) 9?:?;?0@\4 @Dʆ+8_(4威@D0A D0B L4p(8#W" \40040SQ  8@D;D _ 4 +04HL0$ 6 400406 0@S4Dp0H Z0PE@ZU8tgx|p@ ⨃p ^&:l0 0:00pZl0 0S50P0;T0l50 0X00\0, @D5威005@D0 ;@y 60050 0@0h(4890(8 (8:0;d600D60x6l 0ZZj0PE@ZdU0L0Sd  0 6  0p41q岠pT*Um 0`4`UU PE1q岠@pW0`8@DQ{8@DD-8tgx|p@⨁pV7L00 PpC? 8(89i0+@]\8@D 0w@D(4l8l0U0 0 000P0<@@O0 0`pC( (0R@D0+S(0,80080$S>0p0P0 0X00tpXp04040P. H900 8( 89HeSR: 3@ 0@0I9@0i900900 pCp T  d\ 0  \ h gP 4:000 威pC0@D0d:00l:0 0S|:0W0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000f@Pp`W2@ R2Q <00 00S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S 3#R0S  l0pS0pCp)x 000 0P,04D0p0 p0 0 0 30 Ѝl0Sl0@@@cS???4 P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8 (  0(3/PI 8 ᥴ(!ᡴP S>0Rp:oRS B P T  B T p X0Bp (0 #8ჴ8@p 0BS.  p 8 td pP S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-MP@ @㬰(0U 0C0 0$SP $C`0p sRpW(-0 p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 00CP R"P @U\! V0! 01 002T 0 T 0SЍЍ 0D?o240%R00S020,0@0000,004@0D?o280(0 0  B<00 0$ 0 0S03@05 :^N , %0! ' %0 %`03!305(0<9P0C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F ( Y FV(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @@ <01( 00 ,0, 0 00008@, 40S , 0O-0CDM000 C  2 00!8ӗ1х1&=  x l0tJB H0Hxt^Hl0:8HpXT`!4Dp`ᶐH@ᰐ00Rx0 Ph`0l \0S8 B0l0\000S[ tAP`tx0l h Rl R010#P60 6SB \0P8 B_l0\00PЍl8  R&0&0& PV) )h0\0P8 B2l0\0{00SЍ  O-T$M t<4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@l30 B0(1I>R<30+"8ӗ1҅1&=  `tQI6 Y0 60Rl00XP80tT@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6!ƈ9096tl I Qtl 1Y^ 't1QX 0S Q. Ql kP (l `f@ p400D`H0A `l @5!0 PH0  ` 0ll R1#:\ 6S \0P8 B 'l0\0p0P$Ѝ\0P8 B l0\0^00S$Ѝ   0, 0CSO-0! M00@p0U\Zi6P*0U 1oPEo:l0\`匴`C 0 S[ P1[SEWo᫲ZSW 0 0 0B % B 0 0B 0 #40BV V0\ 81!  t\` 0  PE 0C ` U0 \`  Z  BP  P 0P `S , 8Rr06AG,0l06\00P `Sl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \6&S06l0R, ` 6V`!VW\, Q* 65@ 0CP!P 1RV G/o"S W  R  PR#P`1`!WG80  =\00\0YPl0<AQ0Cl0 ϫ6&S06l08R6 J  ᾫ6,AQ  l00l0&n8 j, l0B0Pl0\P`1`!W 8 0 \00\0d  PR#P" 0S $0S 0S P0X*SES[SgSqS9 CS0//O-MP@`?o2P0S}@00Sx S t0Ss0,0S$ RiL0Dp 0CpB ፯,0lp\pv`FP0*SWtpWT 0k ,0V0pG**0  00 P  t0S"l8PLPXTD@p4`H0 9*0Ằ QH0岰0t0lt0Sl  l \  60x0`00 th  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C Ცpp@-@P$ 0S! $0S ?`PP0 S0c```,0S`  *00 00(0p`p 900p@-P@P pP,0L D0<00 B@C Ữ0\ 0 10 |0:l@\@t@Fx ` h@H@pLp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:k`@`U@40C00 0 &PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PpQb!Tc@Te?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟 0P0 X  0@S P X0 SQ\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 0 30  0#400  0 p0S0c0?o20 Ѝ0So= 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q000*0S9QI B0 00 t0  R 0,0S0Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E00Q P p K 0S  0PESPo p W *G 0 ,0 SR0 B0Ztp 6l8&`6&6!ƅ909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\000P0S P{X: X!0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S 00R01 00 q000SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0  0& ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:{ RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:M R+0 B0`00,0S!  Rg  S 0 Q*0S 000 #4090q000SE 0 B0+0#  #800#"0 IQ"V\ R8 C0 l0\000Sj`ptZ(l 8`pR B 0 ^L 6ƅp6ƅp6!ƅ9096&tRl0A0tl0 Qt QX Q Ql 8`p0 w X 0Sq0 B000 B00,00I ^ ^<00 Y Y Y Y Y Y Y^ Ioᩒ#Y0C0KS`00`S&&p 0C0ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 0*0[B  :XF 6S \0S0,000= h0 0000 B00P0U0S_8 `徣 0p!(3/@PU X!@峣 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/80S. @ R+ D PR% , 8 ሣ, @@ უL DD ~ z0 0C006& 0&;> 0$0;/ O-QM R0  \ " !#4"  `P `p  *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R`  ! @0#   R#4,  " "0 0S"$,00# "0 0S"$, 00#0#   R#4  P% 0#  R#4  PUTp @RR.0R$D. R$.0#0A0R.$ AR.D$0#00R$D. R$.0#0APE.4$ AU#D$ 0 @  P   " !Q#4"Ѝ` " R !L -Ppp h  \ $ @ C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! @-@P xpxPp`@` 01ē!0Q0 0#B   @-@P xpxPp`@` 01ē!0Q0 0#B  L 0@-18P@\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#H7cN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /qR'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /q/ U/ 0`0/t47ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O-DM pPjp5W@T4PPTQ=N0 PP0\ˀC Y Q 9ʶ 60p\0 1 0Q-p qX䰠 60C6Y 0 QI 0CAp P0 Ȁ  gXQP4 !\˒0C`K P4`ˀY`;T$Q BXKT$T;往P PQ͌Q-PP ^ Ƞ 1 ",ȠA  `{6P4pSTP I0`T$!\. @   p嶣 1Y㲠bQⵟPP 0100W0 [.0^A  װ& 0А##U60 6<,Ɔ0 SZP. Y> 0  JJ0RP LGP 0 QR0C Y> 00 B 0 \0000C01 LR  0P0N  @0 00T0 0s P\ R @00SC00 R0P\DЍWP 00YQ / !0@[1^PG65#6pQZ p J0 0=A-@1^PRPA@D@0+}nR- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O- MⲐY``00RCJ!Pk΄  R7 Q. R2 ৎP01nh Q&80pNFh0`0#4``06cUQpPv R0Sz P`0 [ ЍYf0q 8YC8 !.P&pe(WB(0 `p0p00`#4pp06PE`0cQ38C8f6PaUx0Gx#800P``pp0P't``pvApg^xGx B(Q"(a0APP0#4PP06cR!0C 60S 0 SP`0 P`0 R+=ʲPpeW6y`p8C8000`p#406PEP0cQ UAVfN.0 APP 0#4PP06 c^ 0C6qpPp6gQ0#80A6`00Gp`p!0aUQA6 S, N.0 APP 0#4PP06 c^ 0C6q`0f /P UAV B("(PV^ B("(06VʀO-kn6@SMN 3003P0030 0300300%10 Jb ^@$HN@@p@p. BnS.HN@ἦ6S&00H DH4P  p, Ḁ! @b T H DH)& B @@$D @F @dXDHDH&qZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DHDH&0CS㎀ޕޅq᷀ಠBj^@$HNI @@ @"$ &J bX.HN@ἦ p#Rs `D0C8#8JO6S@ἦj 0c Q.AP`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ 6@-S k>@@0 #400k.06S0 k΁0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&蘎ʀA-Pk@8` R.; pNp "$pp &bS0 B0&0  8#̠   4##<V0 0 [    &*60@-S S00k@@6 0C60k>@@@!PPƂ0k΁6 0@-# SH$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@@ @"$PP Ɓ0O-@ MPp,0S ᔀ&]P+(+%0 N. 0r?010S!@P j600&6 0!R1Q  S030#Z0Sk 0("( Y9>8C80 00#40编0iR#8 IC8἖(+ ,K("( Y98C8k0 00#40编0iR#8 IC8἖ Y("(98C8k0 00#40编0iR38 IC8἖ Y @("(98C8k0 00#40编iR I!἖T30M>0k.꼖ό YȠ,LȠ἖ ! Ɩl^ LƆP | y 0x"0 P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V g 8C800 0#406 cQ 0C6@!!἖:8C8἖8C8἖8C8἖  X  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  h p@-@P`d0P \0P 6@T @Ϙ@pVp"(@ pyaratcid@-M @PoЍk@oЍ@-M @PЍ\@Z@Ѝ@-M @PoЍK@oЍ@-M @PЍ<@:@Ѝ@-Mp`P @P +@Ѝ k#p W/Ѝ@P/T 0A-S ` 0@ Cp'P#U P 0 0A-S P0@PCp'`#V `000A-S ` 0@ CpP"U PȜ 0 0A-S P0@PCp`"V `譜00媜@- MP "p 0S p@0@Cu'`"V ` Ѝ荜0 0 Ѝ膜 Ѝ@- MP "p 0S p@0@C]`"V ` Ѝh0 0 Ѝa ЍA-Mp@P `P "p . 0S P 0 C, @W"T@ Ѝ7`Ѝ20`0Ѝ+@`.T` Ѝp@-@lPz0PPptcidp@-@`Pn$0P p!00ploobp@-P`!@P   @ap@-@>@@-@8@@-@2@@-@,@0@-@&@N@-@ @]@-@@{@-@@@-@@@-@@@-@@@-@@@-@@ @-@@"@-@@8@-@@L@-@@b@-@@z@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`{@P   @pp@-P`i@P   @pp@-` PV@P   @pp@-P`D@P   @|pp@-P`2@P   @jpp@-P` @P   @Xpp@-P`@P   @Fpp@-` P@P  z @3pp@-P`@P  h @!pp@-P`@P  V @pp@-P`@P  D @ pp@-P`@P  2 @ pp@-` P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`p@P   @ pp@-` P]@P   @} pp@-PZ@h(0P p10P 0pgntsp@-P`@P   @Z pp@-P`@P   @I pp@-`P%@3HP p6P U %00ppatadp@-P`@P  c @ pp@-P`@P  Q @ pp@-MP@ d0P @Ѝp  x)`P  @P`+Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`3@P    @ pp@-P`'@P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @ pp@-P@P ?#@y p@-@"@@-@"@@-@"@*@-@"@H@-@"@f@-@"@u@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@ @-@z"@$@-@t"@:@-@n"@P@-@h"@d@-@b"@z@-@\"@@-@V"@@-@P"@p@-P`@P  k" @ p0p@-P@P "@ pp@-P`@P  H" @ p0p@-P@P "@ pp@-P`q@P  %" @ p0p@-P_@P ^"@ pp@-P`N@P  " @ p0p@-P<@P ;"@u pp@-` P*@P  ! @b pp@- P@P "@Q pp@-P`@P  ! @? p0p@-P @P !@. pp@-P` @P  ! @ p0p@-P @P !@ pp@-P` @P  u! @ p0p@-P @P !@ pp@-P` @P  R! @ p0p@-P @P !@ pp@-` Pz @P  .! @ pp@- Ph @P g!@ pp@-P`o @P   ! @ p p@-P] @P D!@~ pp@-P`L @P   @l p p@-P: @P !!@[ pp@-P`) @P   @I p p@-P @P  @8 pp@-P` @P   @& p p@-P @P  @ pp@-` P @P  ~ @ pp@- P @P  @ pp@-P` @P  [ @ p p@-P @P  @ pp@-P` @P  8 @ p p@-P @P q @ pp@-P`y @P   @ p p@-Pg @P N @ pp@-P`V @P   @v p p@-PD @P + @e pp@-` P2 @P   @R pp@- P @P  @A pp@-P@, (0P p0P 0pgntsp@-P`@P   @ pp@-P|@P @ pp@-P`q@P  z @pp@-Pa@P @pp@-`P7@ HP pP U 00ppatadp@-P`l@P  > @pp@-P`{@P  , @pp@-P H@P e@pp@-P X@P T@pp@-MP@x d0P @Ѝp4  $`P  J@P`;'Ѝpgntsp@-P@W (0P p 0P 0pgntsp@-P`@P   @Ipp@-P@P @:pp@-P`@P   @)pp@-P@P @p@-@Q @@-@R  @p@-@0 P &&p@PPc!0S ^!pԋW!0#@- @@>!Ɋ"^P 0R @-P Q uo//t h 0S p@-@L`P`PpwP p@' & P E0 0 o@-됬 l @-P Q @0@ @0@ 0 a( (0( 0 b \ 8 0  0< @-}뼬 x m@-0P M`0! #@P 0P0 `  Ѝ&ppp  P`   %@ Ѝ %`\ @- #@P $0 0 0 [A-pP #@P ~0 0 0 ׎`w#PP  P `0 000 ,0X @x[Ī @-@P @ te-@-M(pW ,P0  P#@P?#`P  0 P# UЍ@Ѝ/Ѝ@Ѝ/ 0 0t 븩 E,b @-@P q@ 1"p@-@P x0 00R0 P#0P Q ! p@^ppY( p@-@P `0 00R P"0P Q ! p@pX P/0 00R /XP/<0 00R0/P///TX4 0P p@- o QP  QQ !/X P/ 0 00R/xW@-@P \0 00R  p"0P Q ]!00@W P/00 00RP///V @-@PM 000/o"P R Ѝ R0 ` 0 `p."PP 0 S  R L  " `PP b$  00|V @-@PM 0 00R ЍQP! 0 S pp !`P 0 S d  P" pP` )$000( (0( $0 l|U( t X + P H0-00/o"^ R  R/|TP/D0 00R /@-P Ўo T P/D0 00R /@-P oS P p000/o"\ R RP Q  Q /hS  fP 40 00RP ~/R f$0A-SM`"P@U Ѝ0 PP 5!pP 00 0wP S o# "!@P d0 0 0 @Ѝ4 PSP  (Q| 0 //p@-@P& R 0P:P PpW" P `0` `0 vL0L L0 n808 80 fp訡 Ģ T h 4   p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@ $@-@P@ܝ p@-@P  PP 0, 0p"@"p@-PQ@` 0 S S   CQ R 0 S S CQ\<S0S !S0-S 0F?o2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ VPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0`000 0`pL L0L H0 _0`tC  >R00pp P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /0@- UoO-p-KM `Y됊0:P10 0 0Q@@0 >SS @S@P@   A-PRM`Pp`0 @T- ߈0@0W  WV 0/RA 0CW /RW  CW0  B/Q p!@C@T@!  Ј;@04D .00ᭈ 0 S* ྈ\p@  U O0@\H0@ۍB? 0 ۍ; 0 ۍ S0p qPoD8p  p@ C-`M.mP@P4 ,p`F Hp@ pEe0R8p"0 `uhp)    000chp! 0PPЍ 0 0 `Shp  Ѝ@Ѝ@@- @i@@-_P 0 0 !x O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`^a P0 p0 3/V@ 6/T ^T T @@T. 0S2 0 3/P V 6/^0S @0 R 2/0P`^ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0 0 |0 l l0l 0C/By댏   h D Ў ̍  E ;؎ d p@-P@PP  P $0SP  R PpdSP P ZPP , `PPt D P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0^P $ 0R000 Mߍ R00 0 0K/܋ d  0/0/@-@@XP 00#0 0 P 0S S R/P/ R0/  @-@ 0p@-(M{P@ | { h``VP (ЍpD { P j(Ѝp܋ p $@-@@- @@}8p@-M@Pᣊ` `0Ps0*0 00 Ѝp荊0"Sp@-M@`჊P Pqp 0 00 Ѝpo0"S 00 S 0 P:\03#/S 0 P\0///A-P``ᘀ@P  (pP @P sNɀW@(0( (0   5x | 00 S 0 P:\03#/S 0 P\0///0@-M @P  @ Ѝ00@-M @P  @ zЍ00@-M @P  @ lЍ00@-M @P  @ ^Ѝ0@-@P ,0 00R3 /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / t3P $0 00R //2P $0 00R //P2P $0 00R //2P $0 00R //1MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/1P/l0 00R / 00 0  S *0/ ɒ\* /0P/|0 00R / 00 0 S *0/ - ^: x0P/|0 00R / 00 0 S *0/ - ^: /P/@0 00R / 0 0 S /X/P/|0 00R / 00 0 S *0/ - ^: /P/l0 00R / 00 0 S *0/  \* /t.P/l0 00R / 00 0  S *0/ ɒ\* /-P/|0 00R / 00 0 S *0/ - ^: t-P/@0 00R / 0 0 S /,P/d0 00R / 00 0  S *0/  R* /,P/d0 00R / 00 0 S *0/ R* /,P/\0 00R / 00 \: /!S /+P/\0 00R / 00 \: /!S /0+P/T0 00R / 00 R /! /*P/\0 00R / 00 \: /!S /X*P/d0 00R / 00 0  S *0/  R* /)P/d0 00R / 00 0 S *0/ R* /p)P/\0 00R / 00 \: /!S /(P/T0 00R / 00 R /! /(- P M D000/o"^ R Ѝ R Ѝs(P/L\ /  JQ\/'P/L\ /  JQ\/\'P/P\ / Q/S/Q\/&P/P\ / Q/S/Q\/&p@-@ 0M PR000 0 Ѝp$0S `0-S 0S0xS vP T LP ЍpP`Pdw Ao/A-PP@@Pp t?0,p0P4080<0P`p @@P@X%  @-@ @p@-$@@ |P|$ς˂@-@ @O-4@T ,`@D¤@@`T PpQㅑ ᬂPZ P PZ  0 0 v dy v z @-R 0P< P 4Q ,  D D0D @0 0 000 0 D#x \v (v cx v v p@-M@4 00R<SP,0 S R( 1`V9 P` 0 07P 40, 0C40P0 `ЍpS 0 0D ЍpCf?ЍpR t t0t 0D \ \0\ X0D xH H0H 0D aow u u a\w Xu t 8w u t qw u lt A-@`,pPP W 0 !,,P0`,P0`G-@pMP P  `00Ѝ!  0<`P (0S1  0 0P (0S$`V00 0 P 0S  `P  P X ` 0zP ( (0( $0\ |q X Tt s Dr I 0  0 @-t 8r r  0  0 @-xt T> = = 4> = @-\@ ^ \)QRS  T00 QL R S "  T € 00 0 0 Z(= = < 0@-@R00Q,MP! P! 0       L6T0?o20S00,Ѝ00 < < 0@-MP@0  0o0 0o0 0o00 0P   SЍ00@- M0P@wo ro mo000    S Ѝ0 00@-Pb"M!4b4#  @ 0Po "44 0Ho "44 0@o00 0P   UЍ00@-M 0P@ (o 0b" b! o "440 o0!$$    SЍ0p@-@P(MP`/ 0S, R00n$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 GM P0V00(Ѝp@ R 0S V00x9 @- @ sT00@-@$p00T0s0t0u@-@"T @-@T000 000S/@-ddx000 000S/@-c$x000 000S/@-cx000 000S/@-cx000 000S/@-cdx000 000S/@-c$x000 000S/@-cx000 000S/@-cx000 000S/@-cdx000 000S/@-tc$x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^  \#h,001/001/Ě0 01/ᨚ0S@-@1/00/h0h0@-@ M\P ЍcP rЍ|x/S@-b-@-a000 000S/@-bxAo//- M0 0: Ѝvt- M( 2Pp Ѝwt@Q- M Q Q q 0 Ѝ  Ѝt ^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@p P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pl8000 0@0 !0#2 /UUUU3333  C: S- d S V Sb00Z r - !=w- S ^ >S-00 @Sx00: r0-0 0w0-000 SD !S-00 Sx00p!r-0w- P8 P2 P8 Px 0    Ss00 ! Ss00  Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-Bda`pP8 PeP3  dpP$ 0A0Bd`@@T gP0=S AP`0AT CU! o/edAo 0 pp"p2C-hM 0 PLP T0X\m ``P P唐嘐圐堐夐 `p@Z xp  `p@e ,P7  $(0$p@] `0<S0<0x0@S<00<0@DHp'<''0'd<1<000L0 00d`'X %Uo0S dp@ 6` 2` @Ѝ?OoBЍ@/o00 ` `  `* * * d|) ( O-pM`@ iP-TPk +T@` 0 0Th W p pǯ 0 _ 0 _P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ nP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Pfn0T0Pp`p@-BR"^p@?@PSn0T0PpO-pM`@ iP-TPk +T@` 0 0Th W p pǯ 0  _ 0 _P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ mP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Pm0T0Pp8p@-BR"^p@?@Pm0T0PpO-MHP@Q@0@U P0 `8 (" 0@hP`$Ѝ R4l"0P`0le!0 N$ЍX000T0 0P00 0vP00S< 6#R0P` U03[0:P 00$Ѝ!0 P`$Ѝ?/%1R5%%;R:*%6R1!%?RP`\ ` 0P `8 ` 0P `}   ,  @-M"{ @|d{ @0S D <0 0 |0 30Ѝ  :?4 -M{(, {Ѝ 0 0 9/smNA00/sG-pAB`PNQ! @IQ JZ3T1P@ V B  PA@Y0@O-,Mȟ08 00p8 @p0S00 H8`0S 8( (((( '_P@0+0C< W Pp  q 0 AB000 S 00PU- 0X0F0-SPUP^P0-S0!000 ,Ѝ ,Ѝ60p p -U0 Ц` :U`< + B R 0Z0P0 WU E :Ro 0S000\6\0P60`u0v` 060  ,Ѝ60Pu `00PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0@\5 00@500S 0:S 050c5W 0 0+ C :R :S?k:i 0S`0  :R 0X0! $ 00O|40p4 0$  RL$  = ZY0P0| C000Z p p@P`@p`W  Ub0Se 2 PR z PP  0pQW`0S p @Az `T 0RZ0S" 2 00S 0:S  X0 S2 00+ Cd`0JS0S:  00 SP0 S`,Ѝ p @ De1 00S 0:S  <1 0? 1 00S 0:S  {Z 0 10S$000<1 00S 0:S L a00C 00 S 00 00+ C0 0 0 00S 0:S < t00P0+ C10P8<,r|rxrTH  4r 4q qppF |pTp8p TTE p nD ntn0D  (  h j@  O-p2̒0 \`" P@T6圢 0 R01-[@lP-T@PB T"LRPP XP -@X0P  :R8 2 0 0S! 000PP@:T0S! 000100S 0:S 0 |?@0SX1 0@ 0<P ,10P$1$$0 0:S  W  00:R@ 0S |0?@ g0000|0| 0 @ @z$iiyhi? 4yhhh 8 > h  ((0 @-@0X @H  Q0  A0 AQ;  A@-0M 0@_6PЍ0 Qp@-@ cZ00QUPQdZp VZ00QUPOZ00QR !/A-pRP`@ @T T !03/pWG /p@-@PT 0p@/pA-`Qp@P RYxP0D00 00㼀p$`,@(P0R*g 0 A-P`p @P> 0U0! V WppP`P`(xP) 0 0 00㼀@D $P,`(p0W PpPpV W dpd`p`TPPH``f00t\p@-@0`M1PS ,0S %b$0S b JpЍpO-0M @!c`pP 200S 0S 00*  0Sx "  G(?P` f0S{ 03/t"  7P}f0X S 3/("  $Pif000  P     @ P 00  00 UPX Y$p1UAhh1pP@$T!0,0 H1 ( 0 0ЍX&f  03/w{PP 0[Ѝ f0S fHVfD!@e0@0꼰e @(  PeD40D0@-S @X0 P @0P 0 0001 1 00Xe 0 p@-@0`P1S ,0S  a$0S a@ppp@-@rX00CS00 PpXp !P--M  D?Ѝ Ѝ/ -- M0 0> ЍЍ/0P0@-$M Rd P@0S#  S!`0  B0!  0 0$Ѝ00`L0 0 @ P >0S$  YL _ #  @YP 4000S$/00// Y XL pA-`h!  8MPP 4 . D<  Q S  @2 ]E`Up  \ $@8`pU 0 0 40 30#8Ѝ@@p pW aP\ 0 P  @2{`p,@p@\H H!  - MZ ЍG-0!MPD!004081 04p0<801 p`|@P !0 0 <8 304 !ݍ  8d0 00@pOP@T Cnx` P 0 P8T{P}aP @T@$!0 C-!MM  !0 Q00 P <( 040 x1@`{0P@4p 00H1p{ P4400 $ ( ,  0 0 ppPP"@T Cnؐ` 0 P8T{{PaP @T@0S  待d L0 0 <8 30 !ݍЍ800嬅(ķe  l8d$dO-@FM# M3 0Y㐤T`p0d40X ( 0Kd 00; P0S 0K  PU  0P(00FP k$ 4Pu /Pp$_Ug ,&Pg(V,TrFP $LU ,H  Y "2 0 d4 30Fލ Ѝd 0P0D w`Pr`P9 / xP@ @U  ,<V< VF ! 0 0 g0 ^PllR0$0SH / x8! 0 P  01!0  00 0  }0 qjc ||t H   t $ T <   l  P  , @-@441M0 `Pp 000ZbT T) b@/00 0 0 0 30-Ѝ0U000 @@P@00yvP "448#800U0Pnb0P7ib@P h O-P-*%GM: 5M $0ĝ0l404 0P@`9 @@0D`H`L`J500p@> l5l(000(ph 0 r@P!  Pub00S/ b0=S0`S0`V`X`V `ሀ\Pb0#S PU @|$d4 0 l4 30GލЍ(00C(08a0 @h00000 0DyPa @xP0h00000 00yP 3 Z  Yt  Y0S(00C(0p  0,0`Pu #`p(0 F\ P\0U P0000@8`~a -Pzھ0w 0hPC <6Y0i0SO SM \  \  \  P\, R"J0  =a 05 0,P(0,0 S  P (0S 00000,  pzxPJ PF P`0S $0pd( ( t x D d @  p 8  @ X C-PT!`P1 0\M.0T004,!48@#8 xp|a0000000 $(,0qP!Q ,X0 p(@Ld T0 0 T0 30 \Ѝ 1 @  뤩L V -MЍO-`!p1 Ƞ0,̠dMČ!0\00< 8P#8 @ 㐐刀匠0$000 0 (,048P80Q ,  (XIP 0S 0 @ׁ 0 0 \0 30dЍtS0  @寁@ ,'  4P- M0 Ѝ0@-@x lMt0 P00d00 =0 (0 0 d0 30lЍ0hϟ? O-M0@@ \000'U\ `` T` @!?b"`!P+d+) pP b)͌h P%d P @pgbx"n.'t*|bt'Pn* )dA, @PL`lp` iA$@Hi!h(Df& +e,)f)h+ t . 'M `k(+x`eq "$p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%}(nd.eT(  "d)͌ g. dA k(+ "$,@k" @$읉@l @&`g!,(@@ fH&g!"$D ! Li,fd$@gA .aH!*$DLaD$p*+匠- `j*i +j+i(P% `&b  0``ian, ah!&d .lad&.'. _%@$,Pp_$bq.p4PPbq'͌pe%h. ) }eT)l. +,*+. +@**b!d($"$(,dD"$ *.,/"+.0`&.o&+o&4(`+ha. ` ha& ` _%_%_%, PgQ,Ph P%PO$O$m`O$g @O]g. fA @͌eQ@$gqpfA% @?fA$f1ꯠ`*!`!$` .))@(**}*,la%..` `&gq.0l'`O.P=OP`'].lc1O `#.p͌p뿠+`'' @++O+4ea# @O `&`꿠@m/+$/"/"+++lOe, 0(O0n,= eQfan&P@) ] 뿠坌+@++cA&+(,@$n@. , ,.4eQ.믈`$.c% .Mꯈ`c1ia% `&dAꯈ0ia$`&P=Pm P8_% _%_%_%n$,P_i+P 쟠_)(_%_%PP*)P*))c1ៈnQ#@P%潋韈PfA#]n @$k쟈@f+.00$.!!(.4..M0e+f!`.,`)8o)`.`.=.dAea$ `& ` ⟈c$m.eQa럈P@c!.鏈@c1.'鿠'p0/+/"/" $ ,.].f!M(v.0! "0%q0 ?p0%0?SP@@g PQ0gS@pG" ` # *G0S@@:`F ApPp@-@10MP 0 00R00113 R0 0~? S `` 0~? S U PE "001<3 R08 (0 0 0 30Ѝpz| ` y 0 0@-PQ0$M000 @ 0 @" 0S0(0T H0 0 0 30 $Ѝ0)}PP yp yG-QM !P1 0稐p 0 500E4e(P<0G 0S08C;t0' T DPP!  `T0@To0PT0@KT@  0 0 5 30"Qލ+9T0@4TU@ 0P P LQ@fp p@`]Wxw- M0 Ѝ0@-@x tMt0 P00l00 ;0 (0 0 l0 30tЍ0*vv {40444 000{ 0/#EgܺvT2O-tM@@ 02O P?D @`  0 p, .`h d` 4   *d,! L꫅appl[ P8 ` P%lk.0`&P p``{[d[ ppmܼvmzNSdK P%P[`[h0nbk*@`<nbk& @`'i` .DfinlkajK(l @%LjK$ @g a,`dMbKh &͠iˌb+h  .e+ "8 j f$jlf!  idah d  b-g+d)h,n h ) g{T苠fp`! g|e{D`)fk`" l )e[Pe]n[fjLdka( Ha)dK@ 'b )n8M X`Kllˉh& h)` h0a a0%g;0# f;$0f;#`x2@ahhlʠebˌ *b+ +g+bd )@lhf`fk $0n )g{Dplxe{`!)*e[`PXm]dkn[dKea()@dJ`KTDbhn)( h&L. 隠gllˋ *4 jabaj+ f+$L "dˌah(,d+.e  " , P -8f+fkl̠i gˌ g{p8ye[h (e n ( j{ pp'` d ,` ph"+H`knn0`lkk,`H`gz@h`i{`!ik`mb j !jk`nekh` `&`fj$lkfh (@`+.d@bb+T@gnK(@<@ @!l˄ k(! ɠb-je[`` \!0ag;g{S 00 00//T@-M `P @8<ppPU0D>S 0!31000  <Ѝ>SL 0!31000 K00K00S/-p@-MP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( RH < $  A =QC #XA\#\ !  +A /R   /R   +S -S =S000@/Rh-+"    000000 0@- |A@0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-LM`V 8@0 (P(0,00040H`pE  `I @ CI@T2T7 `000000   0pa0HSt]rqpon7lkjihgf*dcba`'I00I0@I`@LЍS  "=X  R!   P:0$`I@ $CI R "@$`0ኡ  Y 0 S:$`I@ $tCI0S 0"0C$`0X W     X  ,X +X@ 0-S=X000$ | 0 P @X B R񏐗~}b[fxa^S  Z0$`)IP C!I RX "@$`0ኡ  0 =Xv Y+0H?o20S Zp 0W0 X00 Z$`H PBH0S% "2@$` 0T 000 W  | ;zI?xI0v0tW  p |0S 0 S2*- + H  @ LЍp'}C~p=X   00$`H P}BH0S "2@$` yq$`zH P$gBsH0S 0$ 0C0`1DsPbH00LЍ 0Xp+P-@ +0B XR R  +0B 0+R XR  -R  X@PPQpN -0M   y1p`ЍP 0 @-G/o`/00/00/00/ 00// ///00/ // /A-@p`e6+P6U PU  0  P@P PPr]P \000p@400G0PQOGPؓ 0p@-P@`T @@T0rS 8Ppp@0.P0+Spp@ p@-MPr\@`   0P D0P0 ` @Ѝp  0P@- M00b0P0L10 0  <100S]<p@( P r<0 0 00S3000 Ѝz0 0 @/F@I<d0 00S dF00@ Ѝ($Cxh @- M P"!0(0040000310`0d0(0040000' rd0?Y0P%Q%00AA0$0 ``00@E,0 `0@0 A`M`M`K2@s4  GzG L  ̮ SQ$ | O-@́̑!M0 Q:Tf PU# U* U T 0^ S^ЍTPU U U\?^ @0@ 0Pp`WP PPPP& PW P`0T`Pp0W 0ST:0S#`@0Q @ 0pP W?[*!]-KE0@- M0MK04000S0 0@ $03/P H0 0 4 30 ۍЍPd66G-P` ``a V00"5Ep@P5  PI 0SH 0 R0CÐP0P1 U  \   1`V*o`CqhP Y !'CpC 0   1  şO-px- MMM㰠UE0 `JC05T004*0U@@ R R 40B?o2 000TU$00 S0E0 )0S}0000Slp0+(0;(0 @  (02/(0Z 0@ 40000:0F,00 3/ P   0S00*  0.S 0S RV: R R   (0P8 (0* R $ (0R(0P , CQ/ 3 C1100 0 P000$0 000S  0 P80: S 0" $2 MލЍ Rv 0 R u P (0IE(0Zu@T  R e0oB04/P 0 000b$00 0 P04 j 0.Sg0SR 0.SaN Rg  0@0*  2/0S  00.S7 F (0Pr (0 C 0 )P$ 00B0 Rs B00$ \YB0/ 0 00;43* <1G-`dp`" KMM\ؔܤ $ 1 //\P @ P\/\   W!1 0 4 30lKލЍR8/\3^*P`W0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P!K R @ (03/P 0: SW/00Ɓ00Ɓ TyaA/0P0Pl.-O-PM@$$M; ~^0` M 0 p ^  圤*^1 0@^ ?^! [^ !R 0S0^@000WS 0GZ 0< S H@V 0,@ \< 0 0\ S #0 @ 0  p G0 R/R00B0 4[S 0G*0 ;P4S 00C PJR*00S;R{ W @G 0Gz+ @PV t"; 0 2 ۍ$Ѝ@T@0DjSq 0]S2!R020 ]R0    -R0]S` 0010 ]R0! @, ;  0LXm 0\ Sj0LXg 0\ Sd0@* 0Q 0A  001A0 O+Q Y;P\@0 0 p030Pdn0G*0 ;+PU 00[0!R0 0@0SJT@aR+?**l)[!-]\ O-MMQ8@Pp`9  @ ];0S @}\ \ [\ {\^! N\]\@ \ ~ލЍ @ ]RRR @ QP+[S0 S]S*SP[0 P{S &,S^U ' B00S0 &0[ 00ލЍ0]SS 0]SS }S^NU  E B   :  0A- M`Pp 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍA7? 0 A-MMP    ,  ` P \  ލЍ`` K RB ^ \^ pWލЍ\@p@-`Pp@0T1@D 0CP@DP t 000p0S. *S9 ?0C R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S.0 ^ \S 0000S\  00"S 00 CR S 000   !0@- QM MP 0   @ % 0 'p @EO0 00P p \0 0 5 30 Qލ Ѝ0D8  0P07n pn p `p ,G-Mlel` p #S$=0 ˪P@$ 0S %P @ 0S=0SЍt `p+0@S 004 0   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 f5P 000#3R0 \# 000H P5P 000#3R0 # 000 :5P( 000#3R05 " 000 0#S RP@0 S00,P0@@0Ѝ0 S SD  5P 000#3R0 " 0@00o 4P  4P0 000#3R0' ! 0 00R⌴Ѝ 000#3R0 P! 000<< 0@S 0 4@  4P =Q+00P 4P=Q 0 0@ 0B v+00PH l (l xj Tj i <i i i ph xh Lh Ph 00 A-R` & PpPpr@T x9P $P 0S 0P@ W0CQ0#R7 L0CQ0#R M0CQ 0#R N0CQ 0#R 0S:V 00'@T R B K 6P= 0p'@0000@'@ e0 ST@;' R P@ᐺ$: 0'0':Z0ST 0 :00  W:V   Pᐺ0S @:0'0Z'P:P0@[0 0\ 830 0@0@  ' 3 0 00  " @'@2 0 00  " @'@0'0cp08400P00P08040fH о0S 8:0'0'@2:@ Po {g 㺾' @^*v:000`00R 0SCN @@H ើx0@' 0>0@:  吾@' 4@2@G0 9Y0 P @ᐺ0Q P@ᐺL0S0  n' `00C0  b'  P㐺@. P㐺@) P㐺@$@{ d8e ` d @X_ @\ d^ ] `] -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP sP ЍpPA-A`@0S(@@Q0,pPpPR @P P p0 @BA QA3M@  p0 p0 8$p@-p`pP`P @T T0T0 R@@pᖾP00P$$A-`P@P@p0S |@@J4 R"@`W4@jP0080@t|@-< 0 0 C-`\MPt,@P- 0S8|0V $"$ u UpЍ '0P  $ R%ЁpYTL 0N꤁|0@<|||60R1 0QG B&Q&R-.4 ꐀp0 Wtqd{ SzڙHvY T} Y t| Y | X X X d| { w LW LZ @5O-0-4:050u00%AM M0p0 0 $ 000 0000+0 ᤗP0 40 4"P P @\ P 0S p400#S \ P 0S 8d84`0`\ }P 0S d4`0`\ nP 0S 3 0   \ _0P 0S j30\ R0P 0S jd30\3@E0 +/DcD3`0P0@\ 7@P 0S 2P0[[ 4P200xS0xS0Sc 0`" $2 Aލ ЍdR @P\ Pk 0S 8200#SB \ P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ 0P 0S Wj@10\ 0P 0S Jj!0 ! 00P00 $ 0000 003PPW (TW `hV ,V l8(X ddT S |LĴ TS R hpR xR <,T p@-hPP0S P@L@@p@`@` 4]P@GdD@Q R A- P@P0 $S ppp3P R0Pp<`<`0PpP 0R @ A- P@P0 $S ᳖pppq3P %0Pp<`<`Pp O |Q p@-0dPP 4P pD`D`P@ p̭ppXO Q  @-@@PX00O-S,M050 x l% @`\%p000000000TP 0A  0 0?S SQ *S T 00  *Q .Y Q /Q0S $pP [S7 \S0pS 0T ≐  R?\{ \ *\ p [\ \\0pS Q 0 0sY,ЍYj /Y T lP^\!\00$0  0 0P /S \S U T0  0SC -R X0 T ᱰ0]SZ$0PS * pe fT ⊠Ằ Q]Q \Q A X XY /Y( .Y)0S& 0W 0S 0W/S,Ѝ/Y00  0S9 0W 0S3 0W/S00Sp0ST q UT  ᲠQp *P [Yp Q ;0C 0T 00Y 0 P+/Y[ & 0# /#P@@0P@-@ P 4 0 Q 8Q ?o2c 0I I p@-@`P1P L1PT00pT00pk4 0 pH H O--  " M0 "  pb @T ` !1 0 2 30]ߍ'PW 0  ΌpL  `P: 0S;p 0 0Px`P* @@0  ᪹p@ 0  P0PpW*P< ? 0 "C 0 ቹp@003`-0P0000`0 `0O--  " M0 "  Qpb @T ` !1 0 2 30]ߍPW 0  0pL  `P: 0S;p 0 0P`P* @@0  p@ 0  P0PpW*P< ? 0 "C 0 p@00`3`-0P0000`0 `0O--  " M0 "  ¸pb @T `i g!1 0 2 30]ߍPW 0  ᡸpL  `P: 0S;p 0 0P``P* @@0  ጸp@ 0  qP0PpW*P< o? 0 "C 0 kp@002`-0P0000`0 `0Xp@-`H@P@ PPpPpPP A p@-`H@P@ PpPpPηP A p@-`H@P@ :PpPpPP ,A 0 00 <-H- M0S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/yP-H- M0S0 00 0 0 0 00\100M \0    R 8 00 0 0 30KH Ѝ/>h -- M0 0s'--M  --M  A-`ppQpP @Q PD@0 0000@A e40P R   0//ċǟ7O- -/0 0ᫎ0S@p 0S 0S,/0"S 4'Ѝ T1r0:/ 0 Ѝ0@ ̳p@-PP7 0S0 K*@U3 0U.  /Q0C U!@# *0P/S@ B=>@T@!P;P h00pUX0 B@T@!@@4@0/S @ @ج o -0DM 000 p 800S DЍp@-`Pp@ P ϴp V U ph Cp` VI@@ 3 n Q?o 0?oA-@c^?c%^& ^ `@6$6T&pc@c$0GCH6(0c1C  1. "0;:(0C0 /0 @- /? P!Q/o /oC-@@bT?b(T) T `P6&bpb0xBy66U b1r1 . "1;:( B0 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p Ji@ @-fp J^@ @-[pPP `T@--00p@-P@` <Ppp@-P@ <Ppp@-P@`D <Ppp@-MPP`V f@T |00(Ѝp 0 : p@`$ ֱvԪ4. 00 R oML,@-f-00 0S@Ѳ /"br1 0!@0lR0cR0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`( @L;P PXY  P 8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍtpP @@ @5(@$|lTO-`P⨏DM 00 ?0000 P 0  R X4p@p%Rt @0@0S 0R`0 S S0&4//#b!!"AK/ "bQ3:bQ#3P. ! P0 !>?3c112AK? .##.cR 3: .cR # 3010!00C0 0 0R PR02R0kWhp`% FURb,`_^]\[ZYXWVUTSRQPONMLKJIHGFsRq(9(<;:865 +*)('&S2on ,{sk"f  ; 000V `DЍ0@@0@000@ $p (Ph`8  0`,pC@& P9P @ T 0S $p ` 0`(P,pC@o& P9P @T 0S  0 00S zV0@  000 GR +Ro -R 0400pp\:S 2a2c2SR0c$00 0(000 50400nU V 4 00000 @W^00qWZpWV8  9 0N00 494 4 W B 00> c0400@0@0W%S.UW+ =0 00v W\ ;0 0x0p S00W000 [ 0h00  0Y00A c04N0S00C  4/"b!!!4    (0 404c030S4 !!!v.B B4 00 ǟa@ 4  0@@0@000 0 B R0`0` W G $0 0` @% $0 0@ t8 0P `2% 0@ h8 0P0 00 Qu4 W ! nWl 0 Rp00ZXW^ 000O I 50400 4 04 4  B 00=4 40444 v.B B 00, 044 00@aa B + WP  RM 0s 0v0 @@?3J⊡j ` ?A1c1c B  B0  UR ZRW R   @M 0 0$0t3 @0(004X $p,(P0@W00  $p,(P0@W00 #/#b!!"A0K/ "bQ:2bS0#03"10 !A 0  4 DRd 4 0 MRU 0@^h  @cQ 0 "#^  z F 0/o"#PzVt 0@0 0 B8 <000C Sp10^S10L0"1 `GO0!0 BV 8 <000C S 8ִP 000 TR RS p @H0 CR > A ALA p \WOJQ @ 00 0b$00(09PP)\(\ ף) 8) Q($ n# <# l'$I0 i Q00P00C4\`000s\qT0?2c 1A;S40f`2ca12T @0@000@-W@ A\N A R$ M a"b"b"@000$ (0$p(P, 0$p(P, 040 @) R& @" R 00@ p40 p  0P 4 @0000C!( .$0`00 p  0P 4 @0000C! ( .$00 0L"0p  P l24 0!0@0c( 0$0| 0 0 0Oxp@-P 0 00M`0,00 @ P00Q Q Q ' 0 |t  , 2 0ЍpP ĭ0< ᾭ0( ḭ0Tt,t,t,0@P/ P @/G-X# p`"V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR &@O-` MV8 VPA @bP;  pP< L"001Sp YX Ѝ0g0PMP 0 0P 50 0 :"=00 3"& 0 )0@-RQ M@@  PP TU &0P Ѝ0 Ѝ0& 0 Ѝ0G-p!|1 0MM050`1`P L` PPp> @P<@X0^00pAtAK0O⇳00 TAXA\A B7qύˠ$@P,0  (@ @@P P t `0 0 5 30ݍЍ@H&0@0C&0@0{0 0 -0 |--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-R( M @p` R00?yI00P @ P 200 P ! !  :1XP<  6VP WE V[X0 SPpp` `2(!(1 00 Ѝ`ᲵpP2 PPSPpp`000XPC0 P P00 Ѝ0`f0`ᆵpP V pP `\@-@ M[(0S2 0 `(0` 1/qp0Pp  0 0 PUR <0PUA ЍPPTp 0S  0CP,E%P0p0@-P M(0S< }0 #p(0p 1/qp0@`3  0 0 @ToR <0@To1`VP ЍP@T` 0S  0C@o%T 0 $ 0 0 R/p@- @Tp0 Rp 0R00  P 0S P0 c ( 0P0 0 S,P 4P 8P p@eEp@-P$@@ᆱRp@W@- @@xR@rLW܇p@-,PPk S@dpW1!0C-M P@00S   0 XR0  S= `8)p@ X80CS60I0 S0QT-*@DT)T' @00TX   "Q T #R.S 0a A 0C "T #R Ѝ`0@꨸4  R  *4 8/ᴅ 0X\S 040:8 R РS /QxB@-Pp`P@P@0@D尀 ჵU  [ %@  - MP@ #0 Ap@- h` PPPp P p@PP3f]UJUI1 \l00p00 %00p70000   70D3z8I` H3\uDdDtDC=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 T,1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/000$0S P 0$000s$s\B,BrAASR: G-P000pS` 3/0Y @IOP  T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /@hq4q$qp$@pSR; G-P000pS` 3/00 Y @IP ְ T0 0 0 0  Y @IP ð TT0 0 H H0 0p` P $  /?Lpppo?oA-@P QP P@`p\Pḯ0`P PpW S0"S ᆰK@00@`O-PM M Q0` 0 Q /QE P.00G sPP7p/Q/ Qp @0/SS.Q8 0E00 0C S$/0 D 0l I0 0 % p 0: S-  S/ A/o" R_/Q PP?0V0/0000 ލ Ѝ DR .QRV  u/R0W01ʨ! su0P3 00  R'0 (/QpPVP/0000ލ Ѝ ㏭`P `d00>0000?0000  p@- P\QMP>  HA@00_ P@ 00@T' 1`0@@:T `^ 0 \S 0@ S @ 0:S@:T T0 0Ѝp\0P mH0 0Ѝp+ 0 0`ꐜkjj0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/80A@-@\  \:^|^00^0S R B|S0 0:SS O--MM '7 $0pĝ0<40t4!S S TG@`V 0P0(  ㎬PP 00S < [ & D0 00 P@ 0:Pv00 ` R0@p`0 S Wp :S \Sp S Spp p0Ti*R0+   P 0`0 SWZ@p 0#SS  \ P5000S 5P0:00,0:= pP 0:RPh PR0t4 00 04pVP/ pP* p):00e00Z  0 Sm:00i:SZ @0T:H L@D P @P4 0:R` ` R,0 F C 00SpG:S:0 0E I0HZ 0 D0 04 @PC00EpT@DpTgH @DpGPEP @pPP0S j$ D0AT0: 0P#2 0 <4 30ݍЍ00 0x٬PP@ dPP} T|2@00@S0-0`S嚭`0SRM Z0@厭U@00    :@z  4p,P0 `0 6/p P0003/004`X80,`0C0000e p  PP 03/P$0p0H?o20 0Pm0@600@c03/ 0  0Z&0S 4!$0S 00 ᩟ ᦟꐙh 6` 2-M 0 PЍ@-4@@ P 0 000``3O-p0`C M M\@` 0圓S S P@T 0S l @P 0 0 C R 830000#30:Q0#Q0S(  0R\Sz 2@0 T  P iP 0 0P0 P 2 0   >0S00S\S00 R{DAP 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@M0S't!H1 0 8 30H ލ Ѝ &@P 0 0 C1 0 Y P @P . @@PP P % @0 0   0P 50 0Pm  @j`Pd`0` `_ _^̎]d]D] 0@-@PP MP 0S 0 0$0 0   Ѝ0@d\4\G-`= j@P dtPP 0:SS   d: p \S@0* QP 0:SS ^S 0S:S 0Q0@P PBd ᷪP 0P:SSd Q0 B@A0n0S:S 0C\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/000C\@& @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h P5P@ @@ @ @| 0@0wA-P= `P7 d㩨pP9 0S:S@@c0%0:SS   \0@AddP pA\@A p`pPê@`@@Ṫ@~ 0@0p@-P# VP 0Q @0XS@@<,00A ^a AR70AAAW0A^TppO- AM M0p`#S\3 00(0 0J @`/004 PPO P8T   .00CS4%210/.x,+*)'&%$#"  㟜4$ 㛜` 㖜0:S 84St0S00"2 0 (0 30s K P( BKI8T 0:SSa0 44 440$0<4 0 S BKJ4$; T44/ $0C 0$C0$#<4 $0C 0$C 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR1fPLKJj]~}|{yxhvutsr0p,+*geJ`\[Yv``YBR0000C`0 PB 0S 00 0@@00S0  @DT> = P0  P 00CS0000@ 0D S*v00D00 SL0`I4 @<0 L`  H4 8 BPR '+[ 0ZpC0P M:jWp!vPP p` 0P + @MR^f\dZYBTSNMLKJIH654321A@?>=<;:987654321)/.-,+*)(!   XM P 00CS0!000pWP0 1S XR    0 b $ 0$          00 0P0 0C0000 S000@XT @0 !P0@ S0 B0 0 R P00S000000S0O >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E   BR P X *P@NU 0U00CS0P\0X 00L*P@ XRo  BR  PER*P  P0@@40 > P<D0U0S00CC SP00[ *@@P @0ESH 40SH  P  0@0CSPH00 400  0T0y: `8 <@DV*T *T@0 PT0i 0$0` 0  P 6l$00 p400S P0Sr 0$`0 00000S 0 @0CS0P0T 00*P@+ E  BR P X <*P @  P 0 @0CS0P0 IU00CS0P0X 00*P@W(  R H  R~ WW BRpP  n 0@@N 刀WiU nU00CS0P0X 00*P@ R8P. ARJ p BR P@ p; jP4W2*0P@(U  BR P @p$ SPW*0@P NR p BR P @p 00@<00 0D     SLꈀX@ @@H00@900 0' 00  $  0$  㰀   +  00{N z| ,  C > 0  P 0 0C 0 S P `00@00   =00@<000 0P0^U00P0@@80800,H0U 0$A40>>4 0@<@pD#C8`0-S ]Sm Sa P>>4 08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0p *  + 000@ 0a0 0@0[ @40S@@@XL  M ;PK ?PS40bS9  P 0@0CSPH0  0 0 0CS0P0R%*P00 P P04X X P40@0  P 00CS0P0[ *P4X 9 P 0 0CS0P0R*PdSꉢv00D0?L0@`0@0CS0P0T *P00E PT* 0@0P PT*0PT$0XpP$0P50TP`p00  00S0P0S)@T@ 00 0$@P >. #RR  PR  B   P 00I P0>>03SS 0PU0C0000P0006 0S PP PYR Q 0$@0 0000@00C P0BP0 6PX*0 @PV 4 *P4 R*0P  P R*0P00 `SP00[ J*P @Y\Q$@`PPP0 - P `V0C0P0P  0S P 0 0 0P0$@ P0PC PT*0@PS$0xxPp$00400TPpX` P @0C >>I vw 0 ӡp P p0S P0SY4Y 0S0 00 0 ṡp ᴡ>>3PS 0pS0P0C0400400S mPdXb*0P0@0 0 > ỡPD @0C >>`F  vo  0 n0p. P p R`<@pD8000@ 00=<@pD` 'PX*0P@P 4040P S@ 0@00$00 P/h$00 PaX_*0@PA P[*0P PNXL*@0Pb800C08000]S ,0 P 0 PP80H`0vp80`Yp  P{P00 rP400P PT*0P004 PXs: `8 `8<@TQ @t YJ `8 @< `8 @D<)0S@F `v Y?` 8<-P$ 8<@`Y` 8<`@0 `8 @C<0 S@!@30PUG$P  04P 00 0$P:U$0X`$010:0 `pP ޟPg @0C >>p G 6 0 vᒟpS P!YPE" 0pS$U PU WP0 T! P@DJP UGLp YPE`0pS 5P W P 0C P0 )0@Pķ 0@-@ MP 0[0 0P\ Ѝ0p@-`M@P@ G4P0 PFЍpLX2pA-0P7 !@00S5 (0`1S010e C000PP! pW@0P@ ዝ`PQ 0 0 @0 C PC0000   Q  Q*RQ' @<08 0  BP0AP00`0 ޛP ; B #A ?#@ 0# B0 PX4p@-@P yPp0 $<@-M@ 04/@PЍ @Ѝ\0\ 0@-M $̜0@4/@PЍ @Ѝ\U0@-$<M0  $@4/@P Ѝ @ Ѝdd0 @-M00$  $@4/@P Ѝf @ ЍT0@-$<M0  (@4/@P ЍL @ Ѝdd0 @-M00$  (@4/@P Ѝ1 @ ЍS0@-$<M0  4@4/@P Ѝ @ Ѝdd0 @-M00$  4@4/@P Ѝ @ ЍRO-M@pD0X`@ P$ 0SP  $,0  ;/0$ 0H@ 4/@PЍ @Ѝ$ (@- @MЍQ0 $<@-M8@ 04/@PЍ @Ѝ\0\ 0@-M $̜08@4/@PЍ @ЍQ@-Pp`.t@t0@l@ U  @0 r*$ ᰙP  D 0O-,M`PP tE@0P0 00E00X5p0ʿ00 0  P @0 0! B1 b80B p  U\ @4B 0@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0$ 0`P S^?0@00 0  ߛP 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\  r  `0\  s  `0\  a  `0S\000000 0``0\  b  `0\  t  `0\  n  `0\  v  `0\  f  `| @| 0P_ Z0\  @`oOA- Q@Pp` ᆛP=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 AfP A-p@P`P$T0 AQ_T !T '0DS(0$"0 !@1% 0货 O-pX'-SL7UM 0瀁0L10,7儱0001P<0 y @{0P(0 b`s0P,0 00S080p 9P40 H  T. (`000P@Tp` U T 1 # 0P0?0S0e PkP P6&0 d(0@FDA T @! Dt`)0P$0 0 :40S V D0$ 0C BP$0  T5? 00*R  05` 0$0'R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/P@00$,(8($4 0 L1 30Uߍ<0SP >@- M(@ @0 0 D <0 0P@ 0 30 Ѝۯ< =T=0@-@QMP0 0$  PЍ0` @-R M@0   0$@ Ѝ p@-0@Q0MP`0 0$  `Ѝp蔯 -M00  ЍD -M ( Ѝ -M ( $Ѝ̮ -$M 0 0Љ$ЍO-MM⑞)< R 9 Bq Pp`0 `p@ yrWy `% W `! P 0 R@@ W U ܍Ѝ00 S U  应PP@000@0` @-A!!!!p@-@P 0P0 @p$0A-S`P@:T0 @@T(0  0U  @@0S! 00( pnz0S$ @-`QM@ ᱊pp.  8<0RP@D0RP [P00V Ѝpp ᐊpPG0@B@ЍPPЍA-`pP@P \0 00X0 0 0P `$05%0`@P0\X0@5@-@M0SXPK0 P[0: S S_  SЍS P P 0p`P$pB0` \0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U g:0Ѝ]0S \040. SЍ0$0 N Ѝ ,0 O-04M` (07Pr ( R ,0pB Ror 0@P0,0 , !0P 00,00, 0A /R ,0   0 00 $00 pK0L0000000S 0 050$ 00Y000@@ PP ,  0.Sf  0 @P [@0 0L00,0 0S% % R R,  B $000S<R\ 0 0  0 , R0@PS0B0 0H00CPSP00@t@0,0 0{0 &P0 S ,  0 000 0KR 0\00 050S 0.S000,00 00/  00 0W 0 p0Sg,0 0 XS 00C 0 00,0S (0XS 0L0S,00S X5 (0SXq4Ѝ0@0,0 0  0,0 0px@W p媔W @m@,0p <%,04Ѝm 505[0 0(0SX p4Ѝ ,  @/Q  , 0S  \R   B  0SL0S0 \R   B   R00L Rt 0p0@Q 4ЍOi(0S@05  p0$0|St0T  Pl  0p5l徇Pa 0$0 0O- MPp0@Ph 0PS(,P~ `P0UP1S Q3PP]L, 0 PR `0VL0{ PPP`V" 0PG  ,r`P5 ,\00 LP05XU0P```PVXY000P!, MP , 0 P51 Y ᯓ ЍP婓U ᥓ壓ᡓ@ Ѝd00`@00 Ѝ  ,0 PPXp,00,0,0 P PD @ l 0p@-SP %#L R/@T@XL 0RR@T @LTP FD,@ ?@p(υ0džp` ƅ/p@@弅%T @@@- M@Tj P,,f5S S%* R| ` L0Sy 5S0S@`T`L0s ,0 @L0S,0 $0@S005` Ѝ 0BSR@ @D 0R\ 5`V `̒V`05`V    ,`弒V`P@,0  @ Ѝ P@ i50 $ 5@T 0   0S00,S,0`P00\` ,0/P Vv p 0p0 00@ ЍSR 0 , 0A/P0/0 \ @ Ѝ5#W,0T! PM ,0<,0 P,0 ઄p(W 505t,0(寅P;(寄+@妅P% (奄<, P 05,0@<,0Q0S ,  up( 505@@90 0 1\0(`p`,0<,0&0 $ 50 $ 5  @ R%/@- 0 A-LCPp`w@,0<0"% R0 R@T @垑T V,0`<,0L0`S00/S , @ 0t pp0@ P06 0 0 x0x 0p@-@P R 0`00SRp@((((FP#x$1$0A-P (M\`@ @Ppp 00 0@ P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080"0 0(Ѝ0" 0  0 0 !0Q/0S/S/O-pM`@ gP-TPk +T@` 0 0Th W p pǯ 0 b 0 ZP !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ JP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@P0T0Ppp@-BR"^p@?@P0T0Pp@-LMp`@$0 P 00 P LЍ`0 2LЍC-P!1 0MM`0p0<0㟍l! @PS `1 0S 㑍P(/ k  eP& 1R P$P yPP 0 0 < 30&ލЍ 0娀R 0 P PqPo0SP 塏៏f@P(>(嗏0nSꖧXPdxnfsuniop@-`T@p@  P@P p>0P9Pp`@-M @sp 0: S  p  ]Ѝ 0 ЍЍO-P-$M$@p @-h300;#;S0 000U00Sx00w e00@P` U *B@F `PP@  00 ᡂp P@PE0S: 0S00 "  X*0 P  P 1T0PJUPP6ፌP@0@D`@0 @@p$ 0$Ѝ0 ῎000 x00S0@ 0dP @  0! 0 0 t0 1@T 0. 0 SZ@ T  i 0P S ~0@  ppu0 7P1p@-P ^ @T @XT0 0p  0O-P M Qp 0 `eV 11* @ 7/P  T VK:00S0 0 ЍO-RDM4~Q@ 400008Pˋ P$ x 000T0(0u@D4` 0  $P00( 0  :/@PppV*000k000 R`d `,@0P@P U` :/PP 0Y` ,@0PES*0p P@0PU* E03/P P 4 0pE$ 0pZp 0  S ^ 0* 4@ 0 ,?0( $@40, S ,儍@DЍ$4V  PH PW0P@ ZV 0p'Sv0( 0S 40,000,($ 00P<0 00  0( 000,S$  C000(0 0 0$ P0C, 0 00U00U0#Sz `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 00( 00R00  00y 0SPp 0Z:0  J3/P4 0PJ$ 0PP 0 @Sp'HW0 `0@  S`^ 0* Yd P @ꉐ 0TPU:/P@ P [00P50P1p1 * @:/Pp [:P0@V0US[ 0T00T 0003P 0RU0 C0T 0T0@D @3000@  U 00< P @IT @00:/P 0TPP@pE tᛀ) :/P p PU0@P00 C0T0T0@D @3 P0@ R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 S( , $0, $ ,0YP0( 0 H$@8 -,@j0@0$0,040$0@p@-@ PU 00S  RQ Qp4P{ 00P{  pH0H 0 R@-@( 0(@ xp@-M @T TPT @TЍp0 Q 0QP ``0` P 0 RЍpA-M@P`p0S$00;0 0`  ~P- p0 P' 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 0 R@-@(w0(@p8 xA-p`@PP0 00S (ZP   (Np0S `nP   _0S[(4V0SR00Lxp@- M00 ?P 0`PPp@  Ѝp@.0 S*@` ЍpHŸC-`@2 08M000@Ϡl1?2c A1A11A@@>a\AD00ä?8P=<;:9ZDDW7/.-+)(5l_#$~|H F-  U [n 8-(= 0 |0 30}Ѝ #`!!4A ,P0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0 K 0 S 0! [ K 0P Qd;Q0 0dP   [ 0 S  R    BtQ1:0/A!b0dP   [ 0 S  R  0  ``:Q0 0dP  ц [ 0[  R  0  `i 9Q0 0dP  ᨆ [z 0 Su  R od d9 / b !QQ0 0dP  ቆ [[ 0[V  R P8Q0 0dP  q [C 0 S>  R 8 0   ` ,0 S0C0  B1D8Q/0A!b0dP  B [ 0 S  R   1 '(0 dP0  ( [ 0 S  R |'1 00dP   [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R  001?2c  1R11Aãd0Sâ/d0CS0c0(6dP0 ὅ [ 0 S  R  08   8  `S80S 0R05o005dP0 ᒅ [d 0 S_  R Y4 0  `*M0dPS004 0 n [@ 0 S;  R 5 [3 00[^, 0  ` 0S8 qp  qp 0P3  0S! -R? S30 [ K  S Q X# L "`1aa!B! #<0 dP0   0[ 0 S  R  0  `/  0  `u`0 0S  P Pt [ 0 S  R Ps0`8 i0 S  1h [a K 0PZ QT0S 1 [L K 0RE Q?UP 1 00 / b !Q dP  T [& 02QlP)\(\ ףm`` _ Q P_ (Q ^ *0^ ] ] \ L\ [ d Pa Y ` Y X W I `I tU > = = = = P00/ 0p@- VM0PP0T10p! 0P1s`@s s0P`` S 0#< ,0 0 T1 30VߍpV<0p@-M`P[@@PЍp ]P S[P N[P 00000 PDO-(,p`@T[PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW }P@@Ud P~00P WP: : G-`R p@P8/PPV @!1 G-@Q0MP`000S UI U tP.00!1 0 0 30]Ѝ 0p  )0P00S000 8rPP 0 -rPP $r0SP<Up$0T  !rP/p0p  P0p  rpP  0P@៳00 0qPF`~/ B/0  Q B  /0S %0C 3 0% %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 Pp P Pp/0S :p@-0C@0 P^ P Pp/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0$00$00  /00ꐿpp@-P@9[P 0S S pp@,[ZP p@Zp@-P@[Pp> <[P [P 0S SYP p@Yp0p@/p@-P@ZPp >p@[ [0@- MP@YP Ѝ0ZP 0S00 c[00000S /p@-P@YPpZP YP YP p@Y0S S  /0S0/ R R   /0 / 0 / CR  0 / 00/ 00/ 00/0 0/ @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< TP7 iYP P (! 1 0 3 30?ߍ(3@ R. R  0 z p0S Sp0%  0 | 0 z  R4P  R`t0 0 O-IM4M@PJ p`$ PI=,0 0S S  pH@$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岰p +4# 4J8#8  -z J=00PnJ=  0o0SO S UVZ J= 00p,$3 00$00':00J0 40PP @'0Sn0S  0S0s S0S J= UV 0 ( J= 00piY\ O < SPa iP m 2b"!4b4#"R<J= VU 0 p[pYpU<0J8 J- 0%$ 01Pj 3J=00P00J= 00lS Sm#< iJ͍ 0 pp p 00SSL2Sp S SJ= 00Y0  ISP pJ͍ fPpԒ@. t. -  + O-`$@4 0MQ@pDH 00020P0CS,w6)('&%$#"! : QWX00 R04 0S SQq#3 0 0 30Ѝ30030H 0 D@pЍOgWX= "44 X#8#8 xpP'T%0SR0S # $$("(4 "8#8 DxPT QWX00VTDpVT 00" 0  x -X* P00Sz "0 xT@@? 00y!D txPTp!0 gxiT 1i #Q\倡們P0P p0X! 0 JxP030#?W@D p0W0 0 7xP030#?@D0Q0 0ĠĐ P0 pUp@D 0m   xP030#? \  xꍑ( ( (( ' \' 8' 8 & @ & 7 $& 4? % O-p!`1 0IM010> P@p6 .P PV 5P&VO ]0@S008#<tx'4'< 110↶  0 'xP 0 0 1 30%Iߍ [: J@ Z"448#8WX 0S #P 0 I0\ 0@- M@P 0 o 0P  Ѝ0R Ѝ0p@-MP`P@@P@T 0S  R0S 7P@PЍp/zPPЍpp@-PM@tH$HPp0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd10@- $M#B 0( A S0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-V/ 0  00S S00/ 000S00/00S 0@-P M@P4 0PC@,0S0S 0S Ѝ0/O-P-M@"4M0 0$08 ,0 2p0:,10`0(000  ```   P:1000 0 P@ 1] 1#X 01  8 P 0 00 000 08J P V 00 8,01)؍4Ѝ !448#8S 0 0PU 0S $0S S S ~V0 0 0$0괎tV0 0oV0 0jV$0 0 @PA-p! 1 0AM`@0 40VP PPU( 0@ `t # 0 0 4 30Aލh0 RP P@ .R@ @A>PdEV 0 X A-@TT!0 MS  8 S* e`V" pP Q 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL0 0 0!  "@-`QM @QPp Q Ѝ RR dPP,8#<8#8U R R  P0R  Ѝ  R RD0 P 0  ꌨD G-`p@ dtPP  p @  p@!O-@-hMd)4M40= ,0 080&<$00P :&< 00!S90C &, R &, R(0 0: "448#8S_n 0F @0:0 0 piTP00  03/P &< 00@&, SS 00R0S00j 0P0<040'4tx'xWG [7 0D0$`>j,P@ H0( 0 ZPE0 P'TpP^00  03/PU @TpTTZ 00S W+ &< 00SWWW !WU W<q0@P0S(0S<80ZCW$0HD00S S80 C, 0 0SP, @0(PS$`E @T ȕ@ pPlp tT7 @0 0%|%x% %% % 0000 00uWP + ,0"!0 R R 0   PR, PtTU LE0Sw T00R @p$= ,0 2 ݍ4ЍS0@0&< 00SQ  G'WR.0@Y: T:30 0<q0@PN0pSpW 3$(%$50 5s (0S: 80ZC@$0\RC.@&< 0@IPF #40 0%u@00SD@sS00<:04Q < } y$0DRC.@<0H %u00<0\2z0 0 R@P 00  03/P U 0R 0^0<@j: @"448#8SPPGSP=(00(0Y >Sz :S7S@\10 0 LRPP00 ! s@ P qPP !#@ L0R4  4 S Q 4S @00@PRP@0@0S 0R $ R R $R 0P)밳L `l  O-`$4SM 0@0D10pPP pP $p xY8P00[3  P00 000 _P @pPY 0  MPrr@P#3 0 D1 30Sߍ0000~R Pq 0 .P0P R R. B/o" Sa d! S8*0Sn 0 00 DD0Q 0 pp00 PaN0=S HR0S4 S* S) p0S 0se[j0S 4R00jrhrP0  Pr$R0S00G 0 k000  Q000S000 0 2 30ߍ0 0|0 S0$00$00 `P$`4>$00,0@(z `\6< l2 L;20\0 |0 S   S  Q  RQPP  XPppWS|0R0Q0S 0P^㄀Sg : P|Q ,0 z0S Q0zS %)0P40 pᭇP8x 4  B0 pU0P00^X[ 40 4<@D@P@`XG 0S0pS 0S S 00S . `P0 0 ;` R R R`0S0S`;0SX: 8`S0$00|0 P4<@@`D8 o00SzXz\t0zS0SC x``>4*4: 0 ,*@ 4 *0,`$@ 80Y?@ <0V 0 f362 F;2P |0SM0 S F SRCQ Q : \Q^3R?o20S QP`0 `P0 000804 e?0<00PVX@P񏐒0S Y`V `tV`Y(? Z 020 P @ 0@TPU ,m0P0 gP0`ภnT0:  0@@P@ PPGnt0S 0S >n  t0`0| 0bP)`: 8P| R 0z0S Rx0z0e  rP : 0P00z0S z`p,@$P00u`V0 $P,@P@@p 000 Po`V  R R R`VQ $@@`P mmV$@D 00Swr 00`|`z 00 P 00 :0P00 0`z@P mmX_`]  Q P $0 X 0S 0A\?o20 P00S>0S Y p`5 P 0 R   L" l1, 0S = 00 8Jmz`jP  0 @@uP`H`ZPjP HJH YHT0 V@0T* $m3z0:0$Pt` P@z X`@o `X輐Y0|0D Y000 000n 0 >: А `P n_P3D0L  L0`P00D( | z0T SR S ^  Q 003 Sኡ*0 S :0 SJ 9_@$P1 0 ez0"t0R00lPP @0T 0@l@0T@{lt02`zp,@$PD,Lt8 L4  ,h Ii . >⣩4 ]`P1x00x0 ClFP@0T00T0@7lP 0`zO-LM XXa `@  PP00 0PD pp R R R0 T@}0Pp ((0(  P00 U pWpW 00 pW0S 00SU$@LЍTT P G-`M  P@P p ` @900  0P <0S0- `ЍqPk 0ۉP k@D@PP <`P>K 0 ` O-`-M0P 0@0SP $00S(ЍT @-@ aiP 0  @0O-p"|2 0M020) `@1 p! GP SPX LPPQ BP Qp!1 0 2 30`ߍ[0@SPX S0@SZ00 01P S00 0 P ZY0 S 0 . 0P0 Y:   X 0S  XS  P 0 8 0@- M@P 0 H 0P  Ѝ0D Ѝ00A-.L RO-LMP `0 D@00p840 <0T 8 0 ȟ 0%00#0(<  .  " b* . ,@Xǂ@# !p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpG@,4pTGǂ@@# !84Ga@@ 0"00#VP0p: =T0hV@Hp` J0S@@:p`F A$p@-P0M0`@ 0 00 !? 7R8 bx b   D 80 0 0 30X Ѝp@E~y yG-M\\Ÿ T2T"0 `00  p6 0R P  0XS PP`0Oz`00TAXA\A 0ScP" 0 jpP 0@d0P 0d X0 0 1 30 rߍP ve00; 0P0s}tBs 0 -0 ds -- M0 0 ЍЍ/-0 -M( 00 Ѝ Ѝ/r@-$M@P| |P|0p  P  @p @X@0`V $Ѝh r PP1 @- 0M`!000Xp P@    Yp W@ 0 0 0 30(ЍWP@pW @@T PU 0SP@KTF0@0|$riqp@-@P0d(0Pd(P,Pd 0p0PP 0P 00 0p`00 dP 00 0p<   / 0@-@ 0 0 0 0 0 働 0 0 00@-P M @0fd 00P 0 ??o2 c0 Ѝ0q2 00 0 0p@-@P0 0U0 0pp@-@P8d0PP4d(0P1d(P,PpG-P0P] `PV 0@00 S S0 S S xpPE 00 pY(",48#80: ,r@P q0p00S S S@ 0A S  AZ0@P 0S 00 00bP  bP0@|@X Ľ O-P Mp@,0(Sz: (T^  0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00%  0S000   0S& p0@:c0pp6c(0p3c(p,p@ ЍMbP  (,@N(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 P Ѝ0.p 0$0$ . Ѝ0O-@dULMP$0  @@0 0PH$0`pPC 0 @@P8$PPU 0`Q QB QR Q' 0U 00S| U`bP  `0 @0p R  R/ RY R 0 @Up{b 0J[J0 0 0LЍ   @QA@  0U` (⼐p 0  ,v  p0p 04`kW G   ``` @`^ `@U 0@ @(bLЍ 0@@ bLЍ `^ P@Q  QA@ PT ^ QP @  ,  0 p    S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` `,`  ` `  `Q@@   P@U`a a`UO-P M<`p-_``0@ p    $$[0`(0,`ĕ[`3,`XI0-0(ppP p3 QFpv&pUU`+ `U( PV%Y5X( 0XQ #((R8P P4PE2PE1PESPE`0h ˿PEP:`4;P Ѝ 0 a@ ЍX030#1!-05-0%0Y" #((R8P P4PE2PE1PESPE`0i ᗿPEP8`09P P4 :0 P0 80p@-MTSp. @Tp5 `0v0'0 @PRSu 'V ҕ0Px  -P Ѝpp00TЍp3Se 0 Ѝp*S A-'Qp@D P`ᤕP0 AE00 / @-\ ,@\ \ Q :\ :A 0  0 A-@$MPE P0( O4`6 6v:p`A6gL8'@87;p$2'6g37 L-A@\  \000 8L9>031  (0LЍ1 0 0@-S@ 3/@_O- MP@X Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \᧗" 0\ P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QTr0`   J 0p Z K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B0᧗"Z P Z Z 0\ 0X0 T0o0 pj0`Z$Z5 Z1 Z3 0 pY0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`@p`G0|0x0t0l0h0dy7 \ < (E ! 1 p@-`P00 01000C 11.Q   @@P0: S@"P P p0 P 00C1 000APP 00LDLxY ʚ;8 d4 `ğ0A- 0@P`@V @0`C0APP@`@ 0PP@`V PP`pV p0`C0qPPp`@ 0PP@`V  0`C0PP.S 0`00@000@ 0PP@E0C2S20/.-,+*)}'&%$o"! kf ]OK@2S2[0/.-,+*)O'&%$J"! I; /*)000 @ @  @0BdABdAdafAAFBdABdRnAA0000paP00` O 0PEQQaP00 E 0PEQ`P0兀ಀ00PE0 0` 58X0@- M@0$BÃ!l! A1!1@DL 1D0]PAD0@% Ѝ0l Ql O--(FM@ ' M8 t d$ `!0PP006RPPU0@06Z0P40 0 060: 6 0: 6P0: 60: X0,0h60< P0<0 0  UP0 ?oR20S 80`1  <0` 0` 0V T c\T0P0S50:,0e?Ⲁ5`0x0 `VJ X,0p?Ⱀrd50? X& Y80*2\PT,0? )R d4`0   NP,4 *40 eᐄ40 [p40 \QT4 0 `HI0S|\P ,Z0P40Z0 @#3 0 d4 30Fލ Ѝo`: @\0S 00SU80`1   ]@ [0#2 0 d4 304Fލ ЍO0\X$弐,0!?0"( [YZ2DP0H@PJ[IIY:`d 0!$4$(#"(R(. X f[` _[ Z0 Ᾰ1@ 000 .)ZI0 I⩸YDPH@ ꈡ0   ᛸXh0  0 ㍸<`L` [ Z0 ` Lu0@ 000 .) V[] ZKsSR ` < ? >@ >` ķ C x CP pO N   | D O-tM@@ `UVPPk0P 0 p   0 0 4`18,SἴᲕ0   46< 4 0(V 6< 0A>0PPU R800 0Z`1S   ;`1S0 ط0 0 PL0 0 P9P P P&0 0 P0 0 P0 0 }P0 0 qP0 0 fP`1Sy40S{ < P5p0pW  0R  0Y$pW 0pW  0R| ,0YpWg 0pWb  0R4 00YpWHpWE 0 PS 0 Y`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 001p0 001p0 001p0 wx1p0 Zv[L QYtЍ tЍ 0 શ/0 ࣶ0  0 0  00 x0 y0KLp 7X @ 5 H 3 x L | p P 0  Ь  @-`0 0AMM0 40@0p0 0 8PP0S sD 80 0 4 30AލЍ./aqClC0,@- M@ pp Px8`PYP 0S@ h Ѝ00S.S 0S Ѝp@-Px AM p00 ` $ 0 @P  8 ,0 0 4 30AލpqlB$B0p@-S@` P0 @S UPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝt p@-@MP`X0S 0 @S 0S@V00ЍpO00@0 PhV00Ѝpԧ 0@- MP20@0@x0 @T U Ѝ0l00 PEU:H@@ Ѝ08800 P@5 Ѝ0- H \ D3 Qp@-`M x00<@P 0PU  0VЍp_40P0 ` Ѝp @@,h \,0@- MP0@0@? @T U Ѝ0p00 PU:L@@ Ѝ0<00@00 0P Ѝ00,ĥ ԥ 1 0@-@ M T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPꀦ H P  h X p `   0@- MP O@'P Ѝ0 0( 0P  Ѝ0؜ 0@- MPl0l@0A>@0 @T U Ѝ0O,0@0 P Ѝ0D(Ģ Mp@-@ML ` 0 Q0PP@0<00 00. T @D S000T H0 0 <0 30 @Ѝp@Ѝ/.0 TY/n$:| 9O-PM`@P P 5 p 1 0 R ЍPv SPPP -\00 +\00 |3P0 0  R0N1011.\ 0 @T@ ➀( P 00 S #3@  PR Z 00 S # 3 #T$P+<0+80+40'<0'4 0(<'( 0(4 0((0P p 0S 0p X 0T00  0R00#3@0\SP   0R00#03 3TP ,0 T P00 S #3@ \RP 00 S # 3 #T 00P 000J00  0L   ;,9O-pQ- \M0 R Č  $Ȍ (̌ 0,l8,#4\ЍXZ HY 8ig MbQ` t % d P @ @-@P0D .R S0*SQA@0T.S 0@-MPp00P@OO 0v. 0 0  l;Ѝ0贚 C-`@P@ MPpOP @U QP@ W @ Ѝ @P@p0 0000 Q P J0S0Y@OoB@# |08 C-`@P@ MPpx@P @U dQP@ W @ Ѝ @P@p0 0000 P 0S0Y@OoB@# h/, p@-@P̴00CS0 S  P 0` PôpT`00CS 0 S R 0/S0@-M@0 0ᐴ00 !R !PᎴЍ0@-g  0S0@0Q R  004S 0@Ol@0QR Q  R Q ,-Pp@-@@P@0P`0pp 00,p@X0#,,P D D0 p@-@`P0pp0,p@ +PHH0 A-@pP0`p0 A+PC-P0 M0`ppp@ HD@ <80  @Ѝ 3$+PxC-Pp0  M0`pFp@ (0  =@ Ѝ 2|*P0 0 /)P0 0 /)P0 0)PXA-pP0 M0@P` p 0 pЍ)P 0 034)P|@- tM pP0 `p@ ( 0  !@Ѝ2)PC-Px0 M0`pp@ 400  @Ѝ a2(P8@- @  M0 Ѝ'PH0H 0p@-@0pP p@I:2p'P0   0X'Px R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M(@,pP  0L1`PC0S P0S7@000  0``0A 0ЍX 0S0 S.R 0 R.00 0  .S 0 \ \  0꠿00p@-P0S@` 0 0C0p脿 0 pO-0 M@`PP)X1*00T,:Yp* ԰Ԡ@  Tp  6p0 @\  P0 PD000000 Ѝp00 PG Ѝ T T @-R M @ 0ASPAA`0 p0SA0qp0@ ЍD0hP Ѝ  00P` O-p-MM0/,0= <0 =-=80< 0 <000=004080@?͍0$0=P.M00 P 0S` @0⯍P 8P(0@0 P0:= 0 =H440`P= 00- 0C0H;0H; -0 0<>h0d  0  Pp*0LPgZZ 0JS񏐺Exu>rt:xc7TxRe.-~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      T0 P^Y 0S .Su 0Sr 0So00S.Sbjl9ZD =<00S 0H)0C ( 0, 0 B QP5D0Sz@  0D;pD+00Sd t`【0`Sp[ 0S @0D+@T 0Y4  0d  0  uP@ (= <0 2 ݍЍ词@0 8P(00 XP`0 0P:;=<00D S.d D; 0D;t700  5P( 0, 0 B PH 40@寍@0 8P(00 P D;0B& <Q060d  0  PD; Rx6 00 B(0#8 ,0(00,0D+00pCW``W$p@D+ X5 V@ p I 0 PSWrʰ0 PI0 0&PAt5 000W#80P5$ D0N 0C0 .  . 00CS W0 A0 PD;`0DkV:U`D 0 PD;+$0F ^D;pd0`d 0 00  cPD+0D  d 0  RPD D -0D+  D+d 0  >PD+0D;`V  spD;`V0D;  0d 0 00  "P(00,p`C 0  P0  P 0  P=<00SD -D; D+  D `-0 D;0D;  \20 Ed y0  PfP:D -D;b0D;`d 0 `0  PMD u-D;0D;0d  M0  P:D Z-d D; 0D;T10:0  P'( 0, 0 B :PD `1 A PpPLZ ؐ `/Z 00 FxP0J 0GS U0 kPT"! `  ܍ Ȍ l x  T Ԉ | ` X *$ ԃ Ѓ D  ̀ 8 t  ~ ~ ~  D ~ ~ t} } | { 0{ n Lz y Hy y w w VUUUw v j Lu 8u u a =<00SD ,D+0DD 0d  0  PD `41 Aa pPWW X `/Z 00 FPs0J 0GW Ƶ0 Peap`D D  PD :W0 PQ+ZD  =<00SD;8b0`d 0 0K 0  P8D0D d  : 0  P'D;p0SD;j*b`D;0SD;b*0d 0 0 0  P =<00D SP%,d D; 0D;`30 0  hP(00,p`C 0  PE003d 0 0 JP=<00DS+ 0$0C ( D 3B!?C0 SH0 ,P=<00D S0$0C D 0 4P D;0B$ `D  0 P( 0, 0 B PD; pBqW8` `V D;1 Z2  0d  v 0  Pb(00,p`C 0  rPV0 PN 0  bPF0 P>D 00CS D& =<00DS0h&0C =<00DSx 0&0C D; D+  D `9+6*D;媠0D;6Z0 yPLD "+`D D +D+(7D `(`0(  0 ]P D D7B!?C0 SM0 KP=`D <<0l $0 :P =<00SD *D;`D *``2 D;0D;P80 0 PpD 0 -P D;h`D 0 P0D  0P D+0D; 0P}D 0 Pv D; D < 0Pj( 0, 0 B }P`=<00SD; R3-< R i0`d 0 0P 0  P=D+0D  d ? 0  P,D0D d  . 0  PD;D 0SS( 0, 0 B #P 0 uPD D *D;D *D H[D *0 0D;H[0D;?.=<00DS 00;d 0 0  EPD`VD'  1R̠p`0 0000+= 0 0H+f"H - V00B- 0D; H D 0Sx 0  P( 0, 0 B P 0 PD )D;l0D;`d 0 0  PnD )D;0D;0d  n 0  P[D {)D;`D v)D;pD q)d D; 0D;=0P g-< R 0B- -< R( 0, 0 B FP*D  Ro@>B!?C0 S\0 P_= 00H+!Hkd= 00`C= D  0HkD 0 lP= 00H+!HkD= 00`C= D  0HkD T? 000#80y|7 D;0B/ *0/0C % D;0B/ 00Q0D:H 0 $P3Z 0 PD;`DkpW@ 弯 GQ9g D0 10"3t/ 0;D0000;D020!20;D00030;D0#100;D0100;D=0;D0  P`Dk`Dk0S>0: 0D;D+00SP p〠0pSG 0S `D+`V 0Z6 :d  = 0  P) D0 10"3- 0;D0000;D020!20;D0000;D=0;D;D;D D0 10"3d- 0;D0000;D0200;D=0;D;D;D;D D0-10 0;D=0;D;D;D;D;D;Dw D;0B, 9` pPWW  `/Z 00 F7P0J 0GW 0 *P00,0C '`D D 'D;pD '`2 D;0D;;00 P` epPWW  `/Z 00 FPw0J 0GW ʰ0 Pi= 00H+ HkṰ- D;0`B- Hk D;:d 0 X0  PED; 0SD;.*t*t * ` D+p@J Z0 P( 0d  `-0  PJ`p@ D;S: 0 ~PQ0)0C b9d 0 `0  jP0SG PyD;p`0`SD;0D;; 0d 0 00  MPD 0 BPZD 0S 0 QP D;0B( 0 (PO 0BT( = 00H+ZHK= 00H+&xD;p0D; 0`P7d 0` 0 ` P~0 [Pv|0 PnD &D; 0D;0`Pa= H 0u0PY-  B H+ 0H; 0-PH0 P@D h&vD;p0D; 0`P1= H 0E0P)-  B H+ 0H; 0P0 PD 8&D; 0D;0`yP= H 00P-  B H+ 0H; 0P\0 XPD  &D; 0D;0`JP=H 0`P= 00-0C 0H;0 H;0 0P0 P0  Ph0 P`D  0 tP0 P(0 `CD;t0pD; P0, 0 P}D; R0 Pp%d D; 0D;p30q0  P]0D#0C W00 PM0 PE 20 P9̒ g D;0B" Wvڤ0 Pn$` pPD;WWc \ `/Z 00 FP 0J 0GWM ^0 tP0`0DkV:?0 dP j0 XP Z D;0Bt! 8 D;0B`! 2WP0 >P410d  0 0PW0 %Pu u u u t s (s q \r p ,q 4q p o o ,n Xo o ln m l l U Ll k dk j @j i i hi i i h Xh g g [ $g [ f f Pg g Z e `Z e e le e f xe X c (d 8W b 0 Pj8 N\WP0 PZ D D0D DD !DD DP(DkpW`Dk T0BX! @- @ MR,A L  0(; Ĝ0 Ѝ<M- (040 1 2Ѝ/A-PSp`@@V0 X:@ DDH$H@PU Q#Pٱ@(00@X@D :G-0`VA::0P @4#$4T00 0 p4#4 0@T#0T4#400S0 XT0 $( ,0 P@@ꌱ( 0 QA-Mp$0PS@` 0(010$,0v(`V0S}(0S! 0, $P(0, V3100"Pq,0 \, l0U4#4 00,004#40,(0T0PT(0 SF0P$00Q (0, Ѝ0F /P=, (` , Q7:048=Q| %P [ W0@0@PQ 00@ =Q   PЍ`@QxZЍ`[P` W`@`_][`X`Q 00@=Q ؝P PZ` ZQ Q 0@[W0S `QQ 00@=Q` Z Z PZ Z Z |Z lZ \Z LZ @-0 a0S`A00XS=P 0SQ.C+S^2. @@p 0000   0 C R@0 37 #0CT0 \     0B ^037#> BC,  A-Pp<U00 P@W0`x0`W0 H.p\p@ R0070"200 0 S037#0R0 \00/o////<@-DM` @ 0p0 < 2 0 RP<00P@0P< 00 0 <0 30DЍ5X0 @T O-M葟 0q娂)`ᩒ A'r0 i C0pqB!QP C@$Ah!dP@@C3.*T6W>YFX @00 SP$Z R 000    00 R @Ѝ0 W rP0 DhPW 0 H^PY 0 M SPX  ꉈ%I$: @A-`pPᴨ0S.@ ŨT$ 0D0 .R T  S\R C @D.R @0. 0T  S\R  @@7( 0 0@-M0 M 0 P @080P Ah PS<o8 ,0 0 8 30ލ Ѝ0CWX  0-@- M0@R0  =PP * Ѝ@Ѝ/ % Ѝ@Ѝ/*WPR0@- M P@$~PNP0 ? Ѝ0@2;Ƭ00 Ѝ0PR0@- M P@WP'P0 ? Ѝ0@2꟬00 Ѝ00@-@Q M P2PP0 ? Ѝ0@t2z00 Ѝ0p@-P@b2P  p@ p@p@-@P 0P   L  S P   pL 0 pQP@- 0R R  7 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  rP  T@T @pdP y 0 pp@-PP @RP g T 80,D0S ϫ 0 p T@pp@-@P Tp (0":k0cSp: A pO-0-tM@@0p=f`P60S @P000<@-^-+*)('&%$ r 0 00^00 00N S_ 0qQp00GqQ0N < 0pN WpX   PEUDpPP <@P :QgkR࠱ࠣ @E Rk@ڐ g{[{{R EP_ EPL%b @EPBP E ʓ <@[<00tЍ00XS <0^ ^y 00V006 0SiWM IWJ NW , 8P0 p)0 X03/P+ @ U: p  @T0 X ( R W  R 0G'WS8Z :U X0  A@ pP4 R 0d80Q L0R00SK h@` pIPZO[P 0 000S !烡 Z(B(U /o" R WS0\` PT&00X 40S@0 I@H 0SSQڰ S"@UP0S 0 0X, @C 0@0CSX:0,P Ɩ-80@ XC 0 0CSX:@@嵖 00 RWZ5}0 0 Pe0  TNၖ 0X CR00ST1X0$0X? R R R 000XV*00P R+W 4 XpR000pR00p  QX$H 8 Q*p 00VX 000X0408p040,00$0<0t3}0 0A P0 R  TD ,01Q05R*X@@0P@X@ 0 CR00XẒX0 @00X00 D p@|00< p%. P[<`ޕ 0@X CR00S᎒X000X0 03/P X,@ 0(D0+P 0,0C0 X0 %].| P00•04!000H8!rEnX$)X0P  A pPm0 #  TV40S0X@@ვP\@X@8p @A< T%%.DD ,01Q *0X@@0X PB WD,@ 0(D0o+P 0,0C00@  ̘  d< 0A-@SpM07 S20 0)PP: `P5 80 0P偧P&`   0*0P ,U Ѝ 00S S Ѝ0 0++ 0  G-`0 00" BMS $ 0. SA~ P @ p0u #0GB*0P @T *X<<" 02P 0  "2 0 4 30wBލ 0    ! *N)@PH ppPC 8 0 0@寥PAp 000 0000 0 0Pz+U8 0 @ @IP  ᓔ00S 0  0@T(   0 0C 0  M+ 0  F+3 0  , 00S S!5C@     G-M0p`@P0P0 0   0 p`LPЍ 0 @PP A-M`pP՘@P ,  ( 0  P* @٘Ѝ, 00Ѝp@-RQ M8P@``/0SC 0S 0S0sA S 04< 04 0 0 0@PsP00 ЍpR R k/ 0 0 Ѝp0S ` 0 0 Ѝp0S00  0{  TO-P-{ { { O-MXX P@QpL 7(ZB U U U Q 0 1`Ѝ0` Rz  ?0Z& + y`PP 0:/qp  00P @ P X&00 0 00Ѝp  M0P  * R + L UZ p  07P 00 0SM   00 0:/qp 00`Pÿ\ <`V:X0`v R0D00 l0P :/qp0` c 00 0`VÿR <`VpX0PZKS 0\T 0<`ÿ800C`V0Y !QJL`0`f? ` :/qp@ 00  P  @ P %00 0`Y 00 NP)0S&:0C``09`ЍP`T 0S  0C`ÿ 00C`V0Y  0CI `\A @0\ ]% 000  `` 0@x 4O-S-$MP  0 0؅`0:p#0 B0S0 Q6  R00S 0BQZ  9$ P ; `0p0[] U0 00 @PS  0SRRV  RR00S R Pd  D0 P0Po ^U T~ U\  C0 P  P ATq ^f S 0 WP02 0SV. EP) Q0 P@P 0 Q ^@T T' T. T6 Y@@ Q  再p0Sp$ЍZ P 4#00\00 0%W T TT T S A$ `p@-@00PFG p 00p0@@@p0TS 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< 0p@/p0  0p@/ᨫ- M0 3/Ѝ/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 R R R //00/00/ R R R //00/00/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP0@-0@ MTP T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0R /C-`QM@p Q) Q PЍ0 03/PP WP:UR X$ ЍC0 0  3/P PW*UX !0P0U URPЍ  PpHHBP0SPP!hh ;A-Pp`@P  R 0 R 0\A/W 0A/0@-PMSp@`  SW- ᗊ P R`V V V Ѝ W` 00 R D0SPV]!00ЍT!00Ѝ   Pp88 (#p@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝpp@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@.p0CЍ R? ..R0) .Q -S.S AA#Q0L \S' .S 0 .Q AAQ0B Q AAQ0B QS  Q0L \-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C///*0 0 /^ P$ $M 0 0Ѝ/|^ H0 4 /0 48!211!A1A!0 A]P㙳p X0`0@\s0X0}`@X0v@@&010( R003P[ 0k 3 ""pAk +\p6게 0 L0SE*.00:0$̰Q0`O-P,MX0 p4pt0@p` 0)[X> b{P @Qa W{P @Q㈀ L{P @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] #{Pj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b" R Z A @Rg .RP`@0@,Ѝ P` 0D0C  [4:ދ( 0 ,Ѝ׋ 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYyY pd0G-paQ`=*0 S) \5 0P0S/ @S" 0W*U  @000@琐@@ P 0S00BAU0SPQP!P0W*( 0 PT @O-`VP3P# M0 VP3U0p\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P40 A\ Rɑ!" 40S 4 00- M ЍO-S,MP  [  0S 0S@0P0w @Pa \rTp000[000 0P0$@0C0@TX @0S @S^  0 XL*P΅T p@0T00S 0 Sh*`V` ^ N Y[ R0P Z PC H(00P0S  0R* 0G S 0S 0p$00 0AT" 0eP@1\0[ 00( 0 ,ЍATX0S ! " 0SPi4?<00 R```V0 S000R0 ABQ AAX QS R0SY 0R?0)4@0 )Ɖ 0 ,Ѝ 0H p@-P0 0M0 10 `00p !@p < 40 0 1 30ލp@3tM M A-P `0 0M 0 10@0 (qp 0 p0 (0 0 1 30ލ3L hL Q:/R/0S/S:00/@-\@3$* 0^ @R R R D( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL   0 C( 0 /C/G-@0pTS* W XTpP@0TS P`  ֈ 0 Ј( 0 0QSp@-`P@ ?P`VP@  0R p/pA-APUQU@A`pPWڀ1AP茈( 0 膈 0 ~? 0 Q" A@-SRB 0@S Aa 0 [( 0 /-- M ЍЍ/@-M@ ?p TЍR/0-S0 \S  R 00O-@ M` P P-Yf +Y_ 0Yh T @Q {2`paOPq2`pOP" [)SQ" K0I P0aIQW0IAIQ70IT| V[SQ;+Ç꾇0S \0J00 Ѝ  00YXP 0@ \@ AL\T@D0BR"\00 0dp@-@P၇0T0PpD p@-BR"^p@Q@Po0T0Ppp@-M 00 0@``010P8 xA|A!8O]80 TAXA\APPP08 @(0 0 1 30ލpo10D C 0 -0 TC  -- M0 0 ЍЍ/-0 -M( 00 Ѝ Ѝ/B O-QPM@d 00S000!pR !5  wPP E`#3?`<0P*Q30A !!!! * P6 0 '0 A U pQSBP 0@pQ 00S  Ѝ褆T 0 @00ЍꙆ 0 0p@-@MP` fy 0~PgyЍp0 0@ X~0 0p@-00St@@@pdPddP @PH@P 0000 0l@ xX~8~ @-M@D Ѝ@A-Pp`0t@t@l0@ U  )<0 -u  A? ,NK@-@CP0S  3/000S@$ A-P p@` F  j000 ?@P p@-@PPpp@!1@- BMM0P@040PPPPP*010PT t!`D0S d!p0 Pe P@A0@ P> 10 p!0 0 4 302BލЍ᷅P ൅PP  5/P Q Q 0 0zpx0 00P 0 0 唅 PT/= = p{0= x\ O-MqQpP* ` A@pf a@0` RD0 0]1PI 0SP p Z [ @@P X0[SpP N0PU :Y E`P`PS@P TP 0@U:W /@0@00坜5@Q|00p@@AЍPЍ<00 o ; y4xxhx\ 8 0@-0P $M@P P0L0 0 PP $Ѝ0w G-RPL 81040SA a q`p@ #)/0@S-00儑 000S 0 000 00 xx0 00 \p0 0 @hG #(00ܳP̳D8(dG-耟0S@P$0 @S 0plP`P0S PU @@P Y0UT00 h8@ 0@ P` `uuO-P-dM␐0YS3RQ0@ # 000Sc`0S00 <000x#x3 0 0  0tP W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L9PL 0SI 0<00@00 0<0)P< 0 S@W@ RP00S-! 00C0T@dЍNA@@@,@10\U , 00S/  R||1$ 0 @ $(0'e@"$0@S( @ ( 0[p+ p1S `bPI 0@0C00$ 0 @ $(0P6 @@$0S( @ ( 0@$  $(0x6 xdtH (ts r` Hr r T Pq  @-0N \0N@ T \ڂT 0 \Ђ 0 0@- MP0 @P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000@-Fl@040F. "lV,h PTQhLl -R 0 P0R 0R R0x n@- Ÿ 20#Lc\*0Sl S| 0C l l;Sàʌ͌ec\*0SZ SP` @ 0cϠlT 1C@010|0CsFno2ffaap1@S@ 41N?@1c1c0^0B0P0B\`D4lL S( 0S``Vàڤ0PA0A0R002c2cTÌ l làL l làP)\P ף*Qgfff$I0 P /0S/ 0 S/0S/0S0@//O--M0@ S 0 P H$L(@0 48<0 DWTŠౕnPnnAD(@,jP知GNΠ౔^@n n@,jR柵౐BΠ@N` !B0 4 jQ柵౐AΠ@`0A8j`0csP\0SjQ8v8V8F88f80Sj@,lX:lZ1! R4 Ee@PϠrllq q qC C Q BP^WoPU4 X%80 c s<0 <j( ;RT0:`@Qq( $Pz  UTZ WV^ V0 P@` Pp/  / R0AͱV0 aͱ 0  F"F,l Rl0l0U"R*P;<Ѝ"R 0S*0Zb/ 0*P;M@@` P P00C RWUW,`㸠  `PPH 00R 0R0S V00oW2 z6 @S%VCL00S R ;S,S SH0\- 0(\ 02FSPPE4HspP>0HmpP+ H00cH04H9 l@V|@hƃlhpp崠x|:… ᴠራ }r|ЍPo  0j @ [   1 0!0pS0S >S0C#1 0<P0:P 0,Sd0:P 0SH L$ )(l6 0 $ pbhƁ p60(圔ax|倆0*ğp0;lcXh4 1!?p00c0["\ L   cX*-S +SL P~L Pv L00cL0p p,0唃唓 p|#cR 01:d#cRp3 0! 0  cRp c s S R 0R㞁# 33 p0j8P@@D,@P 04p0f΂Q4p8P<@@00HS0Ű1Fp p,,0s 1Tu00H2X~})\ ף{(\P3p@-@@0S p@jPP d@P x0 h0@TH0 0 8 9[u@@ : [H2xxt:wG-@QMP `VC 5`Pb 0 00t0STK0SE `V LqVLg@p`_dPV`VF|pp 2V oPOTR hQ8 X1X!0d0 P000U00(a]PP`F U0P0\  RP e?PE  PE0P0U0S00#  1 @qPP  l 0 0W@ࣦTD,u<887u h7[t0 6k6@-^F=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWU0 W   0Q񏐩00@0C \$SjPg u0Sq0W p1!PL  u0S0W p1!P<  u0S~0W p1!P,@@@3 1u0Sq0W p1!P"  u0S p 0W p1!P  Z u0SU0W p1!Pg uq0S?0W p1!P `0*S1 0C P@00C P00@ S0`a`0`F0@ \$P0 uA0S0Wp1P 5 u20S0W p1!Pu%0S0W p1!P * u0S0W p1!Pu 0S0W p1!Pw  s u0S@0W p1!Pf > u0S0W p1!PW p <Ѝ 7 u0S p 0W p1!P9u0SJ0W p1!P,pn  u0SC0W p1!P  u0S p 0W p1!P u0S0W p1!P p] p p0W M*0P~ <Ѝ@@@@ dp6c ]pz\ VpU OpN HpG Ap@ :p9vP/p. @0Wp10P"  p u0Sj0W p1!P^ B u0S p 0W p1!PIu0SA0W p1!P<$P}0`P00 pu0SO0W p1!P)@J u0S p 0W p1!P p p pur0S p 0W p1!P p ypx  uM0S kpk 0W p1!Pu:0S XpX 0W p1!P00@ S5@01000C0@ \$P u0S7p6 0Wp1@PsP  0!0 p Wp1@t$P@0O-@-oMMX /L0? 006000!R !0s0 0\0H 0SE   RJ D?Xp00d04?00h00ܐ$00 @@匐H0`TPU @%Ug PU 0T  `J 0 R 00S0U`O0S #X  YP)    R0s P=*X1RRXOXTQXQ\Q.vh0N@QD,TDl(8PD 0<X ``P`YP``0@0@00 0T0pP`r01 000 0GZS.oHGFEDCBA@O "s:0f+~{zyZwS00G@ pA@00G S$Wh @_W000PAU`{*`(;$0 i   S5 0SP|-0r0[T0$ @ 0PU[PPR00S@ryP(@P@,@8@4@W000P @0S @0@0S0000PP )9 0 6 30( oލЍW @q}`r(@PP,841 S0@R00S<0n00000`BVpQ 0Qr0S0Q 0Q0G0S00 R} ( PEU \(  0 p R0 /S1 VPPPz0] 0@BT%S<00e007040[0$ SL0100 @  | L040Sx00t0 `7| R1|0PP @x0P0CH0 P~0P@0 t0$@S-0r0|080s p00 00  W xP?P0p0XS0` > 00 0 R *0    S20    \ 0 R   0S{0|PUQ@ H ( P Q000PxH0 0Cp0H K[[Pdp` K[{0\p0SD @00NSD `Wrid|pP0@0(@PP,P8P9Sr0zsQ\0p( P R Rmdp R 0 ,"0΂!0g0 Pw0Q 0P&Q000P0 c@=:_ T $00]u@H:q T $00o<@1 8 PL $ L 6P,PQӯ$84s0D `hP@, pZRӗZ,  B, J0 K0Q 0 S0 P0P( PBUPU ڐ0QpP0;U@A@TT}ڌP  @DT0Q0S@DT 4 0^@0}P000 P_0S0 lP0PNS0yd\(mdp!0 ΂00  0g0SP000G PpBUo ` 0@@`pPEU 0R`0 S !P000P0P000P 08 10R0bB+ S- C S!!/΍ L!/A!bCcS000@0 @00L0@^B0. ^L0`0`0[0r(0t(0P0O@p(0PP,P8PO0PP$ L L    P  T $$ @ NSL$01LS-0`r0͵[$ 0@ 0BT $$ @ 0O0Pnr0@ p ,0 Q P 0S000T(0@pOT0P0P,040D0  m  S $0  j b  SZ $ O  PL $ L 54 T $$ @ T $$  @x{(0p$0`Wp`{prT0S 8  B0S0S S8 ( 00PT,(0(0PO@p4PzpN 0PKR @s0 Qp(00  `$ @Q P040my?80T0吊,0844`` 0ZVpJ0  J 0S U  S  RX0 Z0P@0,4`吊 P<ps0(0 0(mTp  d@pN 0PpN4000Pf4 00 ER0 ."!.00A`0p x04 ZS 1 0(0p@]N4000P?SH 8 K B¿u Peh` (@@`p PEU0\`0S j'N 0P {SL0$@@L00m J T$L@$ $ L  E T$L@$ $ L PL $L SG $Q0S$L10L$ Te $$  @ pPL $   L T< $$  @ YM 0PupM000P MPPP M 0Py0X 0Rp 0SL0 L0$0  PP0 |PoM000 PQ0' 8 O@pPP , >ptp(00J0S 0&YpJP@ p(@T8DP@( Wp!w0m40c0 80 0N00 ! NP@T`L$ L L$  L  L00LL   L L$  L L$ L L0LJSL0$L000$ |?  pX 0p@@0 @0 0T $$  @^T $$  @TSG|P0 S $_P $L0L00WX] 0  0|Q] 0  0zL$ L &L$ L  L$ L L$ L   fL 0PH|Pp@8 S$L0L000$  0`0iDS gfff

p$@@$ P@ `/0X 0p) 0SL0L0 p@-`M@P@ PO4P0 %POOЍpp 0@-@ MP 08O0 P9O Ѝ0O-pKU/ M 0`PltbX  ЍO{KE{&{0:0 SA. 6b@0c 0c33:0$0G{@+S6L0[(000X0 Z ,0Z0JPC0J_oPåRS 0S000[(0000 0 0pW00`P 0SZ00WPPU0 Q1 0 1kHK!"0 1 0{0KR {0k& [( R {[2J:Wk{{+S 5AH k+C0PS3{01;:00G{5  [ kDk6k+ K R4['k&{;:000C{5{JG[2 k0U 00 pW0pp0 Ն00{00:k{{+S 5A{+CG{5{Fk{PJ

p`Ѝ -- M0 0U ЍЍ/0p@-@Q r  P p0 S 1P po PP   ! ]P @0O-M` p A Q P*5[$ 80Sy SP  @P Rs Q)Q0<0  T" $W `W `k Ѝ @WTQDQD@ Q A[ <0 P   N <0`0 <0 QCW   `V0BSTQ; "!` b <0 V 7T P a PPl3 j P! P T@@b   2  ` 0  0@ ` P !R/0S 0C0/ 0RA-@P)p`B @1S@  C BS   3`S0 pg3wp1V@ * C BQ   Sb R PPO-p-tM0<0@0 , O0\0h00dp` -R-+*)('&%$  C8000R 00B S 00$00lP@T0PA T00Bd @0B Q\;  EPJ dpd+QS -Q,,d0A P0Qdd0Q 1AP*0Ad(d0A Y d0L0A Y( @P (,P(`(0S\ 0p\tЍd0W(XP  \(  AR  R /o"0 ZT@g{Xpp XGڐ: P9f01k5[X 0S# 0Sk %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  h 0 0SiQ IQ NQ(d@g P 0 00d0\ 0(S 0h 00nQ 0h \0dp{I:ț\0H 0\00S`0KS0 h Ph  l00C l0  09 7 5 D3 1 0 l0RA 0 00S S S+ h! 000 @h BAR \ *0    R 00  0 b3"  0Se $0S 00P0\0=R"00h YX   Z BXTd 0A P Pd d0A P lpHpWh  h501{'pH `" PhQ ` l BpYlp  lp p`lp 0 A0S@0,0Q GY  Rh` rA0`000$0, Sl  @00Sh3,0@0000 00 0S?˟80(  J ( ۟ 0:DD@ PP   ! Mh0 `P h   !L`pl 0G00@P S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQF 0SZY  @P  pP 0S0S  00SPX 0 S #r Z $@0, S0\0 [ht 0So 0CQ 0 R00SqaJ400H0000` l0# R00S 0<0I XT3 Pc TQ0hSQ = h  PhQ 0S A ^G@0, Sl`0A0`  XJ` l0<04 CRoᩒY )K{8Ik{-Zɋ10SY }?@?AV瞯<v N?x `P> ~dp( pg  D0Hk01{p W'"00{0z?C0C'zp:0 0:AQ'0 0!:?C0Cp4656:RH k ,10{0  QH ]000d0 R' `00W'"610{0z?C0C'zp:0 0:AQ'0 1!:?C0Cp4656:RH ( (20{0  0Q l d0Q 1AP d0A `  QP d@PS d00Cd0 Pd00d0 00000h \0 h  Ph9 `0 0`0 s P300 (  J1k\00 {0G GPlP H OZ/ 0J4H0  aPh A ^0S ` 0Q0`0K@P  P4 K4 ` 8<PP Z" PPhPh @0 0C@0l00Cl0- +h00 Z 00H0΋000H^4U@Z{00S相 zI8 S ˋ2ahDPA\00Q00\0b @000h0  0\08O"0 0 0000h Kh aPh~ l0` 0Cl0H9P@!0\0 0OJ4 H0 ,  b0   0 10<060SN 0000 h0dP\0h Sdp0p @00h@0l0l4000H 000\000  P ?N( 0S 40400CPh@0`0Cl0 Ph1L0L0LLQʰ\ (_l00000,P0 \0D [:S0 0!l, h:6 l0\, `0 Q:00XS Q0LR)Ao^& 0 0S  0c1# 00Ѝ QN0O0l1 c 0R:v00Q )Q 08Z O-Mp<0` ;H8@P00S 0 0P  B0@0P 0SQ^ 0G PP0 0Q DS ^^ 0S 0S S SK pPr@00@0 00W@ !CKpT0 Pe 0SUP 0@00S S 0 \Pb R  BPPa S@ 0D0CSڣ0SpP[ 0[0 0  RYd*0  TDQ @J \ T   @ T 0CC10BePDP|0S0SCU 0S S S KP@"00ЍRu  BPP @+P~ -P%  LP ࠃ:L @^ > L@YPl #@Ѝ   PL 0X@0Q 0S00r KS S80S #0p00 0p b@0J"00@@~P  D21 2 Qn\  B\  ^   @Y 0Sg Sh S @0p 0ЍI  PePgy0S`YJ@"00Ѝ@ @QA@E|pPJ 0H0Y@HT  21@ 4PEC@80SjU U EP  000b80S80S800c8080S Tp0+  RP!@L80S L80SH  @X \y0l 00f@`  BR"@^"1P 5"@!@V+P(&,V  /A-`> RϠP@pl3 ^P 0 W`00 p 0U@PEPU 0 BP `@ pVp  0 BP0U@98@-`- M p\@KUW0  C00C2S6cА*ZKE̐* Q A@{ Ѝ@-@0AC^ 0S R0A@-B @SA *@Q0A0C00T D B @ H0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/pA-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0 !P@-@M: R @ 0S R0y@ЍA-P q 1p0S2 U`eo@T`* 0S00 000AT !0S 0Ex`e@!0 0D1S  0000S 0)H xd 0p@-@P0p R pPQ`00App@iD ` 0 S,00App@G xȊd0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P?pP   ! -C`} 88S00000P0 0/@-@P0@0O-M0[pp  @S0P0= PaU*0 F B  9G 0 X 0 *0I0Cp0Y003 0[P^  0 p>0 Y0 0[ PT@T 06S 0@ЍG-0q@p9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,11PU 0C  P 00Si`P! 00i0000000S x0d0iV0S 80 ,0R0i C xd̅q<G-P`0b@Tᡢڃ0T&P# Zp !pdF0 n .  P2)0@R0C`0P003 `LpG  P`B-0P!1^$23\ *G-P@0p@DTG !1PG*32^ =:P  @aP @0 0S 0SQ 0 A BpQ3 3 V  0 0S3#V0 F B S 02NS @0@PpP 0 0p@- @APG0D ` PR @*P `1<P0DR 551 16 +CpP56 +Cp4R `5<5#11 +Cp0?C- MkWPAP @4'J66V0`0 T 0  CND@D@5`@ Ѝ P `!30  0S  T0 C@1@` Ѝ00S/0 R /P1@-PHQMPB@s`P4 BpP.0S  Q6 p 0: SV0P ("( @0 $ ,( ЍOEO000Ѝ, DE 0 Ѝ=E 0 < 0D?p@-@ 800CS00 P8pP  BR  /p@-0rSM wS aSOP` E`00pLP`0S e C+S/ ^R$ L0S@@p0KS0DS0ES0PS`@P`0p@-S4 @7P00 P! !& 0S 3/PP೼000P @ P 00 00`aas7@0`` 0p4PD 0P000@-@!R !P 0C 0 0 S /4p@-@Q1P00S2 0  EK 3000S7 0!$0 3/0:0P-p00P @ P i00< R 800pU0P~Gy`4P005p 0 @0 0pD0 @0 0p 8 4-Ѝ/@- QS S S C00 H0 @ ,0 @b 0 @6@000 0 0000/@\SA-@M{`p$ C_o᥂  P$ (P G SS (\y0၀Q  0(Q\ 0 p P Ѝ谀X (P 0^\ P  X X%8SPP[XA`B`($1 $$(0XQ0$$1((Q| 0 (0 ^S:0 # P9 ;`?4`8@A0?>0BDp=%|E F%(%I0JC`GH<`0LpM Npጀ K`OPGDFPEDEPFGPKJIP`HIJǐHPƠOKPƐǠNPMDLFEPG`P`P SR`PPDE`GPQ`P\F0` pP 0 A/p^ APM_Āmp[Q 0pfPM`Q 0pfPBQ 0pfP8 Q 0pfP.Q 0pfP$Q 0pfPQ 0pfPPQ 0pfP UލލAOA,aQp@-P P4ATp  @P 41S P0p@A@A-4!@j pP31S L @P!4Q x0P0W0S!R MoPPP !Rp /W[ApXApUApp@-@P 0@@A-@`BP] VapP5PQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V @0@A@ @O-,M R0  1 sp3/,0 (Q0 P `@P@P0S$Pp NZ@ PU@XX 0 y`P] @^0( PUJ[d`pp,Ѝ 0 kPPu@ $`XkPZ $ 0 P`P4 @^0  0 0PQ QA Q  ᰠZPರU` K@(  dP0  fP @,Ѝp0  p4kP ,Ѝ0  f@P00,Ѝ$`  cP(@HT 1SX$0(Q$ (1ն`o0@-@ 0! \ @?,?00,1S@-@0 @ ?00,1R@-@1  0@?,? ,!G-`(0S M# pPw@P3 Uq    ?Qv 0 p?`?P`ލ Pc  0p '0 VN pWK A/ q# ((x 0(p**x* ..p.,|,,Ġ  !! !" p "x#"$#Ƞp  $0#4(, ))x)Ġ000#.'p.*|.*Ƞ*+/ 30 !!!"!"$p%"x#̠"$&##4)*,-p. 0120(48<@D )7;4)x).<.,.?C5p6809:@A0HBDEF =p|L 'Ġ**<*pB0BBB嶌(tǀp*<**0LLL尠p*40G **8H*0HH岀0(C **Ƞ*4 0pp' **Ƞ*4 0pp'**Ƞ*40p 'R p p APXl^T JRPPğ  8/@0PH(p'pP  D!B08 !0N⸑V Q UQ`PP4Q$0q$a8PP ||sxx3xx@tC  `p `pލO`ß p$> >Q{>Q r 8 8 40D ! =@ =V Pq^4Z X!3\@ ,2$\ \@c4x:P3u0 uD H  p$OcP!82CG<,0(PX QsPpY =@`@q@8  408 D ! Q=@ M=PP '=0P0pW p=PPy=P^v=`GPq= @l=@p% al\O-@(`@Ѝ[ʒ 20 2 00pp *0Y 2Z 00 20120ISؑ 1S 0 8 I80 @("(Rww/ ‘ )P0 "m  B*P 1Sk0Sh1Se*<00<0S< )P  )`P pW0!10! 0 p; * *0 29 20 29 20S 28 2 Rr 82@SWH0 ppa 20 2k 000w감 Y3Y#d1 10)0 Z* _P1P:0 "S  "@  "#,0 #(#4 0p W,,,Ġ$ ̠# Ƞ ( "! '$!!,0&"+ (""$* #,/0, #(#4!%)- .0 m;O00Pp0 d0@0S X 0000 I;q00& Z#Z! 0J/S  0 00P0: S 00 p0 R I R0?004 <0 0U! -ip"00SY `0 S00R0J Z  wP0000S ᩶p p᥶P 0ppGorrH  kjR Q0P:Q0Q:+@-@H @-@@: $ @ 4 p@-@pPm#,Pg$  p@Z0@- @$M0@ P U 0000P 00 0 p 0S$Ѝ0$Ѝ0XP0 0!p 0S00000 0 00d4hݼ꼏 O-@-dM\0P T:U+\   O+\p 0C0.t%01 U* 0`b僐@ X@ H0B$HS񏐊laW~}|{)X0Ƞ,Ƞ PX* 0UU X !    s     jT     8P@ 0X%X@H[$H8#8A[08#80 1$Ѝ00 0   8    8`Fh&h08#8K08#8E0 ` P0?2YC-Mp`@P' PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 @PЍЍO-MPp@Pm 00 0 0(R 00㲁1.@@ ^C -0`PI  10岁 0@00D0 00a!Pp&CP@Ѝ  0`P!   10岁 0 P 0 001@0 P@Ѝ Ѝ A-pP @` 811 X0  P 0M0S@   L Ƞ,Ƞ Po00 000  0KЍS)!1 0C8##Ȅ00 P  I0  %  P 0 0 0XA-PA A hL &hPp a Ƞ,Ƞ\ L Ƞ,Ƞ⌀@@ X  !00 0F B0 Ƞ ,X8QQ#8P("(R  B("(`` @@V0,800 000 0O-P-0DMSx0"tp`2$ (0:*@p P 1"pC 2x '811p 0 g'Ȁ 0 C000S_ , Yp pp 0J 1$(P`P[ 0Z 08 #8 B2R񏐶k: 1! BRG*0*S00:\ ][\ `` 000CS񏐉~}|{z7!qW  E p SR008 1%0C00 0 0 04<00808 7/ 00Zp p10 0P 01! C1ğ0C0  B0 *811*(0  V; 0S 2$ (0 00 pP  뼡 Y9$ ( DЍ2 @ 00  V  ^ 0 10C08#8S 0C8#8 0P0!0 B1 C("( 0*R0岡ᴡ  B("(0 P 0 01" C *8 1W10  *(     k 00d  ,$, PM 0 0 0?T' Q 00S 2$ (0apP $ $( DЍ C !P *("( B0@ 101`p%[  p$ 10C001A$x 10C001*x      z00 pUG- `P?@PN `V8 2 X 0 `(  pW' Q0; R    P@ 1`0C08#8 0C 0 P0 0RpW 0 10C08#8R p jW`0 R  ]`p`0Q ` P ` AC-P@$M`Pp  300 WW 0GS ( S񏐥U|R0GSe'00$Ѝ( A  0 ;p` 0S 1  1 ^PO W W W(0XW p  W  BP3 H⨀H(弁PW) WI,0t110C0 8#8CS  (1 01崀  P,0p1! B ("(R[ 0 Hp0| P 弁pP 0 00(0 00(0Pr?⸁p (=` 2 00$Ѝ0S? 0S< 0 X7弁W[ t 7+긁0(0弁-  '(01ḁ0C08#8(XPW+ p  W  ~PnH(<꼁, 1 lP] 0WSAqW 0G ,p弁 1 RPC 1ᴀX0C08(#8XX 0H1崀ሀ!0  1 -P pp 0C 0( 각 0H⨀H(0!1 p 崀  Pp@-@`PP 0 00(0`00Q(0pO-,0M@0 1 pPC ap`F`h&hV1 PXh%XV @H$H  @\ 0F 8`P 00!01@0 @9 0U @EH$H 0f0@ 0p0Ѝ " US ! B ("(R p0  PЍpQ zP `  ἀ @P| 뼁0S0  $c뼁0@S 0H 1SpP 1X0C00C\   ("( Q  " :QP .P7 !@ B  B  `P' Q0S0  V@UT@ Q 0R `0E 1pP p` pPm P_ pxa A1@D@@DH$H vP@! @1 0P` `FP@D!H$HV@ `F! Hp @ p `1 0p1p`01/  P @T0*p/嚪000/a @-@P , @ ($ 0"92O-$M p0P (@`$ \0  0p0p pP@`  %Ÿf#""0`( "$ `$"     Q!  %&d!"d+" !  pp1p0`00\1 0`P P@  j.. @\ !)!Š`, !, $0⦠b*b*, 0 0 0 @ 0@P0 P 00`0` 00$Ѝ98iC-@P Mp' $Q`?PU($8 V#0(0 `8`P` b8"#4b4#  0V@h 8# Ѝ 08R(@R )@ b(#8 !#)8 b# 0A-1?`@Pp @f(XI P 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ qp0 p$0?W@`G?`@`(`@ } 0$ <@P U 0$ o 0$ q0 0$ `R @-/ C@-@P 0 S@ (" 0" 4R @-}/} &@-@P 4@ 6 P" 0$$3O- -\Mp (@$@,@A@<60@(@4@0,@8@$^_~?L P @<@H`40P08`0 P p:` p@0(00,0@0P`p@P` p$0 0  0 00$)$%Ǡ07")%ɠ7" ; ,40# (000#&0/'!!,  "' 0&$ +$ (̠ Ì  " !,# ,. , 0   4$000 P(0, 03 00#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,` @ 0(P0#0p`+p ?,P)1 ` @P) ?+1 p DP@.̠<3Ì` P0( .@ 0,0# 0, $<P0P\VL 0 000 00 00 00 000000 00000 00 0$0P(0$P0(0,0 , 00 0008 40 040 <08  0<0\Ѝ30Jip@-@@DQPP`U  0pRPQp b p  0P0H `@ \p@,R Q b "p  @0A-1`@Pp fPXo :@0D 0 #@0D  H00H0L00L0pGPpP3W_`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D qp 00#0@pD H0L 0 H0L W+`G``P` @0D ;  SP@0D *H0L 0 H0L U@0Dq0  # @0D`R @-o/G-@PM )PH8 I `p ` U@ Ѝ@-@P 4@  P 0$$)R @-7/PG-@PM PH(  `p `i U@ Ѝ 0` a!, a c,/@-0M@Ġ  00 9 00Ѝ0@-0dMyP0~P@xP񏐧}gpjZTNH#  vChgd}b|{d]\[ZYXWVUTSRUKJQPGyGFEDCBA@?>=<;:9876543210/6P ژ6P 0P$0 000P0?CP 0P 0# 0 0p dЍ0+ 0  +0#0 0p P6 0 # 0# ,0#0 000:P 0# 0#000|0 l F0# E0# D0# C0# B0# 0#e3Pk 0 030pY <0#d G0#_   00 04p[ A ?O7 *0#B )0#= (0#8 &0#0a 0#) %0#$0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0"P0 0# 0#0P  0#00040 0# 0# 0#0w0rd 0#`0gP0bd* i( ('''O&####ˣG- M0`p@  000 0UhVJ QP0S pPPL W`A 0S7 dP= Tp8 T 0S: XP8 @V (! 00S1P0PW 0000 T 0@0 @$   Ѝ WPTU U @ U U X00YY ]Z @V4F xHE E xE XE $E 4p@-0@T 03/@TVdPP R00@T 03/@T\ЩpCH00@T 03/@T$௩pDD TD D C C C @-MX@@P Ѝ  0 4pЍO-PRp M ഁУ@  `980 S# 0SK: f0  0Z  0080 S 0Q>0 O 0 0 Ѝ 2  0 0 2 0 @@8 @ Ѝ  P00 0 00 0 sP00 ЍᵭP   ꮭP  000 0@-P RM@PQ   0 13/Ѝ0sr? 8P100@-P U1!^ 0C BS \ L0D0p@-`PV@1@!T 0N B@n\pSVpC- MP `@(G C``0V#pؑI@ T`1 `! @D s T@ p PU Ѝ ЍpP p`O-p-M؁ 0:PH 0F PU p  @P 0U`1`!000 0FW0  PU0 ! ЍЍ@- M` @  ~ P 0 q@pGs @DP @PPT  Ѝ Ѝ ЍP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:0080pO-@R"2 0|MP0t00\ 00S80S `h"`2 0 t0 30|Ѝ4P  廩P8 0 1\ 40v`08 04 0  0$ pW`9 P%8X= 1!0!` 40 4PU 08  R88P@P`0X A@8徫 12480Q8 :{0 S pu08P婫pP8pYP 8 ` 0 `P p8Z00V08P劫QP8mM0`0h`eh  @`6 O-p-M *0: @$00 20D2 0S{ `Vu 0H"4SkSi90Vm ,0:0`000P . S\ ] } S`PI \0P 0  0CX 0 !>01H0 (0p0S(00S1!R00:X Z c/\ H c/D0p 0S 0 Z00 0p 0SZ0S00H2S708 R,0:, 4P,P0R\ ,0(P(P뀐4`0შ 0 @ p  (`VP` 8H7(047_V04`8X00 S  0 \ V Y P& P PX V0"2 R8\((\ 9P00S%8Q 4Y4 @ [`@- X`D 0SX 0 EPZ【PX 0SPc/  00 0SO ZD 0 SR@T T0S $0S  !a0 0S 0@T `6  P0 SR@T ,0S?00Z【 c/\ H0 SRs@T  R 00"00($4 0 2 30 ߍ  p 8Qc0 SR@T 0S00Z【 c/\p0z@ v~0 S ,c`\ᮩP((\X` `0ᡩR48 0\R408  \P0` @ V;0 SRI@Tc `^X P2 `0 R(S VPR V`Pa `8@40X0 SR1@T _0S00OM0 SRc @ c@ `` 0PP ` O8@P@,@ Xs q@ =@ 0 SR @T 0S@ 뀋 4 2 ,2 . , 0@-P`@$M@`@ 0~80040000 00VPp$Ѝ0* O-M\C\@qA^5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @Y0@"2 0 0 30ЍhTŸ <qAЍOpT 04S:`W ~> P Pp` ) l `X  {TpK`PYH  T  QX Q(   ` T 04S`WA @~p _X` `H`pK`@ T W`@Z~~ @-@0V@p Y ! 14@pU VYp:qT?o20S` P@c0 0 ^Ѐ s s   r q 0 ! ƒG1p@-S@P  0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/0@-M<<1 0R020* ^3 0 @TQ*QQ P1D0"A^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ ={ { z O-p$M"10000 00 P0@@ ᠰs#P@ (P P`# 8/P 8/P8/PY  0@00 S0 00P @c8/`PT*0 0 @T:8/PY Y}  0 SYz0 0 @`TP* 0 0C0C@J BS0!AQ RS Y B10V T0Sv* S:P 0pC00000g0SPd0P@t$U[*`c⃠@W*0 0[ @ 8/P Y Y 0 *  T [0P0U:$Ѝ0  0SiY 0 0V~Y 00 0 `r0 0S0 e0/R $ЍYu  S` 0 @YF PSe  B[Yv  0R08/P8/P0`P08/ P P8/P0 PK8/0P p8/P 0 J0P 8/ PT  8/P 8/ PP P S*0S:  00S  fP0  @a P0 W 0 R0"! RS  B#10S 8/PU 8/ P PPL8/P8/P8/Pu8/P``n8/Pt8/P``_0 0S 0 0C0C @J ES0!s 0 0C0C @JS E0!hR Q0P:Q0Q:.@- 4C-S MP@  $3/t`  0  QP `r4P4S  $3/000 Ѝ 0 A-pd 4V:@T@T 0P R 00  0R 0 00 @P0`0dp@A 0A-`M pᥘ@P"0: SZPP P\ 0 ` tdЍAP00ЍPЍ( $$4/p@-P$0r0" @`Pp4U $0000C0   0R 1  00 0p  0% 0 ?Xo  0@-S N  0 0R 00A0 4O-SMx`A`ↁ0P@p T0? S+Pk $ 0  QPSu$R PWTf000000S@` 0 a 0`4 S   $3/ЍS   00 S`0a  0R` 0 0 0  0000Ѝ j 0 d 0 \O 0 0Q 0A00/0@-S@  R   0 z0Sup@-P@T @T 0 Upp@TP`p  0S S/P/$(0#   @// / ////RQ3@-P # 3Q  RM@`Ѝ0p 0 Pp Ge pЍ%S 0T @0p 0O-0SJ 0P|  Ry p@a) \T B,B R`  k V`!   0 B0`@ 0 p`BV` T0p@p@T T 1 !,03/Pf0p0CS@D0R)  0 T`1 `!0PVQRi,03/`PDY l 0p0CS@D0 T0@pT0  7P@@Ps00S *V *  000P@D`V?V    R !,03/`Pʼ0@00Vg* `@ 0`V:V0P 00 ``F`0`O N 0Y0C00 00RP  < 0`0C0000@@ `/ 0009Pr  0  0 0% p@-P`V @@D00T`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 b0 Pcpz 0P0, @Ϝ Pɜpd  @@-00M>R@ 0 000P001 3"00 =P0ЍH000@@- 0M@>S   "0!,03,0 P0Ѝ$00- MU ЍTH-M  0Ѝ$0$0- M 0I Ѝb R  P 0S/ /0 0@-@ R 0  R 0  0 0c 0     0R0K0 P @P 0 0 $0 hb 4@-@`pM`pP   P0 :RCo; 0  S  L 80(0P  Ѝ ; 0ЍLa #0@-R lMP@ d  C 00  "2 0 d0 30lЍ 0`0S p>0Pr P"P 000PSp p MPP0000S!$p @Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ 0 0{'{{s 0SP ` 0i ppp  00 pHgP` x` <` 0p@-@0MPቚ00Ta厛V( 㔛0T!R Oښ0T!R军0`y00 UTX!\!R Ѝp@d\!s00Ѝp@[00UX\! X\!0 000S/p\ x0 0p@- PUp@0900TQ>0`U TQUP -pX1P0X1-0T0`X1D\ xh0h 0 R/@-@00 X10CSX1 @ OT1f0 @[ x0 000S/g([ x0 0 R/p@-@0PU00 \AQ\ X! BRX! p@ٙ`00OT!200p@Ι[ x\ \0 -4M0 0,008 00 0 ,0 304ЍXZ ,Z  t,@O-MHP@Q@0@U P0 `80qp::0P0TЍp 0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L\ @ P@E 7/0P/@S@@@ ;X; 1Q`0000$ 00@100a0@00 0 `PT1S%  ! 0V000 @0 @10a@P@@ @@0@` `010 @a1 S Do @000Q0 @-@"P 0 PC^0  0 R ^P 0@/0p@-P`@T0M \ [ Rv    T0"k \ ` ``R```0000000000 0#0 0#0000`0`000T ^pp@N ``P`  T2 0V0pp@:R /o"!T0#00#00!0 0PT 00pQ  T \0 !Q RC/A 0\R#R! R/R00> B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/`!`1@- @0,MT0$00> `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@B2C pC `B O-pM`@ P-TP +T@`00T W Xp p 0 0 ?0X 00b 0 0  @Pp P 6 Q P  S  R- !R  00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R ! i"00b"00 0S \0F00 Ѝ@`r00XS00 C R@0` p0 A BRWwp pvH0BR"\04 0;p@-@P'0T0Ppd? p@-BR"^p@'@P0T0Pp@- M@P` p eUT 0S*TP  U@p Ѝ$S T@p @@@p Ѝ@0 0 0/= 0</0 0 0/= 0</0 0 0 /h= 0< /0 0 0/$= 0</0 0 0/< 0</0 0 0/< 0</0 0 0/X< 0</0 0 0 /< 0< /0 0 0 /; 0< /0 0 0@/; 0<@/0 0 0/H; 0</0 0 0 /; 0< /0 0 0/: 0</0 0 0/: @0</ @/ /H-M 0ЍG- `Pp@ @T @'# 000@-/"Ϡ R@ ?#0! PO,M  P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*AG-Q `@PpS Va p@RSV Pg 0Cs ?oo0CS00cÁs4V " rS% o?oHX0 0hs4ÁO@0Ϡ 00 TOOXp0VP0BV00R' 0b /ob7 4?oo0Cs! X7 0hs4ÀV pV e0o`10@@h47~t<ΠQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  0008 / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 0S00/ 00/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP  00Q S@ 0Q00 / 0U0/Qp@- S @ Q0CP S@ P` P 0U0pQ 0@p0@p@-QP" US QPEP  SU @`  0U0pQ 0pS PQ U //q 0/  // R S 0Q 00S00/ 00/0 /R Q 0/ 0U0/ 00/0/R  -/P00 000S00/s R S  0 /U/ 00/ 00/R S Q0 S00  /0 /U/S 00/R S 0Q0 0S00/ 00/0 //q 0/-Q S Q R  0S 00R 0Q@-! S BR0C  S  @ QR 0 0U000 @-M0| @000!00巆巆00屆 ᳆4 ,0 0 0 30Ѝ葪(  ( 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/& x@-@p@-0@ ,ppPq0PplsXs////// //O-Pq4Mp@`T C10 0 $(, ( 05/4Ѝ=0S-  就 ,!p S㴰0S S9 3S0pSQ00 W00Y00Z0 0 \ 00!" R 0S@L RT\00 P0 0 S00ttssssts4s s/O-M+ 0; 0Q000t; 00$0d;0 0 0%SS``S5 0P p 0GZSZXWUTSRQPMhJ~}|{zyxw?>=<;:9876;43210/.-,+)('&%#"# UP( (|x`\lCRW ,pP 0,@`P`@^H V [`4 ^ \ Z0˄S0CP [0404 R*d 0PCUPE_ Z 00˄PU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  S0P 0CUPe0 E `p `70xp `0uA 0SU00:P @UP0Lz 0P I   0pp@ p*W 00G SPpQP00G Sp+` 0 pP 0` 0ppVp ` `0,0 `6 0``0 0`u 0SU00P @UPV0LP0., ` `u0 QU)P @8 0  0 9plWp ;p倐8 0 0u`` 0 @.10d0Q00 S000D0@@CE @H 00<y ` `. 0, 0`uS 0@00 "0!0d00CE @~e< `u ``g P00%0!P%: 0@P"00  i dT0* 0P0@CC0CE @Q [  04z [x* 0``Zp˅ ^qAQAl Z0ࠃ˄Q*fAQA[0 Z 00˄Q*0S` M t 0``0 0|0 [0K0L"42 0 0 30Ѝ  e 000?0 * `0 `l ` `` ` P`0 @$00> , 0 @ ` ` `3 0  @0("(0  0 0@ 0@@@) 000 0 0 @ 0I@G  0= 0pPUP 0`T0  0qꗦ# @ `0` 0A-p`P@PU J0SPE 8/`uX@pW | 0SS S 0R / 0R0@o/ @-ooG-`!p1 0M@0<40P0쀟@  0 @0 <4 30)ݍ  08p 0`p[P ᫏t 0 p\P+ * 8%7     lteG-0S0 S,QU) X&p@`V@ 0`S0P0 S0 S 0S0S0S P PU@0@\0  R!R  R R RO-`-AM M ! 1 0HT0400#DDH$HT1  Р @Dp@T):0 lP U: XmUm0 XPNPL @0 0 4 30Aލ ЍcH | O-\!X1 0AM @ MT0407 0Y4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: m m 0 vP PU:t 0 BlPP D0 0 4 30Aލ Ѝ0x0(S  O--MMh .> l0060 @|>T000G 1SD 6 Sb`1  0 >40X0 00h lb1 @0D0 >00S/ S/vP`㨐0pS AP! p O0 0̀P0S1Ss+P  @`TP00ST0v`PPP0Sqs`V0@  ^ 0Sڨ @ \<, XP Th080v?@00<0h0: 8 T 0S<0#H 1S0 x00S S00L01< 021l0:ATY0D0Sl00h040800SAT} H0@P| @0PPPzz 0;4@ qP @0P-P g 8 <0 @8 @ 0 T<0@ 0 P  SP Q D0S,0SN < 0 h0 S00D0!*px`tP␪60 0 P4/P t$*: 0 6 30ݍЍ0X0 00T0 h  pW A8@P@0Pz !w@0P0 ) 4`0 0}P X,0 P: x<0`SP0c  `@pV  G0 0P`?t0$00(0  i0$( 00  F | &}PP8 U0I  QP `1  0 x80X0 ,0 &,0R  /0,0$0 0 F0 SOb0!`倠?A9c!@00}P 0S @0P ፌ0t'@& 0c ( ,0,0P1 Q!  640 P0`1  0 6T0X0 0 0 0  +1 01 0,0`1  0 H60X0 r000O 00x5L Pb0%0< t XW80x00SA0L0B  00 @00D00,0oQ @U`D 100 p 踠V@00uvWU1 0#03^U1#3 1 $03 Q0Cˆ UY10#030 LP#D @EU e Vʐ$0 @ 0 @0Y0U  L ˆ0v`100@0P ᙋ0#@4#4 0o W (0X00,00 T3 X0@00$3 @XQn0"@" 0D0 AQR % `1S 0  Z tP, ]`!!! QY   T20 @t X0Q E.0D RZ X AT v*`tPh lx0Pp4/P?W0+S .0CS,P@N0P_IPq0 p1D@X0 H0,0d |P0q@ E 0D0,00 0@X0 )0`!`V A  ` tp xl`C<\@t,t4tܝ TLDl lS0P01SH 0T0T00S S00 0堠0 f$0P1C WT0 |P0 T0{P(1014@ `PD h p0 00 &{0PypP 㸰D TP B("(RD D 3{P~0X0{Py0@:t@ X0 6S$0S 0$0whVPK0g(Dp"( D T B("(R0D D  zPI0X0F@D0Pf 0"@# 0هYW 0 0R` 0`1  0 30  X00(V0   , UP  E("( 0R00  T B("(R D  R,# zP0 3\0X0 0,0ᭉ0 $@P$P 0⃇0 84 X00&0R  ,5U 0tP> 0 E@`P V@ 0 2ˆZ00P `8D0S<0X06 X 0 p0 P| # 0Z (0X0@0 0{PTAP 1011S1i= 0 c 0 0 46d@X0" 0`&0R  ,0 x6 X0OB 0 0 0e0&0& ӆ06 @ Xʆ#" P0@K@0X0@0P4 ш0|'@' 0⧆'0+S .0CS@0P ᶈ0'@( 0⌆ P0@ ᠈0@(0T(T v ᒈ0x(0( h/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@UzP$Ѝ0 ]zP0͡"c1010$Ѝ00@-$MP@6zP$Ѝ0 >zP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-!1 `0AMMp0 40pPH d຅PC @ + 0SP7 \4 !P00\+ @ FP0 @R  R R @ J@ @ @ D ,0 0 4 30AލЍ ( TH| O-@#<3- 0BM M0$40103Xd0:3@0:$p00S000- 0p   P?QP0\400 PN0d04 !/ S L 0  e\40 0P 0  0 0  PP P03 5e S1 -e hP10$430KBލ Ѝ!448#8S0Q Q/ Q e     d - "448#8 $$,  P("(d  PV$@ @4 ēG-`\!X1 0AM0 40004p@ V < 0心VP PP U.0P@ 0E8ĝ 0  0 0 4 30Aލ PP P@0.S@L0 A>PdE4  tdꨜ P? XO-p#3 0BM M`P0$40PT@@Ud[: 0.[@[VS5.K2o11T- d1 0T 1 #R T40 0hPY 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QxPN t"PH T40 0Y0 D DR000& 000SG .SB T400Pa0=S 1SA S5 S6 T000SC 0sL0SQ0S c00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T400 P\~c00V@;vcPꫛ    p@-@P`swP p@Dp/O-p0dM2吐0@`P&T V  0 ,#à  #4:U@  4U 0 dЍ!0 +*0  &V`0 0 F 0 ybP0x 'x#c c0SUPP   B R`00 0 BXbP ccc b뺐HdЍ `F 0S0   b b b  bY   <H0 L C-@0 M(p`P/@D T@/)bX b0b b "440(",4@0 Ѝ  0j d̊G- p崒Ḃ@`P E0S@P0WU! yb@ubP, EG kbE4(0`( "4`43Z1S//0O-䱐 MP0S5 DdDtD`p @ S S0   P&  P0 PI  P00^ 0  SR 0  SRS Ѝ+#d10P0d10 H#0P   P  P060 "0P  P  P090\ ᩀ000<ࢀi0:0  }P  vP090090| gP010r  ]P020h  S0P0[^ d@?P 1? # } 0 2M$ 80P0[C @?P 1? # } 0 (32 P+ @ P010   P010꼉ЉONDhNddMMp3 3x@-@(MQux;u{` |  0 %  { 00 x=ux(Ѝ0@-$MAT t0   0% P P00  0u 0 0$Ѝ0@@|0 0@- Q0|MU0t00& t 0p`0# @0  @ 80 0 t0 30|ЍPPꮘ8  /A-@P4s1 0!1n0SvOPpPp #sp0Sp@-@QU x3s|p {01P u01000psctVxrP // XP //ᨂG-p`@>W`PW00V0S@ 0PS1S ` ^ Z `4+4;O- -0_M MP@050_0* $ [T: 0}`@',d!0  d! . 0`1111A05<0~P  0ʏ0J( @$zp d10 d1 ;P* `@ {`0SH _D@X S\  S S00 Q@0S S R: 0CQS0 C0SQ0000 09P 00~?080:} + 0LP 1#S;S 0(S# 8 R 0(S> 0(S 0|(S0 l8R00sS1 S S0@(  (8R1 S S 0S00 S S SS@@ `0 ^{_A0P0@@0Q"0A'A+S? 7R1 S S(00R00S 0`0 S S00 ,@@0S S 50@ @@@@@06@uO0 8?0H*Pd4@ R`P 04@ 0R`y m`L0d!S 0 0 2 d1   AVq| է1|rAp x0τ`0S [ `0`SH@DH .S0S[ P`.EKV00[0S  00P % "0$004 0 5 30_ލ Ѝ0, SA T T Yʔ4 P00: 4$P000 ᐪ,p T T@ TT  ;T RR@T $$0 `p ;T 0000@@T  P 0 0 iP  80  qh1P- @@T;T X30 0000@@T;T   AP 8 l! Y@ P,pk 2Rz1 S Sv 0S`00 S S SS@@U `` y _AH P@`0D`S \R?* S S00 Q`0S00000-/}O5P.UP `Tz1 x#|# |[DQ haD@`r|QLM0 SQ  P 80-1 `t @ 0- ll `7]2  (-]bh , 0VЀ -domasearnamesortoptionhin@Ser};'|| {{chx0xx!1 p@-Phl@(MP ^ T 000(Ѝpp Qx#r c,qV p 1 xT0000002qPT $000(Ѝp!!$v A-p RP@0`P  R P  @R0P\ R 0  0 p4lO-0-OM >|0P: pkz0P0 @  0 P@@     R`P yP[$ RQ0  0N/ !pG00#[b 0PP {yP0S [0 0| R& 0pG0 PQ.  ` ~0PaVpG #U Y@@W  * L 0 9| *00 Oߍ ` ᐚ0 0CQ* @ 0 ,0 S @ :0C S : @Cp  P`P @pR ' ` VPE:p 0``@P R @DpU+  T: 0 @Dq`V p 0  { Ҥ[ 0  { 0  0  0  u| p"@0@ 0@-@P @I 0 0{\ x (0( 0@-@P00 00/w @-@P @I00zw @@-@Pv00@-@ P 0  p@-@`0   0MzPP `P P0PE 0  Ѝp=Ѝp 0  Ѝpv P!P @-MD108Q0pP SpG0`S ` dp4 Ѝ xP 0 xP 0S@ R w@P  A0|Ѝhh h  0|ЍDD D L HpPE n$DmmC|mmCm0p@-0PMU# 0U#0PUP!@@``FyP $yP 0!E`1$(`P 0Ѝp2P''O- Ff@0S` M, 0 4 &V F$0( P@RB 1ȖqYT0i(1<0 BRO#)16: 5 0(< ܅ 1 c0Aş0 p('(p4< 0P(0 PR hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 v,00,000S$0 00ğ00( X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LhP0440^# 0(p Ѝ! qQ 0Q*# 0$|3!0(08Q(%401Rx$# 30<!^ ^ ഇrp S:p 0(" <!0(0% P\4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10( Q   x1x00d10bp (4p Ѝ:p P5p 0s^$psp^4  Z 00K zp%, ll@,kdkhP4jjxh j0`i(hxht`H0p<Hdf3 0$  T` # 0$`$1,hC@ 01$000b`,0ut,0 PY `F `$0 ,P0 ( uP 0SJP( 01 (0.tPP$ 0,P`1 0,P$`1~Pv `@ P $mb0`($0 0$`1j(,@@ P $tP, 0` 1R(0 `<1!0< ^ς}0S0 00@P +.000@P$! /1:^0   ^00 pp<_  ii0  xitiT e h( , lXDl (c@x4hhx_|p_D_^8`0`_\@^@-@P300Q  P    $00<0 0@ ($ $p@-l@@`VpPPpS0U1pPE1PSp  (0$ 0pQA-pA@PT`QV0q@P 0 pPP``p`0(`,`@D\A-p`@qPP T  (0 000P   [\@-@@0/8Y 00(/000/004/00/00/X 00(/`000/L008/8008/$A-x``PU pqW@Ps<0< 0 ,(0 $X Bqrs/< <0 44 -0 M0 9u ЍhW xZx&@-@0`00@@-@Q 00 2   0 G-`P@M@pZ 03p TV 00J 0000 00 000 0$00-PP9 0 2  <R 2"  "V &= " 2H 0 p000 0qpn W* W+ 000@V eP@Ѝ00@T00-0ṣPP  02 2 2: 2( fP)0? 2< 2D1D!00<1 0001 0 0$100100 1 00P 0 R00   0T 0 2 1 3/pd0SW 2: 2l ȚP 2 @0 2@001P,00 <@0VC-p@ MPP  00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03S FUPA (0$`(  2 P500 Ѝ(0 $``VP ЍP00 Ѝ(0" $``V000`V "V00"?o`213/pP ` Ѝ@-`@ MpPP  P00U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ " Ѝv0P0P2!C-RP Mp-:b V %*AY 'pY  0  P Ѝ 0  P`V: ЍpP 21`W 2< 2 ЍO--Xr M9* 0:`Q̡@p@ W ZJ̱ PEdpPP( ̱10PEUP 2< 2 Ѝ0 PE*P@ P Y Ѝ0 2 P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR j0  PpX U"B Ѝ 2< 2 ЍoP"! ЍG-r"W RbM"*R* 0 @\0 U@D0  PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P? pp Ip ("(R1 B!8. 1!` 0S001 V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0S81#810 R2N0C2p0@- M@]0P  PP   Ѝ0Pp@-`P@0S  00T T @00p0Q 2S@3:A@P p(0 2S $A@P$00C$0 2@:0 2pC-@P4M0`S  X00 Vv 2+ R3 13/p* 0 000" "00  0$03 p`0 9/0P 9/0P b0  ^ 4Ѝs$  0_qp 0 -P 2: 24Ѝ?(0p0`,0 09/0P  00  0# 000  0   0Q00S 0(00H00 000 &PL00S H0X0 P0S(0 p00l 0C40A0A8,#8@TL000( p 00P(0 `pV 00hS&h 0,`r(000040?(04,`00?00S$`(00004`,04O- @X1T@0 pS0P`@D%P i gP( [  8#8R40 0 S(!$10$10 10 0S0㔞P 0 P0S 0ᄞP  00S 1$10$100O-`@ M BXp 0Z pp ` XP !PEX%X . 0("(8#80EP 0 P CKpP{ [e0`00pQm Q 1 !(c P PEX%XpG0PK0K000 Bೀ0@P0@000  B W2 PP1! 8 #8 P0C8#8 H(ɺ0 pW0!8#80Hೀ0@0ഀ00000 Ѝ @  ` ಀH(eQ0 Cp ЍP u`P 0@00 0@ A-0p`@PR"  0S00 0ᑝU@ T: 0PX BPR P Q00S000Ӵ00A 8Qx#8 0 A0 0Ƞ,Ƞ000UU800C80O- @`0 T @@DH( $HR(P.X`࢜ 0S %(JPP# @0T @@DH( $HTpW  TP  {PPPA-`P@ T0@ Tp Q Q\PTG-@P `R  R  Q0@PR$  00 SᲀR> 0@S5 \A R0 ᤜP  0 0(!S%$! $! 1Q0 ᏜP 0 㼐ᲀ@p 0p 0 S V10@Rx ἐl'xP $1 0 !$1(z 0 O- @1T@0 p0CS0 M@DP`!P f ^eP' 0 0 ]P 8#8R0  Ѝ0 0S0P 0 0P-000@- M@ Pp10 Ѝ0O-M 0`p0 DHP@pB  P. X00   0  \ @ ಠ Lᱠ0  `p0`000S XЍ 0᫛P   C("(0C 0@00VP @G-`x"t2 0(M0$00w?0 @Rb2 SA:0JS> P Pp2 Sn1C PX: A  W1: 0C8#p#ȅ@*” 20 „ 2X!P1 0 $0 30K (Ѝ P@ ZPp Z 00C @ 1px'x Ⴗp#    0  ` 00 pP202 p F}52/x,|@P5 Thd0S\cT2S H  ([00/ P$CĠ@T ,0p/S[/ UP 0 S:  r&`p ძ qP`%:&%`?A-`@MP$D{ 4 0 LP  K LP  K LP  K LP  Kp"l30h3PPP P$P( @30]P+( WP3( QP7( KP;( EP?P(  P=P( 7P P8$@Ѝ(P ()P7T"'(0S (P(0S (P(0S (P(0S (Pq0S JP!0S0S p X唹`PPa D1R`3PU 0E /R UP(wPU  400,0/00=_00CSXlP0$0u00S t0s00ꐂ'p%J9P'YR9%@mr9U9h& &9A-@Pxz"Yp`  \p 00S V P㆓LP PP ``P _$ڵ 0@T%%%%O O-FM⨖P`;zpX` ` [p p6 HX.0S ЍfP WP! PP p `RP dP vP iP00p `rPxPpp0p0 p$p㨵 qX 1S VDdeddPU K$0P S<500S5<3@X*/Q /[P.QQ .QQ[s$  Q00@  0P0S$0P`S0S@ pP PP0S 㥒50C SWll4ltll0$S P CX !$00 $ 8X ,0v0S $ ?RR00R0SV1 $0SX  P 0 0C0 IP 0S @0S  ;0S 5S 0S 0S:0P 0<[`&<Y@|>Mx;M]N/w08fH8 p0 @0PU TS fCN` V8 ]00P 0PD:@P0 P E @M#%/X,[~D;DH{DVc|D(r}Dȝ՝Rgyaratcid2p%O-0XOX_-TaM22242222322p0 000 ARpr>`PpG PC 42"S 200002^S R2SW10 dbV%L0 ``p L]KpP L0 ``֤ppd2S PtAPX0: S0d2232` 3`Sd2S|}0 t= Pp;0SP L 03PE/PF1@PC9P<  \,88pDPh HA@9Pf007000` ,bj,000S0?# Ԉ0d204202020202 h[hk@ @KTaߍ0220202;/`|P000S fp, 00[ / j`P000S  fp 00V /XP000S ep 0 08*0 j2000 0B B3P 000S ^3 S;3Ť)i00 0 P 000SX"\2RRX2Xi/ P P D@PX0: S00y `P YL/P   0P wd>`P1V>RIC@p X:{\10 [xt*>d[ H1!14@(S8>̲03%703 7pm7037 P ʴ0 S 0R& 2S# 2St 0sdJ X>pDG1P0 ۇP$5 f/H70L7 w?STP'\@<"820,"(2 ldPPO0 0  RZ$ ZI$ P`Std2S+ ?pX1%>00RX!\1  \1X! 0 \1d02T7,2P7̲%ڳ%'b>1 SR Q  RQ!R!RS !14!8!04P`CQښ. .a0C 2 0',%edA/`yp%'c'%p %')RՖ'zd@'&OO-`ؑ؁Q@p XKp%W㰑 0S 0S Yp1`VA AP h<0S P6H`V.Z ЍyPmPPP fP 7pn0@ SXDp00000000000000p}W 0 ~P ,zpPvpP 9X,'%O-$M5%pP j:P!!9D`дЄФ8000``` Jp6Y00S 0S 0S l``4pWQ* 0S00P ,㝤0S 㗤 咤00W30S$ЍzPOPBP4 FPt P@*P0px| @H`0000Ȱ0P2 P20v00 0b㩔Dj 00 婰 P00^ d 堰 P00U H 0c㋔PN,I000E00B00? 0mt1>0S  d00000'000#00 00000000000000 ` `0S]P` ^0Y0S 0 x0P *OEPpG 0q30X7*X'',@' %@\)'R{L`}%O--MP0g]H  PUPEǰʜvPlP*HP6 TP8 8 `px@|p,  oqp@p!0S 4 40Z@pxx 㬀m@ Pdtl|`0"*Ip2 R Y R !$ Q ᓯ$ P R   0*8PP8Pg -RH 000000@  p01@P@Ѝ0 0y ,*?0,0P 0000R0S f```0pZ0S+0S ~ 00 0@xp` @@@ P@T n 0 3/p T _A` { % Dx, %@-(@(@($%O-M -Fp,嘱8 0┱f`P8^  p p 6 R0 8 l,/0P0T 4PP\80 pHPF U85WE`hC`0IPHPU0 -Hp0(5O005SO /5,* 0(0,00(00 0GCP.PP8%8|PzS `SNSM *AS> CSP 00pjaC Q0#! !   !   !       " $","4"  "WSL4$  㶤$ 4RD +K L J ~O c{05xN 0Vt 3M pH n$0%c0!0 0  ㈤$0S@. X~I 3V``R zS NkS CS BSHLS aSDcBl0CS>!""8#"b+b)ZimPeH0SbI0S_O005S& LP" T( p0 (0S 0C !P e@P!#@]p``p! zP|! uPd! 0S1H! 3/ 0`@ PL.`P|?,.P1!4 HR #0 p'4 PP 0 4 0◫0 rp\P%(% LX%/L(%GLp%% 1lG,`L@%qL%%(%LLCCLL*IELJE1iLL!1iui Mm@-P  ~@;@(tp@-D@DP@( p@H($%p@-D@DmPr@(j i{p@d(%%XA-|@|p `(PR,OU0`R8P@J@@4D0EWLA[|(x%%G-`M4PA'vP;'5P0 tp) P5\5@P L5DŸD2D"0@@2@P 4 5 Hp HQ 'h5P ' a@1  p0t0 @ pj0 @d `080<0@0D00 0000P0 0 80$@0P  83 HL@P@T@X@\@HP H333 0400,0( ,00@@0PlpPPUPh0PP 0/`Ѝ6[2N[Y`[[)[e[oi[['%<1//..(O-`-||FMx6P(`0  ]Ep<6X0K (V0SSv@`@0V}P 0SЍuPfPFP RPh ^g@Ph,++++-,++++0,++-00`0P0 D|0#S 0P00 $&$00S  $&$00S @d`P a|0#S (0P $&$0(0Sw P $&$0(0Sk 0fP EP:?q 5?q 0? >` @epKWwQV3@T33@0 RH0cS pS: bSAJJK[0 0\Z9W W, 8 80,3/8 RfV dc@"3Xi 2Pխ R00C?o20S`l tZ|WJ% `{뼭0 $0 000 00D ,0 $00S WZ 0 %꣭0S0:10S31 0S  0妪0 P 0 0 Q0s  `1000L,0 0283PX& S R 0@0@0 #  R S v2P(00s  i2p$S3X /2 02(],5%(H]4]\\]X]x]]@%]]O-P'Mf M@p$PP Cp6 @DT T/ TX 唶Hv`PK'ݍ ЍAP? a@PP񟗡3552525555555525535$3P3X3l35P50S $PW ze`pP%000P00` ǩP P ©P @ ὩPP P  嬩 P wP( z- qpnPq/z00 000#0 00$000 P@i(rPPLdHpz(00HP(X@SW  2 P -P( !&P( (mu`@P TH0 0P`(Ȑ⨀ qnP 00 00$00 0pg@P u@P  wu@Pu@Pou@P `P P P !g`LP X  P( (`m` pP( !qm@PP WD wPa>}0pp+0S > +⼣ /0Pm`` 0V@ ar0 0S0pp` `$ 1PZ00S` 00 000$00 0e( 1pB0@0Ủ0Pa0SJ+S'- 29S!S 1aV`P^\b%"ib(,7b)RՖtb ~bbbzd@edAp@-P@+`p@-P@#`bp@-P@`@-jp@-P@`Yp@-P@ `p@p@-P@`p@ O-nM M0잟@00p4`UPI 00 >R㸎0$0 0^>娮000(000 Ap@:x>P10?0S@>D$RP$r R  $t ⇪|00<4A @0<4x00 <$040p0 xP ЧPp`FB@D4TF|<<<<4B<<p<<<<<<<<<<P==<=<<<@B<<<<<<=><H>|>>>x??<<<?@H@(A@<PA<AA00@ዧPh< $wႧPr .tt 4< j$< $$r $b@<lP; $0 00 0 i<L00(0 0,\;0@= 5x`; $500 0 0 E(;(00!0 X 0 8: 00(0 ( 0*+:$00!0 0 :(00!0 0 X:,00(0 0 $:0:0S -,P0$0H: 000 0 $!00 0 :00!0 0 :00!0 0 (9400c 0 0 (: 00!0 P 0 88괸@0S 0 jPwj}ሦP0@4v ၦP@p 8(gw uHPD40  mPD40D4Y  !0P00O \@00 1 D1 \48C?  - P0 067000 e * G: PP/ P w0S 0T4000(0 <4 T!P\:J8PFU ZU V⡨  ᝨ0HVp0`R 4S<4Z0 H$L40V.p`^p@?HL4@0S |$H?ۣH5HLX  $?ͣ|5XHL0$4SH$L4R0& V-p`  V.p  4S@  zjP = v  s`; PCr`Pd%dV.p `1: SD : $R-@P  <n0P ,0  M.P ,00S,0Z3$R  $H0$*p!|$ L{ =p40+P40 r04DP  ?P$,03}pL{ 40S0X44SP04Sڀ2S, "20# *rP 0T40SPp'0ST4S h38#d`P P3 `s$2S 2H$L4P*pu0 L4H/0#! 0bp<2 C  u(0) ;p̞lR  ; PL P$L4H1# 4S 08_X0 9P0$$4RT SQ  X0  ,p XS  !S0$Qh +S0$:$40 Q$ Qq8*m(p|?||,, (%}~o|Rp%t|2f|4E@%||$}(%zf4}/}Dx@cQ}g}@ (u}}} ~~3~F~(\~n~~~ z~~~mWz,&!dE(%΀aـRgp|SHL$ Q,} Q+Q +*0$$0Q0$SV 4S$nnP 44崀S04144 0S @4S 0 r0@4,4S $4R#1ѣ1,4$00 00 00Vv +t {+0S 0+f뒉p@ P! 0!d|Q7N]0Q;+ P6+-XQ.041$4+.T4S)9 ,"d0|.7+C+A+?+< ,\4$P1H4P<$T1x00@ 0++pe_c|tP;=0Z +KP;=0ePN  Dp  TD > 9+-0$ !O--pDMؓcM0p 4, <pP^3`4pGs04WY `  ἥXaO 4S<44S $$4R0#*p  C `1,p = 4S P,0S Hs$0 $tY0 0 $0 P0$ x1S  $$4P*`DsZU CUDPEU`PxOpSxOxOOxOxOxOxOPPxOxOxOQxOxOLQxOxOxOxS00vbPEUU0RxOxOxO`RxOxORxOxOxORRxOxOxOxO$SxOxOPS (\!8#80( R!0C RJ ("(ns044s04>00 0 0 0100(0 0,0@# p00 0 X 0',%3~F~~!֍2f|4$p-%}\~~~ (Ҍ~~~!U ((d00*0 +0 00*0 +0x00!0  0l00c 0 0 `100!0 8 0S,00\1 I410(40Srt!;xnP!r`*p 4S U)PP!$k0P0!    (@兜P<2(0(p00S0 Z400 !p$T"x$` =0jP0 r04傡P |P"0cr3m`$`4S804S 1S !10 #4 0SDjZP T3P#X\cRc000  $Ĕ!<#^p3   .r0 $ r~pԑ 5P ` 4 $$s(4S$ 05?W  /6 $tR $4&S 4%〠X0; 4 44 W  0n(0pqpWdX0:S Q4S  0 Ԟ  (0Z00S z(2 $!࿞9X0⫱2X0+O-GM MPh B똔D嘤 :p40PEPEUa!@@5PHY\XhYtY\X\XY\X\XY\X\XY\X\YY\X\X\XY`[\X\X\X\X\X\X\X\X\X\X\X\XYZ,Z\XHZdZ\XpZZ\XZ\XZZ[\X\X([D[\X,\|C!04000T8!u(43 !p00,p00000802"!2 !@2 {!D~2 t!Hw2"m!p0L0mx2`"c!f`2D"\!_H2("U!X02 N!p00V2 E!WH1 >!p00X1!5!81 .!`1p00x p0(pp`$  z_qpp`0S   0[p` p0S0Shpl` 0 A/\P"0 0 @x(3xL@P{p !Gލ ЍP,%)Ä"4@Q`o` O- -M@L K@K(UPPHp @(P'pc'x'p  WpC`# 8pIC 0{0狟@{{SH{{S B'P{{Z:'P<;S3'Phͻ Q8t $@<t< @ AG8 ({:ST(; 302HS<+10Y2E20SD I(C@4PdT`____c__c___`aab_Hc______________```_p`c|``__`_a(a4ataabc_bc 09 0r PP0 P00R0S o_ 0;8;08;X 00d1IQP,,1 P00S  ( ?+Sco PP000S0? < - 0< 0: 0 Io@0 00@; 0@0 00 008;0`RMb@A?{Gz?eA,%0#)Jfץ%7PmŤޤD#)2`#)%))@%R($)#)*p#) $)V)ܦH#)`)E3%3% P)) PWP000S0?` Y0P 00@ 00= 09: P^P00PSp <> P/P00S0@S p0K 0!; 000-' 0! 0 000PZ1 P00S s  nY <01 ,'d &P 0: 0 @>vP2!.8` [`22`VȌ0 V̌00 ň p+< 0K0< Pt en 0@ 2@  0@TgPi 0C Sf0400000,00(00$00 0000000000 000000l 00y 0`RD @@.1뤃夓VD 0prx8; 00 L0%p8; 00L0 %p$8; 00L0 %p`8; 00<L0 %p `D  |0 x;0y; D z+/0;0; ; '0cy;0z;(0x;+ @``L0 %P@o;"0#10@00 0pKpQH E p   p0 o%PJK0S ``K0 b%P= 0  006 U%P(0d D088v <x0@6``D0 A%Ph6h&`l9%t`!2(1kkkk,a0a4aV0 0P````)Ϗ&V<;SV%>@ Qqz蛟{  A 7:S%@ @qVz{  A 7I:`"2RifT' O%{ @l30S 0 '' ?%@MHIN2 X0弅#pX00 O@+V0@V0 00D /@0`" '%00S O `42 $P$Gw42AQJo$`'okfik@A{@⠋{'8NjG$@8HIN/'V X({*:#P&U8 0S4 M&@<0T0x`T00`0p+t#pP j0S 8&ӎI$t;@000!R<  W0 0  &|C [/d2"SS 0  -C6?8~A$@@@P)#)%($)H#)"b0#)p%3%)!G@ 1PS+ 2R`2 C8#<48#8Sh0!ddh|d&h!L0 0 d20 "  +  `T`2$0l0hd-$?ph-${3{7@{{{{{ {  M )*3`f 03  h&huh2`0h2d20Wp |B0H #$$@0(0"(00 '2 0BS0 (S8; 2 |0;.pV00#P2!(008C8S! 0 0H 8(#8"(. 0 %1币;    0;w. 0W|B0H #$$@0(00"(0p '0Y 001 JdP@0<0SW $0 0RZW|^B0H #$$@0(00"(0 o' 0 H0D p!.lph0Zp. .)3%ӧN)($)%#)0CSrt8tvvtu,uPuuuuv,vPvtv0 &P Q<Xs|sssssssssssssst- #݋p`zlhd0\#!-D@<840,($ 0 &P@ 0 &P7 Qttttt-:#|-0 &P 0p#$$0(#"(!h-0 l&P, ^-0 b&P 0 Y&P Q Q rp0 G&P z0 =&P 0 4&Ph 0 +&PH 0 "&P( 0 &P 0 &P 0 &P , `` "#pը0Uiʩ5Glz '?Xn̫֫ !4gFN#)]\b0SL S<0( S W|@0H #$$@0(00"(0p %,S<0KX0C W [B0C<0<00C <0=, 0D0H\"D0X0 <0K+0C ;!< D0#D0 <0 RKX0CWD0* +X  bPWD0 <0T,<0 ḋ圖W#G,p 0D0H"D0X0 D0"D006,W@1,#O-M`PEX0@-S@'P084 @ ($ t$ 1$p+4QP a`F0pP[N*ȳPQLpKG2!PL . hP@\3 \C d@P {{{{{{{{{{{{{{{{{{{{{{{L@0S=% @HGG 0 0p) )Y `hZ'Ta`PP`4b2 R T. m.0 S H. C.U+ 0 Y.!.00!0.Xߊ܊ يp84 p10S  X` p0S @0 p  - 0 h Vpߔ`#*Ǭ%68VЬݬ%/n4q/JO-PAM Mʇ$@`|눧WP |uPp700-S% )P )Pg @H p PZ +`F00S @DDA@D `v 90p ,0Stb@Q6 1 Ql1 Дr)P -00 \(`@Z-00  D0B5S񟗌؁~~~~~~~~xl~~~<~~~~~~~~~~~~~~~x́~~,<~~~\~~~~<<~< 00S .gP)g0 0y긄74P "g00k00ht400dx4 `0S `g XH4  T00Q0*P J  X300S P80$030(000,0-#t0Cp ?o2R0S0$0\PWlTPOP1x@Da08 )7T(3@00`FrS= RS iS1 'tS xSA.5뤢̲ +[$C0p 0@00@00S E 0/ T+,00S ,Am.4$A#BR0(0/S 4Y.)(0S  0@/*+H+a,p0,0S (0S xw10t 0/\3S <Th4).(0S 0^ 0@t/4>/+/,>0,XA.4pP+#C 0 pT/PTW2#*Ux,ů0N*3%-;U%%p%M3%'*%հ@m38l&PO-TM)@@pP4/_.p ?,#@DRQ0I  o@@0SRevP cP SP- TP0(3 LP Jd0@S$0HTlx0D003030800H00 30$30,3&D<&H:&L8&VTЍ_*V%w^z`%n=%`*_*_*_*_*`*`*_*pB 7R `*_*`* S}D|G-`XMPHP y I  Y*p 90`FVJʌI{' aDP$ b0@SS ll0lDllPll\l<lhllltll0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R 4&R <&R 0t't7QpqQ P&P@@7=CP SWP0S g P 0000qP&T60 1$YPP2P061 f(VUupd&V"0+S L`X.4" `< @ PL(t5 000H<00/P 0T& t5 0 000:X P00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 0 0C0P00C1# 0 0 0C0P00C1#00 0 C000C2#04qp 0P 0PQT+o`ꮍJZ2V w`'os`F P$ 0SU030#:U %5PX3P HM#1 4 &P&T6K/r0H 3PvTS0 0R3# G@RPEGX!EK/r0|HP"E0<6S"46S|" 02Q|" 42t01%ٌ\6S LLHP W0`W 0 P0 GὌ,6S m/PP c "㦌帾<6S46S;xQL10@6D&Sl1 0 00R\! H& RL! $&DR@! 8&R4! 0&@R$! Q!   @ T댑 @%놑@/ t0P0e*,% )l*ef*f*E8Vg@%-0%Yv/%8X[^adyG-PHM`pI 'p10PEU& GHP h0@ S S̡tttܡttttHHII\00pa< P ` 1 !  !aPP _؀ L`$@@`(` `C& 8iP *Pߐ0S PxW *bP X^0 0000 ]=%,%/ l*uyt Ct G-0HM`p0E C S >'p 2B1 `FS 1S 0$  !RS@$ P+PTu PQ^xP`PAP MP2 Ga0@Sdh hhhhhhhDhhTdhhhh$t 00 04044041! 00101@30@3101101101101ДY 000 0OHЍP !PPp  &^0S  7RG"0 `PKKPV q V R`FV R $Sa (08 ]V Z@l*,%=%0t'Dl*%C-Mp`:@PV e&p-6TpF`F5 VE@T X֌P HьPgW0F,V E&p6PU 5 `V V 50S aP tP0S {V500@V 0S qpG VP`V \\!X L!tP9@PA0@3SꐩЩ $08LT`lzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0: B0SZ<0SU00SPP0$0-:FU 0SA 0S 0S;`V UU5P x݋P ؋P& UH U U6PEU2꘬XTXXX|U( Q P! \ U4 @U U0000  X  U QaWPJ00000  WP  U V$0S W U p  qpK*x@dT A 0"600"$0T$P @PP KP`@Ƒq*%O ),p%""?Yl|G-MbrM@P $p10S AġP` R ލЍRP fP74yYOP` [X@0JoP1 JP/0: S2  S)J `YP0 JN@~p 0q4S00pMv볍0S Zp PJ 6YPJ /Y@PJ(7`0X `X冮0P\ SXn `0 iTM P9Tx <F P9 h(p= P9 T(X(f /bញPx9 h(d40GDS$x(ltT`ж4X|08WT0X8T8P08Eh}4P03娠p2S l PWU)|PH 嬄p 9PB/PE0@' s 7 pl40pEWQU P4 000`ՄP, L ,㈁PE0S#44$ 3 -P z zzzѡP lWvP303 `px p!l|Pd345XX4S HSФP  4FW뎘 P 4SqS徤Pl l  PnRQ|,`p1<01 1> 11bG01/΅01$1徣<y0"02Q$kp`h Pe Q18C8S ǃq`rVl00C?o20S P  \=S` 0 0000l ․18C8S 3S P P=?o20 P Pl d18C8S 0 P `P?o20S 0PWxPY+ -)-P-=-%@%\-`\+-lP L+[+%-H%^3H%--\Z+Z+$( --8%%$C-@`3dPyPT1  LDqH p0,1QA= 1P5 00ZP UP0 cS 9S0S00C0VS  dS lS0 0T TTc ㇪0S)_+M4K%%$# 0p%4G-PC00`@0p0P 0S002LP00z \PS^p#0W* s/RrP00"2PP L밂V 0+0C0S?P<P ?y „`FP n0S aP(2   P 0S P 0S10P  0S1 0$pW pV 0SPPJP`FPzpP6 10S 10[P{㚭g0S0UPP㚬ZPqp 0000E&roPTP `+c0+Suc6+cˇ†ccc|`+ +cX+k%edА+O-pB尒専尢P`;` p2 0 qQ pPpGz{uP`P GP( IP) EP 1 0 pa@P   (@ L  l      0000 fP@ CPA \`BpPB rP pRF_$0 P80: S0S00将`P p9P 00SpWᨄW  \`P 3 t3t C]@00PPPLsz~y~0 @HB$P PR B4o /t,t)to< @tP0@pUPPP4.@<00Vn4 P ,,< K\00 $2" 21QY 㤍s^1 Ѝ@| 0p-40TP 0<0S0<0S0& 004 0!00L1QX C0008sH$H( Wp2P0 0P- P(d@P$ @  Q$ j !OVP 4}04tt 0gOPd O~,E,%yEE'EF5F?Fp%ht@\FFrFFWFMFFF Nr5 bPR0S )\0 0/X0 $ ,P0S  $XȠPpt40  Q   S  R#4pu0S0 r UTP@Pp` tO-0MPp0 0Phb~@P\ X\~@PHHQD0ߍ@P/ ?x1?/0$202@2<211t122H"؞؎klp00m10&`$0 001 0t. 0 h>Mp0\0J00 JR181厾0 J1!1q匡>0 b@P}0, = J0R0 =00-+181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭0h0000=` 0f@PP񟗚<00 X000<H000000X<0x1<*|0$0yu|<` 0q131k0$000AC0` \0<` 0W 0 pP 0yP 0%$P~ A0 JR0 M@P 0 pzo0\ &8d&`@0$01@"p  sP а100 01Sq@(P T;,D4B@>q  mĽ л8:$0P *1@ P 룽 1@ tp  $qp +1$@ 0S  Q0 0  P819:0  0  @O0|) t MpPd 'P ,4L '11X zP`0S9 (Q90( 0(0+=1 @xU``ϼ' p8  P区 !⛺pL V 4XhVV`` ]0S 8嶼XU0S @bV$0 RS 1S !10180X7"/0 Z<!0 <2s7"/0 L<<2s "/ Bp<Y 10F@` NP:'!1 01 6 `廹p-| ( PVV``  0 #$`6`8003p $00cS$0L 1~<Q8&< 0)p !⣺P$A~0S  1 ~0S\ Z~0SV ~0 SR 1011'zp~0S h%d``p~0S @%0ٻ@3P q@ ϻ' ׻$娻k1S $P娻1 t (0 #㔿p岻 m1S 00 #ㇿp ?apW P x630,A>0 (0t10T$t 堸m1Su 004p1,$p 0ᔸk,0(t10#t 劸m1S 4p t04mpl1S 4pl1S |#TTUPhV`p P 101<D00@@00 2`P @ i0 10 ḬpY !1! !" 122߾pD ᵮ+ pd `" 0!R1411ᢼP,% 0$0!$0R0S"RA1r1t!$0P!  R! ֺ$00$0 Q[ 0ccMbHfffL%b bI%%-g``,`` ggH9jJjQ^@RgGgTgf@mѱxHcggdrgg0hyggghĪ)j)h:hPh_hmh}hhh%#whhi<hh%hqi3iGibbbYilixiiiii jl1Y8 ፽1 a1pW41!( < V ?= :0йDt1`@T 0S 0 @喷@ 0S    0S ᝭P`p P ( RV  R   1 k@X0 S   0]`Va  Q/0@-0x l P ^0fNO @ 0 0$010h 0@-MdPP@T Ѝ0L0 0 0 @ }~ 0@v~djXj0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/x$p@-`dAdd1M@0`` H1H!0  00 0  0 oe QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp蘵 $,+*8+ h\ ` L0L @-M @kЍTh  Q/X-M  0 p 0 S 0 0 Ѝ0W@V qa /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/:*/)7*/=4*/1*/.*/"+*/(*/%*/"*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/X */*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/4T*/ */6 */*///*/@-@y@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%eDL`,_d$xXk&|ntwx5x{Y!<TTV4@, (,,_A'*S109P9-p99999::!M"Wc ]yy~~P/$7 8(' WF#)yy`0`H5@:*AXh %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory 8r >  p(@@C  tG @@M hS   Z ` ,@@AK>,@@f hunblock and -DNO_CONV?4dthX0oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ... |S SSSSSSSDSSSE TZ T5TOTeT#oT oT_T^TFT<T>T?TTPATH= 4}tf]+]d]]scc]]m]]l]]r gXYp]cXn]]v ])b    EOF reading here (<<) document2bbbbbbbbbbb`bbbbbccccc"c&c*c1c8cbbb"[bbVZN[@[=}-+?=4!@!eeee#e)e0e:e@lZeZZZZeeabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0gg8'1og$'1ug'8g̑'0g'0g'0g|'0gLd'0gdg[c  ,Al$rc Am* '5i . -#sC_:h=h ˋ!r~e0tl                  'n@mD]ig(lgZ×WbiІThi<L_{pmihIftpitr@i0vi0ziDiP3i`3,]/]i+DVZJYpU5iGriiL&xLiviVi4izN 4 W4 dr i2Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20241117161804Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedqq )qq} drq%q)q .q+ =* q 4ssq:&-qX/r-q-r(-,r-:s-r,.q.́/r,J8/q.!r0+D0(y/(r-r(-w$/q8/C/rrrrr#r3r#r3r2r3r3r#ssss s@@sstt{rzr}sssssCs Rs@YsKs`s.fsrmsts value of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.{@a@@@@@@@@Š@щ @NJ@͊@֊@ފ@ms9 )18?EQ@X@]blr}ZoNj΋֋݋DUiyو3lnjˌЌ،݌e9x+i* O&-3l:?GοLU`9eim*w{ÌYaglszÉˉщՉ܉%.9>EJQZ_gmslnjˌЌ،݌e9x+i* O&-3l:?GοLU`9eim*w{ÌlnjˌЌ،݌e9x+i* O&-3l:?GοLU`9eim*w{Ìchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] p#Usage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'"5KlͶ ' F q  ַl W|Ӹ !/,#/,$&/,1/,2#3/,4/,5?6/,8J9P9W:p;<=@ϹABCKDrEFGHJLкMNOPQR/SITRUZVrW\acdef,g?h?i?pFq/,s/,t/,u\v/,wbxvͼ/PpĽ1CZv׾0PXmIeȿ/,/,/,/,ҿ,?L^x4If~ !A\w/,/, XD$>/,Q/,J/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]",'!,O&-3l:?GοLU`9eim*w{Ìreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-j>Y`s~nOlz,%%H%`%x%%%%%%%(%%@%`%x%%%8O&-3l:?GοLU`9eim*w{Ì"5KlͶ ' F q  ַl W|Ӹ !/,#/,$&/,1/,2#3/,4/,5?6/,8J9P9W:p;<=@ϹABCKDrEFGHJLкMNOPQR/SITRUZVrW\acdef,g?h?i?pFq/,s/,t/,u\v/,wbxvͼ/PpĽ1CZv׾0PXmIeȿ/,/,/,/,ҿ,?L^x4If~ !A\w/,/, XD$>/,Q/,JSFH0eC^*ȿSFU0eCd*mHah!IdontNeedEFIn*s*(s*K>;x0}*|nQn- q+**|nQn- q+**|nQn- q+**|nQn- q+**|nQn- q+*Ì=rGy=iG}**;Mt?++mWC 3KOO+(+yD<#*=(3+=+3Dh&G+O+\ M}-b+s+-чHe+-чH+ZIчH,+IчH'+IчH ++2IчH+S'@ )Ѹ++*1@ )Ѹ,1x )Ѹ,(,backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps!E/E>Esetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatuslD`printallmaindo_setifpreferencedo_setifcapsLzi%yiiiip%C"%iip%x#%!{X#%C"%L"%E(#%Nxp%{K!%Np%N"%"N"%Np%!Np%@NKNVNbNnN zNNN@NNNN N0N@NNNWrN NN O@D`init_current_mediasetmediamodesetmediaoptsetmediasetmediainstPGPP-P,tlP,t P,t`PP@PPP,t-Pmedia_statusmedia_constructorPPO8$%OPO8$%PP#%PPPP$%PPO$%}P}h$%paddr_match\\\\settunnelQp%Q$%print_link_addressessetvlansetvlanifRH%%#SR,%%"S#S%setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanXXXXsethidessidsetapbridgesetiffragsetifrtsX%%XHp%X&%XXp%UX&%UU-* p%L&%Y8&%Y%%Yp%`u&%U`uh.* p%Km8&%S&%Y|-XX,yUyUl,kSkSP%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s^2ff)RՖ"c"fa c 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @BCFI˘L՘NOSab/c:eNf`hikm͙nޙors u@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:C@@ @h pp pp /` !&@ + $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()7<\8\4\;0\,\(\@$\ \\usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY':S3Ss!AkUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printN^jtJDXT)<ATWq07>]a}:QinXbitmask_scant`%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlsendrequestrecvrequest%GKOSW[***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gz|`%`%d`%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data%'5iLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i  ",B ,,%@,4%,@I, Z,ks,d ,A ,,%#,%",%,D,,!,+%,5,l,> C,HY,eɟD,rɟ@ ,Kd ,\c,b,c ,a,%,%~,K,\,%,-,? ,K% ,W%!,collectQU$ O&-3l:?GοLU`9eim*w{ÌNAME=!'^d"mount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsO&-3l:?GοLU`9eim*w{Ì edit_fs_type_ext  H l T P x  0 1L _ o edit_and_check_label O&-3l:?GοLU`9eim*w{Ìdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdtP4 0A A D x4?"P!T"!,"X!,G+G+x0x0n*' *^*e ++,, *!AOAAA,'AAKdAPd!Yd0eA*^d"bdfdA,A*gpt_get_part_devicegpt_get_part_alignmentjYsn Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC^*ȿSFU0eCd*mHah!IdontNeedEFIn*s*(s*K>;x0}*|nQn- q+**|nQn- q+**|nQn- q+**|nQn- q+**|nQn- q+*Ì=rGy=iG}**;Mt?++mWC 3KOO+(+yD<#*=(3+=+3Dh&G+O+\ M}-b+s+-чHe+-чH+ZIчH,+IчH'+IчH ++2IчH+S'@ )Ѹ++*1@ )Ѹ,1x )Ѹ,(,I CCCP(+C`A DtD$D4D GDUDmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new] ib]diXOd: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************%GKOSW[usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option]rb.cdreolfrgmhBmiZej krlxmrn_qo$rplqv r/rs6r.tmuv>rwgxErzyUrA[rBhrC=kDorEyrF~rGrHinICJrKrLTMrNrOrPrQ,SN TrUrVrWrXrZ_1r4s6sq|~ s}+s)s2sBsTsbs`sisgsnsvs{ssss"pssxossssssssssttt ttt*tq3t r?tdefault_configread_configrt_compare_proto''%%rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt%%rt_buildrt_delete$$sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initKxCgxxxCKm[xscript_buftoenvsrs~xmake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os{Uzzzzzif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcp*5APdhcp_bind\emwzuK} }dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B/a//0h<0\0'|0G#0 00001BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ H%$t|-tah'G#  @0$  a@h P'G# `0/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist